BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15982_g1_i2 len=2675 path=[53:0-976 1030:977-2674]

Length=2675
                                                                      Score     E

ref|XP_009759879.1|  PREDICTED: cysteine-rich receptor-like prote...    920   0.0      
ref|XP_009616732.1|  PREDICTED: cysteine-rich receptor-like prote...    914   0.0      
ref|XP_006356404.1|  PREDICTED: cysteine-rich receptor-like prote...    905   0.0      
emb|CDP13195.1|  unnamed protein product                                905   0.0      
ref|XP_004238643.1|  PREDICTED: cysteine-rich receptor-like prote...    899   0.0      
ref|XP_011045282.1|  PREDICTED: cysteine-rich receptor-like prote...    858   0.0      
ref|XP_008221860.1|  PREDICTED: cysteine-rich receptor-like prote...    857   0.0      
ref|XP_002527897.1|  kinase, putative                                   857   0.0      Ricinus communis
ref|XP_010100421.1|  Cysteine-rich receptor-like protein kinase 3       842   0.0      
ref|XP_004300929.1|  PREDICTED: cysteine-rich receptor-like prote...    841   0.0      
ref|XP_002266015.1|  PREDICTED: cysteine-rich receptor-like prote...    838   0.0      Vitis vinifera
ref|XP_008221861.1|  PREDICTED: cysteine-rich receptor-like prote...    832   0.0      
ref|XP_007044718.1|  Cysteine-rich RLK 3 isoform 1                      832   0.0      
ref|XP_010251163.1|  PREDICTED: cysteine-rich receptor-like prote...    830   0.0      
ref|XP_008389699.1|  PREDICTED: cysteine-rich receptor-like prote...    824   0.0      
gb|KDP26626.1|  hypothetical protein JCGZ_17784                         823   0.0      
ref|XP_006438314.1|  hypothetical protein CICLE_v10030965mg             822   0.0      
ref|XP_006483912.1|  PREDICTED: cysteine-rich receptor-like prote...    820   0.0      
ref|XP_004135260.1|  PREDICTED: cysteine-rich receptor-like prote...    814   0.0      
ref|XP_007222003.1|  hypothetical protein PRUPE_ppa002895mg             811   0.0      
gb|KHG18697.1|  Cysteine-rich receptor-like protein kinase 3            808   0.0      
ref|XP_011086609.1|  PREDICTED: cysteine-rich receptor-like prote...    801   0.0      
ref|XP_003552033.1|  PREDICTED: cysteine-rich receptor-like prote...    797   0.0      
emb|CAN64525.1|  hypothetical protein VITISV_005912                     797   0.0      Vitis vinifera
ref|XP_003519826.1|  PREDICTED: cysteine-rich receptor-like prote...    787   0.0      
ref|XP_007153758.1|  hypothetical protein PHAVU_003G062700g             785   0.0      
ref|XP_008446185.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    783   0.0      
gb|KDO82322.1|  hypothetical protein CISIN_1g008239mg                   778   0.0      
ref|XP_009392180.1|  PREDICTED: cysteine-rich receptor-like prote...    780   0.0      
ref|NP_177210.1|  cysteine-rich receptor-like protein kinase 3          772   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006584462.1|  PREDICTED: protein kinase family protein iso...    772   0.0      
ref|XP_002888786.1|  kinase family protein                              771   0.0      
ref|XP_010471049.1|  PREDICTED: cysteine-rich receptor-like prote...    769   0.0      
ref|XP_011045283.1|  PREDICTED: cysteine-rich receptor-like prote...    765   0.0      
ref|XP_010552664.1|  PREDICTED: cysteine-rich receptor-like prote...    768   0.0      
ref|XP_010044591.1|  PREDICTED: cysteine-rich receptor-like prote...    767   0.0      
ref|XP_006390874.1|  hypothetical protein EUTSA_v10018240mg             766   0.0      
ref|XP_010427831.1|  PREDICTED: cysteine-rich receptor-like prote...    764   0.0      
ref|XP_010415737.1|  PREDICTED: cysteine-rich receptor-like prote...    762   0.0      
gb|KFK41463.1|  hypothetical protein AALP_AA2G134200                    758   0.0      
ref|XP_009105722.1|  PREDICTED: cysteine-rich receptor-like prote...    755   0.0      
ref|XP_010044592.1|  PREDICTED: cysteine-rich receptor-like prote...    751   0.0      
ref|XP_006301715.1|  hypothetical protein CARUB_v10022175mg             751   0.0      
ref|XP_004509568.1|  PREDICTED: cysteine-rich receptor-like prote...    743   0.0      
emb|CDY47146.1|  BnaA08g05370D                                          736   0.0      
emb|CDY67166.1|  BnaCnng53810D                                          729   0.0      
ref|XP_004509569.1|  PREDICTED: cysteine-rich receptor-like prote...    704   0.0      
gb|KDO82323.1|  hypothetical protein CISIN_1g008239mg                   697   0.0      
emb|CDY11571.1|  BnaC06g31680D                                          748   0.0      
ref|XP_007157358.1|  hypothetical protein PHAVU_002G063600g             699   0.0      
ref|XP_010044593.1|  PREDICTED: cysteine-rich receptor-like prote...    697   0.0      
gb|KHN42529.1|  Cysteine-rich receptor-like protein kinase 3            693   0.0      
ref|XP_006378232.1|  hypothetical protein POPTR_0010s05380g             684   0.0      
ref|XP_006841048.1|  hypothetical protein AMTR_s00085p00155370          686   0.0      
gb|KGN51784.1|  hypothetical protein Csa_5G600370                       645   0.0      
gb|KDO82324.1|  hypothetical protein CISIN_1g008239mg                   629   0.0      
ref|XP_008785014.1|  PREDICTED: cysteine-rich receptor-like prote...    637   0.0      
emb|CDY61395.1|  BnaA08g30660D                                          632   0.0      
ref|XP_006584463.1|  PREDICTED: protein kinase family protein iso...    621   0.0      
gb|KCW86683.1|  hypothetical protein EUGRSUZ_B03305                     604   0.0      
gb|KCW86684.1|  hypothetical protein EUGRSUZ_B03305                     603   0.0      
gb|KCW86686.1|  hypothetical protein EUGRSUZ_B03305                     591   0.0      
emb|CDP02086.1|  unnamed protein product                                592   0.0      
ref|XP_011098445.1|  PREDICTED: cysteine-rich receptor-like prote...    585   0.0      
ref|XP_004306354.1|  PREDICTED: cysteine-rich receptor-like prote...    584   0.0      
gb|EYU44774.1|  hypothetical protein MIMGU_mgv1a002463mg                581   0.0      
ref|XP_006841049.1|  hypothetical protein AMTR_s00085p00156760          579   0.0      
ref|XP_006338584.1|  PREDICTED: cysteine-rich receptor-like prote...    577   0.0      
ref|XP_004232315.1|  PREDICTED: cysteine-rich receptor-like prote...    577   0.0      
ref|XP_009797283.1|  PREDICTED: cysteine-rich receptor-like prote...    576   0.0      
ref|XP_009602876.1|  PREDICTED: cysteine-rich receptor-like prote...    571   0.0      
ref|XP_002273718.1|  PREDICTED: cysteine-rich receptor-like prote...    571   0.0      Vitis vinifera
ref|XP_007031540.1|  Cysteine-rich RLK 42                               569   0.0      
ref|XP_010251164.1|  PREDICTED: cysteine-rich receptor-like prote...    566   0.0      
ref|XP_010108803.1|  Cysteine-rich receptor-like protein kinase 42      567   0.0      
gb|KEH22098.1|  cysteine-rich receptor-kinase-like protein              564   0.0      
ref|XP_010101899.1|  Cysteine-rich receptor-like protein kinase 42      564   0.0      
ref|XP_011047329.1|  PREDICTED: cysteine-rich receptor-like prote...    563   0.0      
ref|XP_008443549.1|  PREDICTED: cysteine-rich receptor-like prote...    560   0.0      
ref|XP_007140970.1|  hypothetical protein PHAVU_008G156400g             560   0.0      
gb|KDP45316.1|  hypothetical protein JCGZ_09565                         559   0.0      
ref|XP_003555067.1|  PREDICTED: cysteine-rich receptor-like prote...    558   0.0      
ref|XP_006378230.1|  hypothetical protein POPTR_0010s05380g             547   0.0      
gb|KHG06976.1|  Cysteine-rich receptor-like protein kinase 42           551   0.0      
ref|XP_010663147.1|  PREDICTED: cysteine-rich receptor-like prote...    553   0.0      
emb|CBI15002.3|  unnamed protein product                                553   0.0      
ref|XP_006446554.1|  hypothetical protein CICLE_v10014520mg             550   0.0      
ref|XP_010027537.1|  PREDICTED: cysteine-rich receptor-like prote...    548   2e-180   
ref|XP_010027527.1|  PREDICTED: cysteine-rich receptor-like prote...    548   2e-180   
ref|XP_006470280.1|  PREDICTED: cysteine-rich receptor-like prote...    548   3e-180   
ref|XP_002524667.1|  kinase, putative                                   543   2e-179   Ricinus communis
ref|XP_007215016.1|  hypothetical protein PRUPE_ppa002530mg             545   6e-179   
ref|XP_008230569.1|  PREDICTED: cysteine-rich receptor-like prote...    544   1e-178   
emb|CAN69244.1|  hypothetical protein VITISV_038880                     542   5e-178   Vitis vinifera
gb|KHG04179.1|  Cysteine-rich receptor-like protein kinase 42           541   9e-178   
ref|XP_004141193.1|  PREDICTED: cysteine-rich receptor-like prote...    539   1e-177   
ref|XP_006579769.1|  PREDICTED: cysteine-rich receptor-like prote...    541   2e-177   
emb|CAN61087.1|  hypothetical protein VITISV_034611                     540   4e-177   Vitis vinifera
ref|XP_010033300.1|  PREDICTED: cysteine-rich receptor-like prote...    540   7e-177   
gb|KHN45751.1|  Cysteine-rich receptor-like protein kinase 42           537   1e-176   
gb|KCW52910.1|  hypothetical protein EUGRSUZ_J02225                     541   2e-176   
ref|XP_003554810.1|  PREDICTED: cysteine-rich receptor-like prote...    538   2e-176   
ref|XP_010042287.1|  PREDICTED: cysteine-rich receptor-like prote...    536   7e-176   
ref|XP_007151008.1|  hypothetical protein PHAVU_004G011000g             536   9e-176   
ref|XP_006283294.1|  hypothetical protein CARUB_v10004332mg             535   1e-175   
gb|KHN27450.1|  Cysteine-rich receptor-like protein kinase 42           536   2e-175   
gb|KCW83357.1|  hypothetical protein EUGRSUZ_B00292                     533   2e-175   
ref|XP_010041377.1|  PREDICTED: cysteine-rich receptor-like prote...    532   3e-175   
ref|XP_002511372.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    533   4e-175   Ricinus communis
gb|KDO55201.1|  hypothetical protein CISIN_1g007248mg                   533   5e-175   
ref|XP_010441173.1|  PREDICTED: cysteine-rich receptor-like prote...    533   1e-174   
ref|NP_198854.3|  cysteine-rich receptor-like protein kinase 42         531   4e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010027508.1|  PREDICTED: cysteine-rich receptor-like prote...    531   5e-174   
ref|XP_009125135.1|  PREDICTED: cysteine-rich receptor-like prote...    531   1e-173   
ref|XP_008245018.1|  PREDICTED: cysteine-rich receptor-like prote...    530   1e-173   
ref|XP_002300041.2|  hypothetical protein POPTR_0001s35060g             530   2e-173   Populus trichocarpa [western balsam poplar]
ref|XP_010528239.1|  PREDICTED: cysteine-rich receptor-like prote...    530   3e-173   
ref|XP_007036266.1|  Cysteine-rich RLK 42, putative                     529   3e-173   
emb|CDY11684.1|  BnaC06g12920D                                          527   3e-172   
ref|XP_009377193.1|  PREDICTED: cysteine-rich receptor-like prote...    528   3e-172   
ref|XP_010450675.1|  PREDICTED: cysteine-rich receptor-like prote...    526   4e-172   
ref|XP_010435908.1|  PREDICTED: cysteine-rich receptor-like prote...    526   6e-172   
ref|XP_002870713.1|  predicted protein                                  526   6e-172   
ref|XP_006338204.1|  PREDICTED: cysteine-rich receptor-like prote...    525   7e-172   
gb|KCW83338.1|  hypothetical protein EUGRSUZ_B00270                     524   8e-172   
gb|KHN23515.1|  Cysteine-rich receptor-like protein kinase 42           524   8e-172   
ref|XP_006405500.1|  hypothetical protein EUTSA_v10027683mg             525   8e-172   
ref|XP_010027455.1|  PREDICTED: cysteine-rich receptor-like prote...    526   8e-172   
gb|KCW83327.1|  hypothetical protein EUGRSUZ_B00255                     526   1e-171   
ref|XP_010027449.1|  PREDICTED: cysteine-rich receptor-like prote...    526   1e-171   
gb|KCW83326.1|  hypothetical protein EUGRSUZ_B00254                     525   1e-171   
gb|KDP31073.1|  hypothetical protein JCGZ_11449                         523   3e-171   
emb|CDX67454.1|  BnaA07g14940D                                          525   3e-171   
ref|XP_010249418.1|  PREDICTED: cysteine-rich receptor-like prote...    523   4e-171   
ref|XP_006483911.1|  PREDICTED: cysteine-rich receptor-like prote...    522   2e-170   
gb|KDO82327.1|  hypothetical protein CISIN_1g006514mg                   522   2e-170   
ref|XP_011040494.1|  PREDICTED: cysteine-rich receptor-like prote...    519   4e-170   
ref|XP_008341436.1|  PREDICTED: cysteine-rich receptor-like prote...    521   1e-169   
emb|CDP13194.1|  unnamed protein product                                520   1e-169   
ref|XP_010251167.1|  PREDICTED: cysteine-rich receptor-like prote...    519   4e-169   
ref|XP_010027454.1|  PREDICTED: cysteine-rich receptor-like prote...    520   5e-169   
gb|KCW45208.1|  hypothetical protein EUGRSUZ_L01155                     517   5e-169   
ref|XP_010045537.1|  PREDICTED: cysteine-rich receptor-like prote...    516   6e-169   
ref|XP_002265829.1|  PREDICTED: cysteine-rich receptor-like prote...    518   1e-168   Vitis vinifera
ref|XP_010029936.1|  PREDICTED: cysteine-rich receptor-like prote...    516   1e-168   
ref|XP_010040445.1|  PREDICTED: cysteine-rich receptor-like prote...    516   2e-168   
ref|XP_010045441.1|  PREDICTED: cysteine-rich receptor-like prote...    516   2e-168   
ref|XP_008393012.1|  PREDICTED: cysteine-rich receptor-like prote...    516   2e-168   
ref|XP_006438315.1|  hypothetical protein CICLE_v10030934mg             516   4e-168   
ref|XP_006840433.1|  hypothetical protein AMTR_s00045p00163010          516   5e-168   
ref|XP_011071116.1|  PREDICTED: cysteine-rich receptor-like prote...    516   5e-168   
ref|XP_010045541.1|  PREDICTED: cysteine-rich receptor-like prote...    513   2e-167   
ref|XP_010045527.1|  PREDICTED: cysteine-rich receptor-like prote...    513   4e-167   
ref|NP_001238666.1|  protein kinase family protein                      503   8e-167   
ref|XP_006477547.1|  PREDICTED: cysteine-rich receptor-like prote...    512   8e-167   
ref|XP_010045542.1|  PREDICTED: cysteine-rich receptor-like prote...    512   9e-167   
ref|XP_010040242.1|  PREDICTED: cysteine-rich receptor-like prote...    512   1e-166   
gb|KCW45358.1|  hypothetical protein EUGRSUZ_L00960                     511   2e-166   
ref|XP_009618146.1|  PREDICTED: cysteine-rich receptor-like prote...    512   3e-166   
gb|KDO82325.1|  hypothetical protein CISIN_1g008239mg                   500   4e-166   
ref|XP_009616730.1|  PREDICTED: cysteine-rich receptor-like prote...    511   5e-166   
gb|KDO82326.1|  hypothetical protein CISIN_1g008239mg                   499   6e-166   
ref|XP_010045540.1|  PREDICTED: cysteine-rich receptor-like prote...    509   1e-165   
ref|XP_006439855.1|  hypothetical protein CICLE_v10023699mg             506   2e-165   
gb|KCW45360.1|  hypothetical protein EUGRSUZ_L00962                     510   2e-165   
ref|XP_009362983.1|  PREDICTED: cysteine-rich receptor-like prote...    507   2e-165   
gb|KCW83335.1|  hypothetical protein EUGRSUZ_B00265                     508   2e-165   
ref|XP_010045533.1|  PREDICTED: cysteine-rich receptor-like prote...    508   3e-165   
gb|EYU28432.1|  hypothetical protein MIMGU_mgv1a002644mg                508   4e-165   
ref|XP_009772712.1|  PREDICTED: cysteine-rich receptor-like prote...    509   5e-165   
ref|XP_010045529.1|  PREDICTED: cysteine-rich receptor-like prote...    506   1e-164   
emb|CAN64526.1|  hypothetical protein VITISV_005913                     505   1e-163   Vitis vinifera
ref|XP_002265910.1|  PREDICTED: cysteine-rich receptor-like prote...    505   1e-163   Vitis vinifera
gb|KCW83344.1|  hypothetical protein EUGRSUZ_B00278                     503   2e-163   
gb|KCW83333.1|  hypothetical protein EUGRSUZ_B00261                     503   2e-163   
gb|KCW83341.1|  hypothetical protein EUGRSUZ_B00274                     502   4e-163   
ref|XP_006344422.1|  PREDICTED: cysteine-rich receptor-like prote...    503   6e-163   
ref|XP_002318677.2|  hypothetical protein POPTR_0012s08890g             499   1e-162   Populus trichocarpa [western balsam poplar]
ref|NP_001269003.1|  uncharacterized protein LOC101255872               501   2e-162   
ref|XP_008390081.1|  PREDICTED: cysteine-rich receptor-like prote...    491   2e-162   
ref|XP_009768898.1|  PREDICTED: cysteine-rich receptor-like prote...    501   2e-162   
emb|CAN71641.1|  hypothetical protein VITISV_031461                     502   2e-162   Vitis vinifera
gb|KCW83350.1|  hypothetical protein EUGRSUZ_B00284                     498   4e-162   
gb|KHG30441.1|  Cysteine-rich receptor-like protein kinase 1            499   5e-162   
ref|XP_010023497.1|  PREDICTED: cysteine-rich receptor-like prote...    500   7e-162   
ref|XP_009768897.1|  PREDICTED: cysteine-rich receptor-like prote...    500   8e-162   
ref|XP_010026658.1|  PREDICTED: cysteine-rich receptor-like prote...    499   1e-161   
ref|XP_004489796.1|  PREDICTED: cysteine-rich receptor-like prote...    499   1e-161   
ref|XP_010040446.1|  PREDICTED: cysteine-rich receptor-like prote...    506   1e-161   
gb|KDO69587.1|  hypothetical protein CISIN_1g042149mg                   498   2e-161   
ref|XP_009759216.1|  PREDICTED: cysteine-rich receptor-like prote...    499   2e-161   
ref|XP_008791183.1|  PREDICTED: cysteine-rich receptor-like prote...    499   2e-161   
gb|KCW83354.1|  hypothetical protein EUGRSUZ_B00289                     494   3e-161   
ref|XP_007211016.1|  hypothetical protein PRUPE_ppa020522mg             496   1e-160   
ref|XP_009600945.1|  PREDICTED: cysteine-rich receptor-like prote...    497   1e-160   
ref|XP_004238642.1|  PREDICTED: cysteine-rich receptor-like prote...    496   2e-160   
ref|XP_006356405.1|  PREDICTED: cysteine-rich receptor-like prote...    496   2e-160   
ref|XP_006841050.1|  hypothetical protein AMTR_s00085p00158310          495   4e-160   
ref|XP_007153757.1|  hypothetical protein PHAVU_003G062600g             495   5e-160   
ref|XP_007155445.1|  hypothetical protein PHAVU_003G202000g             494   1e-159   
ref|XP_010415736.1|  PREDICTED: cysteine-rich receptor-like prote...    494   1e-159   
ref|XP_006300838.1|  hypothetical protein CARUB_v10019929mg             494   1e-159   
emb|CDP01560.1|  unnamed protein product                                491   2e-159   
ref|XP_006390875.1|  hypothetical protein EUTSA_v10018252mg             493   2e-159   
ref|XP_010471047.1|  PREDICTED: cysteine-rich receptor-like prote...    493   2e-159   
emb|CBI28576.3|  unnamed protein product                                494   8e-159   
ref|XP_007044714.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    492   9e-159   
ref|XP_004299001.1|  PREDICTED: cysteine-rich receptor-like prote...    492   1e-158   
gb|KCW83353.1|  hypothetical protein EUGRSUZ_B00288                     491   1e-158   
dbj|BAF95169.1|  putative protein kinase                                491   2e-158   Ipomoea nil [qian niu]
ref|XP_008781331.1|  PREDICTED: cysteine-rich receptor-like prote...    491   3e-158   
ref|XP_006841051.1|  hypothetical protein AMTR_s00085p00159370          490   4e-158   
ref|XP_006348519.1|  PREDICTED: cysteine-rich receptor-like prote...    490   5e-158   
ref|XP_008444357.1|  PREDICTED: cysteine-rich receptor-like prote...    490   5e-158   
gb|KGN62311.1|  hypothetical protein Csa_2G348970                       490   6e-158   
gb|KCW59793.1|  hypothetical protein EUGRSUZ_H02541                     488   8e-158   
ref|XP_010663140.1|  PREDICTED: cysteine-rich receptor-like prote...    489   1e-157   
emb|CBI14998.3|  unnamed protein product                                488   1e-157   
gb|KHN08615.1|  Cysteine-rich receptor-like protein kinase 2            489   1e-157   
ref|XP_010100422.1|  Cysteine-rich receptor-like protein kinase 2       489   2e-157   
ref|XP_009392899.1|  PREDICTED: cysteine-rich receptor-like prote...    488   3e-157   
ref|XP_010040238.1|  PREDICTED: cysteine-rich receptor-like prote...    488   4e-157   
ref|XP_009392895.1|  PREDICTED: cysteine-rich receptor-like prote...    488   4e-157   
emb|CAN66423.1|  hypothetical protein VITISV_007983                     487   7e-157   Vitis vinifera
ref|XP_010921575.1|  PREDICTED: cysteine-rich receptor-like prote...    487   8e-157   
ref|XP_003551216.2|  PREDICTED: cysteine-rich receptor-like prote...    487   9e-157   
ref|XP_004228552.1|  PREDICTED: cysteine-rich receptor-like prote...    486   1e-156   
ref|XP_007157363.1|  hypothetical protein PHAVU_002G063900g             486   1e-156   
gb|KDP26625.1|  hypothetical protein JCGZ_17783                         484   2e-156   
gb|KFK41462.1|  hypothetical protein AALP_AA2G134000                    485   4e-156   
ref|XP_004508879.1|  PREDICTED: cysteine-rich receptor-like prote...    486   5e-156   
ref|XP_002455789.1|  hypothetical protein SORBIDRAFT_03g025280          485   7e-156   Sorghum bicolor [broomcorn]
ref|XP_003550730.2|  PREDICTED: cysteine-rich receptor-like prote...    483   8e-156   
ref|XP_009105717.1|  PREDICTED: cysteine-rich receptor-like prote...    484   1e-155   
gb|KHG05033.1|  Cysteine-rich receptor-like protein kinase 2            483   2e-155   
ref|XP_010427830.1|  PREDICTED: cysteine-rich receptor-like prote...    483   2e-155   
gb|EYU22513.1|  hypothetical protein MIMGU_mgv1a002715mg                483   3e-155   
ref|XP_004228898.1|  PREDICTED: cysteine-rich receptor-like prote...    483   4e-155   
ref|XP_006378229.1|  kinase family protein                              483   4e-155   
ref|XP_006348510.1|  PREDICTED: cysteine-rich receptor-like prote...    482   5e-155   
ref|XP_003517719.1|  PREDICTED: cysteine-rich receptor-like prote...    482   5e-155   
gb|KCW83336.1|  hypothetical protein EUGRSUZ_B00268                     481   5e-155   
gb|KCW86685.1|  hypothetical protein EUGRSUZ_B03305                     473   7e-155   
ref|XP_006348514.1|  PREDICTED: cysteine-rich receptor-like prote...    482   9e-155   
ref|XP_006574321.1|  PREDICTED: protein kinase family protein iso...    482   9e-155   
ref|XP_008676391.1|  PREDICTED: cysteine-rich receptor-like prote...    481   1e-154   
ref|XP_011045281.1|  PREDICTED: cysteine-rich receptor-like prote...    481   1e-154   
gb|KCW83347.1|  hypothetical protein EUGRSUZ_B00281                     480   1e-154   
ref|XP_002888785.1|  kinase family protein                              480   2e-154   
ref|XP_006841052.1|  hypothetical protein AMTR_s00085p00161150          483   6e-154   
ref|XP_002314609.2|  kinase family protein                              478   9e-154   Populus trichocarpa [western balsam poplar]
gb|KCW83332.1|  hypothetical protein EUGRSUZ_B00260                     477   1e-153   
ref|XP_003613180.1|  Cysteine-rich receptor-like protein kinase         478   1e-153   
gb|KCW83342.1|  hypothetical protein EUGRSUZ_B00275                     477   1e-153   
ref|XP_007157359.1|  hypothetical protein PHAVU_002G063700g             479   1e-153   
emb|CDY09449.1|  BnaC02g19910D                                          478   2e-153   
ref|NP_177209.1|  cysteine-rich receptor-like protein kinase 2          477   4e-153   Arabidopsis thaliana [mouse-ear cress]
gb|EEC78453.1|  hypothetical protein OsI_18315                          478   4e-153   Oryza sativa Indica Group [Indian rice]
ref|XP_011086606.1|  PREDICTED: cysteine-rich receptor-like prote...    477   6e-153   
gb|KCW84027.1|  hypothetical protein EUGRSUZ_B00900                     475   6e-153   
ref|XP_008389698.1|  PREDICTED: cysteine-rich receptor-like prote...    476   6e-153   
ref|XP_009127806.1|  PREDICTED: cysteine-rich receptor-like prote...    476   7e-153   
ref|XP_010551593.1|  PREDICTED: cysteine-rich receptor-like prote...    475   2e-152   
ref|XP_008389695.1|  PREDICTED: cysteine-rich receptor-like prote...    476   2e-152   
ref|XP_002272353.2|  PREDICTED: cysteine-rich receptor-like prote...    477   2e-152   Vitis vinifera
ref|XP_010649523.1|  PREDICTED: cysteine-rich receptor-like prote...    476   3e-152   
emb|CBI22893.3|  unnamed protein product                                476   3e-152   
emb|CDY03741.1|  BnaA02g14960D                                          474   6e-152   
ref|XP_010649524.1|  PREDICTED: cysteine-rich receptor-like prote...    475   6e-152   
ref|XP_004968954.1|  PREDICTED: cysteine-rich receptor-like prote...    474   8e-152   
gb|KHG29367.1|  Cysteine-rich receptor-like protein kinase 2            473   9e-152   
ref|XP_008340076.1|  PREDICTED: cysteine-rich receptor-like prote...    473   2e-151   
gb|KEH31823.1|  cysteine-rich receptor-kinase-like protein              474   2e-151   
ref|XP_008221859.1|  PREDICTED: cysteine-rich receptor-like prote...    472   3e-151   
emb|CAN72173.1|  hypothetical protein VITISV_020702                     472   5e-151   Vitis vinifera
ref|XP_004960388.1|  PREDICTED: cysteine-rich receptor-like prote...    471   9e-151   
ref|NP_001235136.1|  protein kinase family protein                      468   4e-150   
gb|KHN14554.1|  Cysteine-rich receptor-like protein kinase 2            467   4e-150   
ref|XP_004143063.1|  PREDICTED: uncharacterized protein LOC101210276    488   4e-150   
ref|XP_006654958.1|  PREDICTED: cysteine-rich receptor-like prote...    468   7e-150   
ref|XP_007225117.1|  hypothetical protein PRUPE_ppa002639mg             469   9e-150   
ref|XP_010923138.1|  PREDICTED: cysteine-rich receptor-like prote...    468   1e-149   
ref|XP_011086608.1|  PREDICTED: cysteine-rich receptor-like prote...    467   1e-149   
gb|KHN00376.1|  Cysteine-rich receptor-like protein kinase 2            466   1e-149   
ref|XP_010315345.1|  PREDICTED: cysteine-rich receptor-like prote...    465   3e-149   
ref|XP_008444358.1|  PREDICTED: cysteine-rich receptor-like prote...    467   4e-149   
gb|KDO82328.1|  hypothetical protein CISIN_1g006514mg                   462   4e-149   
sp|Q9LMB9.2|CRK1_ARATH  RecName: Full=Cysteine-rich receptor-like...    465   5e-149   
gb|KCW83351.1|  hypothetical protein EUGRSUZ_B00286                     461   6e-149   
dbj|BAJ92547.1|  predicted protein                                      467   8e-149   
ref|XP_010027518.1|  PREDICTED: cysteine-rich receptor-like prote...    461   1e-148   
ref|XP_006348512.1|  PREDICTED: cysteine-rich receptor-like prote...    464   5e-148   
ref|XP_010532281.1|  PREDICTED: cysteine-rich receptor-like prote...    462   2e-147   
emb|CBI34889.3|  unnamed protein product                                479   2e-147   
gb|KGN59690.1|  hypothetical protein Csa_3G838690                       461   3e-147   
ref|XP_004228897.1|  PREDICTED: cysteine-rich receptor-like prote...    461   7e-147   
gb|AAC50044.1|  receptor-like serine/threonine kinase                   460   7e-147   
ref|XP_010045544.1|  PREDICTED: cysteine-rich receptor-like prote...    452   1e-145   
gb|AAU44217.1|  hypothetical protein                                    459   2e-145   
ref|XP_008649610.1|  PREDICTED: cysteine-rich receptor-like prote...    456   1e-144   
ref|XP_006307016.1|  hypothetical protein CARUB_v10008603mg             454   2e-144   
ref|XP_008649611.1|  PREDICTED: cysteine-rich receptor-like prote...    455   2e-144   
ref|XP_010462782.1|  PREDICTED: cysteine-rich receptor-like prote...    454   2e-144   
gb|AFW77897.1|  putative DUF26-domain receptor-like protein kinas...    452   2e-144   
ref|XP_004161086.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    466   3e-144   
ref|XP_010320561.1|  PREDICTED: cysteine-rich receptor-like prote...    450   6e-144   
ref|XP_002439224.1|  hypothetical protein SORBIDRAFT_09g002550          455   6e-144   
ref|XP_010498315.1|  PREDICTED: cysteine-rich receptor-like prote...    452   9e-144   
ref|XP_009105721.1|  PREDICTED: cysteine-rich receptor-like prote...    441   2e-143   
ref|XP_009149385.1|  PREDICTED: cysteine-rich receptor-like prote...    450   3e-143   
ref|XP_010477109.1|  PREDICTED: cysteine-rich receptor-like prote...    449   1e-142   
ref|XP_006841023.1|  hypothetical protein AMTR_s00085p00115570          443   1e-141   
ref|XP_009761577.1|  PREDICTED: cysteine-rich receptor-like prote...    439   4e-140   
ref|XP_002273750.2|  PREDICTED: putative cysteine-rich receptor-l...    441   2e-139   
ref|XP_007044715.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    437   4e-139   
ref|XP_007044716.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    437   5e-139   
gb|KCW83340.1|  hypothetical protein EUGRSUZ_B00273                     435   9e-138   
ref|XP_008656588.1|  PREDICTED: cysteine-rich receptor-like prote...    436   2e-137   
ref|XP_002890316.1|  hypothetical protein ARALYDRAFT_472129             432   2e-136   
ref|NP_564071.3|  receptor-like serine/threonine kinase 2               432   3e-136   
ref|XP_006348580.1|  PREDICTED: cysteine-rich receptor-like prote...    429   4e-136   
gb|AAF79292.1|AC068602_15  F14D16.24                                    432   2e-135   
ref|XP_006348513.1|  PREDICTED: cysteine-rich receptor-like prote...    428   1e-134   
ref|XP_002526197.1|  serine-threonine protein kinase, plant-type,...    427   9e-134   
gb|KCW83337.1|  hypothetical protein EUGRSUZ_B00269                     422   9e-134   
emb|CDY41017.1|  BnaC05g14750D                                          424   2e-133   
gb|KDP46966.1|  hypothetical protein JCGZ_07983                         425   3e-133   
ref|XP_006470476.1|  PREDICTED: putative cysteine-rich receptor-l...    424   5e-133   
ref|XP_007031539.1|  Kinase family protein with domain of Unchara...    422   3e-132   
ref|XP_006372459.1|  hypothetical protein POPTR_0017s01830g             422   1e-131   
emb|CDY47147.1|  BnaA08g05360D                                          411   2e-131   
ref|XP_010251363.1|  PREDICTED: putative cysteine-rich receptor-l...    417   4e-131   
gb|KHN18443.1|  Cysteine-rich receptor-like protein kinase 1            417   5e-131   
emb|CDY26700.1|  BnaA06g13220D                                          417   8e-131   
ref|XP_004293009.1|  PREDICTED: cysteine-rich receptor-like prote...    417   3e-130   
ref|XP_002455790.1|  hypothetical protein SORBIDRAFT_03g025290          416   2e-129   
ref|XP_006416539.1|  hypothetical protein EUTSA_v10007076mg             413   7e-129   
ref|XP_010249417.1|  PREDICTED: putative cysteine-rich receptor-l...    413   1e-128   
ref|XP_009614896.1|  PREDICTED: putative cysteine-rich receptor-l...    412   6e-128   
ref|XP_009400606.1|  PREDICTED: cysteine-rich receptor-like prote...    410   2e-127   
ref|XP_006591283.1|  PREDICTED: cysteine-rich receptor-like prote...    410   2e-127   
ref|XP_009614895.1|  PREDICTED: putative cysteine-rich receptor-l...    410   5e-127   
ref|XP_002298473.2|  hypothetical protein POPTR_0001s28330g             408   7e-127   
ref|XP_006352393.1|  PREDICTED: cysteine-rich receptor-like prote...    409   1e-126   
gb|KDO55202.1|  hypothetical protein CISIN_1g007248mg                   401   1e-126   
ref|XP_006591282.1|  PREDICTED: cysteine-rich receptor-like prote...    408   2e-126   
ref|XP_006352392.1|  PREDICTED: cysteine-rich receptor-like prote...    409   2e-126   
ref|XP_010433187.1|  PREDICTED: putative cysteine-rich receptor-l...    405   3e-126   
ref|XP_007146956.1|  hypothetical protein PHAVU_006G084800g             405   2e-125   
ref|XP_010091811.1|  Cysteine-rich receptor-like protein kinase 3       405   2e-125   
ref|XP_006285167.1|  hypothetical protein CARUB_v10006511mg             404   2e-125   
ref|XP_010648890.1|  PREDICTED: cysteine-rich receptor-like prote...    404   5e-125   
ref|XP_002265619.1|  PREDICTED: cysteine-rich receptor-like prote...    403   9e-125   
ref|XP_002265819.1|  PREDICTED: cysteine-rich receptor-like prote...    403   1e-124   
gb|EEE62217.1|  hypothetical protein OsJ_17004                          400   1e-124   
gb|AES70848.2|  cysteine-rich RLK (receptor-like kinase) protein        403   1e-124   
ref|XP_011024960.1|  PREDICTED: cysteine-rich receptor-like prote...    401   3e-124   
ref|XP_006357154.1|  PREDICTED: putative cysteine-rich receptor-l...    402   3e-124   
ref|XP_011015134.1|  PREDICTED: cysteine-rich receptor-like prote...    401   4e-124   
ref|XP_011024961.1|  PREDICTED: cysteine-rich receptor-like prote...    400   8e-124   
ref|XP_011015135.1|  PREDICTED: cysteine-rich receptor-like prote...    400   9e-124   
ref|XP_006847936.1|  hypothetical protein AMTR_s00029p00129930          399   1e-123   
ref|NP_194596.1|  putative cysteine-rich receptor-like protein ki...    399   2e-123   
ref|XP_008813262.1|  PREDICTED: cysteine-rich receptor-like prote...    399   2e-123   
ref|XP_009400308.1|  PREDICTED: cysteine-rich receptor-like prote...    399   2e-123   
ref|XP_009341862.1|  PREDICTED: cysteine-rich receptor-like prote...    399   5e-123   
ref|XP_008381407.1|  PREDICTED: cysteine-rich receptor-like prote...    398   1e-122   
emb|CBI27330.3|  unnamed protein product                                394   2e-122   
emb|CBI27329.3|  unnamed protein product                                400   2e-122   
ref|XP_002869487.1|  predicted protein                                  396   2e-122   
ref|XP_004500478.1|  PREDICTED: cysteine-rich receptor-like prote...    396   3e-122   
ref|XP_010040241.1|  PREDICTED: cysteine-rich receptor-like prote...    392   9e-122   
ref|XP_006412925.1|  hypothetical protein EUTSA_v10024680mg             394   2e-121   
ref|XP_009763661.1|  PREDICTED: putative cysteine-rich receptor-l...    395   2e-121   
emb|CAN69245.1|  hypothetical protein VITISV_038881                     396   3e-121   
gb|ACN39857.1|  unknown                                                 395   4e-121   
ref|XP_004250234.1|  PREDICTED: putative receptor-like protein ki...    393   5e-121   
ref|XP_004500476.1|  PREDICTED: cysteine-rich receptor-like prote...    394   7e-121   
ref|XP_009763660.1|  PREDICTED: putative cysteine-rich receptor-l...    393   1e-120   
gb|KHN08753.1|  Cysteine-rich receptor-like protein kinase 2            392   1e-120   
gb|KHN08751.1|  Cysteine-rich receptor-like protein kinase 2            391   2e-120   
ref|XP_003553123.1|  PREDICTED: cysteine-rich receptor-like prote...    391   3e-120   
ref|XP_011016348.1|  PREDICTED: putative cysteine-rich receptor-l...    394   5e-120   
ref|XP_011015500.1|  PREDICTED: putative cysteine-rich receptor-l...    395   6e-120   
ref|XP_006352395.1|  PREDICTED: cysteine-rich receptor-like prote...    390   7e-120   
gb|AES70851.2|  cysteine-rich RLK (receptor-like kinase) protein        390   7e-120   
ref|XP_003553121.2|  PREDICTED: cysteine-rich receptor-like prote...    389   1e-119   
gb|KCW83328.1|  hypothetical protein EUGRSUZ_B00256                     378   2e-119   
ref|XP_010555956.1|  PREDICTED: putative cysteine-rich receptor-l...    387   3e-119   
ref|XP_009615413.1|  PREDICTED: cysteine-rich receptor-like prote...    387   7e-119   
ref|XP_007146952.1|  hypothetical protein PHAVU_006G084400g             389   7e-119   
ref|XP_003537415.1|  PREDICTED: cysteine-rich receptor-like prote...    387   8e-119   
gb|KHN18255.1|  Cysteine-rich receptor-like protein kinase 2            387   8e-119   
ref|XP_006590249.1|  PREDICTED: receptor-like protein kinase isof...    387   9e-119   
gb|KHN25160.1|  Cysteine-rich receptor-like protein kinase 2            387   1e-118   
emb|CAN82890.1|  hypothetical protein VITISV_005057                     387   2e-118   
ref|XP_009764431.1|  PREDICTED: cysteine-rich receptor-like prote...    386   3e-118   
ref|XP_003600598.1|  Cysteine-rich receptor-like protein kinase         386   3e-118   
ref|XP_006591287.1|  PREDICTED: cysteine-rich receptor-like prote...    386   5e-118   
ref|XP_003537407.1|  PREDICTED: cysteine-rich receptor-like prote...    385   5e-118   
gb|KCW83330.1|  hypothetical protein EUGRSUZ_B00258                     374   6e-118   
ref|XP_007044717.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    380   7e-118   
gb|KHN23629.1|  Cysteine-rich receptor-like protein kinase 42           382   1e-117   
gb|KHN23631.1|  Cysteine-rich receptor-like protein kinase 2            382   4e-117   
ref|XP_003600597.1|  Cysteine-rich receptor-like protein kinase         384   6e-117   
ref|XP_007146954.1|  hypothetical protein PHAVU_006G084600g             382   8e-117   
gb|EMT04496.1|  Cysteine-rich receptor-like protein kinase 42           373   1e-116   
gb|EMS52195.1|  Cysteine-rich receptor-like protein kinase 42           372   1e-116   
ref|XP_007023702.1|  Serine-threonine protein kinase, plant-type,...    382   1e-116   
gb|EPS69045.1|  hypothetical protein M569_05722                         379   2e-116   
ref|XP_010045536.1|  PREDICTED: cysteine-rich receptor-like prote...    370   3e-116   
ref|XP_006602040.1|  PREDICTED: cysteine-rich receptor-like prote...    380   4e-116   
ref|XP_008227865.1|  PREDICTED: cysteine-rich receptor-like prote...    380   6e-116   
ref|XP_007146955.1|  hypothetical protein PHAVU_006G084700g             380   7e-116   
ref|XP_007221536.1|  hypothetical protein PRUPE_ppa022817mg             379   8e-116   
gb|KHN08752.1|  Cysteine-rich receptor-like protein kinase 2            379   9e-116   
emb|CDP01668.1|  unnamed protein product                                376   1e-115   
emb|CDY35206.1|  BnaA01g08250D                                          378   1e-115   
ref|XP_008776726.1|  PREDICTED: cysteine-rich receptor-like prote...    380   2e-115   
ref|NP_001170087.1|  uncharacterized protein LOC100384005               370   2e-115   
ref|XP_008655308.1|  PREDICTED: uncharacterized protein LOC100384...    370   3e-115   
gb|KHN31644.1|  Cysteine-rich receptor-like protein kinase 2            377   4e-115   
ref|XP_010528243.1|  PREDICTED: putative cysteine-rich receptor-l...    376   5e-115   
ref|XP_010940309.1|  PREDICTED: cysteine-rich receptor-like prote...    376   1e-114   
ref|XP_003552895.1|  PREDICTED: cysteine-rich receptor-like prote...    376   2e-114   
ref|XP_008655309.1|  PREDICTED: uncharacterized protein LOC100384...    367   2e-114   
ref|XP_009129435.1|  PREDICTED: putative cysteine-rich receptor-l...    375   3e-114   
ref|XP_006591291.1|  PREDICTED: cysteine-rich receptor-like prote...    375   3e-114   
gb|KHN23622.1|  Cysteine-rich receptor-like protein kinase 2            374   6e-114   
ref|XP_006591761.1|  PREDICTED: cysteine-rich receptor-like prote...    374   8e-114   
ref|XP_006591771.1|  PREDICTED: cysteine-rich receptor-like prote...    374   9e-114   
ref|XP_007146953.1|  hypothetical protein PHAVU_006G084500g             374   1e-113   
ref|XP_010045539.1|  PREDICTED: cysteine-rich receptor-like prote...    362   3e-113   
ref|XP_009129448.1|  PREDICTED: putative cysteine-rich receptor-l...    372   3e-113   
gb|KHN45756.1|  Cysteine-rich receptor-like protein kinase 2            372   6e-113   
ref|XP_006591756.1|  PREDICTED: cysteine-rich receptor-like prote...    372   8e-113   
gb|EEE54774.1|  hypothetical protein OsJ_02169                          366   1e-112   
gb|EYU34522.1|  hypothetical protein MIMGU_mgv1a002613mg                370   2e-112   
gb|KFK29408.1|  hypothetical protein AALP_AA7G130100                    369   3e-112   
ref|XP_010234835.1|  PREDICTED: cysteine-rich receptor-like prote...    370   3e-112   
emb|CDY38371.1|  BnaC01g09800D                                          369   4e-112   
ref|XP_011085909.1|  PREDICTED: cysteine-rich receptor-like prote...    371   7e-112   
gb|KGN62310.1|  hypothetical protein Csa_2G348960                       363   3e-111   
ref|XP_006591760.1|  PREDICTED: cysteine-rich receptor-like prote...    367   4e-111   
emb|CBH32625.1|  unnamed protein product                                366   8e-111   
ref|XP_010907638.1|  PREDICTED: cysteine-rich receptor-like prote...    365   2e-110   
ref|XP_006603110.1|  PREDICTED: cysteine-rich receptor-like prote...    361   4e-110   
ref|XP_004986492.1|  PREDICTED: cysteine-rich receptor-like prote...    364   5e-110   
gb|KHN45762.1|  Cysteine-rich receptor-like protein kinase 2            362   4e-109   
ref|XP_006591762.1|  PREDICTED: cysteine-rich receptor-like prote...    360   5e-109   
emb|CDM80466.1|  unnamed protein product                                360   2e-108   
dbj|BAJ94974.1|  predicted protein                                      359   3e-108   
gb|KHN25159.1|  Cysteine-rich receptor-like protein kinase 2            359   3e-108   
ref|XP_010528242.1|  PREDICTED: putative cysteine-rich receptor-l...    357   1e-107   
ref|XP_004982820.1|  PREDICTED: cysteine-rich receptor-like prote...    358   1e-107   
ref|XP_006430413.1|  hypothetical protein CICLE_v10011290mg             357   2e-107   
ref|XP_006591763.1|  PREDICTED: cysteine-rich receptor-like prote...    357   4e-107   
gb|KDO57327.1|  hypothetical protein CISIN_1g006168mg                   357   4e-107   
ref|XP_006645986.1|  PREDICTED: cysteine-rich receptor-like prote...    350   5e-107   
ref|XP_006591289.1|  PREDICTED: cysteine-rich receptor-like prote...    356   7e-107   
ref|XP_010646899.1|  PREDICTED: cysteine-rich receptor-like prote...    356   8e-107   
ref|XP_006591288.1|  PREDICTED: cysteine-rich receptor-like prote...    355   9e-107   
ref|XP_006663435.1|  PREDICTED: cysteine-rich receptor-like prote...    351   1e-106   
ref|XP_009763662.1|  PREDICTED: putative cysteine-rich receptor-l...    355   1e-106   
ref|XP_006481962.1|  PREDICTED: cysteine-rich receptor-like prote...    355   1e-106   
tpg|DAA59015.1|  TPA: putative receptor-like protein kinase             344   2e-106   
emb|CBH32626.1|  protein kinase, putative, expressed                    353   8e-106   
gb|KHN08747.1|  Cysteine-rich receptor-like protein kinase 2            352   1e-105   
ref|XP_010433188.1|  PREDICTED: putative cysteine-rich receptor-l...    346   2e-105   
ref|XP_006383965.1|  hypothetical protein POPTR_0004s02530g             351   1e-104   
gb|KDP23802.1|  hypothetical protein JCGZ_00134                         345   2e-104   
gb|KDO75602.1|  hypothetical protein CISIN_1g006155mg                   350   2e-104   
gb|KHN25165.1|  Cysteine-rich receptor-like protein kinase 3            344   3e-104   
ref|XP_011002057.1|  PREDICTED: cysteine-rich receptor-like prote...    348   6e-104   
ref|XP_007143160.1|  hypothetical protein PHAVU_007G048900g             348   1e-103   
gb|KFK26013.1|  hypothetical protein AALP_AA8G191500                    347   1e-103   
gb|EMT04605.1|  Cysteine-rich receptor-like protein kinase 2            340   4e-103   
ref|XP_007226138.1|  hypothetical protein PRUPE_ppa014741mg             346   8e-103   
ref|XP_006449131.1|  hypothetical protein CICLE_v10014521mg             345   9e-103   
ref|XP_003635466.1|  PREDICTED: putative receptor-like protein ki...    346   9e-103   
gb|EMS68799.1|  Cysteine-rich receptor-like protein kinase 2            335   1e-102   
emb|CDP20318.1|  unnamed protein product                                345   2e-102   
ref|XP_002527895.1|  kinase, putative                                   341   2e-102   
ref|XP_003556014.1|  PREDICTED: cysteine-rich receptor-like prote...    344   3e-102   
ref|XP_010112670.1|  Cysteine-rich receptor-like protein kinase 29      343   4e-102   
ref|XP_007143156.1|  hypothetical protein PHAVU_007G048500g             344   4e-102   
gb|KDO37422.1|  hypothetical protein CISIN_1g005846mg                   344   4e-102   
ref|XP_010655950.1|  PREDICTED: cysteine-rich receptor-like prote...    343   5e-102   
ref|XP_003635308.1|  PREDICTED: cysteine-rich receptor-like prote...    343   6e-102   
ref|XP_006467962.1|  PREDICTED: cysteine-rich receptor-like prote...    343   1e-101   
ref|XP_010052449.1|  PREDICTED: putative receptor-like protein ki...    342   2e-101   
gb|AFW83001.1|  putative DUF26-domain receptor-like protein kinas...    337   2e-101   
ref|XP_006449120.1|  hypothetical protein CICLE_v10014504mg             342   3e-101   
ref|XP_008224765.1|  PREDICTED: cysteine-rich receptor-like prote...    342   3e-101   
ref|XP_010647173.1|  PREDICTED: putative receptor-like protein ki...    341   3e-101   
ref|XP_009357379.1|  PREDICTED: cysteine-rich receptor-like prote...    341   3e-101   
dbj|BAK00647.1|  predicted protein                                      334   6e-101   
ref|XP_009349608.1|  PREDICTED: cysteine-rich receptor-like prote...    340   7e-101   
dbj|BAF95165.1|  protein kinase                                         338   9e-101   
ref|XP_007221601.1|  hypothetical protein PRUPE_ppa026879mg             339   1e-100   



>ref|XP_009759879.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Nicotiana 
sylvestris]
Length=649

 Score =   920 bits (2378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/653 (70%), Positives = 528/653 (81%), Gaps = 8/653 (1%)
 Frame = -2

Query  2446  MASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPL  2267
             M S  KW+FLF  F  INRSVSDPRA+EAALICTNRTA QS RQ YVA+F+AA+D++TPL
Sbjct  1     MDSPVKWVFLFTLFSFINRSVSDPRATEAALICTNRTASQSDRQVYVASFLAAMDSVTPL  60

Query  2266  VDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLF  2087
             +  ++YG  + G GN TVYA+GECMKDLSQ DCNLCFAQCKTQILRCLPFQRL+ GGRLF
Sbjct  61    ITRQQYGAVINGTGNNTVYAYGECMKDLSQRDCNLCFAQCKTQILRCLPFQRLITGGRLF  120

Query  2086  YDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFF  1907
             YDGCF+RYD Y FFNES S  D+T+CG   F GN  LF  N   LV  L      NDGF 
Sbjct  121   YDGCFLRYDYYKFFNESVSSVDRTICGNTSFSGNQSLFTENVGKLVKNLEVGGLRNDGFL  180

Query  1906  TAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTK  1727
             TA V  GN TVYGLAQCWEFV G +C  CL+ AVSKI SC PKEEGRVLN GCY+RYST+
Sbjct  181   TAVVSSGNLTVYGLAQCWEFVNGSACQKCLSDAVSKIASCHPKEEGRVLNTGCYVRYSTQ  240

Query  1726  KFYDNS---TIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERK  1556
             KF++NS   T P  N  GG S+ L VILATT G  AFLL + +V+F +RK+++KQ++E+K
Sbjct  241   KFFNNSASDTPPTAN--GGGSSRLAVILATTLGISAFLLFVSAVSFFMRKKVLKQKREKK  298

Query  1555  RLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFF  1376
             +LGA++ TVNKSKLN SYETLEKA +YF++SNKLGQGGSG VYKG+LPDG+ VAIKRLFF
Sbjct  299   QLGALIRTVNKSKLNISYETLEKAANYFNNSNKLGQGGSGSVYKGILPDGQVVAIKRLFF  358

Query  1375  NTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQ  1196
             NT QW DHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYE+VPN SL DY    KN +
Sbjct  359   NTRQWVDHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEYVPNHSLLDYVFDTKNLK  418

Query  1195  PLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPE  1016
             PL+W+QRYKI+LGTAEGLAYLHEE++L IIHRDIKLSNVLLDE+FTPKIADFGL RLFPE
Sbjct  419   PLTWDQRYKIVLGTAEGLAYLHEESKLRIIHRDIKLSNVLLDEDFTPKIADFGLARLFPE  478

Query  1015  DKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQ  836
             D++HISTA+AGTLGYMAPEY+V+GKLTEKADVYSFGVLVIE+V GKKNS  +Q + SLLQ
Sbjct  479   DRTHISTAIAGTLGYMAPEYIVRGKLTEKADVYSFGVLVIELVCGKKNSYVFQNTNSLLQ  538

Query  835   QHWNLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ  659
             Q WNL+  GK  EAVD SLE      EA++ LQ+GL+CVQAS ELRPSMS+VVKM++ + 
Sbjct  539   QLWNLYGMGKSCEAVDPSLEGNFNEEEASKLLQVGLLCVQASAELRPSMSSVVKMLTENH  598

Query  658   DIPQPTQPPFLTSNSAASSGSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
             +IPQPTQPPFL  NS +S  S  N  G   + QPSSSTQSS N +TESWIDPR
Sbjct  599   EIPQPTQPPFL--NSGSSEFSPFNLHGKRFFGQPSSSTQSSGNKLTESWIDPR  649



>ref|XP_009616732.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Nicotiana 
tomentosiformis]
Length=649

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/653 (70%), Positives = 530/653 (81%), Gaps = 8/653 (1%)
 Frame = -2

Query  2446  MASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPL  2267
             M S  KW+F+F  F  INRSVSDPRA+EAALICTNRTA Q+ RQ YVA+F+AA+D++TPL
Sbjct  1     MDSPVKWVFIFTLFSFINRSVSDPRATEAALICTNRTASQTDRQVYVASFLAAMDSVTPL  60

Query  2266  VDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLF  2087
             V  ++YG  + G GN TVYA+GECMKDLSQ DCNLCFAQCKTQILRCLPFQRL+ GGRLF
Sbjct  61    VARQQYGAVINGTGNNTVYAYGECMKDLSQRDCNLCFAQCKTQILRCLPFQRLITGGRLF  120

Query  2086  YDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFF  1907
             YDGCF+RYD Y FFNES S  D+T+CG   F G+  LF+ N   LV  L      NDG+ 
Sbjct  121   YDGCFLRYDYYKFFNESVSSVDRTICGNRSFSGDQSLFKENVGKLVRNLEVGGLRNDGYL  180

Query  1906  TAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTK  1727
             TA VG GN TVYGLAQCWEFV G +C  CL+ AVSKIGSC PKEEGRVLN GCY+RYST+
Sbjct  181   TAVVGTGNLTVYGLAQCWEFVNGSACQRCLSDAVSKIGSCHPKEEGRVLNTGCYVRYSTQ  240

Query  1726  KFYDNS---TIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERK  1556
             KF++NS   T P  N  GG S+ L VILATT G  AFLL + +V+F +RK+++KQ++E+K
Sbjct  241   KFFNNSASDTPPIGN--GGGSSRLAVILATTLGISAFLLFVSAVSFFMRKKVLKQKREKK  298

Query  1555  RLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFF  1376
             +LGA++ TVNKSKLN SYETLEKA +YF++SNKLGQGGSG VYKG+LPDG+ VAIKRLFF
Sbjct  299   QLGALIRTVNKSKLNISYETLEKAANYFNNSNKLGQGGSGSVYKGILPDGQVVAIKRLFF  358

Query  1375  NTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQ  1196
             NT QW DHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYE+VPN SL DY    KN Q
Sbjct  359   NTRQWVDHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEYVPNHSLLDYVFDTKNLQ  418

Query  1195  PLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPE  1016
             PL+W+QRYKI+LGTAEGLAYLHEE++L IIHRDIKLSNVLLDE+FTPKIADFGL RLFPE
Sbjct  419   PLTWDQRYKIVLGTAEGLAYLHEESKLRIIHRDIKLSNVLLDEDFTPKIADFGLARLFPE  478

Query  1015  DKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQ  836
             D++HISTA+AGTLGYMAPEY+V+GKLTEKADVYSFGVLVIE+V GKKN+  +Q + SLLQ
Sbjct  479   DRTHISTAIAGTLGYMAPEYIVRGKLTEKADVYSFGVLVIELVCGKKNNYVFQNTNSLLQ  538

Query  835   QHWNLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ  659
             Q WNL+  GK  EAVD SLE      EA++ LQ+GL+CVQAS ELRPSMS+VVKM++ + 
Sbjct  539   QLWNLYGIGKSCEAVDPSLEGNFNEEEASKLLQVGLLCVQASAELRPSMSSVVKMLTDNH  598

Query  658   DIPQPTQPPFLTSNSAASSGSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
             +I QPTQPPFL  NS +S  S  N  G   + QPSSSTQSS N +TESWIDPR
Sbjct  599   EILQPTQPPFL--NSGSSEFSPFNLHGKRFFGQPSSSTQSSGNKLTESWIDPR  649



>ref|XP_006356404.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Solanum tuberosum]
Length=649

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/653 (70%), Positives = 522/653 (80%), Gaps = 8/653 (1%)
 Frame = -2

Query  2446  MASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPL  2267
             M   SKW+F+F  F  I  S+SDPRA+EAALICTNRTA QS RQ YVA F+ A+D++TPL
Sbjct  1     MGFSSKWVFVFTLFSFIKLSISDPRATEAALICTNRTAAQSDRQVYVATFLEAMDSITPL  60

Query  2266  VDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLF  2087
             V   K+G  + G GN TVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLV GGRL+
Sbjct  61    VGRDKFGAVINGTGNNTVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVTGGRLY  120

Query  2086  YDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFF  1907
             YDGCF+RYD Y FFNES S  D+T+CG   F GN  LF  N   L  +L      NDGF 
Sbjct  121   YDGCFLRYDYYRFFNESLSSVDRTICGNTSFSGNQSLFSENVGKLARDLEFGGLRNDGFL  180

Query  1906  TAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTK  1727
             TA V  GN TVYGLAQCWEFV G +C  CL+ AV KIGSC PKEEGRVLN GCY+RYST+
Sbjct  181   TAVVSTGNLTVYGLAQCWEFVNGSACQRCLSDAVLKIGSCTPKEEGRVLNTGCYVRYSTQ  240

Query  1726  KFYDNS---TIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERK  1556
             +F++NS   T PA N  GG SN L VILATT G  AFLL + +V+F VR++++KQ++E+K
Sbjct  241   RFFNNSASDTPPAGN--GGGSNRLAVILATTLGISAFLLFVSAVSFFVRRKVLKQKREKK  298

Query  1555  RLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFF  1376
             +LGA++ TVNKSKLN SYETLEKA +YF++SNKLGQGGSG VYKG+LPDG+ VAIKRLFF
Sbjct  299   QLGALIRTVNKSKLNISYETLEKAANYFNNSNKLGQGGSGSVYKGILPDGQVVAIKRLFF  358

Query  1375  NTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQ  1196
             NT QW DHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYE+VPN SL DY    KN Q
Sbjct  359   NTRQWVDHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEYVPNHSLADYVFDTKNLQ  418

Query  1195  PLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPE  1016
             PL+W QRYKI+LGTAEGLAYLHEE++L IIHRDIKLSNVLLDE+F  KIADFGL RLFPE
Sbjct  419   PLTWSQRYKIVLGTAEGLAYLHEESKLRIIHRDIKLSNVLLDEDFMAKIADFGLARLFPE  478

Query  1015  DKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQ  836
             DKSHISTA+AGTLGYMAPEYVV+G LTEKADVYSFGVLV+EVV GKKN+  ++ + SLLQ
Sbjct  479   DKSHISTAIAGTLGYMAPEYVVRGILTEKADVYSFGVLVVEVVCGKKNNYVFKNTNSLLQ  538

Query  835   QHWNLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ  659
             Q WNL+  GK YEAVD  LE    + EA++ LQ+GL+CVQAS ELRPSMS+VVKM++ + 
Sbjct  539   QLWNLYGMGKSYEAVDPLLEGNFNKEEASKLLQVGLLCVQASAELRPSMSSVVKMLTENH  598

Query  658   DIPQPTQPPFLTSNSAASSGSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
             +IPQPTQPPFL  NS +S  S  N  G   + QPSSSTQSS N +TESWI+PR
Sbjct  599   EIPQPTQPPFL--NSGSSEFSPFNLHGKRFFGQPSSSTQSSGNKLTESWIEPR  649



>emb|CDP13195.1| unnamed protein product [Coffea canephora]
Length=641

 Score =   905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/644 (69%), Positives = 528/644 (82%), Gaps = 5/644 (1%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             + + IF  +I RS+SDPRA+EAAL+CTN+T+ QS RQ YVA+F+AA+DA++PLV  + YG
Sbjct  1     MLVIIFSSNIIRSLSDPRATEAALVCTNKTSSQSDRQVYVASFLAAMDAISPLVARQGYG  60

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
               V G GN TVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRL RGGRLFYDGC++R
Sbjct  61    GVVNGTGNNTVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLTRGGRLFYDGCYLR  120

Query  2065  YDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRG  1886
             YDDY+FFNES    DKTVCG  DFGGN  LF+ N A LV  +  +A   DGFF   V RG
Sbjct  121   YDDYMFFNESLDAEDKTVCGVNDFGGNQSLFKANVAQLVRNMSVEAPKTDGFFKGFVNRG  180

Query  1885  NSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNST  1706
             N TVYGLAQCWEFV G SC+ CL  +VS+IGSC PK+EGRVLNAGCY+RYSTKKFYDNS+
Sbjct  181   NLTVYGLAQCWEFVNGTSCEKCLKDSVSRIGSCPPKDEGRVLNAGCYLRYSTKKFYDNSS  240

Query  1705  IPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVN  1526
               A + +GG S  + +ILA TF + AFLLIL  ++F  +KR++KQ++E+K+LGA+L TVN
Sbjct  241   TTAPSGNGGGSRRVAIILAATFSAIAFLLILAFISFFAKKRVMKQKREKKQLGALLQTVN  300

Query  1525  KSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFF  1346
             KS+LN SYETLE+ATDYF+++NKLGQGGSG VYKGVLP+G+ VA+KRLFFNTTQW DHFF
Sbjct  301   KSRLNISYETLERATDYFNNANKLGQGGSGSVYKGVLPNGQAVAVKRLFFNTTQWVDHFF  360

Query  1345  NEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKI  1166
             NEVNLISGI HKNLV+LLGCSITGPESLLVYE+VPN SL+D+   +KN QPLSWE RYKI
Sbjct  361   NEVNLISGIQHKNLVQLLGCSITGPESLLVYEYVPNGSLHDHIFVKKNVQPLSWEDRYKI  420

Query  1165  ILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVA  986
             ILGTAEGLA+LHEE++L IIHRDIKLSN+L+DE FTPKIADFGL RLFPEDK+HISTA+A
Sbjct  421   ILGTAEGLAFLHEESKLRIIHRDIKLSNILVDESFTPKIADFGLARLFPEDKTHISTAIA  480

Query  985   GTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKK-NSSFYQASVSLLQQHWNLFRAG  809
             GTLGYMAPEYVV+GKLTEKADVYSFGVLVIEV+ GK+ N++  Q S S+LQ+ W L+  G
Sbjct  481   GTLGYMAPEYVVRGKLTEKADVYSFGVLVIEVICGKRNNNAVSQNSFSVLQKAWKLYGTG  540

Query  808   KLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPP  632
             KL EAV+ SL+    + EA+R LQIGL+CVQAS ELRPSMS VVKM++   +I QPTQPP
Sbjct  541   KLGEAVEASLQGNFIIEEASRLLQIGLLCVQASAELRPSMSVVVKMLNNQHEIAQPTQPP  600

Query  631   FLTSNSAASSGSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
             FL  N ++S  S  NR G TPY Q  S TQSS N MT+S+I+ R
Sbjct  601   FL--NCSSSDISPLNRSG-TPYFQSDSYTQSSGNDMTDSFIEAR  641



>ref|XP_004238643.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Solanum 
lycopersicum]
Length=649

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/653 (69%), Positives = 523/653 (80%), Gaps = 8/653 (1%)
 Frame = -2

Query  2446  MASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPL  2267
             M   SK  F+F  F  IN S+ DPRA+EAALIC+NRTA QS RQ YV +F+ A+D++TPL
Sbjct  1     MGFSSKCFFVFTLFSLINVSICDPRATEAALICSNRTAAQSDRQVYVESFLEAMDSITPL  60

Query  2266  VDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLF  2087
             V  +K+G  + G GN TVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLV GGRL+
Sbjct  61    VGREKFGAVINGTGNNTVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVTGGRLY  120

Query  2086  YDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFF  1907
             YDGCF+RYD Y FFNES S  D+T+CG + F GN  LF  N   LV +L      NDGF 
Sbjct  121   YDGCFLRYDYYRFFNESLSSVDRTICGNKSFAGNQSLFSDNVGKLVRDLEFGGLRNDGFL  180

Query  1906  TAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTK  1727
             TA V  GN +VYGLAQCWEFV G +C  CL+ AV KIGSC PKEEGRVLN GCY+RYST+
Sbjct  181   TAVVSSGNLSVYGLAQCWEFVNGSACQRCLSDAVLKIGSCAPKEEGRVLNTGCYVRYSTQ  240

Query  1726  KFYDNS---TIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERK  1556
             +F++NS   T PA N  GG SN L VILATT G  AFLL + +V+F VR++I+KQ++E+K
Sbjct  241   RFFNNSATDTPPAGN--GGGSNRLAVILATTLGISAFLLFVSAVSFFVRRKILKQKREKK  298

Query  1555  RLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFF  1376
             +LGA++ TVNKSKLN SYETLEKA +YF++SNKLGQGGSG VYKG+LPDG+ VAIKRLFF
Sbjct  299   QLGALIRTVNKSKLNISYETLEKAANYFNNSNKLGQGGSGSVYKGILPDGQVVAIKRLFF  358

Query  1375  NTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQ  1196
             NT QW DHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYE+VPN SL DY    KN Q
Sbjct  359   NTRQWVDHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEYVPNHSLADYVFDTKNLQ  418

Query  1195  PLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPE  1016
             PL+W QRYKI+LGTAEGLAYLHEE++L IIHRDIKLSNVLLDE+FT KIADFGL RLFPE
Sbjct  419   PLTWSQRYKIVLGTAEGLAYLHEESKLRIIHRDIKLSNVLLDEDFTAKIADFGLARLFPE  478

Query  1015  DKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQ  836
             D+SHISTA+AGTLGYMAPEYVV+G LTEKADVYSFGVLV+EVV GKKN+  ++ + SLLQ
Sbjct  479   DRSHISTAIAGTLGYMAPEYVVRGILTEKADVYSFGVLVVEVVCGKKNNYVFKNTNSLLQ  538

Query  835   QHWNLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ  659
             Q WNL+  GK  EAVD  LE    + EA++ LQ+GLVCVQAS ELRPSMS+VVKM+S + 
Sbjct  539   QLWNLYGMGKSNEAVDPLLEGNFNKEEASKLLQVGLVCVQASAELRPSMSSVVKMLSENH  598

Query  658   DIPQPTQPPFLTSNSAASSGSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
             +IPQPTQPPFL  NS +S  S  N  G   + QPSSSTQSS N +TESWI+PR
Sbjct  599   EIPQPTQPPFL--NSGSSEFSPFNLHGKRFFGQPSSSTQSSGNKLTESWIEPR  649



>ref|XP_011045282.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 isoform 
X1 [Populus euphratica]
Length=646

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/648 (69%), Positives = 510/648 (79%), Gaps = 11/648 (2%)
 Frame = -2

Query  2428  WLFLFIFF-LSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKK  2252
             +L L  F   S+N S+SDPRA++AALICTNRTA   +RQ +VANF+AALDA+TPL+  +K
Sbjct  5     FLILLSFLCFSVNLSLSDPRATQAALICTNRTATVPERQTFVANFLAALDAVTPLILRQK  64

Query  2251  YGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCF  2072
             Y   + G G+  VYAFGECMKDL  TDCNLCFAQCKTQ+LRCLPFQR  RGGRLFYDGC+
Sbjct  65    YAAVINGTGSTAVYAFGECMKDLDGTDCNLCFAQCKTQVLRCLPFQRATRGGRLFYDGCY  124

Query  2071  VRYDDYVFFNESSSLSDKTVCGAEDF-GGNSGLFRRNAAALVGELGRKAAANDGFFTAAV  1895
             +RYDDY FFNE+ S  DKT+C + DF GGN  +F  N   LV  L   A  NDGF+  +V
Sbjct  125   LRYDDYDFFNETLSTQDKTICASGDFSGGNKTVFSANVLELVRNLSVAAPKNDGFYVGSV  184

Query  1894  GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYD  1715
              RGN +V+GLAQCWEFV G +C+ CL  AVS+IGSC PKEEGR LNAGCY+RYST+KFYD
Sbjct  185   DRGNVSVFGLAQCWEFVNGSACETCLTNAVSRIGSCTPKEEGRALNAGCYLRYSTQKFYD  244

Query  1714  NSTIP-ATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAML  1538
             NST P   N+S GR   L VILA T  S A  L++ +  F VR+R+V++R+ RK LGA+L
Sbjct  245   NSTSPIGRNKSRGR---LTVILAVTSSSVAVALMIATTVFFVRRRVVEKRRARKELGALL  301

Query  1537  VTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWA  1358
             VTVNKSKLNFSYE+LEKAT+YF  SNKLGQGGSG VYKG L DG TVAIKRL FNT QW 
Sbjct  302   VTVNKSKLNFSYESLEKATNYFHLSNKLGQGGSGSVYKGTLSDGTTVAIKRLLFNTRQWV  361

Query  1357  DHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQ  1178
             DHFFNEVNLISGI HKNL KLLGCSITGPESLLVYE+VPNQSL+DY SA+ N  PLSW  
Sbjct  362   DHFFNEVNLISGIQHKNLAKLLGCSITGPESLLVYEYVPNQSLHDYFSAKMNLPPLSWAM  421

Query  1177  RYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHIS  998
             RY IILGTAEGLAYLHEE+EL IIHRDIKLSNVLLDE+F PKIADFGL RLFPEDKSHIS
Sbjct  422   RYNIILGTAEGLAYLHEESELRIIHRDIKLSNVLLDEDFNPKIADFGLARLFPEDKSHIS  481

Query  997   TAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLF  818
             TA+AGTLGYMAPEYVV+GKLTEK DVYSFGVLVIEVVSGK   S  Q S S+LQ+ W+L 
Sbjct  482   TAIAGTLGYMAPEYVVRGKLTEKVDVYSFGVLVIEVVSGKGKDSVPQDSRSILQKVWSLH  541

Query  817   RAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPT  641
               G+L EAVD  LE   +  EA+R LQIGL+CVQASPELRPSMS +VKMI+   +IPQPT
Sbjct  542   GNGRLCEAVDPVLEGNFQEDEASRLLQIGLLCVQASPELRPSMSIIVKMINDSHEIPQPT  601

Query  640   QPPFLTSNSAASSGSYPNRG-GvtpysqpssstqssVNTMTESWIDPR  500
             QPPFL   S A+  S P R  G T  SQP SSTQSS N+MT+SWI+PR
Sbjct  602   QPPFL---SPATMESSPFRQPGSTYKSQPESSTQSSGNSMTQSWIEPR  646



>ref|XP_008221860.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 isoform 
X1 [Prunus mume]
Length=647

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/629 (67%), Positives = 495/629 (79%), Gaps = 4/629 (1%)
 Frame = -2

Query  2383  SDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAF  2204
             SDPRA+EAAL+CTN TA  ++RQ ++ANF+A +DA+TP +  ++Y   V G GN TVYAF
Sbjct  22    SDPRATEAALMCTNETALMAERQTFIANFLATMDAVTPQIAVQRYAAVVNGTGNNTVYAF  81

Query  2203  GECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLS  2024
             GECMKDLS+ DC++CFAQCKTQILRCLPFQ+  RGGRLF+DGC++RYDD+ FFN+S S  
Sbjct  82    GECMKDLSKQDCDVCFAQCKTQILRCLPFQKATRGGRLFFDGCYLRYDDFNFFNQSLSAQ  141

Query  2023  DKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFV  1844
             D +VCGA  FGGN  +F+ NA  LV  L   A  NDGF    VG+GN TVYGLAQCWEFV
Sbjct  142   DTSVCGATGFGGNQSVFKDNALRLVRNLSFVAPKNDGFSVGFVGQGNETVYGLAQCWEFV  201

Query  1843  RGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHL  1664
              G +C++CLA  V +IGSC PK EGRVLNAGCY+RYST+KFY N+T     ++GG    L
Sbjct  202   NGSACEECLADTVVRIGSCPPKAEGRVLNAGCYLRYSTQKFYSNNTSTDAARNGGHRG-L  260

Query  1663  PVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKA  1484
              +ILA T   FA +L + SVA   RK+I+K+RKE+K+LG +L TVNKS+LNFSYE LE+A
Sbjct  261   AIILAVTSAVFAVVLSIFSVALFTRKKILKRRKEKKQLGPLLATVNKSQLNFSYEDLERA  320

Query  1483  TDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNL  1304
             T+YF DSNKLGQGGSG VYKGVLPDGK VAIKRLFFNT QW DHFFNEVNLISGIHHKNL
Sbjct  321   TNYFHDSNKLGQGGSGSVYKGVLPDGKVVAIKRLFFNTRQWVDHFFNEVNLISGIHHKNL  380

Query  1303  VKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEE  1124
             VKLLGCSITGPESLLVYE+VPNQSL+DY + + N  PL WE RYKIILGTAEGLAYLHEE
Sbjct  381   VKLLGCSITGPESLLVYEYVPNQSLHDYFTVKNNVDPLRWELRYKIILGTAEGLAYLHEE  440

Query  1123  TELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQG  944
             +++ IIHRDIKLSN+LLDE F PKIADFGL RLFPEDK+HISTA+AGTLGYMAPEYVV+G
Sbjct  441   SKVRIIHRDIKLSNILLDENFMPKIADFGLARLFPEDKTHISTAIAGTLGYMAPEYVVRG  500

Query  943   KLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEER-A  767
             KLTEKADVYSFGVLVIEVV GK+N+ +   SVS+L   W+L+  G+L   VD  LE +  
Sbjct  501   KLTEKADVYSFGVLVIEVVCGKRNNCYIPNSVSILHMAWDLYGTGRLCSVVDPLLEGKFD  560

Query  766   RVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNSAASSGSYPN  587
               EA+R LQIGL+CVQAS ELRP+MS VVKM+  +  IPQPTQPPFL S SA      P+
Sbjct  561   EEEASRLLQIGLLCVQASAELRPAMSLVVKMLIENPKIPQPTQPPFLNSGSAEFGRQIPS  620

Query  586   RGGvtpysqpssstqssVNTMTESWIDPR  500
               G       S++T SS N+MT+SWI+PR
Sbjct  621   --GTFNTLPDSNNTHSSRNSMTQSWIEPR  647



>ref|XP_002527897.1| kinase, putative [Ricinus communis]
 gb|EEF34454.1| kinase, putative [Ricinus communis]
Length=649

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/635 (68%), Positives = 505/635 (80%), Gaps = 12/635 (2%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             SVSDPRA++AALICTNRTA   +RQ ++ NF+A LDA+TPLV  ++YG  + G GN TVY
Sbjct  22    SVSDPRATQAALICTNRTAITQERQTFITNFLATLDAVTPLVARQQYGAVINGTGNTTVY  81

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSS  2030
              +GECMKDL QTDCNLCFAQCKTQILRCLPFQ   RGGRLFYDGC++RYDDY FFNES  
Sbjct  82    TYGECMKDLDQTDCNLCFAQCKTQILRCLPFQLATRGGRLFYDGCYLRYDDYYFFNESLD  141

Query  2029  LSDKTVCGAEDF-GGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCW  1853
               D+TVC +EDF GGN  L+  NA  L+  L      NDGFF  +V +GN +VYGLAQCW
Sbjct  142   SQDRTVCASEDFNGGNKTLYSDNAMELMRNLSVLTPKNDGFFVGSVNKGNISVYGLAQCW  201

Query  1852  EFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRS  1673
             E V   +C+ CLA AVSKI +C PKEEGRVLN+GCY+RYST+KFY+NS  PA   +GG S
Sbjct  202   ELVNTSACETCLADAVSKITNCTPKEEGRVLNSGCYLRYSTQKFYNNSG-PANADNGG-S  259

Query  1672  NHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETL  1493
             +HL VILA    S A +L++ +  F ++KR+ ++R++RK LGA+L+ VN SKLNF+YE+L
Sbjct  260   SHLAVILAAASSSVAVVLLVATAVFFMKKRVAEKRRQRKELGALLIAVNNSKLNFTYESL  319

Query  1492  EKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHH  1313
             EKAT+YF  SNKLGQGGSG VYKG+LPDGK VAIKRL FNT QW DHFFNEVNLIS I H
Sbjct  320   EKATNYFHLSNKLGQGGSGSVYKGILPDGKAVAIKRLLFNTRQWVDHFFNEVNLISNIQH  379

Query  1312  KNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYL  1133
             KNLVKLLGCSITGPESLLVYE+VPNQSL+DY    KN QPL+WE RYKIILGTAEGLAYL
Sbjct  380   KNLVKLLGCSITGPESLLVYEYVPNQSLHDYLFVAKNVQPLTWEMRYKIILGTAEGLAYL  439

Query  1132  HEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYV  953
             HEETEL IIHRD+KLSNVLLDE+F PKIADFGL RLFPEDK+HISTA+AGTLGYMAPEY+
Sbjct  440   HEETELRIIHRDVKLSNVLLDEDFLPKIADFGLARLFPEDKTHISTAIAGTLGYMAPEYI  499

Query  952   VQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVD----G  785
             V+GKLTEKADVYSFGVL+IEVVSGK+N+SF Q S S+LQ  WNL+  G+L+EAVD    G
Sbjct  500   VRGKLTEKADVYSFGVLLIEVVSGKRNNSFVQDSGSILQMVWNLYGTGRLWEAVDPVLAG  559

Query  784   SLEERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNSAAS  605
             + +E    EA+R LQ+GL+CVQAS ELRP+MS  VKM+SG  ++ QPTQPPFL  N + S
Sbjct  560   NFQEE---EASRLLQVGLLCVQASAELRPAMSVAVKMLSGIHELSQPTQPPFL--NPSTS  614

Query  604   SGSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
             S   P     T  SQP S TQSS N+MT+SWI+PR
Sbjct  615   SEISPFMRPATSSSQPDSRTQSSGNSMTQSWIEPR  649



>ref|XP_010100421.1| Cysteine-rich receptor-like protein kinase 3 [Morus notabilis]
 gb|EXB82555.1| Cysteine-rich receptor-like protein kinase 3 [Morus notabilis]
Length=647

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/635 (67%), Positives = 495/635 (78%), Gaps = 8/635 (1%)
 Frame = -2

Query  2395  NRSVSDPRASEAALICTNRTAP-QSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNA  2219
             N  +SDPRA++AALIC N TA   SQR  ++AN++AA+DA+TPLV  K++   V    N 
Sbjct  18    NSVLSDPRATQAALICANTTASTSSQRATFIANYLAAMDAVTPLVSRKRFAAVV----NG  73

Query  2218  TVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNE  2039
             TVYAFGECMKDLSQ DCNLCFAQCK+QILRC PFQ+    GRLFYDGC++RYDD+ FFN+
Sbjct  74    TVYAFGECMKDLSQRDCNLCFAQCKSQILRCFPFQKATLAGRLFYDGCYLRYDDHDFFNQ  133

Query  2038  SSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQ  1859
             SSS+ D+TVCG  DF GNS +FR N A LV  L  +A   DGFF  +V RGN +V+GLAQ
Sbjct  134   SSSIEDRTVCGPTDFAGNSRVFRDNVAELVRNLSVEAPRRDGFFVGSVTRGNVSVHGLAQ  193

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGG  1679
             CWEFV G +C+ CLA +V K+GSC+PKEEGR+LNAGCY+RYSTKKFYDNST   + Q   
Sbjct  194   CWEFVTGSACEYCLAGSVKKLGSCVPKEEGRLLNAGCYLRYSTKKFYDNSTSDDSGQGNS  253

Query  1678  RSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYE  1499
              +  L +ILA T   FA LL L +VAF +RK ++K+R+E KRLGA+L TVNKSKLN+SYE
Sbjct  254   GNRPLAIILAVTSAGFALLLTLAAVAFFLRKGLLKKRREEKRLGALLDTVNKSKLNYSYE  313

Query  1498  TLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGI  1319
              LEKAT+YF DSNKLGQGGSG VYKGVLPDGKTVAIKRLFFNT QW DHFF EVNLISGI
Sbjct  314   VLEKATNYFHDSNKLGQGGSGSVYKGVLPDGKTVAIKRLFFNTRQWVDHFFTEVNLISGI  373

Query  1318  HHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYT-SARKNHQPLSWEQRYKIILGTAEGL  1142
              HKNLV+LLGCSITGPESLLVYE+VPNQSL D     +KN   LSWE RYKIILGTAEGL
Sbjct  374   CHKNLVELLGCSITGPESLLVYEYVPNQSLLDNLFGGKKNAPQLSWELRYKIILGTAEGL  433

Query  1141  AYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAP  962
             AYLHEE+ L IIHRDIKLSN+LLDE++ PKIADFGL RLFPEDK+HISTA+AGTLGYMAP
Sbjct  434   AYLHEESNLRIIHRDIKLSNILLDEDYAPKIADFGLARLFPEDKTHISTAIAGTLGYMAP  493

Query  961   EYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGS  782
             EY+V+GKL+EKAD+YSFGVLVIE++ G+KN+SF Q S S+LQ  WNL+  GKL +AVD  
Sbjct  494   EYIVRGKLSEKADIYSFGVLVIEIICGRKNNSFTQTSYSVLQMVWNLYGTGKLSDAVDPG  553

Query  781   LEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNSAAS  605
             LE      EA+R LQIGLVCVQAS ELRPSMS+VVKM++   +IPQPTQPPF+ S S   
Sbjct  554   LEGNFNSEEASRLLQIGLVCVQASAELRPSMSSVVKMLTESHEIPQPTQPPFINSASTEI  613

Query  604   SGSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
                  +R         S++  S  NT TESWI PR
Sbjct  614   GRGVLSRSKEYKSQPDSNTQSSGNNT-TESWIGPR  647



>ref|XP_004300929.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Fragaria vesca subsp. vesca]
Length=645

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/629 (67%), Positives = 501/629 (80%), Gaps = 7/629 (1%)
 Frame = -2

Query  2380  DPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAFG  2201
             DPRA+EAALICTN TA  SQRQ+++ANF+AALD LTPL+  +KY   V G GN TVYAFG
Sbjct  22    DPRATEAALICTNDTALTSQRQSFIANFLAALDTLTPLISRQKYAAVVNGTGNTTVYAFG  81

Query  2200  ECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLSD  2021
             ECM+DLS+TDC+LCFAQCKTQILRCLPFQ+   GGRLF+DGC++RYDD+ FFN+S S  D
Sbjct  82    ECMRDLSKTDCDLCFAQCKTQILRCLPFQKATLGGRLFFDGCYLRYDDFDFFNQSLSTED  141

Query  2020  KTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFVR  1841
             K+VCG   F GN  +F+ NA  LV  L  +A  NDGFF  +V +GN TVYGLAQCWE V 
Sbjct  142   KSVCGVNSFVGNQTVFKANALELVKNLSVEATRNDGFFVGSVNKGNVTVYGLAQCWESVN  201

Query  1840  GKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLP  1661
             G +C+ CL+  V +IGSC PKEEGRVLNAGCY+RYST+KFY+N+T   T+   G  NHL 
Sbjct  202   GSACEKCLSDTVIRIGSCPPKEEGRVLNAGCYLRYSTQKFYNNNT--ETSDGNGGHNHLG  259

Query  1660  VILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKAT  1481
             +ILA T  +FA +L + + AF+ RK++VK+RKE+K+LGA+L  VNKS+LN+SYE LE AT
Sbjct  260   MILAVTSAAFALMLAISAFAFLTRKKLVKKRKEKKQLGALLSIVNKSQLNYSYEVLENAT  319

Query  1480  DYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLV  1301
             +YF DSNKLGQGGSG VYKGVLPDGK VAIKRLFFNT QW DHFFNEVNLISGIHHKNLV
Sbjct  320   NYFHDSNKLGQGGSGSVYKGVLPDGKVVAIKRLFFNTRQWVDHFFNEVNLISGIHHKNLV  379

Query  1300  KLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEET  1121
             KLLGCSITGPESLLVYE+VPNQSL+DY S + N +PL WE R KIILGTAEGLAYLHEE+
Sbjct  380   KLLGCSITGPESLLVYEYVPNQSLHDYFSVKNNLEPLRWELRSKIILGTAEGLAYLHEES  439

Query  1120  ELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGK  941
             ++ IIHRDIKLSN+LLDE F PKIADFGL RLFPEDK+HISTA+AGTLGYMAPEYV +GK
Sbjct  440   KVRIIHRDIKLSNILLDENFMPKIADFGLARLFPEDKTHISTAIAGTLGYMAPEYVTRGK  499

Query  940   LTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEER-AR  764
             LTEKADVYSFGVLVIE++SGK+ +SF   SVS+LQ  W L+ + +L  AVD  LE     
Sbjct  500   LTEKADVYSFGVLVIEIISGKRINSFASNSVSILQAVWVLYGSDQLCNAVDPVLEGNFIN  559

Query  763   VEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ-DIPQPTQPPFLTSNSAASSGSYPN  587
              EA++ LQ+GL+CVQAS ELRPSM  VVKM++    +IP+PTQPPFL S SA  S   P+
Sbjct  560   NEASQLLQVGLLCVQASAELRPSMPLVVKMLTNQNLEIPRPTQPPFLNSGSAEYSKRIPS  619

Query  586   RGGvtpysqpssstqssVNTMTESWIDPR  500
                 T  SQP S T SS N+MT+SWI+PR
Sbjct  620   ---GTSNSQPESHTHSSRNSMTQSWIEPR  645



>ref|XP_002266015.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Vitis 
vinifera]
 emb|CBI28579.3| unnamed protein product [Vitis vinifera]
Length=649

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/634 (66%), Positives = 501/634 (79%), Gaps = 6/634 (1%)
 Frame = -2

Query  2398  INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNA  2219
             I  S+SDPR ++ ALIC+NRTA   +RQ ++ANF+ A+D +TPL+ +++Y +   G G+ 
Sbjct  21    IPHSLSDPRTTQVALICSNRTALMPERQTFIANFLEAMDQVTPLISTQRYADVTSGTGST  80

Query  2218  TVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNE  2039
              V+ FGECM+DLSQ DCNLCFA CKTQ+LRC+PFQ+  RGGR FYDGC++RYDDY FF+E
Sbjct  81    AVFLFGECMEDLSQNDCNLCFALCKTQLLRCVPFQKSTRGGRSFYDGCYIRYDDYKFFDE  140

Query  2038  SSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQ  1859
             + S  DKTVCG +DF G+  +FR NA  LV  L  +A  NDGFF  +V R N +VYGLAQ
Sbjct  141   ALSAEDKTVCGTKDFSGDQTVFRANAIELVRNLSVEAPGNDGFFVGSVNRSNISVYGLAQ  200

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGG  1679
             CWEFV+G +C +CLA A S+IG C PKEEGRVLNAGCY+RYST+KFYDNST     ++ G
Sbjct  201   CWEFVKGSACAECLANATSRIGLCPPKEEGRVLNAGCYLRYSTQKFYDNSTSDFVEENEG  260

Query  1678  RSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYE  1499
              S+ L +IL  T  SFA LLI+    F VRK+  K+R+E+K+LG +L TVNKSKLNFSYE
Sbjct  261   -SSRLAIILGVTSSSFALLLIIAMTVFFVRKKRAKRRREKKQLGDLLATVNKSKLNFSYE  319

Query  1498  TLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGI  1319
             TLEKAT+YF  SNKLGQGGSG VYKG++PDGK VAIKRLFFN+ QW DHFFNEVNLISGI
Sbjct  320   TLEKATNYFHHSNKLGQGGSGSVYKGIMPDGKVVAIKRLFFNSRQWVDHFFNEVNLISGI  379

Query  1318  HHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLA  1139
              HKNLVKLLGCSITGPESLLVYE+VPNQSL+DY   ++N  PL+WE RYKI+LG AEGLA
Sbjct  380   DHKNLVKLLGCSITGPESLLVYEYVPNQSLHDYL-VKRNAPPLAWEMRYKILLGIAEGLA  438

Query  1138  YLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPE  959
             YLHEE+ L IIHRDIKLSNVLLDE+F  KIADFGL RLFPEDK+HISTA+AGTLGYMAPE
Sbjct  439   YLHEESMLRIIHRDIKLSNVLLDEDFAAKIADFGLARLFPEDKTHISTAIAGTLGYMAPE  498

Query  958   YVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSL  779
             YVV+GKLTEK DVY FGVLVIEVV GK+N+SF Q S S+LQ  WNL+  G+LYEAVD SL
Sbjct  499   YVVRGKLTEKVDVYGFGVLVIEVVCGKRNNSFTQDSFSILQMVWNLYGTGRLYEAVDPSL  558

Query  778   EERARVE-ATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNSAASS  602
                 + + A+R L++GL+CVQAS ELRPSMS VVKM++ + + PQPTQPPFL S +A SS
Sbjct  559   GGNFQEDMASRVLKVGLLCVQASAELRPSMSLVVKMLTENHETPQPTQPPFLHSGNAESS  618

Query  601   GSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
                P     T +S P S TQSS N+MT+SWI+PR
Sbjct  619   ---PLVKAETSHSLPESGTQSSKNSMTQSWIEPR  649



>ref|XP_008221861.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 isoform 
X2 [Prunus mume]
Length=623

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/629 (65%), Positives = 482/629 (77%), Gaps = 28/629 (4%)
 Frame = -2

Query  2383  SDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAF  2204
             SDPRA+EAAL+CTN TA  ++RQ ++ANF+A +DA+TP +  ++Y   V G GN TVYAF
Sbjct  22    SDPRATEAALMCTNETALMAERQTFIANFLATMDAVTPQIAVQRYAAVVNGTGNNTVYAF  81

Query  2203  GECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLS  2024
             GECMKDLS+ DC++CFAQCKTQILRCLPFQ+  RGGRLF+DGC++RYDD+ FFN+S S  
Sbjct  82    GECMKDLSKQDCDVCFAQCKTQILRCLPFQKATRGGRLFFDGCYLRYDDFNFFNQSLSAQ  141

Query  2023  DKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFV  1844
             D +VCGA  FGGN  +F+ NA  LV  L   A  NDGF    VG+GN TVYGLAQCWEFV
Sbjct  142   DTSVCGATGFGGNQSVFKDNALRLVRNLSFVAPKNDGFSVGFVGQGNETVYGLAQCWEFV  201

Query  1843  RGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHL  1664
              G +C++CLA  V +IGSC PK EGRVLNAGCY+RYST+KFY N+T     ++G      
Sbjct  202   NGSACEECLADTVVRIGSCPPKAEGRVLNAGCYLRYSTQKFYSNNTSTDAARNG------  255

Query  1663  PVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKA  1484
                                VA   RK+I+K+RKE+K+LG +L TVNKS+LNFSYE LE+A
Sbjct  256   -------------------VALFTRKKILKRRKEKKQLGPLLATVNKSQLNFSYEDLERA  296

Query  1483  TDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNL  1304
             T+YF DSNKLGQGGSG VYKGVLPDGK VAIKRLFFNT QW DHFFNEVNLISGIHHKNL
Sbjct  297   TNYFHDSNKLGQGGSGSVYKGVLPDGKVVAIKRLFFNTRQWVDHFFNEVNLISGIHHKNL  356

Query  1303  VKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEE  1124
             VKLLGCSITGPESLLVYE+VPNQSL+DY + + N  PL WE RYKIILGTAEGLAYLHEE
Sbjct  357   VKLLGCSITGPESLLVYEYVPNQSLHDYFTVKNNVDPLRWELRYKIILGTAEGLAYLHEE  416

Query  1123  TELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQG  944
             +++ IIHRDIKLSN+LLDE F PKIADFGL RLFPEDK+HISTA+AGTLGYMAPEYVV+G
Sbjct  417   SKVRIIHRDIKLSNILLDENFMPKIADFGLARLFPEDKTHISTAIAGTLGYMAPEYVVRG  476

Query  943   KLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEER-A  767
             KLTEKADVYSFGVLVIEVV GK+N+ +   SVS+L   W+L+  G+L   VD  LE +  
Sbjct  477   KLTEKADVYSFGVLVIEVVCGKRNNCYIPNSVSILHMAWDLYGTGRLCSVVDPLLEGKFD  536

Query  766   RVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNSAASSGSYPN  587
               EA+R LQIGL+CVQAS ELRP+MS VVKM+  +  IPQPTQPPFL S SA      P+
Sbjct  537   EEEASRLLQIGLLCVQASAELRPAMSLVVKMLIENPKIPQPTQPPFLNSGSAEFGRQIPS  596

Query  586   RGGvtpysqpssstqssVNTMTESWIDPR  500
               G       S++T SS N+MT+SWI+PR
Sbjct  597   --GTFNTLPDSNNTHSSRNSMTQSWIEPR  623



>ref|XP_007044718.1| Cysteine-rich RLK 3 isoform 1 [Theobroma cacao]
 gb|EOY00550.1| Cysteine-rich RLK 3 isoform 1 [Theobroma cacao]
Length=648

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/632 (65%), Positives = 492/632 (78%), Gaps = 7/632 (1%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             S+SDPRA+EAAL+CTNRTA  ++RQ +++N++A +DA+TPL+  +++   V G G+  V+
Sbjct  22    SLSDPRATEAALVCTNRTASTTERQTFISNYLAVMDAVTPLIVQQRFAAVVNGTGDTKVF  81

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSS  2030
              +GECMKDL Q+DCN+CFAQCKTQILRCLPFQ + RGGRLFYDGC++RYDDY FF+ES S
Sbjct  82    GYGECMKDLDQSDCNVCFAQCKTQILRCLPFQLVTRGGRLFYDGCYLRYDDYNFFSESLS  141

Query  2029  LSDKTVCGAEDFGG-NSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCW  1853
               D+TVC   D    N  +FR     LV  L  +A  NDGFF  +V RGN +VYGLAQCW
Sbjct  142   EGDRTVCNTSDAASSNQTVFRDYVLQLVRNLSVEAPKNDGFFVGSVSRGNVSVYGLAQCW  201

Query  1852  EFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRS  1673
             E V   +C+ CLA AVS+I SCLPKEEGR LNAGCY+RYST+KFY NST P    + GR 
Sbjct  202   ELVNKSACESCLANAVSRIRSCLPKEEGRALNAGCYLRYSTEKFYYNSTAPPVIGNRGR-  260

Query  1672  NHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETL  1493
               L VILATTF + A  LI+ +  F V K++V++R+ERK+LGA+   VNKSKLNFSYE+L
Sbjct  261   RKLAVILATTFSTLALTLIIATAVFCVNKKLVRKRRERKQLGALSHIVNKSKLNFSYESL  320

Query  1492  EKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHH  1313
             E+AT+YF DSNKLGQGGSG VYKG LP+GK VAIKRLFFNT QW DHFFNEVNLIS I+H
Sbjct  321   ERATNYFHDSNKLGQGGSGSVYKGTLPNGKVVAIKRLFFNTRQWVDHFFNEVNLISSIYH  380

Query  1312  KNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYL  1133
             KNLVKLLGCSITGPESLLVYE+VPNQSL+DY   +K+ +PL WE R+KI+LGTAEGLAYL
Sbjct  381   KNLVKLLGCSITGPESLLVYEYVPNQSLHDYLFVKKDAEPLRWEARFKIVLGTAEGLAYL  440

Query  1132  HEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYV  953
             HEE++L IIHRDIKLSNVLLDE+  PKIADFGL RLFPEDK+HISTAVAGTLGYMAPEYV
Sbjct  441   HEESKLRIIHRDIKLSNVLLDEDLIPKIADFGLARLFPEDKTHISTAVAGTLGYMAPEYV  500

Query  952   VQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEE  773
             V GKL+EK DVYSFGVLVIEV+ GK+N  F + SVS+L   WN +   KL EAVD  +E+
Sbjct  501   VCGKLSEKVDVYSFGVLVIEVICGKRN-KFSEDSVSILHMVWNHYEVDKLCEAVDPIIED  559

Query  772   RARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGD-QDIPQPTQPPFLTSNSAASSGS  596
                 EA+R L+IGL+CVQA  E+RPSMS VV+M++ D  +IPQPTQPPFL S+S   S  
Sbjct  560   NFLKEASRLLKIGLLCVQAYAEMRPSMSTVVQMLTDDAHEIPQPTQPPFLNSSSTEVS--  617

Query  595   YPNRGGvtpysqpssstqssVNTMTESWIDPR  500
               N    T  SQP S TQ S N+MT+S I+PR
Sbjct  618   -QNIASETYNSQPESYTQCSGNSMTQSMIEPR  648



>ref|XP_010251163.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Nelumbo 
nucifera]
Length=646

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/637 (64%), Positives = 492/637 (77%), Gaps = 14/637 (2%)
 Frame = -2

Query  2395  NRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNAT  2216
             N + SDPRA++AAL+CTNRTA    RQ ++ANF+AA+D++TP + S++Y  TV G GN T
Sbjct  19    NTAFSDPRATQAALVCTNRTAATPDRQTFIANFLAAMDSVTPQIASQRYARTVEGTGNNT  78

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             VYAFGECMKDLSQ DCNLCFAQCKTQ+LRCLPFQ+  RGG++FYDGC++RYDDY FF E+
Sbjct  79    VYAFGECMKDLSQNDCNLCFAQCKTQVLRCLPFQKGTRGGKIFYDGCYLRYDDYEFFGEA  138

Query  2035  SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQC  1856
              S +D+TVCG   FGG    FR NA  LV  L  +A  NDGFF  +V RGNSTVYGLAQC
Sbjct  139   LSPADRTVCGTTGFGGKRTAFRVNALELVKNLSAEAPRNDGFFVGSVDRGNSTVYGLAQC  198

Query  1855  WEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGR  1676
             WE++   SC  CL +AVS+I SCLP  EGR LNAGCY+RYST KFY+NS   A    GG 
Sbjct  199   WEYLNASSCRSCLQSAVSEIDSCLPNVEGRALNAGCYLRYSTDKFYNNSGTDAVGGDGG-  257

Query  1675  SNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYET  1496
               HL  ILA      A ++++ +V F  ++++ + R+ERK+LGA++  VNKS+LNF YE 
Sbjct  258   VRHLATILAVVSSVLAVVMVVATVIFFGKRKLARSRRERKQLGALVTVVNKSELNFKYEI  317

Query  1495  LEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIH  1316
             LE+AT+YF +SNKLG+GGSG VYKG+LPDGK VA+KRLFFNT QW D FFNEVNLIS +H
Sbjct  318   LERATNYFSNSNKLGEGGSGSVYKGILPDGKAVAVKRLFFNTRQWVDQFFNEVNLISTVH  377

Query  1315  HKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAY  1136
             HKNLVKLLGCSITGPESLLVYE+VPN SL  Y   ++N   L+W+ RY II+GTAEGLAY
Sbjct  378   HKNLVKLLGCSITGPESLLVYEYVPNHSLAQYLFDKRNAHQLTWDMRYSIIVGTAEGLAY  437

Query  1135  LHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEY  956
             LHEE+ L IIHRDIKLSN+LLDE F  KIADFGL RLFPEDK+HISTA+AGTLGYMAPEY
Sbjct  438   LHEESRLRIIHRDIKLSNILLDENFMAKIADFGLARLFPEDKTHISTAIAGTLGYMAPEY  497

Query  955   VVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLE  776
             +V+GKLTEKADVYSFGVLVIEVV GK+ SSF Q S ++LQ  WNL+ + +LYEAVD SL 
Sbjct  498   IVRGKLTEKADVYSFGVLVIEVVCGKRISSFTQDSYNILQMVWNLYGSARLYEAVDPSLA  557

Query  775   ERARVE-ATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSN----SA  611
              R + E A+R LQIGL+C QAS ELRPSMS VVKM++ + DIP+PTQPPFL SN    S+
Sbjct  558   SRFQKEQASRLLQIGLLCTQASAELRPSMSMVVKMLTDNHDIPKPTQPPFLNSNNVGPSS  617

Query  610   ASSGSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
              S G+Y +R        P S +QSS N MTESWI+PR
Sbjct  618   ISPGAYNSR--------PDSYSQSSGNDMTESWIEPR  646



>ref|XP_008389699.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Malus 
domestica]
Length=647

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/633 (63%), Positives = 496/633 (78%), Gaps = 11/633 (2%)
 Frame = -2

Query  2383  SDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAF  2204
             SDPRA++AALIC N T    +RQ +++NF+AA++A+TP + +++Y   V G GN TV+AF
Sbjct  21    SDPRATQAALICRNDTIQIPERQTFISNFLAAMNAVTPQIATRRYASVVTGTGNVTVFAF  80

Query  2203  GECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLS  2024
             GECMKD+S+TDC+ CFAQCK +IL CL F +  RGGRLF+DGC++R+DD+ FFN+S S  
Sbjct  81    GECMKDVSKTDCDQCFAQCKIKILGCLQFVKATRGGRLFFDGCYLRHDDFDFFNQSLSSE  140

Query  2023  DKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTA-AVGRGNSTVYGLAQCWEF  1847
             D+TVCG  DFG N  +F+ NA  LV  L   A  NDGF     VG GN +VYGLAQCWEF
Sbjct  141   DRTVCGDRDFGRNRTVFKDNALRLVRNLSSLAPRNDGFSAGFVVGEGNVSVYGLAQCWEF  200

Query  1846  VRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNH  1667
             V+G  C++CLA AV +IGSC PKEEGR LNAGCY+RYST+KFYDN+T+    ++ GR + 
Sbjct  201   VKGPGCEECLADAVKRIGSCTPKEEGRALNAGCYLRYSTQKFYDNNTVTDDCRTKGRRS-  259

Query  1666  LPVILATTFGSFAFLLILGSVAFIVRKRIVKQRK---ERKRLGAMLVTVNKSKLNFSYET  1496
             L +ILA TF   A +L + +VAF  RK+I+ +RK   E+K+ GA+  TVNKS+LNFSYE 
Sbjct  260   LAIILAVTF---AVVLTISAVAFFARKKILTRRKAASEKKQFGALFATVNKSQLNFSYEV  316

Query  1495  LEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIH  1316
             LEKAT+YF D+NKLGQGGSG VYKGVLPDG  VAIKRLFFN  QW DHFFNEVNLISGIH
Sbjct  317   LEKATNYFHDANKLGQGGSGSVYKGVLPDGNVVAIKRLFFNARQWVDHFFNEVNLISGIH  376

Query  1315  HKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAY  1136
             HKNL+KLLGCSITGPESLLVYE+VPNQSL+DY   + N +PL W+ RYKIILGTAEGLAY
Sbjct  377   HKNLLKLLGCSITGPESLLVYEYVPNQSLHDYFIVKNNVEPLRWDLRYKIILGTAEGLAY  436

Query  1135  LHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEY  956
             LHEE++L IIHRDIKLSN+LLDEEF  KIADFGL R+FPEDK+HISTA+AGTLGYMAPEY
Sbjct  437   LHEESKLRIIHRDIKLSNILLDEEFNAKIADFGLARMFPEDKTHISTAIAGTLGYMAPEY  496

Query  955   VVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLE  776
             VV+G LTEKADVYSFGVLVIE++SG++N+S + +S S+L+  W+L+   +L EAVD  LE
Sbjct  497   VVRGMLTEKADVYSFGVLVIEIISGRRNNSVFSSSTSILKMTWDLYGTCRLCEAVDPLLE  556

Query  775   ER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNSAASSG  599
              +    EA+R LQIGL+C+QAS ELRP+MS VVKM++ + +IPQPTQPPFL S SA  + 
Sbjct  557   GKFENEEASRLLQIGLLCMQASAELRPAMSLVVKMLTENLEIPQPTQPPFLNSGSAVLNR  616

Query  598   SYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
             + P+  G        S+TQSS N+M +SWI+PR
Sbjct  617   TIPS--GSLISLPAESNTQSSKNSMIQSWIEPR  647



>gb|KDP26626.1| hypothetical protein JCGZ_17784 [Jatropha curcas]
Length=657

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/660 (63%), Positives = 498/660 (75%), Gaps = 10/660 (2%)
 Frame = -2

Query  2458  MNRKMASLSKWLFLFIFFLS-----INRSVSDPRASEAALICTNRTAPQSQRQAYVANFV  2294
             M RK+     + +  I  LS     +  SVS+PRA++AA+IC+NRTA  S+RQ +V NF+
Sbjct  1     MERKINPFFPYGYFLISLLSCLSFLVKFSVSEPRATQAAMICSNRTAANSERQIFVVNFL  60

Query  2293  AALDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQ  2114
             A +D +TPLV  +++G  + G+GN TVY  GECMKDL  TDCNLCFAQ KTQILRCLPFQ
Sbjct  61    ATMDVVTPLVARQQFGAVINGSGNTTVYTLGECMKDLDPTDCNLCFAQSKTQILRCLPFQ  120

Query  2113  RLVRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFG-GNSGLFRRNAAALVGELG  1937
                RGGRLFYDGC++RYDDY FFNE+ S  D+TVC    F  G+  +F  NA  LV  L 
Sbjct  121   LGTRGGRLFYDGCYLRYDDYNFFNETLSSQDRTVCANGTFNNGSKTVFSANAMELVRNLS  180

Query  1936  RKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLN  1757
              +A  +DGF    V RGN +VYGLAQCWE +   SC+ CLA AVSKI +C PKEEGRVLN
Sbjct  181   VQAPKSDGFSVGFVNRGNVSVYGLAQCWELLNASSCETCLANAVSKIANCTPKEEGRVLN  240

Query  1756  AGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIV  1577
             AGCY+RYS +KFY+NS   A   +GGRS HL VILA    + A  LI+ +  F  +KRI 
Sbjct  241   AGCYLRYSPQKFYNNSGT-ANVGNGGRS-HLAVILAVISSAVAVTLIVSTAVFFGKKRIA  298

Query  1576  KQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTV  1397
             ++R++R  LGA+L T+N SKLNFSYE+LE+AT+YF  S KLGQGGSG VYKGVLPDG  V
Sbjct  299   EKRRQRNELGALLTTLNNSKLNFSYESLERATNYFHSSTKLGQGGSGSVYKGVLPDGTVV  358

Query  1396  AIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYT  1217
             AIKRL FNT QW DHFFNEVNLIS I HKNLVKLLGCSITGPESLLVYE+VPN+SL DY 
Sbjct  359   AIKRLLFNTRQWVDHFFNEVNLISDIQHKNLVKLLGCSITGPESLLVYEYVPNRSLQDYF  418

Query  1216  SARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFG  1037
               + N +PL+WE RY IILGTAEGLAYLHEETEL IIHRDIKLSN+LL E+FTPKIADFG
Sbjct  419   FDKNNVRPLTWEMRYNIILGTAEGLAYLHEETELRIIHRDIKLSNILLGEDFTPKIADFG  478

Query  1036  LVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQ  857
             L RLFP+DK+HI+T +AGTLGYMAPEYV++GKLTEKADVYSFGVLV+EVVSG++N++F Q
Sbjct  479   LARLFPQDKTHITTVIAGTLGYMAPEYVIRGKLTEKADVYSFGVLVMEVVSGRRNNAFVQ  538

Query  856   ASVSLLQQHWNLFRAGKLYEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVV  680
              S S+LQ  W L+  G+L EAVD  LE +    EA+R LQIGL+CVQAS +LRP+MS VV
Sbjct  539   DSGSILQMVWTLYGTGRLCEAVDPKLEGDFQEEEASRLLQIGLLCVQASADLRPAMSIVV  598

Query  679   KMISGDQDIPQPTQPPFLTSNSAASSGSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
             KM++   +IPQPTQPPFL   S +S  S   R   T  SQP S TQSS N+MT+SWI+PR
Sbjct  599   KMLNNSHEIPQPTQPPFLNPASNSSEISTLIRPA-TSSSQPESYTQSSGNSMTQSWIEPR  657



>ref|XP_006438314.1| hypothetical protein CICLE_v10030965mg [Citrus clementina]
 gb|ESR51554.1| hypothetical protein CICLE_v10030965mg [Citrus clementina]
Length=626

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/596 (67%), Positives = 476/596 (80%), Gaps = 6/596 (1%)
 Frame = -2

Query  2380  DPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAFG  2201
             DPRA+ AALICTNRTA  S R+ ++ NF+AA+D +TPL+  ++Y   V G G A+VYAFG
Sbjct  23    DPRATRAALICTNRTASSSLRRTFITNFLAAMDIVTPLIARQRYAAVVNGTGTASVYAFG  82

Query  2200  ECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLSD  2021
             ECMKDLS  DCNLCFAQCKTQ+L+CLPFQ   RGGR+FYDGCF+RYDDY FFNES S  D
Sbjct  83    ECMKDLSPNDCNLCFAQCKTQVLKCLPFQLATRGGRVFYDGCFLRYDDYDFFNESLSSQD  142

Query  2020  KTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--GRGNSTVYGLAQCWEF  1847
             +TVCG++DFGGN+ +F  NA  LV  L  +A  NDGFF  +V   +GN +V+GLAQCWEF
Sbjct  143   RTVCGSKDFGGNNTVFGANAIELVRNLSVQAVKNDGFFVGSVTFSKGNVSVHGLAQCWEF  202

Query  1846  VRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNH  1667
             V G +C++CL  AVS+I SC  KEEGRVLNAGCY+RYST++FY+NS  P      G  N 
Sbjct  203   VNGSACENCLENAVSRIASCTQKEEGRVLNAGCYLRYSTQRFYNNSG-PDPVPGNGGDNK  261

Query  1666  LPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEK  1487
             L VILAT+  + A LL+   VAF VR++++++R+ERK+LGA+ V VNKSKLNFSYETLEK
Sbjct  262   LAVILATS--AVALLLVFSLVAFFVRRKLLQKRRERKQLGALQVAVNKSKLNFSYETLEK  319

Query  1486  ATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKN  1307
             AT+YF +SNKLGQGGSG VYKG LP G+ VA+KRLF+NTTQW DHFFNEVNLISGI+HKN
Sbjct  320   ATNYFHESNKLGQGGSGSVYKGTLPGGEAVAVKRLFYNTTQWVDHFFNEVNLISGINHKN  379

Query  1306  LVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHE  1127
             LVKLLGCSITGPESLLVYEFVPNQSL D    R++ +PLSWE RYKIIL  AEGL YLHE
Sbjct  380   LVKLLGCSITGPESLLVYEFVPNQSLLDNLFVRQDVEPLSWEVRYKIILSAAEGLTYLHE  439

Query  1126  ETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQ  947
             E++L IIHRDIKLSN+LLDEEFT KIADFGLVRLFPED +HIS  +AGTLGYMAPEYVV+
Sbjct  440   ESKLRIIHRDIKLSNILLDEEFTAKIADFGLVRLFPEDITHISATLAGTLGYMAPEYVVR  499

Query  946   GKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEERA  767
             GKLTEKADVYSFGV+VIEVV  K+ + F Q S S+LQ  W+L+  G+L+EAVD +L    
Sbjct  500   GKLTEKADVYSFGVVVIEVVCRKRINLFTQNSFSILQTVWDLYVKGRLHEAVDPALAGNF  559

Query  766   RV-EATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNSAASS  602
             +  E +R LQIGL+CVQAS ELRPSMS VVKM++G+ +I QPTQPPFL  N +  S
Sbjct  560   QEGEPSRLLQIGLLCVQASAELRPSMSIVVKMLTGNHEILQPTQPPFLNPNGSEIS  615



>ref|XP_006483912.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Citrus sinensis]
Length=626

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/596 (67%), Positives = 476/596 (80%), Gaps = 6/596 (1%)
 Frame = -2

Query  2380  DPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAFG  2201
             DPRA+ AALICTNRTA  S R+ ++ NF+AA+D +TPL+  ++Y   V G G A+VYAFG
Sbjct  23    DPRATRAALICTNRTASSSLRRTFITNFLAAMDIVTPLIARQRYAAVVNGTGTASVYAFG  82

Query  2200  ECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLSD  2021
             ECMKDLS  DCNLCFAQCKTQ+L+CLPFQ   RGGR+FYDGC++RYDDY FFNES S  D
Sbjct  83    ECMKDLSPNDCNLCFAQCKTQVLKCLPFQLATRGGRVFYDGCYLRYDDYDFFNESLSSQD  142

Query  2020  KTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--GRGNSTVYGLAQCWEF  1847
             +TVCG++DFGGN+ +F  NA  LV  L  +A  NDGFF  +V   +GN +V+GLAQCWEF
Sbjct  143   RTVCGSKDFGGNNTVFGANAIELVRNLSVQAVKNDGFFVGSVTFSKGNVSVHGLAQCWEF  202

Query  1846  VRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNH  1667
             V G +C++CL  AVS+I SC  KEEGRVLNAGCY+RYST++FY+NS  P      G  N 
Sbjct  203   VNGSACENCLENAVSRIASCTQKEEGRVLNAGCYLRYSTQRFYNNSG-PDPVPGNGGDNK  261

Query  1666  LPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEK  1487
             L VILAT+  + A LL+   VAF VR++++++R+ERK+LGA+ V VNKSKLNFSYETLEK
Sbjct  262   LAVILATS--AVALLLVFSLVAFFVRRKLLQKRRERKQLGALQVAVNKSKLNFSYETLEK  319

Query  1486  ATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKN  1307
             AT+YF +SNKLGQGGSG VYKG LP G+ VA+KRLF+NTTQW DHFFNEVNLISGI+HKN
Sbjct  320   ATNYFHESNKLGQGGSGSVYKGTLPGGEAVAVKRLFYNTTQWVDHFFNEVNLISGINHKN  379

Query  1306  LVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHE  1127
             LVKLLGCSITGPESLLVYEFVPNQSL D    R++ +PLSWE RYKIIL  AEGL YLHE
Sbjct  380   LVKLLGCSITGPESLLVYEFVPNQSLLDNLFVRQDVEPLSWEVRYKIILSAAEGLTYLHE  439

Query  1126  ETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQ  947
             E++L IIHRDIKLSN+LLDEEFT KIADFGLVRLFPED +HIS  +AGTLGYMAPEYVV+
Sbjct  440   ESKLRIIHRDIKLSNILLDEEFTAKIADFGLVRLFPEDITHISATLAGTLGYMAPEYVVR  499

Query  946   GKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEERA  767
             GKLTEKADVYSFGV+VIEVV  K+ + F Q S S+LQ  W+L+  G+L+EAVD +L    
Sbjct  500   GKLTEKADVYSFGVVVIEVVCRKRINLFTQNSFSILQTVWDLYVKGRLHEAVDPALAGNF  559

Query  766   RV-EATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNSAASS  602
             +  E +R LQIGL+CVQAS ELRPSMS VVKM++G+ +I QPTQPPFL  N +  S
Sbjct  560   QEGEPSRLLQIGLLCVQASAELRPSMSIVVKMLTGNHEILQPTQPPFLNPNGSEIS  615



>ref|XP_004135260.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Cucumis sativus]
 ref|XP_004165355.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Cucumis sativus]
Length=651

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/648 (63%), Positives = 488/648 (75%), Gaps = 8/648 (1%)
 Frame = -2

Query  2437  LSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDS  2258
             L  +L +  FF    +S +DPRA+EAALIC+N TA  ++R  +VANF+ ++DA+TPL+ S
Sbjct  10    LIPFLLMLSFFRLPIQSSADPRATEAALICSNNTASPAERSTFVANFLDSMDAVTPLIAS  69

Query  2257  KKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDG  2078
             +++   + G GN TVYAFGECM DLSQ DC+LCFAQ KTQ+LRCLPFQ   RGGRLFYDG
Sbjct  70    QRFAAVINGTGNTTVYAFGECMNDLSQADCDLCFAQMKTQVLRCLPFQLATRGGRLFYDG  129

Query  2077  CFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAA  1898
             CFVRYD Y FFNES S  D+TVCG  D+ GN  +F  +A  L   L   A  NDGF   +
Sbjct  130   CFVRYDYYNFFNESLSAVDRTVCGKLDYSGNRSVFSDSAMKLARNLSVVAPKNDGFAVGS  189

Query  1897  VGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFY  1718
             V   N +VYGL QCW+FVRG SC  CL  A  +IGSC PK EGRVLNAGCY RYST+KFY
Sbjct  190   VDFRNVSVYGLGQCWKFVRGSSCSKCLVDAAKEIGSCPPKSEGRVLNAGCYFRYSTEKFY  249

Query  1717  DNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAML  1538
              N+T  AT   G  S  L +ILA+   + A  LI+ +V F  R+R++++R E+++LG ++
Sbjct  250   FNTTATAT--GGNNSRRLAIILASVSAAVAAALIISTVLFCARRRVLRKRNEKRQLGPLV  307

Query  1537  VTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWA  1358
               VNKSKLNFSYETLEKAT+YFD SNKLGQGGSG VYKG L DG+ VAIKRLFFNT QW 
Sbjct  308   AIVNKSKLNFSYETLEKATNYFDQSNKLGQGGSGSVYKGTLSDGRVVAIKRLFFNTRQWV  367

Query  1357  DHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQ  1178
             DHFFNEVNLISGI HKNLV LLGCSITGPESLLVYE+VPNQSL+DY    KN QPLSW+ 
Sbjct  368   DHFFNEVNLISGIRHKNLVGLLGCSITGPESLLVYEYVPNQSLHDYLFGNKNVQPLSWQS  427

Query  1177  RYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHIS  998
             R+KI+LGTAEGLAYLHEE+ + IIHRDIKLSN+LLD +FTPKIADFGL RL PEDK+HIS
Sbjct  428   RFKIVLGTAEGLAYLHEESNVKIIHRDIKLSNILLDYDFTPKIADFGLARLLPEDKTHIS  487

Query  997   TAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLF  818
             TA+AGTLGYMAPEYVV+GKL+EKADVYSFGV  IEV++G++N  FYQ S S+LQ+ WNL+
Sbjct  488   TAIAGTLGYMAPEYVVRGKLSEKADVYSFGVFAIEVITGRRNGHFYQDSTSILQKVWNLY  547

Query  817   RAGKLYEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPT  641
               G+LY AVD  L  +  R EA+R LQIGLVCVQA  +LRPSMS VVKM++ + +IPQP 
Sbjct  548   GEGRLYAAVDPILAGDYPRDEASRLLQIGLVCVQAFADLRPSMSMVVKMLTANYEIPQPK  607

Query  640   QPPFLTSNSAASSGSY-PNRGGvtpysqpssstqssVNTMTESWIDPR  500
             QPP+L      SSGS  P     +       ++++S N+MT+S IDPR
Sbjct  608   QPPYL----HPSSGSMKPQNSSDSSNPNLYYNSRTSQNSMTQSIIDPR  651



>ref|XP_007222003.1| hypothetical protein PRUPE_ppa002895mg [Prunus persica]
 gb|EMJ23202.1| hypothetical protein PRUPE_ppa002895mg [Prunus persica]
Length=623

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/629 (65%), Positives = 479/629 (76%), Gaps = 28/629 (4%)
 Frame = -2

Query  2383  SDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAF  2204
             SDPRA+EAAL+CTN TA  ++RQ +VANF+A +DA+TP +  ++Y   V G GN TVYAF
Sbjct  22    SDPRATEAALMCTNETALMAERQTFVANFLATMDAVTPQIAVQRYAAAVNGTGNNTVYAF  81

Query  2203  GECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLS  2024
             GECMKDLS+ DC++CFAQCKTQILRCLPFQ+  RGGRLFYDGC++RYDD+ FFN+S S  
Sbjct  82    GECMKDLSKQDCDVCFAQCKTQILRCLPFQKATRGGRLFYDGCYLRYDDFNFFNQSLSAQ  141

Query  2023  DKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFV  1844
             D +VCG   FGGN  +F+ NA  LV  L   A  NDGF    VG+GN TVYGLAQCWEFV
Sbjct  142   DTSVCGGTGFGGNQSVFKDNALRLVRNLSFVAPKNDGFSVGFVGQGNETVYGLAQCWEFV  201

Query  1843  RGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHL  1664
              G +C++CLA  V +IGSC PK EGRVLNAG                            L
Sbjct  202   NGSACEECLADTVVRIGSCPPKAEGRVLNAG-------------------------HRGL  236

Query  1663  PVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKA  1484
              +ILA T   FA +L + SVAF  RK+I+K+RKE+K+LG +L TVNKS+LNFSYE LE+A
Sbjct  237   AIILAVTAAVFAVVLSIFSVAFFTRKKILKRRKEKKQLGPLLATVNKSQLNFSYEVLERA  296

Query  1483  TDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNL  1304
             T+YF DSNKLGQGGSG VYKGVLPDGK VAIKRLFFNT QW DHFFNEVNLISGIHHK L
Sbjct  297   TNYFHDSNKLGQGGSGSVYKGVLPDGKVVAIKRLFFNTRQWVDHFFNEVNLISGIHHKKL  356

Query  1303  VKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEE  1124
             VKLLGCSITGPESLLVYE+VPNQSL DY + + N +PL WE RYKIILGTAEGLAYLHEE
Sbjct  357   VKLLGCSITGPESLLVYEYVPNQSLNDYFTVKNNVEPLRWELRYKIILGTAEGLAYLHEE  416

Query  1123  TELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQG  944
             +++ IIHRDIKLSN+LLDE+F PKIADFGL RLFPEDK+HISTA+AGTLGYMAPEYVV+G
Sbjct  417   SKVRIIHRDIKLSNILLDEDFMPKIADFGLARLFPEDKTHISTAIAGTLGYMAPEYVVRG  476

Query  943   KLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEER-A  767
             KLTEKADVYSFGVLVIEVV GK+N+ +   SVS+L   W+L+  G+L  AVD  LE +  
Sbjct  477   KLTEKADVYSFGVLVIEVVCGKRNNCYIPNSVSILHMAWDLYGTGRLCSAVDPLLEGKFD  536

Query  766   RVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNSAASSGSYPN  587
               EA+R LQIGL+CVQAS ELRP+MS VVKM+  + +IPQPTQPPFL S SA      P+
Sbjct  537   EEEASRLLQIGLLCVQASAELRPAMSLVVKMLIENPEIPQPTQPPFLNSGSAEFGRQIPS  596

Query  586   RGGvtpysqpssstqssVNTMTESWIDPR  500
               G       S++T SS N+MT+SWI+PR
Sbjct  597   --GTFNTLPDSNNTHSSRNSMTQSWIEPR  623



>gb|KHG18697.1| Cysteine-rich receptor-like protein kinase 3 [Gossypium arboreum]
Length=666

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/603 (65%), Positives = 466/603 (77%), Gaps = 7/603 (1%)
 Frame = -2

Query  2386  VSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYA  2207
             + DPRA+EAALICTN TA  + R+++VANF+A LD+ TPL+  ++Y   V G+G+  VY 
Sbjct  18    LCDPRATEAALICTNTTASITARKSFVANFLAVLDSFTPLIVRQRYAVVVKGSGDTRVYG  77

Query  2206  FGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSL  2027
             FGECMKDL Q DCN+CFAQCK QI+RCLPFQ   RGGRLFYDGC++RYDDY FF+ES S 
Sbjct  78    FGECMKDLEQGDCNICFAQCKAQIMRCLPFQIGTRGGRLFYDGCYLRYDDYNFFDESLSE  137

Query  2026  SDKTVCGAEDFG-GNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNST-VYGLAQCW  1853
             +D+TVC  +D G  N   FR N   LV  L  +A  NDGFF  ++G+GN+  VYGLAQCW
Sbjct  138   TDRTVCATKDVGLSNETGFRANVMQLVRNLTVEAPKNDGFFVGSMGKGNNVLVYGLAQCW  197

Query  1852  EFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRS  1673
             E V   +C+DCL  AVS+I SCLPKEEGRVLNAGCY+RYST KFY NST P    + GR 
Sbjct  198   ELVNASACEDCLVNAVSRISSCLPKEEGRVLNAGCYLRYSTNKFYYNSTAPPVGGNRGR-  256

Query  1672  NHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETL  1493
               L +ILATTF + A  LI  +  F V K++VK+R+E K+LGA+   +NKSKLN SYE+L
Sbjct  257   RKLAIILATTFSTMALALIFATAIFFVNKKLVKKRQESKQLGALSPLLNKSKLNLSYESL  316

Query  1492  EKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHH  1313
             EKAT+YF D+NKLGQGGSG VYKG LP+GK VAIKRLFFNT QW D FFNEVNLISGI+H
Sbjct  317   EKATNYFSDTNKLGQGGSGSVYKGTLPNGKVVAIKRLFFNTRQWVDQFFNEVNLISGINH  376

Query  1312  KNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYL  1133
             KNLVKLLGCSITGPESLLVYEFV NQSL+DY   RK+ +PL WE+RYKI+LGTAEGLAYL
Sbjct  377   KNLVKLLGCSITGPESLLVYEFVSNQSLHDYLFVRKDVEPLRWEERYKIVLGTAEGLAYL  436

Query  1132  HEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYV  953
             HEE++L IIHRDIK SN+LLDE+ TPKIADFGLVRLFPEDK+HISTA+AGTLGYMAPEY 
Sbjct  437   HEESKLRIIHRDIKPSNILLDEDLTPKIADFGLVRLFPEDKTHISTAIAGTLGYMAPEYA  496

Query  952   VQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEE  773
             V+G LT+KADVYSFGVLVIE+  GK+N  F    V +L   WN + A KL E VD  +E 
Sbjct  497   VRGMLTQKADVYSFGVLVIEITCGKRNKCFSPDMVCILHMVWNQYEADKLREVVDPVIEL  556

Query  772   RARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ-DIPQPTQPPFLTSNSAASSGS  596
               R +A R LQIGL+CVQAS ELRPSMS +V++++ D  +IP PTQPP L   S +SSG 
Sbjct  557   NFREKACRLLQIGLLCVQASTELRPSMSTIVQILTDDTCEIPFPTQPPIL---SPSSSGV  613

Query  595   YPN  587
              PN
Sbjct  614   SPN  616



>ref|XP_011086609.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Sesamum 
indicum]
Length=642

 Score =   801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/641 (63%), Positives = 495/641 (77%), Gaps = 15/641 (2%)
 Frame = -2

Query  2419  LFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGET  2240
             L +    + +S S+PRA+EAALIC+NRTA  S RQ YVA+F+A +D++TP V  ++YG  
Sbjct  16    LIVLVFHVRQSFSEPRATEAALICSNRTAEASDRQVYVASFLATMDSVTPQVSRQRYGVV  75

Query  2239  VIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYD  2060
             + G GN TVY FGECMKDLSQ DCNLCFA+ KTQILRCLPFQRL +GGRLFYDGC++RYD
Sbjct  76    INGTGNNTVYTFGECMKDLSQNDCNLCFARMKTQILRCLPFQRLTKGGRLFYDGCYLRYD  135

Query  2059  DYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNS  1880
             D++FFNES S  D+TVCGA+DF GN  LF  +   L  ++  +   NDGFFT +V  GN 
Sbjct  136   DFMFFNESLSAVDRTVCGADDFVGNRSLFADSVLELSRKVRVEGPKNDGFFTGSVSNGNL  195

Query  1879  TVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIP  1700
             TVYGLAQCWEFV G  C +CL  AV +IGSC PK EGR LNAGCY RYST +FY+NS   
Sbjct  196   TVYGLAQCWEFVNGSGCVNCLENAVLRIGSCPPKVEGRALNAGCYFRYSTTRFYNNSASD  255

Query  1699  ATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKS  1520
             A    GG S+    I A+T  + A LL + +V+F  R RIV++R+E+K+LG +L  V KS
Sbjct  256   APAGGGGGSHRRATIFASTSAAIACLLFVAAVSFFARNRIVRRRREKKKLGTLLARVTKS  315

Query  1519  KLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNE  1340
             K+NFSYETLE+AT+YF +SNKLGQGGSG VYKG+LP G+TVA+KRLFFNTTQWADHFFNE
Sbjct  316   KINFSYETLERATNYFANSNKLGQGGSGSVYKGILPGGQTVAVKRLFFNTTQWADHFFNE  375

Query  1339  VNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIIL  1160
             VNLISGI H NLVKLLGCSITGPESLLVYE+VPNQSL+DY   RK               
Sbjct  376   VNLISGIDHPNLVKLLGCSITGPESLLVYEYVPNQSLHDYMFVRKXXX------------  423

Query  1159  GTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGT  980
              TAEGLA+LHE ++L IIHRDIKLSNVLL  +FTPKIADFGL RLFPED++HISTAVAGT
Sbjct  424   XTAEGLAFLHETSKLRIIHRDIKLSNVLLHMDFTPKIADFGLARLFPEDETHISTAVAGT  483

Query  979   LGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLY  800
             LGYMAPEYVV+GKLTEKADVYSFGV+V+EVVSG++N++F Q S+S+LQ+ W+L+++G+L 
Sbjct  484   LGYMAPEYVVRGKLTEKADVYSFGVVVMEVVSGRRNNAFSQNSLSILQKVWDLYQSGQLI  543

Query  799   EAVDGSLEERARVE-ATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLT  623
             EAVD S++ +   E ATR LQIGL+C QA+ E RPSMS +VKM++G+++IP PTQPPFL+
Sbjct  544   EAVDPSVKGKFPEEGATRLLQIGLICAQAAAERRPSMSVIVKMLTGNEEIPGPTQPPFLS  603

Query  622   SNSAASSGSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
             SNSA   G +   G    +SQ  S+T+S  N +TES+ +PR
Sbjct  604   SNSAEMIGPFNPPG--KYFSQHESNTESYDNEITESFFEPR  642



>ref|XP_003552033.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Glycine max]
Length=656

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/660 (62%), Positives = 498/660 (75%), Gaps = 22/660 (3%)
 Frame = -2

Query  2434  SKWLFLFIFFLSINRSVSDPRASEAALICTNRTA-PQSQRQAYVANFVAALDALTPLVDS  2258
             S +LFLF     +  ++SDPRA  AAL+CTNRT    S+RQ ++ANF+AA+DALTPL  S
Sbjct  4     SSFLFLFHCSFFLPYALSDPRAQRAALLCTNRTVLSLSRRQVFIANFLAAMDALTPLTTS  63

Query  2257  KKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDG  2078
               +G    G+ NATVYAFGECM+DLS+ DCNLC AQCKTQ+L CLPFQR  RGGRLF+DG
Sbjct  64    HGHGAVSNGSQNATVYAFGECMRDLSRNDCNLCLAQCKTQLLACLPFQRGTRGGRLFFDG  123

Query  2077  CFVRYDDYVFFNESSSLSDKTVCGAEDF------------GGNSGLFRRNAAALVGELGR  1934
             C++RYDDY FF E+ S  D TVCG                  +SG+++ NA ALV  L  
Sbjct  124   CYLRYDDYNFFGETRSDQDTTVCGNNSNNNNSNSVANSATNSSSGVYKANAMALVLNLSE  183

Query  1933  KAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNA  1754
              A  +DGFF  +V R N  VYGLAQCWE+V G +C+ CLA AV++IGSC   +E R LNA
Sbjct  184   LAPKSDGFFVGSVERKNVRVYGLAQCWEYVNGSACERCLADAVTRIGSC-ATQEARALNA  242

Query  1753  GCYMRYSTKKFYDNS-TIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIV  1577
             GCY+RYS +KFY+NS  +P   + G R   L  ILA +  + A LL++ +V F +RK +V
Sbjct  243   GCYLRYSAQKFYNNSGVVPTAGKHGKR--RLAKILAASSAALALLLVIATVVFFIRKNVV  300

Query  1576  KQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTV  1397
              +R+ER++ GA+L TVNKSKLN  YE LEKAT+YF+++NKLGQGGSG VYKGV+PDG TV
Sbjct  301   TRRRERRQFGALLDTVNKSKLNMPYEVLEKATNYFNEANKLGQGGSGSVYKGVMPDGITV  360

Query  1396  AIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYT  1217
             AIKRL FNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYE+VPNQSL+D+ 
Sbjct  361   AIKRLSFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEYVPNQSLHDHF  420

Query  1216  SARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFG  1037
             S R+  QPL+WE R+KI+LG AEG+AYLHEE+ + IIHRDIKLSN+LL+E+FTPKIADFG
Sbjct  421   SVRRTSQPLTWEIRHKILLGIAEGMAYLHEESHVRIIHRDIKLSNILLEEDFTPKIADFG  480

Query  1036  LVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQ  857
             L RLFPEDKSHISTA+AGTLGYMAPEYVV+GKLTEKADVYSFGVLVIE+VSGKK S++  
Sbjct  481   LARLFPEDKSHISTAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLVIEIVSGKKISAYIM  540

Query  856   ASVSLLQQHWNLFRAGKLYEAVDGSLEERARVE-ATRQLQIGLVCVQASPELRPSMSAVV  680
              S SLL   W+L+ + +L E VD +LE     E A + LQIGL+C QAS ELRPSMS VV
Sbjct  541   NSSSLLHTVWSLYGSNRLSEVVDPTLEGAFPAEVACQLLQIGLLCAQASAELRPSMSVVV  600

Query  679   KMISGDQDIPQPTQPPFLTSNSAASSGSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
             KM++ D +IPQPTQPPF+ S S+     +   G      QP S+TQSS NT++ES I+PR
Sbjct  601   KMVNNDHEIPQPTQPPFMNSGSS----EFGKSGLPGYNFQPGSNTQSSGNTISESEIEPR  656



>emb|CAN64525.1| hypothetical protein VITISV_005912 [Vitis vinifera]
Length=690

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/575 (67%), Positives = 462/575 (80%), Gaps = 3/575 (1%)
 Frame = -2

Query  2323  QRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCK  2144
             +RQ ++ANF+ A+D +TPL+ +++Y +   G G+  V+ FGECM+DLSQ DCNLCFA CK
Sbjct  3     ERQTFIANFLEAMDQVTPLISTQRYADVTSGTGSTAVFLFGECMEDLSQNDCNLCFALCK  62

Query  2143  TQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRN  1964
             TQ+LRC+PFQ+  RGGR FYDGC++RYDDY FF+E+ S  DKTVCG +DF G+  +FR N
Sbjct  63    TQLLRCVPFQKSTRGGRSFYDGCYIRYDDYKFFDEALSAEDKTVCGTKDFSGDQTVFRAN  122

Query  1963  AAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCL  1784
             A  LV  L  +A  NDGFF  +V R N +VYGLAQCWEFV+G +C +CLA A S+IG C 
Sbjct  123   AIELVRNLSVEAPGNDGFFVGSVNRSNISVYGLAQCWEFVKGSACAECLANATSRIGLCP  182

Query  1783  PKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSV  1604
             PKEEGRVLNAGCY+RYST+KFYDNST     ++ G S+ L +IL  T  SFA LLI+   
Sbjct  183   PKEEGRVLNAGCYLRYSTQKFYDNSTSDFVEENEG-SSRLAIILGVTSSSFALLLIIAMT  241

Query  1603  AFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYK  1424
              F VRK+  K+R+ERK+LG +L TVNKSKLNFSYETLEKAT+YF  SNKLGQGGSG VYK
Sbjct  242   VFFVRKKRAKRRRERKQLGDLLATVNKSKLNFSYETLEKATNYFHHSNKLGQGGSGSVYK  301

Query  1423  GVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFV  1244
             G++PDGK VAIKRLFFN+ QW DHFFNEVNLISGI HKNLVKLLGCSITGPESLLVYE+V
Sbjct  302   GIMPDGKVVAIKRLFFNSRQWVDHFFNEVNLISGIDHKNLVKLLGCSITGPESLLVYEYV  361

Query  1243  PNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEE  1064
             PNQSL+DY   ++N  PL+WE RYKI+LG AEGLAYLHEE+ L IIHRDIKLSNVLLDE+
Sbjct  362   PNQSLHDYL-VKRNAPPLAWEMRYKILLGIAEGLAYLHEESMLRIIHRDIKLSNVLLDED  420

Query  1063  FTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVS  884
             F  KIADFGL RLFPEDK+HISTA+AGTLGYMAPEYVV+GKLTEK DVY FGVLVIEVV 
Sbjct  421   FAAKIADFGLARLFPEDKTHISTAIAGTLGYMAPEYVVRGKLTEKVDVYGFGVLVIEVVC  480

Query  883   GKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEERARVE-ATRQLQIGLVCVQASPE  707
             GK+N+SF Q S S+LQ  WNL+  G+LYEAVD SL    + + A+R L++GL+CVQAS E
Sbjct  481   GKRNNSFTQDSFSILQMVWNLYGTGRLYEAVDPSLGGNFQEDMASRVLKVGLLCVQASAE  540

Query  706   LRPSMSAVVKMISGDQDIPQPTQPPFLTSNSAASS  602
             LRPSMS VVKM++ + + PQPTQPPFL S +A SS
Sbjct  541   LRPSMSLVVKMLTENHETPQPTQPPFLNSGNAESS  575



>ref|XP_003519826.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Glycine max]
 gb|KHN00377.1| Cysteine-rich receptor-like protein kinase 3 [Glycine soja]
Length=648

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/618 (62%), Positives = 473/618 (77%), Gaps = 10/618 (2%)
 Frame = -2

Query  2440  SLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVD  2261
             S + +  +F+ + ++  +++DPRA+E A++CTN TAP  QRQA++ NF  AL+ALT LV 
Sbjct  2     SFASFFLIFLCYHAL-PALADPRATEVAVLCTNTTAPMPQRQAFLTNFYDALEALTALVT  60

Query  2260  SKKYGETVIGA--GNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLF  2087
              +KY   V G    NATVYAFGEC KDL++ DC++CFAQCKT++LRC PFQR + GG  F
Sbjct  61    RQKYAFVVKGTTQNNATVYAFGECRKDLTKPDCDVCFAQCKTRVLRCSPFQRGIDGGMFF  120

Query  2086  YDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFF  1907
             +DGCF+RYD Y FFNES S  D TVCG EDF GN  +++ N   LV  L  +A  N+GFF
Sbjct  121   FDGCFLRYDGYNFFNESLSPQDFTVCGTEDFSGNWSVYKANTVELVRNLSIEAPKNEGFF  180

Query  1906  TAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTK  1727
                V + N TVYGLAQCW+F+ G +C +CL  AV++I SC  K EG+ LNAGCY+RYST 
Sbjct  181   VGYVSQRNVTVYGLAQCWKFMNGSACQNCLVEAVTRIDSCASKAEGKALNAGCYLRYSTH  240

Query  1726  KFYD--NSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKR  1553
              FY+  N+ +P  NQ  G  N L +I+A    S A LLI+ +V F VR  ++K+R+ER++
Sbjct  241   NFYNSSNNNVPHENQ--GHKN-LAIIVAVASASLALLLIVATVVFFVRTNLLKRRRERRQ  297

Query  1552  LGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFN  1373
              GA+L TVNKSKLN  YE LEKATDYF  SNKLG+GGSG VYKGVLPDG T+AIKRL FN
Sbjct  298   FGALLNTVNKSKLNMPYEILEKATDYFSHSNKLGEGGSGSVYKGVLPDGNTMAIKRLSFN  357

Query  1372  TTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP  1193
             T+QWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPN SLYD+ S RKN Q 
Sbjct  358   TSQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNHSLYDHLSGRKNSQQ  417

Query  1192  LSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPED  1013
             L+WE R+KIILGTAEGLAYLHEE++  IIHRDIKL+N+L+D+ FTPKIADFGL RLFPED
Sbjct  418   LTWEVRHKIILGTAEGLAYLHEESQR-IIHRDIKLANILVDDNFTPKIADFGLARLFPED  476

Query  1012  KSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQ  833
             KSH+STA+ GTLGYMAPEYVV GKLTEKADVYSFGVL++E++SGKK+ SF + S S+LQ 
Sbjct  477   KSHLSTAICGTLGYMAPEYVVLGKLTEKADVYSFGVLIMEIISGKKSKSFVENSYSILQT  536

Query  832   HWNLFRAGKLYEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQD  656
              W+L+ + +L + VD  L+     +EA + L+IGL+C QAS ELRP MS VV+MI+ +  
Sbjct  537   VWSLYGSNRLCDIVDPILDGNYPEMEACKLLKIGLLCAQASAELRPPMSVVVEMINNNHG  596

Query  655   IPQPTQPPFLTSNSAASS  602
             I QPTQPPFL+ +SA  S
Sbjct  597   ITQPTQPPFLSCSSAEFS  614



>ref|XP_007153758.1| hypothetical protein PHAVU_003G062700g [Phaseolus vulgaris]
 gb|ESW25752.1| hypothetical protein PHAVU_003G062700g [Phaseolus vulgaris]
Length=655

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/655 (62%), Positives = 493/655 (75%), Gaps = 22/655 (3%)
 Frame = -2

Query  2419  LFIFFLSI--NRSVSDPRASEAALICTNRTAPQ-SQRQAYVANFVAALDALTPLVDSKKY  2249
               + FLS+    ++SDPRA  AAL+CTNR+    S+RQ +++NF+ A+DALTPL  +++ 
Sbjct  8     FLLLFLSVFAPLTLSDPRAQRAALLCTNRSVSSLSRRQVFISNFLEAMDALTPLTTTRQR  67

Query  2248  GETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFV  2069
             G  V G+GN TVYA GECMKDLSQ+DCN+C AQCKTQ+L CLPFQ+  +GGRLF+DGC++
Sbjct  68    GAVVKGSGNVTVYAMGECMKDLSQSDCNVCLAQCKTQLLACLPFQKGTQGGRLFFDGCYL  127

Query  2068  RYDDYVFFNESSSLSDKTVCGAE----------DFGGNSGLFRRNAAALVGELGRKAAAN  1919
             RYDDY FF ES    D TVCG            D   +SG+++ NA  LV  L   A  N
Sbjct  128   RYDDYNFFAESFGDQDTTVCGTNVSSKNSNNISDGAHSSGIYKANALELVRNLSEVAPKN  187

Query  1918  DGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMR  1739
             DGF+  +V + N +VYGLAQCWEFV G +C  CLA A ++I SC   +EGR LNAGCY+R
Sbjct  188   DGFWVGSVEKKNVSVYGLAQCWEFVNGSACKKCLADAATRIASC-ATQEGRALNAGCYLR  246

Query  1738  YSTKKFYDNST-IPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKE  1562
             +S  KFY+NST +  +   G RS  L  ILA T  + A LL++ +V F +RK +V +R+E
Sbjct  247   FSAHKFYNNSTDVAISGNHGQRS--LAKILAATTAALALLLVVATVVFFIRKNMVTRRRE  304

Query  1561  RKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRL  1382
             R++ GA+L  VNKS+LN SYE LEKATDYF+DSNKLGQGGSG VYKGV+PDG TVAIKRL
Sbjct  305   RRQFGALLDQVNKSRLNISYEILEKATDYFNDSNKLGQGGSGSVYKGVMPDGITVAIKRL  364

Query  1381  FFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKN  1202
              FNTTQW DHFFNEVNLIS I HKNLVKLLGCSITGPESLLVYE+VPNQSLYD+ S R+ 
Sbjct  365   RFNTTQWVDHFFNEVNLISDIQHKNLVKLLGCSITGPESLLVYEYVPNQSLYDHLSVRRI  424

Query  1201  HQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLF  1022
              QPLSWE R+KIILG AEGLAYLHEE+ L IIHRDIKLSN+LL+E+FTPKIADFGL RLF
Sbjct  425   SQPLSWEFRHKIILGIAEGLAYLHEESHLRIIHRDIKLSNILLEEDFTPKIADFGLARLF  484

Query  1021  PEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSL  842
             PED+SHIST +AGTLGYMAPEYV++GKL+EKADVYSFGVLVIE+VSGK+NSSF   S SL
Sbjct  485   PEDRSHISTVIAGTLGYMAPEYVIRGKLSEKADVYSFGVLVIEIVSGKRNSSFIMNSSSL  544

Query  841   LQQHWNLFRAGKLYEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG  665
             LQ  W L+ + +L E VD +LE      EA + LQIGL+C QA+ ELRPSMS VVKM++ 
Sbjct  545   LQTVWRLYGSNRLSEIVDPTLECPFPAEEACQLLQIGLLCAQATAELRPSMSVVVKMVNH  604

Query  664   DQDIPQPTQPPFLTSNSAASSGSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
             + +IPQPTQPPF+ S S+  S S    G      QP S+TQSS NTMTES I+PR
Sbjct  605   NHEIPQPTQPPFINSGSSELSRS----GLPGHNFQPESNTQSSANTMTESQIEPR  655



>ref|XP_008446185.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 3 [Cucumis melo]
Length=653

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/632 (63%), Positives = 480/632 (76%), Gaps = 4/632 (1%)
 Frame = -2

Query  2392  RSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATV  2213
             +S +DPRA+EAALIC+N TA  ++R  +VANF+ ++DA+TPL+ S+++   + G GN TV
Sbjct  25    QSSADPRATEAALICSNNTASPAERSTFVANFLDSMDAVTPLIASQRFAAVINGTGNTTV  84

Query  2212  YAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESS  2033
             YAFGECM DLSQ+DC+LCFAQ KTQILRCLPFQ   RGGRLFYDGC++RYD Y FFNES 
Sbjct  85    YAFGECMNDLSQSDCDLCFAQMKTQILRCLPFQLATRGGRLFYDGCYIRYDYYNFFNESL  144

Query  2032  SLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCW  1853
             S  D+TVCG  D+ GN  +F  +A  L   L   A  N+GF    V   N +VYGL QCW
Sbjct  145   SAVDRTVCGKLDYSGNRSVFSDSAMKLARNLSAVAPKNNGFAVGLVDFRNVSVYGLGQCW  204

Query  1852  EFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRS  1673
             +FVRG SC  CL  A  +IGSC PK EGRVLNAGCY RYST++FY N+T  AT     R 
Sbjct  205   KFVRGSSCSKCLVDAAKEIGSCPPKSEGRVLNAGCYFRYSTERFYFNTTATATG-GNNRR  263

Query  1672  NHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETL  1493
               L +ILA+   + A  LI+ +V F  R+R+V++RKE+++LG ++  VNKSKLNF YETL
Sbjct  264   RRLAIILASISAAVAAALIISTVLFCARRRVVRKRKEKRQLGPLVAIVNKSKLNFXYETL  323

Query  1492  EKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHH  1313
             EKAT+YFD SNKLGQGGSG VYKG L DG+ VAIKRLFFNT QW DHFFNEVNLISGI H
Sbjct  324   EKATNYFDQSNKLGQGGSGSVYKGTLSDGRVVAIKRLFFNTRQWVDHFFNEVNLISGIRH  383

Query  1312  KNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYL  1133
             KNLV LLGCSITGPESLLVYE+VPNQSL+DY    KN QPLSW  R+KI+LGTAEGLAYL
Sbjct  384   KNLVGLLGCSITGPESLLVYEYVPNQSLHDYLFGNKNVQPLSWGSRFKIVLGTAEGLAYL  443

Query  1132  HEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYV  953
             HEE+ + IIHRDIKLSN+LLD +FTPKIADFGL RL PEDK+HISTA+AGTLGYMAPEYV
Sbjct  444   HEESNVKIIHRDIKLSNILLDHDFTPKIADFGLARLLPEDKTHISTAIAGTLGYMAPEYV  503

Query  952   VQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLE-  776
             V+GKL+EKADVYSFGV  IEV++G++N  FYQ S S+LQ+ WNL+  G+LY AVD  L  
Sbjct  504   VRGKLSEKADVYSFGVFAIEVITGRRNGHFYQDSTSILQRVWNLYGEGRLYAAVDPILAG  563

Query  775   ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNSAASSGS  596
             +  R EA+R LQIGLVCVQA  +LRPSMS VVKM++ + +IPQP QPP+L  +S+ S   
Sbjct  564   DYPRDEASRLLQIGLVCVQAFADLRPSMSMVVKMLTANYEIPQPKQPPYLHPSSSGSMK-  622

Query  595   YPNRGGvtpysqpssstqssVNTMTESWIDPR  500
              P     +       ++++S N+MT+S IDPR
Sbjct  623   -PQNSSDSSNPNLYYNSRTSQNSMTQSIIDPR  653



>gb|KDO82322.1| hypothetical protein CISIN_1g008239mg [Citrus sinensis]
Length=573

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/565 (67%), Positives = 453/565 (80%), Gaps = 6/565 (1%)
 Frame = -2

Query  2287  LDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRL  2108
             +D +TPL+  ++Y   V G G A+VYAFGECMKDLS  DCNLCFAQCKTQ+L+CLPFQ  
Sbjct  1     MDIVTPLIARQRYAAVVNGTGTASVYAFGECMKDLSPNDCNLCFAQCKTQVLKCLPFQLA  60

Query  2107  VRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKA  1928
              RGGR+FYDGC++RYDDY FFNES S  D+TVCG++DFGGN+ +F  NA  LV  L  +A
Sbjct  61    TRGGRVFYDGCYLRYDDYDFFNESLSSQDRTVCGSKDFGGNNTVFGANAIELVRNLSVQA  120

Query  1927  AANDGFFTAAV--GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNA  1754
               NDGFF  +V   +GN +V+GLAQCWEFV G +C++CL  AVS+I SC  KEEGRVLNA
Sbjct  121   VKNDGFFVGSVTFSKGNVSVHGLAQCWEFVNGSACENCLENAVSRIASCTQKEEGRVLNA  180

Query  1753  GCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVK  1574
             GCY+RYST++FY+NS  P      G  N L VILAT+  + A LL+   VAF VR+++++
Sbjct  181   GCYLRYSTQRFYNNSG-PDPVPGNGGDNKLAVILATS--AVALLLVFSLVAFFVRRKLLQ  237

Query  1573  QRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVA  1394
             +R+ERK+LGA+ V VNKSKLNFSYETLEKAT+YF +SNKLGQGGSG VYKG LP G+ VA
Sbjct  238   KRRERKQLGALQVAVNKSKLNFSYETLEKATNYFHESNKLGQGGSGSVYKGTLPGGEAVA  297

Query  1393  IKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTS  1214
             +KRLF+NTTQW DHFFNEVNLISGI+HKNLVKLLGCSITGPESLLVYEFVPNQSL D   
Sbjct  298   VKRLFYNTTQWVDHFFNEVNLISGINHKNLVKLLGCSITGPESLLVYEFVPNQSLLDNLF  357

Query  1213  ARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGL  1034
              R++ +PLSWE RYKIIL TAEGLAYLHEE++L IIHRDIKLSN+LLDEEFT KIADFGL
Sbjct  358   VRQDVEPLSWEVRYKIILSTAEGLAYLHEESKLRIIHRDIKLSNILLDEEFTAKIADFGL  417

Query  1033  VRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQA  854
             VRLFPED +HIS  +AGTLGYMAPEYVV+GKLTEKADVYSFGV+VIEVV  K+ + F Q 
Sbjct  418   VRLFPEDITHISATLAGTLGYMAPEYVVRGKLTEKADVYSFGVVVIEVVCRKRINLFTQN  477

Query  853   SVSLLQQHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVK  677
             S S+LQ  W+L+  G+L+EAVD +L    +  + +R LQIGL+CVQAS ELRPSMS VVK
Sbjct  478   SCSILQTVWDLYVKGRLHEAVDPALAGNFQEGKPSRLLQIGLLCVQASAELRPSMSIVVK  537

Query  676   MISGDQDIPQPTQPPFLTSNSAASS  602
             M++G+ +I QPTQPPFL  N +  S
Sbjct  538   MLTGNHEILQPTQPPFLNPNGSEIS  562



>ref|XP_009392180.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Musa 
acuminata subsp. malaccensis]
Length=655

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/613 (60%), Positives = 469/613 (77%), Gaps = 13/613 (2%)
 Frame = -2

Query  2425  LFLFIFFLS----INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDS  2258
              FL +  +S    I  S+SDPR S+AALICTN TA  + R ++VANF++A+DA+TP + +
Sbjct  12    FFLMVVVISSATLITPSLSDPRTSQAALICTNHTASAAARSSFVANFLSAMDAVTPQITA  71

Query  2257  KKYGETVIGAGN-----ATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGR  2093
             ++Y   V+  G+     + VYAFG+CMKDLS+ DC++CFA CKTQIL+CLPFQ+  RGGR
Sbjct  72    RQYARVVVTGGSNPDNASAVYAFGQCMKDLSKADCDMCFATCKTQILKCLPFQKATRGGR  131

Query  2092  LFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDG  1913
              F DGC++RYD+Y FF E+ S  D+ +C  ++F GN+  F  N   LV +L  +A  NDG
Sbjct  132   NFLDGCYLRYDEYEFFGEALSQDDRVICSDQEFAGNTTAFTENTKNLVKKLSTEAPRNDG  191

Query  1912  FFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYS  1733
             F   +V  GNS+VYGL QCWEFV   SC+ CL  A   I SC+PK+EGRVLN+GCYMRYS
Sbjct  192   FLVGSVEAGNSSVYGLGQCWEFVNKSSCEKCLLNARKTINSCIPKQEGRVLNSGCYMRYS  251

Query  1732  TKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKR  1553
               +FY+NS    T+ +GG   HL VILA    + AF++IL S+ F  +++I+++RK R++
Sbjct  252   ISRFYNNS---GTDAAGGGGGHLAVILAVVSSAVAFVMILASIIFFGKRKILQRRKVRRQ  308

Query  1552  LGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFN  1373
             LGA+  T+ +S LNF YETLE+AT+YF D+NKLGQGGSG V+KGVLPDG++VA+KRLFFN
Sbjct  309   LGALATTIRRSSLNFKYETLERATNYFSDANKLGQGGSGSVFKGVLPDGRSVAVKRLFFN  368

Query  1372  TTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP  1193
             T QW D FFNEVNLISG+ HKNLVKLLGCS+TGPESLLVYE+VPN+SL+ Y S   N + 
Sbjct  369   TRQWVDQFFNEVNLISGLEHKNLVKLLGCSVTGPESLLVYEYVPNKSLHHYLSDNANAKL  428

Query  1192  LSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPED  1013
             LSW  RYKII+GTAEGLAYLHEE++L IIHRDIKLSN+LLDEE+  KIADFGL RLFPED
Sbjct  429   LSWNIRYKIIMGTAEGLAYLHEESQLRIIHRDIKLSNILLDEEYAAKIADFGLARLFPED  488

Query  1012  KSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQ  833
             K+HIST +AGTLGYMAPEY+V+G+LTEKAD++SFGVL+IEV++G++NSS  +  +S LQ+
Sbjct  489   KTHISTGIAGTLGYMAPEYLVRGRLTEKADIFSFGVLLIEVITGRRNSSRSEDPISTLQE  548

Query  832   HWNLFRAGKLYEAVDGSLEERARVE-ATRQLQIGLVCVQASPELRPSMSAVVKMISGDQD  656
              WNL+ + +L EA+D  LE    +E ATR LQIGL+C QAS ELRP++S VVKM+  D  
Sbjct  549   VWNLYTSNRLLEAIDPILEGNFPMEKATRVLQIGLLCAQASAELRPAISMVVKMLVDDSP  608

Query  655   IPQPTQPPFLTSN  617
             IP PTQPPFL S+
Sbjct  609   IPSPTQPPFLNSS  621



>ref|NP_177210.1| cysteine-rich receptor-like protein kinase 3 [Arabidopsis thaliana]
 sp|Q9CAL2.1|CRK3_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 3; Short=Cysteine-rich 
RLK3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG52470.1|AC010796_9 putative protein kinase; 41292-38663 [Arabidopsis thaliana]
 gb|AEE35075.1| cysteine-rich receptor-like protein kinase 3 [Arabidopsis thaliana]
Length=646

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/615 (60%), Positives = 470/615 (76%), Gaps = 18/615 (3%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             SVSD R    A IC NRT    QR  +V NF+AA+DA++PLV++K YG+ V G GN TVY
Sbjct  18    SVSDSRGDTVAQICNNRTTTPQQRSLFVTNFLAAMDAVSPLVEAKGYGQVVNGTGNLTVY  77

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSS  2030
             A+GEC+KDL + DC+LCFAQ K ++ RCLPFQ+  RGG++F DGC++RYDDY F+NE+ S
Sbjct  78    AYGECIKDLDKKDCDLCFAQIKAKVPRCLPFQKGTRGGQVFSDGCYIRYDDYNFYNETLS  137

Query  2029  LSDKTVCGAEDFGG-NSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCW  1853
             L D+TVC  ++  G N  +FR NAA LV  +  +A  N GF+   V R N TV+GLAQCW
Sbjct  138   LQDRTVCAPKEITGVNRTVFRDNAAELVKNMSVEAVRNGGFYAGFVDRHNVTVHGLAQCW  197

Query  1852  EFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRS  1673
             E +    C +CL+ A  +IGSCL  EEGRVL+AGCYMR+ST+KFY+NS    ++ +GG  
Sbjct  198   ETLNRSGCVECLSKASVRIGSCLVNEEGRVLSAGCYMRFSTQKFYNNSGNSTSDGNGGH-  256

Query  1672  NHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETL  1493
             NHL VILA T    AF+L++ +  F+++KR  K+++E+K+LG++ +  NKS L FSYE L
Sbjct  257   NHLGVILAVTSSVVAFVLLVSAAGFLLKKRHAKKQREKKQLGSLFMLANKSNLCFSYENL  316

Query  1492  EKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHH  1313
             E+ATDYF D NKLGQGGSG VYKGVL +GKTVA+KRLFFNT QW DHFFNEVNLIS + H
Sbjct  317   ERATDYFSDKNKLGQGGSGSVYKGVLTNGKTVAVKRLFFNTKQWVDHFFNEVNLISQVDH  376

Query  1312  KNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYL  1133
             KNLVKLLGCSITGPESLLVYE++ NQSL+DY   RK+ QPL+W +R+KIILGTAEG+AYL
Sbjct  377   KNLVKLLGCSITGPESLLVYEYIANQSLHDYLFVRKDVQPLNWAKRFKIILGTAEGMAYL  436

Query  1132  HEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYV  953
             HEE+ L IIHRDIKLSN+LL+++FTP+IADFGL RLFPEDK+HISTA+AGTLGYMAPEYV
Sbjct  437   HEESNLRIIHRDIKLSNILLEDDFTPRIADFGLARLFPEDKTHISTAIAGTLGYMAPEYV  496

Query  952   VQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEE  773
             V+GKLTEKADVYSFGVL+IEV++GK+N++F Q + S+LQ  W+L+R   + EAVD  L +
Sbjct  497   VRGKLTEKADVYSFGVLMIEVITGKRNNAFVQDAGSILQSVWSLYRTSNVEEAVDPILGD  556

Query  772   R-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFL----------  626
                ++EA+R LQIGL+CVQA+ + RP+MS VVKM+ G  +I  PTQPPFL          
Sbjct  557   NFNKIEASRLLQIGLLCVQAAFDQRPAMSVVVKMMKGSLEIHTPTQPPFLNPGSVVEMRK  616

Query  625   -----TSNSAASSGS  596
                  T+N + SSGS
Sbjct  617   MMMTPTTNQSNSSGS  631



>ref|XP_006584462.1| PREDICTED: protein kinase family protein isoform X1 [Glycine 
max]
Length=657

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/642 (63%), Positives = 490/642 (76%), Gaps = 20/642 (3%)
 Frame = -2

Query  2383  SDPRASEAALICTNRTA-PQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYA  2207
             SDPRA  AAL+CTNRT    S+RQ +VANF+AA+DALTPL  S  +G    G+ NATV+A
Sbjct  22    SDPRAQRAALLCTNRTVLSLSRRQVFVANFLAAMDALTPLTTSHGHGAVFNGSQNATVFA  81

Query  2206  FGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSL  2027
             FGECM+DLSQ DCNLC AQCKTQ+L CLPFQR  RGGRLF+DGC++RYDDY FF E+ S 
Sbjct  82    FGECMRDLSQNDCNLCLAQCKTQLLACLPFQRGTRGGRLFFDGCYLRYDDYNFFGETRSD  141

Query  2026  SDKTVCGAEDFGGNS------------GLFRRNAAALVGELGRKAAANDGFFTAAVGRGN  1883
              D TVCG      NS            G+++ NA ALV  L   A  NDGFF  +V R N
Sbjct  142   QDTTVCGNNSSNNNSNSAANSATNSSSGVYKANAMALVRNLSGLAPKNDGFFVGSVERKN  201

Query  1882  STVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTI  1703
              +VYGLAQCWEFV G +C+ CLA AV++IGSC   +E R L+AGCY+RYS++KFY+NS+ 
Sbjct  202   VSVYGLAQCWEFVNGSACERCLADAVTRIGSC-STQEARALSAGCYLRYSSQKFYNNSSD  260

Query  1702  PATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNK  1523
               T    G+   L  ILA +  + A LL++ +V F  RK +V +R+ER++ GA+L TVNK
Sbjct  261   VVTAGKHGKRT-LVKILAASSAALALLLVVVTVVFFTRKNVVTRRRERRQFGALLATVNK  319

Query  1522  SKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFN  1343
             SKLN  YE LEKAT+YF+++NKLGQGGSG VYKGV+PDG TVAIKRL +NTTQWA+HFF 
Sbjct  320   SKLNMPYEVLEKATNYFNEANKLGQGGSGSVYKGVMPDGNTVAIKRLSYNTTQWAEHFFT  379

Query  1342  EVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKII  1163
             EVNLISGIHHKNLVKLLGCSITGPESLLVYE+VPNQSL+D+ S R+  QPL+WE R KII
Sbjct  380   EVNLISGIHHKNLVKLLGCSITGPESLLVYEYVPNQSLHDHFSVRRTSQPLTWEMRQKII  439

Query  1162  LGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAG  983
             LG AEG+AYLHEE+ + IIHRDIKLSN+LL+E+FTPKIADFGL RLFPEDKSHISTA+AG
Sbjct  440   LGIAEGMAYLHEESHVRIIHRDIKLSNILLEEDFTPKIADFGLARLFPEDKSHISTAIAG  499

Query  982   TLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKL  803
             TLGYMAPEY+V+GKLTEKADVYSFGVLVIE+VSGKK SS+   S SLLQ  W+L+ + +L
Sbjct  500   TLGYMAPEYIVRGKLTEKADVYSFGVLVIEIVSGKKISSYIMNSSSLLQTVWSLYGSNRL  559

Query  802   YEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFL  626
             YE VD +LE      EA + LQIGL+C QAS ELRPSMS VVKM++ + +IPQP QPPF+
Sbjct  560   YEVVDPTLEGAFPAEEACQLLQIGLLCAQASAELRPSMSVVVKMVNNNHEIPQPAQPPFI  619

Query  625   TSNSAASSGSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
              S+S+  S S    G      QP S+TQSS NT++ES I+PR
Sbjct  620   NSSSSEFSKS----GLPGYNFQPGSNTQSSGNTISESQIEPR  657



>ref|XP_002888786.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65045.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=649

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/619 (60%), Positives = 473/619 (76%), Gaps = 19/619 (3%)
 Frame = -2

Query  2398  INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGA-GN  2222
             IN SVSD R +  A IC+NRT P  QR  +V  F+AA+DA++PLV++K YG+ V  A GN
Sbjct  17    INPSVSDSRGATVAQICSNRTTPPQQRSLFVKTFLAAMDAVSPLVEAKGYGQVVNNANGN  76

Query  2221  ATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFN  2042
              TVYA+GEC+KDL++ DC+LCFAQ K ++  CLPFQR  RGG++F DGC++RYDDY FFN
Sbjct  77    LTVYAYGECIKDLNKKDCDLCFAQIKAKVPICLPFQRGTRGGQVFSDGCYIRYDDYNFFN  136

Query  2041  ESSSLSDKTVCGAEDFGG-NSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGL  1865
             E+  L D+TVC  ++  G N  +FR NAA LV  +  +A  N GF+   V R N TV+GL
Sbjct  137   ETLGLQDRTVCAPKEITGVNRTVFRDNAAELVKNMSVEAVRNGGFYAGFVDRHNVTVHGL  196

Query  1864  AQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQS  1685
             AQCWE +    C +CL+ A   IGSCL  EEGRVL+AGCYMR+ST+KFY+NS    ++ +
Sbjct  197   AQCWETLNRSGCVECLSKASVSIGSCLVNEEGRVLSAGCYMRFSTQKFYNNSGNSTSDGN  256

Query  1684  GGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFS  1505
             GG  NHL VILA T    AF+L++ +  F+++KR  K+++E+K+LG++ +  NKS L FS
Sbjct  257   GGH-NHLGVILAVTSSVVAFVLLVSAAGFLLKKRHAKKQREKKQLGSLFMLANKSNLCFS  315

Query  1504  YETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLIS  1325
             YE LE+ATDYF D NKLGQGGSG VYKGVL +GKTVA+KRLFFNT QW DHFFNEVNLIS
Sbjct  316   YENLERATDYFSDKNKLGQGGSGSVYKGVLTNGKTVAVKRLFFNTKQWVDHFFNEVNLIS  375

Query  1324  GIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEG  1145
              ++HKNLVKLLGCSITGPESLLVYE++ NQSL+DY   RK+ QPL+W +R+KIILGTAEG
Sbjct  376   QVNHKNLVKLLGCSITGPESLLVYEYIANQSLHDYLFVRKDVQPLNWAKRFKIILGTAEG  435

Query  1144  LAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMA  965
             +AYLHEE+ L IIHRDIKLSN+LL+++FTP+IADFGL RLFPEDK+HISTA+AGTLGYMA
Sbjct  436   MAYLHEESNLRIIHRDIKLSNILLEDDFTPRIADFGLARLFPEDKTHISTAIAGTLGYMA  495

Query  964   PEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDG  785
             PEYVV+GKLTEKADVYSFGVL+IEV++GK+N++F Q + S+LQ  W+L+R   L EAVD 
Sbjct  496   PEYVVRGKLTEKADVYSFGVLMIEVITGKRNNAFVQEAGSILQTVWSLYRTRNLEEAVDP  555

Query  784   SLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFL------  626
              L +   ++EA+R LQIGL+CVQA+ + RP+MS VVKM+ G  +I  PTQPPFL      
Sbjct  556   ILGDNFNKIEASRLLQIGLLCVQAAFDQRPAMSTVVKMMKGSLEIHTPTQPPFLNPGSVV  615

Query  625   ---------TSNSAASSGS  596
                      T+N + SSGS
Sbjct  616   EMRKMMMTPTTNQSNSSGS  634



>ref|XP_010471049.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Camelina 
sativa]
Length=654

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/620 (60%), Positives = 471/620 (76%), Gaps = 19/620 (3%)
 Frame = -2

Query  2398  INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIG--AG  2225
             IN SVSD R    + IC+NRT+P  QR  +V+ F+AA+D+++PLV++K YG+ V      
Sbjct  20    INPSVSDSRGETVSQICSNRTSPPQQRSLFVSTFLAAMDSVSPLVEAKGYGQVVNRNVTA  79

Query  2224  NATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFF  2045
             N TVYA+GECMKDLS+ DC+LCFAQ K ++ RCLPFQ+  RGG++F DGC++RYDDY FF
Sbjct  80    NQTVYAYGECMKDLSKKDCDLCFAQIKAKVPRCLPFQKGTRGGQVFSDGCYIRYDDYNFF  139

Query  2044  NESSSLSDKTVCGAEDFGG-NSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYG  1868
             NE+ SL D++ C  ++  G N  +FR NAA LV  +  +A  N GF+   V R N TV+G
Sbjct  140   NETVSLRDESKCAPKEITGVNRTVFRDNAAVLVRNMRVEAVRNGGFYAGFVDRDNVTVHG  199

Query  1867  LAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQ  1688
             LAQCWE V    C  CL+ A   IGSCL  EEGR L+ GCYMR+ST+KFY+NS    ++ 
Sbjct  200   LAQCWETVNRSGCAQCLSKASVGIGSCLVNEEGRFLSVGCYMRFSTQKFYNNSGNSTSDG  259

Query  1687  SGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNF  1508
             +GG  N L VILA T    AF+L++ +V F+ +KR  K+++E+K+LG++ +  NKS L F
Sbjct  260   NGGGHNRLGVILAVTSSVVAFVLLVSAVGFLFKKRHAKKQREKKQLGSLFMLANKSNLCF  319

Query  1507  SYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLI  1328
             SYE LEKATDYF D NKLGQGGSG VYKGVL +GKTVA+KRLFFNT QW DHFFNEVNLI
Sbjct  320   SYENLEKATDYFSDKNKLGQGGSGSVYKGVLTNGKTVAVKRLFFNTKQWVDHFFNEVNLI  379

Query  1327  SGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAE  1148
             S + HKNLVKLLGCSITGPESLLVYE++ NQSL+DY   RK+ QPLSW +R+KI+LGTAE
Sbjct  380   SQVDHKNLVKLLGCSITGPESLLVYEYIANQSLHDYLFVRKDVQPLSWGKRFKILLGTAE  439

Query  1147  GLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYM  968
             G+AYLHEE+ L IIHRDIKLSN+LL+++FTP+IADFGL RLFPEDK+HISTA+AGTLGYM
Sbjct  440   GMAYLHEESNLRIIHRDIKLSNILLEDDFTPRIADFGLARLFPEDKTHISTAIAGTLGYM  499

Query  967   APEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVD  788
             APEYVV+GKLTEKADVYSFGVL+IEV++GK+N++F Q + S+LQ  W+L+R   L EAVD
Sbjct  500   APEYVVRGKLTEKADVYSFGVLMIEVITGKRNNAFVQEAGSILQTVWSLYRTRNLEEAVD  559

Query  787   GSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFL-----  626
               LE+   ++EA+R LQIGL+CVQA+ + RP+MSAVVKM+ G+ +I  PTQPPFL     
Sbjct  560   PILEDNFNKIEASRLLQIGLLCVQAAFDQRPAMSAVVKMMKGNLEIHTPTQPPFLNPGNV  619

Query  625   ----------TSNSAASSGS  596
                       T+N + SSGS
Sbjct  620   VEMRKFMMTPTTNQSNSSGS  639



>ref|XP_011045283.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 isoform 
X2 [Populus euphratica]
Length=563

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/569 (71%), Positives = 451/569 (79%), Gaps = 10/569 (2%)
 Frame = -2

Query  2194  MKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLSDKT  2015
             MKDL  TDCNLCFAQCKTQ+LRCLPFQR  RGGRLFYDGC++RYDDY FFNE+ S  DKT
Sbjct  1     MKDLDGTDCNLCFAQCKTQVLRCLPFQRATRGGRLFYDGCYLRYDDYDFFNETLSTQDKT  60

Query  2014  VCGAEDF-GGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRG  1838
             +C + DF GGN  +F  N   LV  L   A  NDGF+  +V RGN +V+GLAQCWEFV G
Sbjct  61    ICASGDFSGGNKTVFSANVLELVRNLSVAAPKNDGFYVGSVDRGNVSVFGLAQCWEFVNG  120

Query  1837  KSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIP-ATNQSGGRSNHLP  1661
              +C+ CL  AVS+IGSC PKEEGR LNAGCY+RYST+KFYDNST P   N+S GR   L 
Sbjct  121   SACETCLTNAVSRIGSCTPKEEGRALNAGCYLRYSTQKFYDNSTSPIGRNKSRGR---LT  177

Query  1660  VILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKAT  1481
             VILA T  S A  L++ +  F VR+R+V++R+ RK LGA+LVTVNKSKLNFSYE+LEKAT
Sbjct  178   VILAVTSSSVAVALMIATTVFFVRRRVVEKRRARKELGALLVTVNKSKLNFSYESLEKAT  237

Query  1480  DYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLV  1301
             +YF  SNKLGQGGSG VYKG L DG TVAIKRL FNT QW DHFFNEVNLISGI HKNL 
Sbjct  238   NYFHLSNKLGQGGSGSVYKGTLSDGTTVAIKRLLFNTRQWVDHFFNEVNLISGIQHKNLA  297

Query  1300  KLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEET  1121
             KLLGCSITGPESLLVYE+VPNQSL+DY SA+ N  PLSW  RY IILGTAEGLAYLHEE+
Sbjct  298   KLLGCSITGPESLLVYEYVPNQSLHDYFSAKMNLPPLSWAMRYNIILGTAEGLAYLHEES  357

Query  1120  ELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGK  941
             EL IIHRDIKLSNVLLDE+F PKIADFGL RLFPEDKSHISTA+AGTLGYMAPEYVV+GK
Sbjct  358   ELRIIHRDIKLSNVLLDEDFNPKIADFGLARLFPEDKSHISTAIAGTLGYMAPEYVVRGK  417

Query  940   LTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEERARV  761
             LTEK DVYSFGVLVIEVVSGK   S  Q S S+LQ+ W+L   G+L EAVD  LE   + 
Sbjct  418   LTEKVDVYSFGVLVIEVVSGKGKDSVPQDSRSILQKVWSLHGNGRLCEAVDPVLEGNFQE  477

Query  760   -EATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNSAASSGSYPNR  584
              EA+R LQIGL+CVQASPELRPSMS +VKMI+   +IPQPTQPPFL   S A+  S P R
Sbjct  478   DEASRLLQIGLLCVQASPELRPSMSIIVKMINDSHEIPQPTQPPFL---SPATMESSPFR  534

Query  583   G-GvtpysqpssstqssVNTMTESWIDPR  500
               G T  SQP SSTQSS N+MT+SWI+PR
Sbjct  535   QPGSTYKSQPESSTQSSGNSMTQSWIEPR  563



>ref|XP_010552664.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Tarenaya 
hassleriana]
Length=653

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/651 (59%), Positives = 480/651 (74%), Gaps = 9/651 (1%)
 Frame = -2

Query  2446  MASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPL  2267
             +AS+S  L L I    +N ++SD R +   LIC+NRT+    R  Y+ NF+AA+DA++P 
Sbjct  10    VASISVLLLLGIL---VNPTISDSRGTTVGLICSNRTSAAEDRNVYIDNFLAAMDAVSPP  66

Query  2266  VDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLF  2087
             V +  Y     G GN TVYA+GEC+KDL + DC+LCFAQ KTQ+ RCLPFQR  RG R+F
Sbjct  67    VATDGYARVNRGGGNNTVYAYGECLKDLDKKDCDLCFAQIKTQVPRCLPFQRATRGARVF  126

Query  2086  YDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGG-NSGLFRRNAAALVGELGRKAAANDGF  1910
              DGC++RYDDY F+NE+ S  D+TVC      G N  +F  NAA LV  +  +A  N GF
Sbjct  127   SDGCYIRYDDYPFYNETVSPEDRTVCANNTVTGLNQTVFGENAAELVRNMSVQAV-NGGF  185

Query  1909  FTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYST  1730
             +   V R N TV+GLAQCWE +    C  CL  A + I SC  +EEGR LNAGCYMR+ST
Sbjct  186   YAGFVDRQNVTVHGLAQCWEPLNRSGCQHCLGKAANAIASCFVREEGRSLNAGCYMRFST  245

Query  1729  KKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRL  1550
             +KFY+NS   ++  + GR NHL V LA T    AF+L+  +V F ++K++ ++R+E+K+L
Sbjct  246   QKFYNNSGDSSSGGNNGR-NHLAVALAVTSSVVAFVLVASAVTFFLKKKLARKRREKKQL  304

Query  1549  GAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNT  1370
             G++    N S L FSYETLEKAT+YF  SNKLGQGGSG VYKG+LPDGKTVA+KRLFFNT
Sbjct  305   GSLFRMANNSSLCFSYETLEKATNYFSHSNKLGQGGSGSVYKGILPDGKTVAVKRLFFNT  364

Query  1369  TQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPL  1190
              QW DHFFNEVNLIS I HKNLVKLLGCS+TGPESLLVYE+V NQSLYDY   RK+ +PL
Sbjct  365   RQWVDHFFNEVNLISRIQHKNLVKLLGCSLTGPESLLVYEYVGNQSLYDYLFVRKDVEPL  424

Query  1189  SWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDK  1010
             SWE+R KIIL  AEGLAYLHEE+ L IIHRDIKLSNVLLD +FTPKIADFGL RLFPED+
Sbjct  425   SWEKRIKIILEIAEGLAYLHEESNLRIIHRDIKLSNVLLDYDFTPKIADFGLARLFPEDQ  484

Query  1009  SHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQH  830
             SHISTAVAGTLGYMAPEY+V+GKLTEKADVYSFGVL+IEV+SG++N++F Q S S+LQ  
Sbjct  485   SHISTAVAGTLGYMAPEYIVRGKLTEKADVYSFGVLMIEVISGRRNNAFSQNSSSILQMV  544

Query  829   WNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDI  653
             W+L+    L EAVD  + +   V EA R ++IGL+CVQA+ + RP+MS+VVKM++G ++I
Sbjct  545   WSLYGTRTLREAVDPIMGDNFDVEEAKRVMKIGLLCVQAAFDQRPAMSSVVKMMTGREEI  604

Query  652   PQPTQPPFLTSNSAASSGSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
             P+PTQPPFL + SA SS  +          +  S + +S N++TES++DPR
Sbjct  605   PEPTQPPFLNTASAESSRVFS--PTSYLPHKDQSQSSASRNSITESFMDPR  653



>ref|XP_010044591.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Eucalyptus 
grandis]
Length=648

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/649 (60%), Positives = 477/649 (73%), Gaps = 8/649 (1%)
 Frame = -2

Query  2443  ASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLV  2264
             AS+   +F  +FF ++   + DPRA+EAALIC+NRT P   R+A+ ++   A+DA++P +
Sbjct  7     ASVPLVVFSVLFFAAL--CLCDPRANEAALICSNRTTPLPDRRAFASSVAEAMDAVSPQI  64

Query  2263  DSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFY  2084
             ++++Y   V GAGN TVYAF ECM+DL + DC+LC A+ K QILRCLPFQ   RGGRLFY
Sbjct  65    NARQYASAVGGAGNNTVYAFAECMEDLDRIDCDLCVARAKVQILRCLPFQWGTRGGRLFY  124

Query  2083  DGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFT  1904
             DGC++RYDDY FFNES S  D TVCG  DFGGN  +F  N   L   L  +A  N GF  
Sbjct  125   DGCYLRYDDYNFFNESLSPQDTTVCGTGDFGGNQAMFMNNVVELGRNLSLQAPINGGFSV  184

Query  1903  AAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKK  1724
              +V RGN +VYGLAQCW+ V G  C +CL     +I SC PKEEGR LNAGCY  YST+K
Sbjct  185   GSVIRGNVSVYGLAQCWKLVNGSECQNCLNNTAVRIDSCPPKEEGRGLNAGCYFMYSTEK  244

Query  1723  FYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGA  1544
             FY NST P     G R     +ILA    + A LLI+   AF++R+++V++ +E+K+LG 
Sbjct  245   FYYNSTEPFRRDEGERR---LIILAAVSSTLALLLIIALAAFLIRRKLVRKTREKKQLGL  301

Query  1543  MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQ  1364
             ++  VN SK NFSYE LEKAT YF  S+KLGQGGSG VYKG+LPDGK VAIKRL FNTTQ
Sbjct  302   LVDVVNNSKRNFSYELLEKATSYFHQSSKLGQGGSGSVYKGILPDGKPVAIKRLVFNTTQ  361

Query  1363  WADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSW  1184
             W DHFFNEVNLIS I HKNLVKLLGCSITGPESLLVYE++PN SL+D+  A+KN  PLSW
Sbjct  362   WVDHFFNEVNLISDIDHKNLVKLLGCSITGPESLLVYEYIPNLSLHDHLFAKKNVPPLSW  421

Query  1183  EQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSH  1004
             E R KIILGTAEGLAYLHEE+ L IIHRDIKL+NVLLD++FTPKIADFGL RLFPED +H
Sbjct  422   ETRCKIILGTAEGLAYLHEESNLRIIHRDIKLTNVLLDKDFTPKIADFGLARLFPEDATH  481

Query  1003  ISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWN  824
             IST VAGTLGY+APEYVV+GKLT+K DVYS+GVL++EV+SGKKN +F ++S S+LQ  WN
Sbjct  482   ISTGVAGTLGYLAPEYVVRGKLTDKVDVYSYGVLMMEVLSGKKNYTFSESSCSILQMVWN  541

Query  823   LFRAGKLYEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQ  647
              + +G+L+EA+D  LE +    E +R LQIGL+CVQAS ELRPSMS VVKM+    ++P 
Sbjct  542   QYGSGRLFEAIDPILEGQFQEEEVSRLLQIGLLCVQASAELRPSMSVVVKMLKESSELPT  601

Query  646   PTQPPFLTSNSAASSGSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
             PTQPPFL  NS+ S+    +          S +  +   TMTESWI+PR
Sbjct  602   PTQPPFL--NSSRSTECSRHMSEPNSSFHLSDTQSTGNATMTESWIEPR  648



>ref|XP_006390874.1| hypothetical protein EUTSA_v10018240mg [Eutrema salsugineum]
 gb|ESQ28160.1| hypothetical protein EUTSA_v10018240mg [Eutrema salsugineum]
Length=660

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/636 (59%), Positives = 473/636 (74%), Gaps = 5/636 (1%)
 Frame = -2

Query  2395  NRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNAT  2216
             N  +SD R    A IC+NRT    QR  +V +F+AA+DA++PLV++K YG+ V G GN T
Sbjct  26    NPVISDSRGETVAQICSNRTTIPQQRSLFVTSFLAAMDAVSPLVEAKGYGQVVNGTGNLT  85

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             VYA+GECMKDL + DC+LCFAQ K ++ RC PFQR  RGG++F DGC++RYDDY FFNE+
Sbjct  86    VYAYGECMKDLDKKDCDLCFAQIKAKVPRCRPFQRGTRGGQVFSDGCYIRYDDYNFFNET  145

Query  2035  SSLSDKTVCGAEDFGG-NSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQ  1859
              SL D+TVC  ++  G N  LFR NAA LV  +  +A  N GF+   V R N TV+GLAQ
Sbjct  146   LSLQDRTVCAEKEITGVNRTLFRDNAAELVRNMSVEAVRNGGFYAGFVERRNVTVHGLAQ  205

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGG  1679
             CWE +    C +CL  A  KIGSCL KEEGRVLNAGCYMR+ST+KFY+NS    ++ +GG
Sbjct  206   CWEPLNRSGCVECLRKASEKIGSCLDKEEGRVLNAGCYMRFSTQKFYNNSGNSTSDGNGG  265

Query  1678  RSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYE  1499
             R N L VILA T    AF+L++    F+ +K+  K+++E+K+LG++ +  NKS L FSYE
Sbjct  266   R-NRLAVILAVTSSVVAFVLLVSVAGFLFKKKRAKKQREKKQLGSLFMLANKSNLCFSYE  324

Query  1498  TLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGI  1319
              LE+ATDYF D NKLGQGGSG VYKGVL +GKTVA+KRLFFNT QW DHFFNEVNLIS I
Sbjct  325   NLERATDYFSDKNKLGQGGSGSVYKGVLTNGKTVAVKRLFFNTKQWVDHFFNEVNLISQI  384

Query  1318  HHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLA  1139
              HKNLVKLLGCSITGPESLLVYE++ NQSL+DY   R++ QPL+W +R+KI+LGTAEG+A
Sbjct  385   DHKNLVKLLGCSITGPESLLVYEYIANQSLHDYLFVRQDVQPLNWAKRFKILLGTAEGMA  444

Query  1138  YLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPE  959
             YLHEE+ L IIHRDIKLSN+LL+ +FTP+IADFGL RLFPEDK+HISTA+AGTLGYMAPE
Sbjct  445   YLHEESNLRIIHRDIKLSNILLEHDFTPRIADFGLARLFPEDKTHISTAIAGTLGYMAPE  504

Query  958   YVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSL  779
             YVV+GKLTEKADVYSFGVL+IEV++G++N++  Q + S+LQ  W+L+    L + VD  L
Sbjct  505   YVVRGKLTEKADVYSFGVLMIEVITGRRNNALSQDASSILQTVWSLYGTSNLTKVVDPIL  564

Query  778   EER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNSAASS  602
              +    +EA+R LQIGL+CVQA+ + RP+MSAVVKM+ G+ +I  PTQPPFL   S A  
Sbjct  565   GDNFNEIEASRLLQIGLLCVQAAFDQRPAMSAVVKMMKGNLEIQTPTQPPFLNPGSVAEM  624

Query  601   GSYPNRGGvtpysqpssstq--ssVNTMTESWIDPR  500
                 +    T   Q   +    S  N ++ES+ +PR
Sbjct  625   RKMMSHSHTTDSHQQDQTQSSGSRSNIISESFFEPR  660



>ref|XP_010427831.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Camelina 
sativa]
Length=651

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/620 (60%), Positives = 470/620 (76%), Gaps = 19/620 (3%)
 Frame = -2

Query  2398  INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIG--AG  2225
             IN SVSD R    + IC+NRT+P  QR  +V+ F+AA+D+++PLV++K YG+ V      
Sbjct  17    INPSVSDSRGETVSQICSNRTSPPQQRSLFVSTFLAAMDSVSPLVEAKGYGQVVNRNVTA  76

Query  2224  NATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFF  2045
             N TVYA+GECMKDLS+ DC+LCFAQ K ++ RCLPFQ+  RGG++F DGC++RYDDY FF
Sbjct  77    NQTVYAYGECMKDLSKKDCDLCFAQIKAKVPRCLPFQKGTRGGQVFSDGCYIRYDDYSFF  136

Query  2044  NESSSLSDKTVCGAEDFGG-NSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYG  1868
             NE+ SL D++ C  ++  G N  +FR NAA LV  +  +A  N GF+   V R N TV+G
Sbjct  137   NETVSLRDESKCAPKEITGVNRTVFRDNAAVLVRNMRVEAVRNGGFYAGFVDRDNVTVHG  196

Query  1867  LAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQ  1688
             LAQCWE +    C  CL+ A  +IGSC   EEGR L+ GCYMR+ST+KFY+NS    ++ 
Sbjct  197   LAQCWETLNRSGCAQCLSKASVRIGSCFVNEEGRFLSVGCYMRFSTQKFYNNSGNSTSDG  256

Query  1687  SGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNF  1508
             +GG  N L VILA T    AF+L++ +V F+ +KR  K+++E+K+LG++ +  NKS L F
Sbjct  257   NGGGHNRLGVILAVTSSVVAFVLLVSAVGFLFKKRHAKKQREKKQLGSLFMLANKSNLCF  316

Query  1507  SYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLI  1328
             SYE LEKATDYF D NKLGQGGSG VYKGVL +GKTVA+KRLFFNT QW DHFFNEVNLI
Sbjct  317   SYENLEKATDYFSDKNKLGQGGSGSVYKGVLTNGKTVAVKRLFFNTKQWVDHFFNEVNLI  376

Query  1327  SGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAE  1148
             S + HKNLVKLLGCSITGPESLLVYE++ NQSL+DY   RK+ QPLSW +R+KI+LGTAE
Sbjct  377   SQVDHKNLVKLLGCSITGPESLLVYEYIANQSLHDYLFVRKDVQPLSWGKRFKILLGTAE  436

Query  1147  GLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYM  968
             G+AYLHEE+ L IIHRDIKLSN+LL+++FTP+IADFGL RLFPEDK+HISTA+AGTLGYM
Sbjct  437   GMAYLHEESNLRIIHRDIKLSNILLEDDFTPRIADFGLARLFPEDKTHISTAIAGTLGYM  496

Query  967   APEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVD  788
             APEYVV+GKLTEKADVYSFGVL+IEV++GK+N++F Q + S+LQ  W+L+R   L EAVD
Sbjct  497   APEYVVRGKLTEKADVYSFGVLMIEVITGKRNNAFVQEAGSILQTVWSLYRTRNLEEAVD  556

Query  787   GSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFL-----  626
               L +   ++EA+R LQIGL+CVQA+ + RP+MSAVVKM+ G+ +I  PTQPPFL     
Sbjct  557   PILGDNFNKIEASRLLQIGLLCVQAAFDQRPAMSAVVKMMKGNLEIHTPTQPPFLNPGNV  616

Query  625   ----------TSNSAASSGS  596
                       T+N + SSGS
Sbjct  617   VEMRKFMMTPTTNQSNSSGS  636



>ref|XP_010415737.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Camelina 
sativa]
Length=655

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/619 (60%), Positives = 467/619 (75%), Gaps = 19/619 (3%)
 Frame = -2

Query  2395  NRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIG--AGN  2222
             N SVSD R    + IC+NRT+P  QR  +V+ F+AA+D+++PLV++K YG+ V      N
Sbjct  22    NPSVSDSRGETVSQICSNRTSPPQQRSLFVSTFLAAMDSVSPLVEAKGYGQVVNRNVTAN  81

Query  2221  ATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFN  2042
              TVYA+GECMKDLS+ DC+LCFAQ K ++ RCLPFQ+  RGG++F DGC++RYDDY FFN
Sbjct  82    QTVYAYGECMKDLSKKDCDLCFAQIKAKVPRCLPFQKGTRGGQVFSDGCYIRYDDYNFFN  141

Query  2041  ESSSLSDKTVCGAEDFGG-NSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGL  1865
             E+ SL D++ C  ++  G N   FR NAA LV  +  +A  N GF+   V R N TV+GL
Sbjct  142   ETVSLRDESKCAPKEITGVNRTGFRDNAAELVRNMRVEAVRNGGFYAGFVDRHNVTVHGL  201

Query  1864  AQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQS  1685
             AQCWE V    C  CL+ A   IGSCL  EEGR L+ GCYMR+ST+KFY+NS    ++ +
Sbjct  202   AQCWETVNRSGCAQCLSKASVGIGSCLVNEEGRFLSVGCYMRFSTQKFYNNSGNSTSDGN  261

Query  1684  GGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFS  1505
             GG  N L VILA T    AF+L++ +V F+ RKR  K+++E+K+LG++ +  NKS L FS
Sbjct  262   GGGHNRLGVILAVTSSVVAFVLLVSAVGFLFRKRHAKKQREKKQLGSLFMLANKSNLCFS  321

Query  1504  YETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLIS  1325
             YE LEKATDYF D NKLGQGGSG VYKGVL +GKTVA+KRLFFNT QW DHFFNEVNLIS
Sbjct  322   YENLEKATDYFSDKNKLGQGGSGSVYKGVLTNGKTVAVKRLFFNTKQWVDHFFNEVNLIS  381

Query  1324  GIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEG  1145
              + HKNLVKLLGCSITGPESLLVYE++ NQSL+DY   RK+ QPLSW +R+KI+LGTAEG
Sbjct  382   QVDHKNLVKLLGCSITGPESLLVYEYIANQSLHDYLFVRKDVQPLSWGKRFKILLGTAEG  441

Query  1144  LAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMA  965
             +AYLHEE+ L IIHRDIKLSN+LL+++FTP+IADFGL RLFPEDK+HISTA+AGTLGYMA
Sbjct  442   MAYLHEESNLRIIHRDIKLSNILLEDDFTPRIADFGLARLFPEDKTHISTAIAGTLGYMA  501

Query  964   PEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDG  785
             PEYVV+GKLTEKADVYSFGVL+IEV++GK+N++F Q + S+LQ  W+L+R   L EAVD 
Sbjct  502   PEYVVRGKLTEKADVYSFGVLMIEVITGKRNNAFVQEAGSILQTVWSLYRTRNLEEAVDP  561

Query  784   SLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFL------  626
              L +   ++EA+R LQIGL+CVQA+ + RP+MSAVVKM+ G  +I  PTQPPFL      
Sbjct  562   VLGDNFNKIEASRLLQIGLLCVQAAFDQRPAMSAVVKMMKGSLEIHTPTQPPFLNPGNVV  621

Query  625   ---------TSNSAASSGS  596
                      T+N + SSGS
Sbjct  622   EMRKFMMTPTTNQSNSSGS  640



>gb|KFK41463.1| hypothetical protein AALP_AA2G134200 [Arabis alpina]
Length=645

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/596 (61%), Positives = 461/596 (77%), Gaps = 3/596 (1%)
 Frame = -2

Query  2395  NRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNAT  2216
             N  VSD R    A IC+NRT+P  QR  +V NF++A+D ++PL+++ +YGE + G GN T
Sbjct  16    NPVVSDSRGETVAQICSNRTSPPQQRSLFVTNFLSAMDLVSPLIEANRYGEVITGTGNLT  75

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             VY +GEC+KDL + DC+LCFAQ K ++ RCLPFQ+  RGG++F DGC++RYDDY FFNE+
Sbjct  76    VYTYGECIKDLDKKDCDLCFAQIKAKVPRCLPFQKGTRGGQVFSDGCYIRYDDYNFFNEA  135

Query  2035  SSLSDKTVCGAEDFGG-NSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQ  1859
              S  D+  C  ++  G N  L+R NAA LV ++  +A  N GF+   V R N TV+GLAQ
Sbjct  136   LSSQDRINCTVKEITGVNRTLYRNNAAELVRKMSVEAGRNGGFYAGFVERSNVTVHGLAQ  195

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGG  1679
             CWE V G  C +CL+ A  +IGSCL  E+GRVLNAGCYMR +  +FY+NS    ++++GG
Sbjct  196   CWESVNGSGCVECLSNASERIGSCLVSEDGRVLNAGCYMRIANHRFYNNSGNSTSDRNGG  255

Query  1678  RSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYE  1499
               NHL VILA T    AF+L++  V F+ RK+  K+++E+K+LG++ +  NKS L FSYE
Sbjct  256   H-NHLGVILAVTSSVVAFVLLVFVVGFLFRKKRAKKQQEKKQLGSLFMLANKSNLCFSYE  314

Query  1498  TLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGI  1319
              LE+ATDYF D NKLGQGGSG V+KGVL +GKTVA+KRLFFNT QW DHFFNEVNLIS I
Sbjct  315   NLERATDYFSDKNKLGQGGSGSVFKGVLTNGKTVAVKRLFFNTKQWVDHFFNEVNLISQI  374

Query  1318  HHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLA  1139
              HKNLVKLLGCSITGPESLLVYE++ NQSL+DY   RK+ QPL+WE+R+KIILGTAEG+A
Sbjct  375   EHKNLVKLLGCSITGPESLLVYEYIANQSLHDYLFVRKDVQPLNWEKRFKIILGTAEGMA  434

Query  1138  YLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPE  959
             YLHEE+ L IIHRDIKLSN+LL+ +FTPKIADFGL RLFPEDK+HISTA+AGTLGYMAPE
Sbjct  435   YLHEESNLRIIHRDIKLSNILLEHDFTPKIADFGLARLFPEDKTHISTAIAGTLGYMAPE  494

Query  958   YVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSL  779
             YVV+GKLTEKADVYSFGVL+IEVV+G++N++F Q + S+LQ  WNL+    L EAVD  L
Sbjct  495   YVVRGKLTEKADVYSFGVLLIEVVTGRRNNAFSQDASSILQTVWNLYGTRNLSEAVDPVL  554

Query  778   EER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNS  614
              +   ++EA+R LQIGL+CVQA+ + RP+MSAVVKM+ G+ +I  PTQPPFL   S
Sbjct  555   GDNFNKIEASRLLQIGLLCVQAAFDQRPAMSAVVKMMKGNLEIQTPTQPPFLNPGS  610



>ref|XP_009105722.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Brassica 
rapa]
Length=648

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/596 (61%), Positives = 452/596 (76%), Gaps = 3/596 (1%)
 Frame = -2

Query  2395  NRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNAT  2216
             N  +SD R    A  C+NRT    QR   V NF+AA+DA++PLV++K YG+ V G GN T
Sbjct  20    NPVISDSRGETVAQRCSNRTTTPQQRSLVVTNFLAAMDAVSPLVEAKGYGQVVNGTGNLT  79

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             VYA+GECMKDL + DC+LCFAQ K ++ RCLPFQR  RGGR+F DGCF+RYD+Y FFNE+
Sbjct  80    VYAYGECMKDLDKKDCDLCFAQIKAKVPRCLPFQRGTRGGRVFSDGCFIRYDEYNFFNET  139

Query  2035  SSLSDKTVCGAEDFGG-NSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQ  1859
              S  D T C  ++  G N  LFR NAA LV  +  +A  N GF+   V R N T +GLAQ
Sbjct  140   LSSQDVTNCSNKEITGVNRTLFRANAAELVKFMSVEAVRNGGFYAGFVDRRNVTAHGLAQ  199

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGG  1679
             CWE +    C +CL+ A  +IGSCL KEEGR LNAGCYMR+S  KFY+NS    ++ +GG
Sbjct  200   CWEPLTRSGCAECLSKASEQIGSCLGKEEGRALNAGCYMRFSNLKFYNNSGNSTSDGNGG  259

Query  1678  RSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYE  1499
               NHL VILA T    AF+L++ ++ F+ +K+  K+ +E+K+LG++ +  NKS L FSYE
Sbjct  260   H-NHLAVILAVTSSVVAFVLLVSALGFLYKKKRAKKLREKKQLGSLFMLANKSDLCFSYE  318

Query  1498  TLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGI  1319
              LE+ATDYF D NKLGQGGSG V+KGVL +GKTVA+KRLFFNT QW DHFFNEVNLIS I
Sbjct  319   NLERATDYFSDKNKLGQGGSGSVFKGVLSNGKTVAVKRLFFNTKQWVDHFFNEVNLISQI  378

Query  1318  HHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLA  1139
              HKNLVKLLGCSITGPESLLVYE++ NQSL+DY   R++ QPLSW +R+KIILGTAEG+A
Sbjct  379   DHKNLVKLLGCSITGPESLLVYEYIANQSLHDYLFVRQDVQPLSWAKRFKIILGTAEGMA  438

Query  1138  YLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPE  959
             YLHEE+ L IIHRDIKLSN+LL+ +FTP+IADFGL RLFPEDK+HISTA+AGTLGYMAPE
Sbjct  439   YLHEESNLRIIHRDIKLSNILLEHDFTPRIADFGLARLFPEDKTHISTAIAGTLGYMAPE  498

Query  958   YVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSL  779
             YVV+GKLTEKADVYSFGVL+IEV++G++N++F Q S S+LQ  W L+      + VD  L
Sbjct  499   YVVRGKLTEKADVYSFGVLMIEVITGRRNNAFSQDSSSILQTVWRLYGTSNFVQVVDPVL  558

Query  778   EER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNS  614
              +   ++EA+R L+IGL+CVQA+ + RP+MSAVVKM+ G  +IP PTQPPFL   S
Sbjct  559   GDNFNKMEASRLLEIGLLCVQAAFDQRPAMSAVVKMMKGSLEIPTPTQPPFLNPGS  614



>ref|XP_010044592.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 isoform 
X1 [Eucalyptus grandis]
Length=650

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/653 (59%), Positives = 468/653 (72%), Gaps = 15/653 (2%)
 Frame = -2

Query  2443  ASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLV  2264
             AS+   +F  +FF ++     DPRA+E  LIC+NRT P   R+A+  +F  A+DA++P +
Sbjct  8     ASVPLLVFSALFFAAL--CFCDPRANEVDLICSNRTTPLPDRRAFATSFAEAMDAVSPQI  65

Query  2263  DSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFY  2084
             ++++Y   V  AGN TVYAF ECM+DL + DC+LC A+ K QILRC   Q+  RGGRLFY
Sbjct  66    NAQQYASAVGRAGNNTVYAFAECMEDLDRIDCDLCIARAKVQILRCSALQQGTRGGRLFY  125

Query  2083  DGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFT  1904
             DGC++RYDDY FFNES S  D TVCG EDFGGN  +F  N   L   L  +A  N GF  
Sbjct  126   DGCYLRYDDYYFFNESLSPQDTTVCGTEDFGGNQTMFMNNVVELGRNLSLQAPINGGFSV  185

Query  1903  AAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKK  1724
              +V RGN +VYGLAQCW+ V G  C +CL     +I SC PK+EGR LNAGCY  YST+K
Sbjct  186   GSVIRGNVSVYGLAQCWKLVNGSECQNCLNNTAVRIDSCPPKKEGRGLNAGCYFMYSTEK  245

Query  1723  FYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGA  1544
             FY N+T P     G R     +ILA    + A LLI+   AF++R ++V++ +E+K+LG 
Sbjct  246   FYYNNTKPFQINEGERR---LIILAAVSSTLALLLIIALAAFLIRMKLVRKTREKKQLGL  302

Query  1543  MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQ  1364
             ++  VN SK NFSYE LEKAT YF  S+KLGQGGSG VYKG+LPDGK VAIKRL FNTTQ
Sbjct  303   LVDVVNNSKRNFSYELLEKATSYFHQSSKLGQGGSGSVYKGILPDGKPVAIKRLVFNTTQ  362

Query  1363  WADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSW  1184
             W DHFFNEVNLIS I HKNLVKLLGCSITGPESLLVYE++PN SL+D+  A+KN  PLSW
Sbjct  363   WVDHFFNEVNLISDIDHKNLVKLLGCSITGPESLLVYEYIPNLSLHDHLFAKKNIPPLSW  422

Query  1183  EQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSH  1004
             E R KIILGTAEGLAYLHEE+ L IIHRDIKL+NVLLD++FTPKIADFGL RLFPED +H
Sbjct  423   ETRCKIILGTAEGLAYLHEESNLRIIHRDIKLTNVLLDKDFTPKIADFGLARLFPEDATH  482

Query  1003  ISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWN  824
             IST VAGTLGYMAPEYVV+GKLTEK DVYS+GVL++EV+SGKKN SF ++S S+LQ  WN
Sbjct  483   ISTGVAGTLGYMAPEYVVRGKLTEKVDVYSYGVLMMEVLSGKKNYSFSESSCSILQTVWN  542

Query  823   LFRAGKLYEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQ  647
             LF +G+L EA+D  LE +    E +R LQIGL+CVQAS ELRPSMS VVKM+    ++P 
Sbjct  543   LFGSGRLCEAIDPILEGQFQEQEVSRLLQIGLLCVQASAELRPSMSVVVKMLKESSELPT  602

Query  646   PTQPPFLTSNSAASSG----SYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
             PTQPPFL S+ +        S PN       +Q   +        TESW+ PR
Sbjct  603   PTQPPFLNSSRSTECSRHMFSEPNSSRQESDTQSPGNA-----ATTESWVKPR  650



>ref|XP_006301715.1| hypothetical protein CARUB_v10022175mg [Capsella rubella]
 gb|EOA34613.1| hypothetical protein CARUB_v10022175mg [Capsella rubella]
Length=652

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/620 (59%), Positives = 464/620 (75%), Gaps = 20/620 (3%)
 Frame = -2

Query  2398  INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIG--AG  2225
             IN  VSD R    + +C+NRT P  QR  +V  F+AA+DA++PLV+++ YG+ V      
Sbjct  19    INPCVSDSRGETVSRVCSNRTTPLQQRTLFVGTFLAAMDAVSPLVEARGYGQVVNRNVTA  78

Query  2224  NATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFF  2045
             N TVYA+GEC+KDL + DC+LCFAQ K ++  CLPFQR  RGG++F DGC++RYDDY FF
Sbjct  79    NQTVYAYGECIKDLDKKDCDLCFAQIKAKVPLCLPFQRGTRGGQVFSDGCYIRYDDYSFF  138

Query  2044  NESSSLSDKTVCGAEDFGG-NSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYG  1868
             NE+ SL D++ C  ++  G N  +FR NAA LV  +  +A  N GF+   V R N TV+G
Sbjct  139   NETVSLQDESKCAPKEITGVNRTVFRANAAELVRNMRVEAVRNGGFYAGFVNRQNVTVHG  198

Query  1867  LAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQ  1688
             LAQCWE +    C  CL+ A   IGSCL  EEGR L  GCY+R+ST+KFY+NS    ++ 
Sbjct  199   LAQCWETLNRSGCGQCLSKASVGIGSCLVNEEGRFLGVGCYLRFSTQKFYNNSGNSTSDG  258

Query  1687  SGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNF  1508
             +GG  NHL VILA T    AF+L++ +V F+ +KR  K+++E+K+LG++ +  NKS L F
Sbjct  259   NGGH-NHLGVILAVTSSVVAFVLLVSAVGFLFKKRHAKKQREKKQLGSLFMLANKSNLCF  317

Query  1507  SYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLI  1328
             SYE LE+ATDYF D NKLGQGGSG VYKGVL +GKTVA+KRLFFNT QW DHFFNEVNLI
Sbjct  318   SYENLERATDYFSDKNKLGQGGSGSVYKGVLSNGKTVAVKRLFFNTKQWVDHFFNEVNLI  377

Query  1327  SGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAE  1148
             S + HKNLVKLLGCSITGPESLLVYE++ NQSL+DY   RK+ QPL+W +R+KI+LGTAE
Sbjct  378   SQVDHKNLVKLLGCSITGPESLLVYEYIANQSLHDYLFVRKDVQPLNWAKRFKILLGTAE  437

Query  1147  GLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYM  968
             G+AYLHEE+ L IIHRDIKLSN+LL+++FTP+IADFGL RLFPEDK+HISTA+AGTLGYM
Sbjct  438   GMAYLHEESNLRIIHRDIKLSNILLEDDFTPRIADFGLARLFPEDKTHISTAIAGTLGYM  497

Query  967   APEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVD  788
             APEYVV+GKLTEKADVYSFGVL+IEV++GK+N++F Q + S+LQ  W+L+R   + EAVD
Sbjct  498   APEYVVRGKLTEKADVYSFGVLMIEVITGKRNNAFVQEAGSILQTVWSLYRTSNVEEAVD  557

Query  787   GSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFL-----  626
               L +   ++EA+R LQIGL+CVQA+ + RP+MSAVVKM+ G  +I  PTQPPFL     
Sbjct  558   PILGDNFDKIEASRLLQIGLLCVQAAFDQRPAMSAVVKMMKGSLEILTPTQPPFLNPGSV  617

Query  625   ----------TSNSAASSGS  596
                       T+N + SSGS
Sbjct  618   VEMRKMMMTPTTNQSNSSGS  637



>ref|XP_004509568.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
isoform X1 [Cicer arietinum]
Length=664

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/649 (60%), Positives = 487/649 (75%), Gaps = 13/649 (2%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTA-PQSQRQAYVANFVAALDALTPLVDSKKY  2249
             +FLF+F+ + + ++SDPRA++A+L+CTNRTA     R+ +++NF++A+D+LTPL+ +++Y
Sbjct  10    IFLFLFYFTPSPTLSDPRATKASLLCTNRTATSMPHRKIFISNFLSAMDSLTPLISTQRY  69

Query  2248  GETVIGAG-NATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCF  2072
             G    G   NA VYAF EC KDLSQ+DCN+C AQCKTQIL CLPFQ+  RGG+LF+DGC+
Sbjct  70    GAVSKGTTQNAAVYAFAECFKDLSQSDCNVCIAQCKTQILSCLPFQKGTRGGKLFFDGCY  129

Query  2071  VRYDDYVFFNESSSLSDKTVCGAEDF--GGNSGLFRRNAAALVGELGRKAAANDGFFTAA  1898
             +RYDDY FFNES S  D  +C       G    ++R +A  LV  L   A  NDGF    
Sbjct  130   LRYDDYNFFNESFSDQDTVLCSGNTTSNGDIVDVYRDSALKLVRNLSVLAPKNDGFSVGF  189

Query  1897  VGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGS-CLPKEEGRVLNAGCYMRYSTKKF  1721
             V R N TVYGLAQCW F+ G  C +CL  AVS+IGS C  KEE R LN+GCY+RYS KKF
Sbjct  190   VKRENVTVYGLAQCWRFINGSKCGECLEDAVSRIGSLCGKKEEARGLNSGCYLRYSGKKF  249

Query  1720  YDNSTIPATNQSGGRSNH--LPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLG  1547
             Y+N++   ++   G   H  + +ILA++F   A LL + +V F  RK ++++R+ER++ G
Sbjct  250   YNNNS-NGSDVIDGNHGHRKMDIILASSFAVVALLLAVATVVFFTRKNVMRRRRERRQFG  308

Query  1546  AMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTT  1367
              +L  VNKSKLN  YE LEKATDYFDD+NKLGQGGSG VYKGV+PDG  VA+KRL FN+T
Sbjct  309   TLLDKVNKSKLNVPYEILEKATDYFDDANKLGQGGSGSVYKGVMPDGNIVAVKRLSFNST  368

Query  1366  QWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLS  1187
             QW DHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYE+VPNQSL+D+ S R+  QPL+
Sbjct  369   QWVDHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEYVPNQSLHDHLSVRRICQPLT  428

Query  1186  WEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKS  1007
             WE R+K+ILG AEG+AYLHEE+ + IIHRDIKLSN+LL+E+FTPKIADFGL RLFPE+ S
Sbjct  429   WELRHKVILGIAEGMAYLHEESHVRIIHRDIKLSNILLEEDFTPKIADFGLARLFPENNS  488

Query  1006  HISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHW  827
             HIST VAGTLGYMAPEYV++GKLTEKADVYSFGVLVIE+VSGK+NSS+   S S+LQ  W
Sbjct  489   HISTVVAGTLGYMAPEYVIRGKLTEKADVYSFGVLVIEIVSGKRNSSYVLNSSSILQTVW  548

Query  826   NLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIP  650
             NL+ + +L +  D  LE      EA + LQIGL+C QA+ ELRPSMS VVKMI+ + +I 
Sbjct  549   NLYGSNRLSDIFDPILEGNFPTEEACQMLQIGLLCAQATAELRPSMSVVVKMINNNHEIS  608

Query  649   QPTQPPFLTSNSAASSGSYPNRGGvtpysqpssstqssVNTMTESWIDP  503
             Q TQPPF+ S+S+  S S   R       +  S+TQSS +TMTES ++P
Sbjct  609   QLTQPPFINSSSSELSKSTLPR----YDFRLQSNTQSSGDTMTESLVEP  653



>emb|CDY47146.1| BnaA08g05370D [Brassica napus]
Length=618

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/567 (62%), Positives = 439/567 (77%), Gaps = 3/567 (1%)
 Frame = -2

Query  2308  VANFVAALDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILR  2129
             V NF+AA+DA++PLV++K YG+ V G GN TVYA+GECMKDL + DC+LCFAQ K ++ R
Sbjct  19    VTNFLAAMDAVSPLVEAKGYGQVVNGTGNLTVYAYGECMKDLDKKDCDLCFAQIKAKVPR  78

Query  2128  CLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGG-NSGLFRRNAAAL  1952
             CLPFQR  RGGR+F DGCF+RYD+Y FFNE+ S  D T C  ++  G N  LFR NAA L
Sbjct  79    CLPFQRGTRGGRVFSDGCFIRYDEYNFFNETLSSQDVTNCSNKEITGVNRTLFRANAAEL  138

Query  1951  VGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEE  1772
             V  +  +A  N GF+   V R N T +GLAQCWE +    C +CL+ A  +IGSCL KEE
Sbjct  139   VKFMSVEAVRNGGFYAGFVDRRNVTAHGLAQCWEPLTRSGCAECLSKASEQIGSCLGKEE  198

Query  1771  GRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIV  1592
             GR LNAGCYMR+S  KFY+NS    ++ +GG  NHL VILA T    AF+L++ ++ F+ 
Sbjct  199   GRALNAGCYMRFSNLKFYNNSGNSTSDGNGGH-NHLAVILAVTSSVVAFVLLVSALGFLY  257

Query  1591  RKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLP  1412
             +K+  K+ +E+K+LG++ +  NKS L FSYE LE+ATDYF D NKLGQGGSG V+KGVL 
Sbjct  258   KKKRAKKLREKKQLGSLFMLANKSDLCFSYENLERATDYFSDKNKLGQGGSGSVFKGVLS  317

Query  1411  DGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQS  1232
             +GKTVA+KRLFFNT QW DHFFNEVNLIS I HKNLVKLLGCSITGPESLLVYE++ NQS
Sbjct  318   NGKTVAVKRLFFNTKQWVDHFFNEVNLISQIDHKNLVKLLGCSITGPESLLVYEYIANQS  377

Query  1231  LYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPK  1052
             L+DY   R++ QPLSW +R+KIILGTAEG+AYLHEE+ L IIHRDIKLSN+LL+ +FTP+
Sbjct  378   LHDYLFVRQDVQPLSWAKRFKIILGTAEGMAYLHEESNLRIIHRDIKLSNILLEHDFTPR  437

Query  1051  IADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN  872
             IADFGL RLFPEDK+HISTA+AGTLGYMAPEYVV+GKLTEKADVYSFGVL+IEV++G++N
Sbjct  438   IADFGLARLFPEDKTHISTAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLMIEVITGRRN  497

Query  871   SSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPS  695
             ++F Q S S+LQ  W L+      + VD  L +   ++EA+R L+IGL+CVQA+ + RP+
Sbjct  498   NAFSQDSSSILQTVWRLYGTSNFVQVVDPVLGDNFNKMEASRLLEIGLLCVQAAFDQRPA  557

Query  694   MSAVVKMISGDQDIPQPTQPPFLTSNS  614
             MSAVVKM+ G  +IP PTQPPFL   S
Sbjct  558   MSAVVKMMKGSLEIPTPTQPPFLNPGS  584



>emb|CDY67166.1| BnaCnng53810D [Brassica napus]
Length=613

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/576 (61%), Positives = 443/576 (77%), Gaps = 4/576 (1%)
 Frame = -2

Query  2332  PQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFA  2153
             PQ QR   V NF+ A+DA++PL++++ YG+ V G GN TVYA+GECMKDL + DC+LCFA
Sbjct  3     PQ-QRSLVVTNFLNAMDAVSPLIEARGYGQVVNGTGNLTVYAYGECMKDLDKKDCDLCFA  61

Query  2152  QCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGG-NSGL  1976
             Q K ++ RCLPFQ++ RGGR+F DGC+VRYD+Y FFNE+ S  D+T C  ++  G N  L
Sbjct  62    QIKAKVPRCLPFQQITRGGRVFSDGCYVRYDEYNFFNETLSSLDQTNCSEKEITGVNRTL  121

Query  1975  FRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKI  1796
             FR NAAALV  +  +A  N GF+   V + N TV+GLAQCWE +    C +CL+ A  +I
Sbjct  122   FRDNAAALVKFMSVEAVRNGGFYAGFVDKRNVTVHGLAQCWEPLTRSGCVECLSKASEQI  181

Query  1795  GSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLI  1616
             GSCL KEEGR LNAGCYMR+ST KFY+NS     + +GG  NHL VILA      AF+L+
Sbjct  182   GSCLGKEEGRALNAGCYMRFSTHKFYNNSGNSTADGNGGH-NHLVVILAVRCSVVAFVLL  240

Query  1615  LGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSG  1436
             + +V F+ RK++ K+++E K+LG + +  NKS + FSYE LEKATDYF D NKLGQGGSG
Sbjct  241   VSAVGFLYRKKLAKKQRENKQLGPLFMLTNKSNICFSYENLEKATDYFSDKNKLGQGGSG  300

Query  1435  CVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLV  1256
              V+KGVL +GKT+A+KRLFFNT QW DHFFNEVNLIS I+HKNLVKLLGCSITGPESLLV
Sbjct  301   SVFKGVLRNGKTIAVKRLFFNTKQWVDHFFNEVNLISQINHKNLVKLLGCSITGPESLLV  360

Query  1255  YEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVL  1076
             YE++ N+SL+DY   R++  PL W +R+KI+LGTAEG+AYLHEE+ L IIHRDIKLSN+L
Sbjct  361   YEYIANKSLHDYLFVRQDVPPLDWAKRFKILLGTAEGMAYLHEESNLRIIHRDIKLSNIL  420

Query  1075  LDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVI  896
             L+ +FTP+IADFGL RLFP DK+HISTA+AGT GYMAPEY V+GKLTEKADVYSFGVL+I
Sbjct  421   LEHDFTPRIADFGLARLFPGDKTHISTAIAGTRGYMAPEYAVRGKLTEKADVYSFGVLMI  480

Query  895   EVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQ  719
             EV++G++N++F Q + S+LQ  W+L+    L + VD  L +   ++EA+R L+IGL+CVQ
Sbjct  481   EVITGRRNNAFSQDASSILQTVWSLYGTSNLVQVVDQVLGDNFNKMEASRLLEIGLLCVQ  540

Query  718   ASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNSA  611
             A+ E RP+MSAVVKMI G  +IP PTQPPFL   S 
Sbjct  541   AAFEQRPAMSAVVKMIKGSLEIPTPTQPPFLNPGSV  576



>ref|XP_004509569.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
isoform X2 [Cicer arietinum]
Length=643

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/649 (58%), Positives = 471/649 (73%), Gaps = 34/649 (5%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTA-PQSQRQAYVANFVAALDALTPLVDSKKY  2249
             +FLF+F+ + + ++SDPRA++A+L+CTNRTA     R+ +++NF++A+D+LTPL+ +++Y
Sbjct  10    IFLFLFYFTPSPTLSDPRATKASLLCTNRTATSMPHRKIFISNFLSAMDSLTPLISTQRY  69

Query  2248  GETVIGAG-NATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCF  2072
             G    G   NA VYAF EC KDLSQ+DCN+C AQCKTQIL CLPFQ+  RGG+LF+DGC+
Sbjct  70    GAVSKGTTQNAAVYAFAECFKDLSQSDCNVCIAQCKTQILSCLPFQKGTRGGKLFFDGCY  129

Query  2071  VRYDDYVFFNESSSLSDKTVCGAEDF--GGNSGLFRRNAAALVGELGRKAAANDGFFTAA  1898
             +RYDDY FFNES S  D  +C       G    ++R +A  LV  L   A  NDGF    
Sbjct  130   LRYDDYNFFNESFSDQDTVLCSGNTTSNGDIVDVYRDSALKLVRNLSVLAPKNDGFSVGF  189

Query  1897  VGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGS-CLPKEEGRVLNAGCYMRYSTKKF  1721
             V R N TVYGLAQCW F+ G  C +CL  AVS+IGS C  KEE R LN+GCY+RYS KKF
Sbjct  190   VKRENVTVYGLAQCWRFINGSKCGECLEDAVSRIGSLCGKKEEARGLNSGCYLRYSGKKF  249

Query  1720  YDNSTIPATNQSGGRSNH--LPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLG  1547
             Y+N++   ++   G   H  + +ILA++F   A LL + +V F  RK ++++R+ER++ G
Sbjct  250   YNNNS-NGSDVIDGNHGHRKMDIILASSFAVVALLLAVATVVFFTRKNVMRRRRERRQFG  308

Query  1546  AMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTT  1367
              +L  VNKSKLN  YE LEKATDYFDD+NKLGQGGSG VYKGV+PDG  VA+KRL FN+T
Sbjct  309   TLLDKVNKSKLNVPYEILEKATDYFDDANKLGQGGSGSVYKGVMPDGNIVAVKRLSFNST  368

Query  1366  QWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLS  1187
             QW DHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYE+VPNQSL+D+ S         
Sbjct  369   QWVDHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEYVPNQSLHDHLS---------  419

Query  1186  WEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKS  1007
                         EG+AYLHEE+ + IIHRDIKLSN+LL+E+FTPKIADFGL RLFPE+ S
Sbjct  420   ------------EGMAYLHEESHVRIIHRDIKLSNILLEEDFTPKIADFGLARLFPENNS  467

Query  1006  HISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHW  827
             HIST VAGTLGYMAPEYV++GKLTEKADVYSFGVLVIE+VSGK+NSS+   S S+LQ  W
Sbjct  468   HISTVVAGTLGYMAPEYVIRGKLTEKADVYSFGVLVIEIVSGKRNSSYVLNSSSILQTVW  527

Query  826   NLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIP  650
             NL+ + +L +  D  LE      EA + LQIGL+C QA+ ELRPSMS VVKMI+ + +I 
Sbjct  528   NLYGSNRLSDIFDPILEGNFPTEEACQMLQIGLLCAQATAELRPSMSVVVKMINNNHEIS  587

Query  649   QPTQPPFLTSNSAASSGSYPNRGGvtpysqpssstqssVNTMTESWIDP  503
             Q TQPPF+ S+S+  S S   R       +  S+TQSS +TMTES ++P
Sbjct  588   QLTQPPFINSSSSELSKSTLPR----YDFRLQSNTQSSGDTMTESLVEP  632



>gb|KDO82323.1| hypothetical protein CISIN_1g008239mg [Citrus sinensis]
Length=492

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/495 (68%), Positives = 399/495 (81%), Gaps = 9/495 (2%)
 Frame = -2

Query  2287  LDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRL  2108
             +D +TPL+  ++Y   V G G A+VYAFGECMKDLS  DCNLCFAQCKTQ+L+CLPFQ  
Sbjct  1     MDIVTPLIARQRYAAVVNGTGTASVYAFGECMKDLSPNDCNLCFAQCKTQVLKCLPFQLA  60

Query  2107  VRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKA  1928
              RGGR+FYDGC++RYDDY FFNES S  D+TVCG++DFGGN+ +F  NA  LV  L  +A
Sbjct  61    TRGGRVFYDGCYLRYDDYDFFNESLSSQDRTVCGSKDFGGNNTVFGANAIELVRNLSVQA  120

Query  1927  AANDGFFTAAV--GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNA  1754
               NDGFF  +V   +GN +V+GLAQCWEFV G +C++CL  AVS+I SC  KEEGRVLNA
Sbjct  121   VKNDGFFVGSVTFSKGNVSVHGLAQCWEFVNGSACENCLENAVSRIASCTQKEEGRVLNA  180

Query  1753  GCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVK  1574
             GCY+RYST++FY+NS  P      G  N L VILAT+  + A LL+   VAF VR+++++
Sbjct  181   GCYLRYSTQRFYNNSG-PDPVPGNGGDNKLAVILATS--AVALLLVFSLVAFFVRRKLLQ  237

Query  1573  QRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVA  1394
             +R+ERK+LGA+ V VNKSKLNFSYETLEKAT+YF +SNKLGQGGSG VYKG LP G+ VA
Sbjct  238   KRRERKQLGALQVAVNKSKLNFSYETLEKATNYFHESNKLGQGGSGSVYKGTLPGGEAVA  297

Query  1393  IKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTS  1214
             +KRLF+NTTQW DHFFNEVNLISGI+HKNLVKLLGCSITGPESLLVYEFVPNQSL D   
Sbjct  298   VKRLFYNTTQWVDHFFNEVNLISGINHKNLVKLLGCSITGPESLLVYEFVPNQSLLDNLF  357

Query  1213  ARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGL  1034
              R++ +PLSWE RYKIIL TAEGLAYLHEE++L IIHRDIKLSN+LLDEEFT KIADFGL
Sbjct  358   VRQDVEPLSWEVRYKIILSTAEGLAYLHEESKLRIIHRDIKLSNILLDEEFTAKIADFGL  417

Query  1033  VRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQA  854
             VRLFPED +HIS  +AGTLGYMAPEYVV+GKLTEKADVYSFGV+VIEVV  K+ + F Q 
Sbjct  418   VRLFPEDITHISATLAGTLGYMAPEYVVRGKLTEKADVYSFGVVVIEVVCRKRINLFTQN  477

Query  853   SVSLLQQ----HWNL  821
             S S+LQ      WN+
Sbjct  478   SCSILQTVILLTWNI  492



>emb|CDY11571.1| BnaC06g31680D [Brassica napus]
Length=2213

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/596 (60%), Positives = 451/596 (76%), Gaps = 3/596 (1%)
 Frame = -2

Query  2395  NRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNAT  2216
             N    +P     A  C+NRT    QR   V NF+AA+DA++PLV++K YG+ V G GN T
Sbjct  973   NTVTDNPPGETVAQRCSNRTTTPQQRSLVVTNFLAAMDAVSPLVEAKGYGQVVNGTGNLT  1032

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             VYA+GECMKDL + DC+LCFAQ K ++ RCLPFQR  RGGR+F DGCF+RYD+Y FFNE+
Sbjct  1033  VYAYGECMKDLDKKDCDLCFAQIKAKVPRCLPFQRGTRGGRVFSDGCFIRYDEYNFFNET  1092

Query  2035  SSLSDKTVCGAEDFGG-NSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQ  1859
              S  D T C  ++  G N  LFR NA  LV  +  +A  N GF+   V R N T +GLAQ
Sbjct  1093  LSSQDVTNCSNKEITGVNRTLFRDNAGELVKFMSVEAVRNGGFYAGFVERRNVTAHGLAQ  1152

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGG  1679
             CWE +    C +CL+ A  KIGSCL KEEGRVLNAGCYMR+S  KFY+NS    ++ +GG
Sbjct  1153  CWEPLTRSGCAECLSNASEKIGSCLGKEEGRVLNAGCYMRFSNLKFYNNSGNSTSDGNGG  1212

Query  1678  RSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYE  1499
               NHL VILA T    AF+L++ +V F+ +K+  K+ +E+K+LG++ +  NKS L+FSYE
Sbjct  1213  H-NHLAVILAVTSSVVAFVLLVSAVGFLYKKKRAKKLREKKQLGSLFMLANKSDLSFSYE  1271

Query  1498  TLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGI  1319
              LE+ATDYF + NKLGQGGSG V+KGVL +GKTVA+KRLFFNT QW DHFFNEVNLIS I
Sbjct  1272  NLERATDYFSNKNKLGQGGSGSVFKGVLSNGKTVAVKRLFFNTKQWVDHFFNEVNLISQI  1331

Query  1318  HHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLA  1139
              HKNLVKLLGCSITGPESLLVYE++ NQSL+DY   R++ +PLSW +R+KII GTAEG+A
Sbjct  1332  DHKNLVKLLGCSITGPESLLVYEYIANQSLHDYLFVRQDVEPLSWAKRFKIIFGTAEGMA  1391

Query  1138  YLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPE  959
             YLHEE+ L IIHRDIKLSN+LL+ +FTP+IADFGL RLFPEDK+HISTA+AGTLGYMAPE
Sbjct  1392  YLHEESNLRIIHRDIKLSNILLEHDFTPRIADFGLARLFPEDKTHISTAIAGTLGYMAPE  1451

Query  958   YVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSL  779
             YVV+GKLTEKADVYSFGVL+IEV++G++N++F Q S S+LQ  W+L+      + VD  L
Sbjct  1452  YVVRGKLTEKADVYSFGVLMIEVITGRRNNAFSQDSSSILQTVWSLYGTSNFVQVVDPVL  1511

Query  778   EER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNS  614
              +   ++EA+R L+IGL+CVQA+ + RP+MSAVVKM+ G  +IP PTQPPFL   S
Sbjct  1512  GDNFNKMEASRLLEIGLLCVQAAFDQRPAMSAVVKMMKGSLEIPTPTQPPFLNPGS  1567


 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/596 (59%), Positives = 449/596 (75%), Gaps = 3/596 (1%)
 Frame = -2

Query  2395  NRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNAT  2216
             N  +SDPR    A +C NRT    Q+   V NF+AA+DA++PL+++K YG+ V G GN T
Sbjct  205   NPVISDPRGETVAQMCNNRTMTPQQKSLVVTNFLAAMDAVSPLLEAKGYGQVVNGTGNLT  264

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             VYA+GECMKDL + DC+LCFAQ K ++ RCLPFQ++ RGGR+F DGC+VRYD+Y FFNE+
Sbjct  265   VYAYGECMKDLDKKDCDLCFAQIKAKVPRCLPFQQITRGGRVFSDGCYVRYDEYNFFNET  324

Query  2035  SSLSDKTVCGAEDFGG-NSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQ  1859
              S  D+T C  ++  G N  LFR NAA LV  +  +A  N GF+   V + N TV+GLAQ
Sbjct  325   LSSLDQTNCSEKEITGVNRTLFRDNAAELVKFMSEEAVRNGGFYAGFVDKRNVTVHGLAQ  384

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGG  1679
             CWE +    C +CL+ A  +IGSC   EEGR LNAGCYMR+ST KFY+NS    ++ +GG
Sbjct  385   CWEPLTRSGCVECLSKASEQIGSCFGNEEGRALNAGCYMRFSTHKFYNNSGNSTSDGNGG  444

Query  1678  RSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYE  1499
               NHL VILA T    AF+L++ +V F+ RK+  K+ +E K+LG + +  NKS + FSYE
Sbjct  445   H-NHLVVILAVTCSVVAFVLLVSAVGFLYRKKRAKKLRENKQLGPLFMLANKSNICFSYE  503

Query  1498  TLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGI  1319
              LEKATDYF D NKLGQGGSG V+KGVL +GK +A+KRLFFNT QW DHFFNEVNLIS I
Sbjct  504   NLEKATDYFSDKNKLGQGGSGSVFKGVLRNGKNIAVKRLFFNTKQWVDHFFNEVNLISQI  563

Query  1318  HHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLA  1139
              HKNLVKLLGCSITGPESLLVYE++ N+SL+DY   R++  PL W +R+KI+LGTAEG+A
Sbjct  564   DHKNLVKLLGCSITGPESLLVYEYIANKSLHDYLFVRQDVPPLDWAKRFKILLGTAEGMA  623

Query  1138  YLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPE  959
             YLHEE+ L IIHRDIKLSN+LL+ +FTP+IADFGL RLFP DK+HISTA+AGT GYMAPE
Sbjct  624   YLHEESNLRIIHRDIKLSNILLEHDFTPRIADFGLARLFPGDKTHISTAIAGTRGYMAPE  683

Query  958   YVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSL  779
             Y V+GKLTEKADVYSFGV++IEV++G++NS+F Q + S+LQ  W+L+    L + VD  L
Sbjct  684   YAVRGKLTEKADVYSFGVVMIEVITGRRNSAFSQDATSILQTVWSLYGTSNLAQVVDQVL  743

Query  778   EER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNS  614
              +   ++EA+R L+IGL+CVQA+ E RP+MSAVVKM+ G+ +IP P QPPFL   S
Sbjct  744   GDNFNKMEASRLLEIGLLCVQAAFEQRPAMSAVVKMMKGNMEIPTPKQPPFLDPGS  799


 Score =   488 bits (1256),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 265/606 (44%), Positives = 366/606 (60%), Gaps = 41/606 (7%)
 Frame = -2

Query  2380  DPRASEAALICTNRTAPQSQRQ--AYVANFVAALDALTPLVDSKKYGETVIGAGNATVYA  2207
             +PRA    + C+    PQ +     +V NFVA+++ ++ +V +  +G    G+G    YA
Sbjct  1596  NPRARSVKITCS----PQLEHNETVFVPNFVASMEKISQVVQTTGFGTAQTGSGPDGNYA  1651

Query  2206  FGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSL  2027
               +C  DL   DC LC+A+ +T + +C P      GGR+F DGCF+R ++Y F+ E    
Sbjct  1652  LAQCYGDLPLNDCVLCYAEARTILPKCYP----QNGGRIFLDGCFMRAENYSFYKEVKGP  1707

Query  2026  SDKTVCGAEDFGGNSGLFRRNAAAL---VGELGRKAAA----NDGFFTAAVGRGNSTVYG  1868
              D  +CG           RRN A     V ++ R A A    N G+   A   G S+ + 
Sbjct  1708  EDTVLCGNAT--------RRNNATFGDAVRQVVRNAVAAAPGNGGYARGASANGESSAFV  1759

Query  1867  LAQCWEFVRGKSCDDCLA-AAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATN  1691
             L  CW  +  +SC  CL  A+ S +  CLP  EGR L+ GC++RYS + F +   IP   
Sbjct  1760  LVNCWRNLSPESCKQCLEDASASMVDKCLPWSEGRALHTGCFLRYSDQDFLNK--IPRNG  1817

Query  1690  QSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIV-KQRKERKRLGAMLVTVNKSKL  1514
             +S G    + V + ++   F   + +G   +I + R + K+R+    +  M  T+  S L
Sbjct  1818  RSRGSVVVIVVSVLSSVIVFMVGIAIG--VYICKNRTIQKKRRGSNDVEKMAKTLTDSSL  1875

Query  1513  NFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVN  1334
             NF Y TLEKAT  FD++NKLGQGG G VYKGVLPDG+ +A+KRLFFN    A  F+NEVN
Sbjct  1876  NFKYSTLEKATGSFDNANKLGQGGFGTVYKGVLPDGRDIAVKRLFFNNRHRAADFYNEVN  1935

Query  1333  LISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGT  1154
             +IS + HKNLV+LLGCS +GPESLLVYE++ N+SL  +       + L W +R+ II+GT
Sbjct  1936  IISSVEHKNLVRLLGCSCSGPESLLVYEYLQNKSLDRFIFDVNRGKTLDWPRRFVIIVGT  1995

Query  1153  AEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLG  974
             AEGL YLHE++ + IIHRDIK SN+LLD +   KIADFGL R F EDKSHISTA+AGTLG
Sbjct  1996  AEGLVYLHEQSSVKIIHRDIKASNILLDSKLQAKIADFGLARSFQEDKSHISTAIAGTLG  2055

Query  973   YMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHWNLFRAGKLY  800
             YMAPEY+  G+LTEK DVYSFGVLV+E+V+GK+N  S     S SL+ + W  F+ G+L 
Sbjct  2056  YMAPEYLAHGQLTEKVDVYSFGVLVLEIVTGKQNTKSKMSDYSDSLITEAWKHFQTGELE  2115

Query  799   EAVDGSLEER-------ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDI-PQP  644
             E  D +L+ +        + E  R +QIGL+C Q    LRPSMS V+ M+   +++ P P
Sbjct  2116  EIYDPNLDWKNQNDSLIIKKEIVRVVQIGLLCTQEMASLRPSMSKVLHMLKHKEEVLPLP  2175

Query  643   TQPPFL  626
             + PPF+
Sbjct  2176  SNPPFM  2181



>ref|XP_007157358.1| hypothetical protein PHAVU_002G063600g [Phaseolus vulgaris]
 gb|ESW29352.1| hypothetical protein PHAVU_002G063600g [Phaseolus vulgaris]
Length=609

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/537 (62%), Positives = 416/537 (77%), Gaps = 4/537 (1%)
 Frame = -2

Query  2440  SLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVD  2261
             SL+ +L +F+   ++  +++DPRA+E A++CTN TAP  QRQA++ NF  A++ALT L+ 
Sbjct  68    SLASFLLVFLCCGAL-PALADPRATELAVMCTNTTAPMLQRQAFLTNFYDAMEALTDLIT  126

Query  2260  SKKYGETVIGAG-NATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFY  2084
             S++Y   V G   N TVYAFGECMKDLS+ DC++CFAQCKT++ RC PFQR   GG  F+
Sbjct  127   SQRYALVVKGTTQNETVYAFGECMKDLSKPDCDVCFAQCKTRVHRCSPFQRGTNGGMFFF  186

Query  2083  DGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFT  1904
             DGC++RYD Y FFNES S  D+T+CG EDF GN  +F+ N   LV  L  +   N+GF  
Sbjct  187   DGCYLRYDGYNFFNESLSPRDRTICGTEDFRGNWSVFKANTVELVRNLSIETPKNEGFSA  246

Query  1903  AAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKK  1724
               V R N T+YGLAQCW+FV   SC +CLA A+++I SC PK E R LNAGCY+RY+T  
Sbjct  247   GYVRRSNVTIYGLAQCWKFVNSSSCQNCLAEAITRIDSCAPKGEVRALNAGCYLRYATHN  306

Query  1723  FYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGA  1544
             FY++S      +  G  N   +I+A +  S AFLLI+ +V F+V   ++K+R+ER+++G 
Sbjct  307   FYNSSNNNPPQEHRGHKN-FAIIVAASSASLAFLLIVSTVIFLVWTNLLKRRRERRQVGV  365

Query  1543  MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQ  1364
             +L TV KSKLN  YE LEKATDYF DSNK+G+GGSG V+KGVLPDG TVA+KRL FNT+Q
Sbjct  366   LLNTVIKSKLNMPYEILEKATDYFSDSNKVGEGGSGSVFKGVLPDGTTVAVKRLTFNTSQ  425

Query  1363  WADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSW  1184
             WADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPN SLY + S R+N Q L+W
Sbjct  426   WADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNHSLYYHLSGRRNSQQLTW  485

Query  1183  EQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSH  1004
             E R+KIILGTAEGLAYLHEE++  IIHRDIKL N+L+DE FTPKIADFGL RLFPEDKSH
Sbjct  486   EVRHKIILGTAEGLAYLHEESQR-IIHRDIKLGNILIDENFTPKIADFGLARLFPEDKSH  544

Query  1003  ISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQ  833
             +STA+ GTLGYMAPEYVV GKLTEKADVYSFGVL++E++SGKK++SF Q S S+L +
Sbjct  545   LSTAICGTLGYMAPEYVVLGKLTEKADVYSFGVLIMEIISGKKSTSFVQNSYSILHR  601



>ref|XP_010044593.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 isoform 
X2 [Eucalyptus grandis]
Length=629

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/653 (56%), Positives = 447/653 (68%), Gaps = 36/653 (6%)
 Frame = -2

Query  2443  ASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLV  2264
             AS+   +F  +FF ++     DPRA+E  LIC+NRT P   R+A+  +F  A+DA++P +
Sbjct  8     ASVPLLVFSALFFAAL--CFCDPRANEVDLICSNRTTPLPDRRAFATSFAEAMDAVSPQI  65

Query  2263  DSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFY  2084
             ++++Y   V  AGN TVYAF ECM+DL + DC+LC A+ K QILRC   Q+  RGGRLFY
Sbjct  66    NAQQYASAVGRAGNNTVYAFAECMEDLDRIDCDLCIARAKVQILRCSALQQGTRGGRLFY  125

Query  2083  DGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFT  1904
             DGC++RYDDY FFNES S  D TVCG EDFGGN  +F  N   L   L  +A  N GF  
Sbjct  126   DGCYLRYDDYYFFNESLSPQDTTVCGTEDFGGNQTMFMNNVVELGRNLSLQAPINGGFSV  185

Query  1903  AAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKK  1724
              +V RGN +VYGLAQCW+ V G  C +CL     +I SC PK+EGR LNAGCY  YST+K
Sbjct  186   GSVIRGNVSVYGLAQCWKLVNGSECQNCLNNTAVRIDSCPPKKEGRGLNAGCYFMYSTEK  245

Query  1723  FYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGA  1544
             FY N+T P     G R     +ILA    + A LLI+   AF++R ++V++ +E+K+LG 
Sbjct  246   FYYNNTKPFQINEGERR---LIILAAVSSTLALLLIIALAAFLIRMKLVRKTREKKQLGL  302

Query  1543  MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQ  1364
             ++  VN SK NFSYE LEKAT YF  S+KLGQGGSG VYKG+LPDGK VAIKRL FNTTQ
Sbjct  303   LVDVVNNSKRNFSYELLEKATSYFHQSSKLGQGGSGSVYKGILPDGKPVAIKRLVFNTTQ  362

Query  1363  WADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSW  1184
             W DHFFNEVNLIS I HKNLVKLLGCSITGPESLLVYE++PN SL+D+  A+KN  PLSW
Sbjct  363   WVDHFFNEVNLISDIDHKNLVKLLGCSITGPESLLVYEYIPNLSLHDHLFAKKNIPPLSW  422

Query  1183  EQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSH  1004
             E R KIILGTAEGLAYLHEE+ L IIHRDIKL+NVLLD++FTPKIADFGL RLFPED +H
Sbjct  423   ETRCKIILGTAEGLAYLHEESNLRIIHRDIKLTNVLLDKDFTPKIADFGLARLFPEDATH  482

Query  1003  ISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWN  824
             IST VAGT                      +GVL++EV+SGKKN SF ++S S+LQ  WN
Sbjct  483   ISTGVAGTF---------------------YGVLMMEVLSGKKNYSFSESSCSILQTVWN  521

Query  823   LFRAGKLYEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQ  647
             LF +G+L EA+D  LE +    E +R LQIGL+CVQAS ELRPSMS VVKM+    ++P 
Sbjct  522   LFGSGRLCEAIDPILEGQFQEQEVSRLLQIGLLCVQASAELRPSMSVVVKMLKESSELPT  581

Query  646   PTQPPFLTSNSAASSG----SYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
             PTQPPFL S+ +        S PN       +Q   +        TESW+ PR
Sbjct  582   PTQPPFLNSSRSTECSRHMFSEPNSSRQESDTQSPGNA-----ATTESWVKPR  629



>gb|KHN42529.1| Cysteine-rich receptor-like protein kinase 3 [Glycine soja]
Length=572

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/578 (63%), Positives = 442/578 (76%), Gaps = 19/578 (3%)
 Frame = -2

Query  2194  MKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLSDKT  2015
             M+DLS+ DCNLC AQCKTQ+L CLPFQR  RGGRLF+DGC++RYDDY FF E+ S  D T
Sbjct  1     MRDLSRNDCNLCLAQCKTQLLACLPFQRGTRGGRLFFDGCYLRYDDYNFFGETRSDQDTT  60

Query  2014  VCGAEDFGGNS------------GLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVY  1871
             VCG      NS            G+++ NA ALV  L   A  NDGFF  +V R N +VY
Sbjct  61    VCGNNSSNNNSNSAANSATNSSSGVYKANAMALVRNLSGLAPKNDGFFVGSVERKNVSVY  120

Query  1870  GLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATN  1691
             GLAQCWEFV G +C+ CLA AV++IGSC   +E R L+AGCY+RYS++KFY+NS+   T 
Sbjct  121   GLAQCWEFVNGSACERCLADAVTRIGSC-STQEARALSAGCYLRYSSQKFYNNSSDVVTA  179

Query  1690  QSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLN  1511
                G+   L  ILA +  + A LL++ +V F  RK +V +R+ER++ GA+L TVNKSKLN
Sbjct  180   GKHGKRT-LVKILAASSAALALLLVVVTVVFFTRKNVVTRRRERRQFGALLATVNKSKLN  238

Query  1510  FSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNL  1331
               YE LEKAT+YF+++NKLGQGGSG VYKGV+PDG TVAIKRL +NTTQWA+HFF EVNL
Sbjct  239   MPYEVLEKATNYFNEANKLGQGGSGSVYKGVMPDGNTVAIKRLSYNTTQWAEHFFTEVNL  298

Query  1330  ISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTA  1151
             ISGIHHKNLVKLLGCSITGPESLLVYE+VPNQSL+D+ S R+  QPL+WE R KIILG A
Sbjct  299   ISGIHHKNLVKLLGCSITGPESLLVYEYVPNQSLHDHFSVRRTSQPLTWEMRQKIILGIA  358

Query  1150  EGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGY  971
             EG+AYLHEE+ + IIHRDIKLSN+LL+E+FTPKIADFGL RLFPEDKSHISTA+AGTLGY
Sbjct  359   EGMAYLHEESHVRIIHRDIKLSNILLEEDFTPKIADFGLARLFPEDKSHISTAIAGTLGY  418

Query  970   MAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAV  791
             MAPEY+V+GKLTEKADVYSFGVLVIE+VSGKK SS+   S SLLQ  W+L+ + +LYE V
Sbjct  419   MAPEYIVRGKLTEKADVYSFGVLVIEIVSGKKISSYIMNSSSLLQTVWSLYGSNRLYEVV  478

Query  790   DGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFLTSNS  614
             D +LE      EA + LQIGL+C QAS ELRPSMS VVKM++ + +IPQP QPPF+ S+S
Sbjct  479   DPTLEGAFPAEEACQLLQIGLLCAQASAELRPSMSVVVKMVNNNHEIPQPAQPPFINSSS  538

Query  613   AASSGSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
             +  S S    G      QP S+TQSS NT++ES I+PR
Sbjct  539   SEFSKS----GLPGYNFQPGSNTQSSGNTISESQIEPR  572



>ref|XP_006378232.1| hypothetical protein POPTR_0010s05380g [Populus trichocarpa]
 gb|ERP56029.1| hypothetical protein POPTR_0010s05380g [Populus trichocarpa]
Length=488

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/485 (70%), Positives = 390/485 (80%), Gaps = 6/485 (1%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L  F+ F  +N S+SDPRA++AALICTNRTA   +RQ +VANF+AALDA+TPL+  +KY 
Sbjct  8     LLSFLCFF-VNLSLSDPRATQAALICTNRTAAMPERQTFVANFLAALDAVTPLILRQKYA  66

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
               + G G+ TVYAFGECMKDL  TDCNLCFAQCKTQ+LRCLPFQR +RGGR+F DGC+VR
Sbjct  67    AVINGTGSTTVYAFGECMKDLDGTDCNLCFAQCKTQVLRCLPFQRGIRGGRIFCDGCYVR  126

Query  2065  YDDYVFFNESSSLSDKTVCGAEDF-GGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGR  1889
             YDDY FFNE+ S  DKT+C + DF GGN  +F  N   L+  L   A  NDGF+  +V R
Sbjct  127   YDDYDFFNETLSTQDKTICASADFSGGNKTVFSANVLELMRNLSVSAPKNDGFYVGSVDR  186

Query  1888  GNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNS  1709
             GN +V+GLAQCWEFV G +C+ CL  AVS+IGSC PKEEGR LNAGCY+RYSTKKFYDNS
Sbjct  187   GNVSVFGLAQCWEFVNGSACETCLTNAVSRIGSCTPKEEGRALNAGCYLRYSTKKFYDNS  246

Query  1708  TIP-ATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVT  1532
             T P   N+S GR   L VILA T  S A  L++ +  F VR+R+V++R+ RK LGA+LVT
Sbjct  247   TSPIGRNKSRGR---LTVILAVTSSSVAVALMIATTVFFVRRRVVEKRRARKELGALLVT  303

Query  1531  VNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADH  1352
             VNKSKLNFSYE+LEKAT+YF  SNKLGQGGSG VYKG L DG TVAIKRL FNT QW DH
Sbjct  304   VNKSKLNFSYESLEKATNYFHLSNKLGQGGSGSVYKGTLSDGTTVAIKRLLFNTRQWVDH  363

Query  1351  FFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRY  1172
             FFNEVNLISGI HKNL KLLGCSITGPESLLVYE+VPNQSL+DY SA+ N +PLSW  R+
Sbjct  364   FFNEVNLISGIQHKNLAKLLGCSITGPESLLVYEYVPNQSLHDYFSAKTNLRPLSWAMRF  423

Query  1171  KIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTA  992
              IILGTAEGLAYLHEE+EL IIHRDIKLSNVLLDE+F PKIADFGL RLFPEDKSHISTA
Sbjct  424   NIILGTAEGLAYLHEESELRIIHRDIKLSNVLLDEDFNPKIADFGLARLFPEDKSHISTA  483

Query  991   VAGTL  977
             +AGTL
Sbjct  484   IAGTL  488



>ref|XP_006841048.1| hypothetical protein AMTR_s00085p00155370 [Amborella trichopoda]
 gb|ERN02723.1| hypothetical protein AMTR_s00085p00155370 [Amborella trichopoda]
Length=638

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/591 (57%), Positives = 433/591 (73%), Gaps = 8/591 (1%)
 Frame = -2

Query  2383  SDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAF  2204
             SDPR ++AA+IC N+TA    R A+  NF++ALD+LT  + +++Y   V G+  +TVYAF
Sbjct  26    SDPRITQAAIICGNKTA--LDRPAFTRNFLSALDSLTQQIANQRYATVVQGSNPSTVYAF  83

Query  2203  GECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLS  2024
             G+CM DLSQTDC LCF++CKT+I +C+PFQ+    GR F DGC++RYD Y FF+E     
Sbjct  84    GQCMNDLSQTDCQLCFSECKTEIYKCVPFQKGTTRGRTFLDGCYLRYDTYDFFHEILDSE  143

Query  2023  DKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFV  1844
             DK VC    F G+   F RN+  L+  L   A   DGF    V R N++VYGL QCW+ +
Sbjct  144   DKVVCNGSRFNGSERSFVRNSLGLMKNLSAGATGGDGFKVGFVERENTSVYGLVQCWKPL  203

Query  1843  RGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHL  1664
                SC  CL + V  + +CLP  EGRVLN+GCY+RYST+ FY+ +T    +  G R    
Sbjct  204   NMSSCGRCLDSGVVSLSTCLPLVEGRVLNSGCYLRYSTRPFYNVNTSSVASTKGHR--RF  261

Query  1663  PVILATTFGSFAFLLILGSVAFIVRK-RIVKQRKERKRLGAMLVTVNKSKLNFSYETLEK  1487
             PVILA    S A  ++L  + FI  K ++ K+R+E+K+LG +  TVNKSKLNF YE LE+
Sbjct  262   PVILAIVSCSCAVFMLL-VLGFIKGKNKLEKRRREQKQLGQLAATVNKSKLNFKYEMLEE  320

Query  1486  ATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKN  1307
             ATDYFD+SNKLGQGG+G VYKG+LP+G+ VAIKRLFFNT QW D FFNEVNLIS + HKN
Sbjct  321   ATDYFDNSNKLGQGGNGSVYKGILPNGQVVAIKRLFFNTRQWVDEFFNEVNLISDVQHKN  380

Query  1306  LVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHE  1127
             LVKLLGCSITGPESLLVYE+VPN+SL ++     N   LSW  R +II+G AEGLAYLHE
Sbjct  381   LVKLLGCSITGPESLLVYEYVPNKSLDNFLFDNGNSPKLSWNTRCEIIVGVAEGLAYLHE  440

Query  1126  ETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQ  947
             E++L IIHRDIKLSN+LLDE F  KIADFGL R FP+DK+HIST +AGTLGYMAPEY+++
Sbjct  441   ESKLRIIHRDIKLSNILLDENFNAKIADFGLARCFPQDKTHISTGIAGTLGYMAPEYIIR  500

Query  946   GKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLE-ER  770
             GKLTEKADVYSFGVL++E++SG++ +S+ Q +  +LQ  W+L+R+ +LYEAVD SLE   
Sbjct  501   GKLTEKADVYSFGVLIVEILSGRRVNSYSQTTGPVLQVVWDLYRSCRLYEAVDPSLEGGY  560

Query  769   ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ-DIPQPTQPPFLTS  620
             +R + +R LQIGL+C QAS ELRPSM+ VV+M+     +IP PTQPPF+ +
Sbjct  561   SREDVSRVLQIGLLCTQASAELRPSMALVVQMLKDTNCNIPLPTQPPFINT  611



>gb|KGN51784.1| hypothetical protein Csa_5G600370 [Cucumis sativus]
Length=536

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/487 (65%), Positives = 373/487 (77%), Gaps = 2/487 (0%)
 Frame = -2

Query  2437  LSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDS  2258
             L  +L +  FF    +S +DPRA+EAALIC+N TA  ++R  +VANF+ ++DA+TPL+ S
Sbjct  10    LIPFLLMLSFFRLPIQSSADPRATEAALICSNNTASPAERSTFVANFLDSMDAVTPLIAS  69

Query  2257  KKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDG  2078
             +++   + G GN TVYAFGECM DLSQ DC+LCFAQ KTQ+LRCLPFQ   RGGRLFYDG
Sbjct  70    QRFAAVINGTGNTTVYAFGECMNDLSQADCDLCFAQMKTQVLRCLPFQLATRGGRLFYDG  129

Query  2077  CFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAA  1898
             CFVRYD Y FFNES S  D+TVCG  D+ GN  +F  +A  L   L   A  NDGF   +
Sbjct  130   CFVRYDYYNFFNESLSAVDRTVCGKLDYSGNRSVFSDSAMKLARNLSVVAPKNDGFAVGS  189

Query  1897  VGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFY  1718
             V   N +VYGL QCW+FVRG SC  CL  A  +IGSC PK EGRVLNAGCY RYST+KFY
Sbjct  190   VDFRNVSVYGLGQCWKFVRGSSCSKCLVDAAKEIGSCPPKSEGRVLNAGCYFRYSTEKFY  249

Query  1717  DNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAML  1538
              N+T  AT   G  S  L +ILA+   + A  LI+ +V F  R+R++++R E+++LG ++
Sbjct  250   FNTTATAT--GGNNSRRLAIILASVSAAVAAALIISTVLFCARRRVLRKRNEKRQLGPLV  307

Query  1537  VTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWA  1358
               VNKSKLNFSYETLEKAT+YFD SNKLGQGGSG VYKG L DG+ VAIKRLFFNT QW 
Sbjct  308   AIVNKSKLNFSYETLEKATNYFDQSNKLGQGGSGSVYKGTLSDGRVVAIKRLFFNTRQWV  367

Query  1357  DHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQ  1178
             DHFFNEVNLISGI HKNLV LLGCSITGPESLLVYE+VPNQSL+DY    KN QPLSW+ 
Sbjct  368   DHFFNEVNLISGIRHKNLVGLLGCSITGPESLLVYEYVPNQSLHDYLFGNKNVQPLSWQS  427

Query  1177  RYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHIS  998
             R+KI+LGTAEGLAYLHEE+ + IIHRDIKLSN+LLD +FTPKIADFGL RL PEDK+HIS
Sbjct  428   RFKIVLGTAEGLAYLHEESNVKIIHRDIKLSNILLDYDFTPKIADFGLARLLPEDKTHIS  487

Query  997   TAVAGTL  977
             TA+AGTL
Sbjct  488   TAIAGTL  494



>gb|KDO82324.1| hypothetical protein CISIN_1g008239mg [Citrus sinensis]
Length=437

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/439 (69%), Positives = 356/439 (81%), Gaps = 5/439 (1%)
 Frame = -2

Query  2287  LDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRL  2108
             +D +TPL+  ++Y   V G G A+VYAFGECMKDLS  DCNLCFAQCKTQ+L+CLPFQ  
Sbjct  1     MDIVTPLIARQRYAAVVNGTGTASVYAFGECMKDLSPNDCNLCFAQCKTQVLKCLPFQLA  60

Query  2107  VRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKA  1928
              RGGR+FYDGC++RYDDY FFNES S  D+TVCG++DFGGN+ +F  NA  LV  L  +A
Sbjct  61    TRGGRVFYDGCYLRYDDYDFFNESLSSQDRTVCGSKDFGGNNTVFGANAIELVRNLSVQA  120

Query  1927  AANDGFFTAAV--GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNA  1754
               NDGFF  +V   +GN +V+GLAQCWEFV G +C++CL  AVS+I SC  KEEGRVLNA
Sbjct  121   VKNDGFFVGSVTFSKGNVSVHGLAQCWEFVNGSACENCLENAVSRIASCTQKEEGRVLNA  180

Query  1753  GCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVK  1574
             GCY+RYST++FY+NS  P      G  N L VILAT+  + A LL+   VAF VR+++++
Sbjct  181   GCYLRYSTQRFYNNSG-PDPVPGNGGDNKLAVILATS--AVALLLVFSLVAFFVRRKLLQ  237

Query  1573  QRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVA  1394
             +R+ERK+LGA+ V VNKSKLNFSYETLEKAT+YF +SNKLGQGGSG VYKG LP G+ VA
Sbjct  238   KRRERKQLGALQVAVNKSKLNFSYETLEKATNYFHESNKLGQGGSGSVYKGTLPGGEAVA  297

Query  1393  IKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTS  1214
             +KRLF+NTTQW DHFFNEVNLISGI+HKNLVKLLGCSITGPESLLVYEFVPNQSL D   
Sbjct  298   VKRLFYNTTQWVDHFFNEVNLISGINHKNLVKLLGCSITGPESLLVYEFVPNQSLLDNLF  357

Query  1213  ARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGL  1034
              R++ +PLSWE RYKIIL TAEGLAYLHEE++L IIHRDIKLSN+LLDEEFT KIADFGL
Sbjct  358   VRQDVEPLSWEVRYKIILSTAEGLAYLHEESKLRIIHRDIKLSNILLDEEFTAKIADFGL  417

Query  1033  VRLFPEDKSHISTAVAGTL  977
             VRLFPED +HIS  +AGTL
Sbjct  418   VRLFPEDITHISATLAGTL  436



>ref|XP_008785014.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Phoenix 
dactylifera]
Length=687

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/634 (53%), Positives = 423/634 (67%), Gaps = 27/634 (4%)
 Frame = -2

Query  2371  ASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIG-AGNATVYAFGEC  2195
             AS A LIC  RTA  S R A+  N  +A++A+ P V SK+Y   V G + +  VYA GEC
Sbjct  71    ASRATLICGTRTAAPSDRLAFAKNLRSAMEAIAPQVSSKRYARVVAGTSADDRVYASGEC  130

Query  2194  MKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLSDKT  2015
              + LS+  C+ C A CK QILRC P +R  RG R++ DGC +R+DDY FF E+  L +  
Sbjct  131   SEHLSRPACHRCIAWCKAQILRCFPGERPTRGARIYLDGCHLRFDDYDFFGEAPGLDNHL  190

Query  2014  VCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGK  1835
             VC      GN   F   A   VG+   +A  ND FF A+VG+ NS+V+GL  CW+FV  +
Sbjct  191   VCSVVHSNGNRTAFATAARKFVGKSSMRAPPNDSFFAASVGKENSSVHGLGPCWKFVNKR  250

Query  1834  SCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVI  1655
             SC +CL  A ++IG C PK+   +L +GCYMRY   + +++  I     +G     LPV+
Sbjct  251   SCPECLPDAGTRIGHCFPKQGASMLRSGCYMRYPISQLHNDFEIHVV-VAGRHIIKLPVV  309

Query  1654  LATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDY  1475
                       +L+L  V     KR V+ R  RK+LGA+  TV KS L+F+YE LE+AT+Y
Sbjct  310   FP-----IVVILMLIMVLIFFGKRKVETRTVRKQLGALAATVIKSSLHFNYEMLERATNY  364

Query  1474  FDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKL  1295
             FD SNKLGQGGSG V+KGVL D + VA+KRLFF+T QW + FFNE+NLIS I HKNLVKL
Sbjct  365   FDSSNKLGQGGSGSVFKGVLLDDRVVAVKRLFFHTGQW-EKFFNEINLISTIDHKNLVKL  423

Query  1294  LGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETEL  1115
             LGCSITGPESLLVYE+VPN+SL  Y S R+N Q LSWE RY II+G AEGLAYLHEE++L
Sbjct  424   LGCSITGPESLLVYEYVPNKSLCYYFSDRRNAQLLSWEMRYNIIVGAAEGLAYLHEESQL  483

Query  1114  CIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLT  935
              I+HRDIKLSN+LLDE ++PKIADFGLVRL P DK+HI+TA+AGTLGYMAPEY+  GKLT
Sbjct  484   RIVHRDIKLSNILLDESYSPKIADFGLVRLLPGDKTHITTAIAGTLGYMAPEYLASGKLT  543

Query  934   EKADVYSFGVLVIEVVSGKKNSSFYQAS----VSLLQQHWNLFRAGKLYEAVDGSLEERA  767
             EKADV+SFGVL+IEVV+GK+N+S         + +LQ  WN + + ++ EAVD  LE   
Sbjct  544   EKADVFSFGVLLIEVVTGKRNNSRKDEQSNNPLGVLQMVWNCYTSNRMLEAVDPVLEGNF  603

Query  766   RVE-ATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFL---TSN-SAASS  602
              +E A+R L IGL+C Q S ELRPSMSAVVKM+  D  I QPT PPFL   T N SAA  
Sbjct  604   PLEKASRALHIGLLCAQLSAELRPSMSAVVKMLKEDDTITQPTPPPFLGYGTENASAAPK  663

Query  601   GSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
               Y   G           + SS+N+ T S ++PR
Sbjct  664   KIYSQHGS----------SASSINSTTISILEPR  687



>emb|CDY61395.1| BnaA08g30660D [Brassica napus]
Length=599

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/503 (61%), Positives = 385/503 (77%), Gaps = 3/503 (1%)
 Frame = -2

Query  2113  RLVRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGG-NSGLFRRNAAALVGELG  1937
             ++ RGGR+F DGC+VRYD+Y FFNE+ S  D+T C  ++  G N  LFR NAA LV  + 
Sbjct  61    QITRGGRVFSDGCYVRYDEYNFFNETLSSLDQTNCSEKEITGVNRTLFRDNAAELVKFMS  120

Query  1936  RKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLN  1757
              +A  N GF+   V + N TV+GLAQCWE +    C +CL+ A  +IGSCL KEEGR LN
Sbjct  121   EEAVRNGGFYAGFVDKRNVTVHGLAQCWEPLTRSGCVECLSKASEQIGSCLGKEEGRALN  180

Query  1756  AGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIV  1577
             AGCYMR+ST KFY+NS     + +GG  NHL VILA      AF+L++ +V F+ RK++ 
Sbjct  181   AGCYMRFSTHKFYNNSGNSTADGNGGH-NHLVVILAVRCSVVAFVLLVSAVGFLYRKKLA  239

Query  1576  KQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTV  1397
             K+++E K+LG + +  NKS + FSYE LEKATDYF D NKLGQGGSG V+KGVL +GKT+
Sbjct  240   KKQRENKQLGPLFMLANKSNICFSYENLEKATDYFSDKNKLGQGGSGSVFKGVLRNGKTI  299

Query  1396  AIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYT  1217
             A+KRLFFNT QW DHFFNEVNLIS I+HKNLVKLLGCSITGPESLLVYE++ N+SL+DY 
Sbjct  300   AVKRLFFNTKQWVDHFFNEVNLISQINHKNLVKLLGCSITGPESLLVYEYIANKSLHDYL  359

Query  1216  SARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFG  1037
               R++  PL W +R+KI+LGTAEG+AYLHEE+ L IIHRDIKLSN+LL+ +FTP+IADFG
Sbjct  360   FVRQDVPPLDWAKRFKILLGTAEGMAYLHEESNLRIIHRDIKLSNILLEHDFTPRIADFG  419

Query  1036  LVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQ  857
             L RLFP DK+HISTA+AGT GYMAPEY V+GKLTEKADVYSFGVL+IEV++G++N++F Q
Sbjct  420   LARLFPGDKTHISTAIAGTRGYMAPEYAVRGKLTEKADVYSFGVLMIEVITGRRNNAFSQ  479

Query  856   ASVSLLQQHWNLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVV  680
              + S+LQ  W+L+    L + VD  L +   ++EA+R L+IGL+CVQA+ E RP+MSAVV
Sbjct  480   DASSILQTVWSLYGTSNLVQVVDQVLGDNFNKMEASRLLEIGLLCVQAAFEQRPAMSAVV  539

Query  679   KMISGDQDIPQPTQPPFLTSNSA  611
             KMI G  +IP PTQPPFL   S 
Sbjct  540   KMIKGSLEIPTPTQPPFLNPGSV  562



>ref|XP_006584463.1| PREDICTED: protein kinase family protein isoform X2 [Glycine 
max]
Length=539

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/538 (62%), Positives = 406/538 (75%), Gaps = 19/538 (4%)
 Frame = -2

Query  2074  FVRYDDYVFFNESSSLSDKTVCGAEDFGGNS------------GLFRRNAAALVGELGRK  1931
             + RYDDY FF E+ S  D TVCG      NS            G+++ NA ALV  L   
Sbjct  8     YFRYDDYNFFGETRSDQDTTVCGNNSSNNNSNSAANSATNSSSGVYKANAMALVRNLSGL  67

Query  1930  AAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAG  1751
             A  NDGFF  +V R N +VYGLAQCWEFV G +C+ CLA AV++IGSC   +E R L+AG
Sbjct  68    APKNDGFFVGSVERKNVSVYGLAQCWEFVNGSACERCLADAVTRIGSC-STQEARALSAG  126

Query  1750  CYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQ  1571
             CY+RYS++KFY+NS+   T    G+   L  ILA +  + A LL++ +V F  RK +V +
Sbjct  127   CYLRYSSQKFYNNSSDVVTAGKHGKRT-LVKILAASSAALALLLVVVTVVFFTRKNVVTR  185

Query  1570  RKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAI  1391
             R+ER++ GA+L TVNKSKLN  YE LEKAT+YF+++NKLGQGGSG VYKGV+PDG TVAI
Sbjct  186   RRERRQFGALLATVNKSKLNMPYEVLEKATNYFNEANKLGQGGSGSVYKGVMPDGNTVAI  245

Query  1390  KRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSA  1211
             KRL +NTTQWA+HFF EVNLISGIHHKNLVKLLGCSITGPESLLVYE+VPNQSL+D+ S 
Sbjct  246   KRLSYNTTQWAEHFFTEVNLISGIHHKNLVKLLGCSITGPESLLVYEYVPNQSLHDHFSV  305

Query  1210  RKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLV  1031
             R+  QPL+WE R KIILG AEG+AYLHEE+ + IIHRDIKLSN+LL+E+FTPKIADFGL 
Sbjct  306   RRTSQPLTWEMRQKIILGIAEGMAYLHEESHVRIIHRDIKLSNILLEEDFTPKIADFGLA  365

Query  1030  RLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQAS  851
             RLFPEDKSHISTA+AGTLGYMAPEY+V+GKLTEKADVYSFGVLVIE+VSGKK SS+   S
Sbjct  366   RLFPEDKSHISTAIAGTLGYMAPEYIVRGKLTEKADVYSFGVLVIEIVSGKKISSYIMNS  425

Query  850   VSLLQQHWNLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKM  674
              SLLQ  W+L+ + +LYE VD +LE      EA + LQIGL+C QAS ELRPSMS VVKM
Sbjct  426   SSLLQTVWSLYGSNRLYEVVDPTLEGAFPAEEACQLLQIGLLCAQASAELRPSMSVVVKM  485

Query  673   ISGDQDIPQPTQPPFLTSNSAASSGSYPNRGGvtpysqpssstqssVNTMTESWIDPR  500
             ++ + +IPQP QPPF+ S+S+  S S    G      QP S+TQSS NT++ES I+PR
Sbjct  486   VNNNHEIPQPAQPPFINSSSSEFSKS----GLPGYNFQPGSNTQSSGNTISESQIEPR  539



>gb|KCW86683.1| hypothetical protein EUGRSUZ_B03305 [Eucalyptus grandis]
Length=506

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/494 (62%), Positives = 365/494 (74%), Gaps = 5/494 (1%)
 Frame = -2

Query  2443  ASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLV  2264
             AS+   +F  +FF ++   + DPRA+EAALIC+NRT P   R+A+ ++   A+DA++P +
Sbjct  7     ASVPLVVFSVLFFAAL--CLCDPRANEAALICSNRTTPLPDRRAFASSVAEAMDAVSPQI  64

Query  2263  DSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFY  2084
             ++++Y   V GAGN TVYAF ECM+DL + DC+LC A+ K QILRCLPFQ   RGGRLFY
Sbjct  65    NARQYASAVGGAGNNTVYAFAECMEDLDRIDCDLCVARAKVQILRCLPFQWGTRGGRLFY  124

Query  2083  DGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFT  1904
             DGC++RYDDY FFNES S  D TVCG  DFGGN  +F  N   L   L  +A  N GF  
Sbjct  125   DGCYLRYDDYNFFNESLSPQDTTVCGTGDFGGNQAMFMNNVVELGRNLSLQAPINGGFSV  184

Query  1903  AAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKK  1724
              +V RGN +VYGLAQCW+ V G  C +CL     +I SC PKEEGR LNAGCY  YST+K
Sbjct  185   GSVIRGNVSVYGLAQCWKLVNGSECQNCLNNTAVRIDSCPPKEEGRGLNAGCYFMYSTEK  244

Query  1723  FYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGA  1544
             FY NST P     G R     +ILA    + A LLI+   AF++R+++V++ +E+K+LG 
Sbjct  245   FYYNSTEPFRRDEGERR---LIILAAVSSTLALLLIIALAAFLIRRKLVRKTREKKQLGL  301

Query  1543  MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQ  1364
             ++  VN SK NFSYE LEKAT YF  S+KLGQGGSG VYKG+LPDGK VAIKRL FNTTQ
Sbjct  302   LVDVVNNSKRNFSYELLEKATSYFHQSSKLGQGGSGSVYKGILPDGKPVAIKRLVFNTTQ  361

Query  1363  WADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSW  1184
             W DHFFNEVNLIS I HKNLVKLLGCSITGPESLLVYE++PN SL+D+  A+KN  PLSW
Sbjct  362   WVDHFFNEVNLISDIDHKNLVKLLGCSITGPESLLVYEYIPNLSLHDHLFAKKNIPPLSW  421

Query  1183  EQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSH  1004
             E R KIILGTAEGLAYLHEE+ L IIHRDIKL+NVLLD++FTPKIADFGL RLFPED +H
Sbjct  422   ETRCKIILGTAEGLAYLHEESNLRIIHRDIKLTNVLLDKDFTPKIADFGLARLFPEDATH  481

Query  1003  ISTAVAGTLGYMAP  962
             IST VAGTL    P
Sbjct  482   ISTGVAGTLYVTFP  495



>gb|KCW86684.1| hypothetical protein EUGRSUZ_B03305 [Eucalyptus grandis]
Length=506

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/494 (62%), Positives = 364/494 (74%), Gaps = 5/494 (1%)
 Frame = -2

Query  2443  ASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLV  2264
             AS+   +F  +FF ++   + DPRA+EAALIC+NRT P   R+A+ ++   A+DA++P +
Sbjct  7     ASVPLVVFSVLFFAAL--CLCDPRANEAALICSNRTTPLPDRRAFASSVAEAMDAVSPQI  64

Query  2263  DSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFY  2084
             ++++Y   V GAGN TVYAF ECM+DL + DC+LC A+ K QILRCLPFQ   RGGRLFY
Sbjct  65    NARQYASAVGGAGNNTVYAFAECMEDLDRIDCDLCVARAKVQILRCLPFQWGTRGGRLFY  124

Query  2083  DGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFT  1904
             DGC++RYDDY FFNES S  D TVCG  DFGGN  +F  N   L   L  +A  N GF  
Sbjct  125   DGCYLRYDDYNFFNESLSPQDTTVCGTGDFGGNQAMFMNNVVELGRNLSLQAPINGGFSV  184

Query  1903  AAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKK  1724
              +V RGN +VYGLAQCW+ V G  C +CL     +I SC PKEEGR LNAGCY  YST+K
Sbjct  185   GSVIRGNVSVYGLAQCWKLVNGSECQNCLNNTAVRIDSCPPKEEGRGLNAGCYFMYSTEK  244

Query  1723  FYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGA  1544
             FY NST P     G R     +ILA    + A LLI+   AF++R ++V++ +E+K+LG 
Sbjct  245   FYYNSTEPFRRDEGERR---LIILAAVSSTLALLLIIALAAFLIRMKLVRKTREKKQLGL  301

Query  1543  MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQ  1364
             ++  VN SK NFSYE LEKAT YF  S+KLGQGGSG VYKG+LPDGK VAIKRL FNTTQ
Sbjct  302   LVDVVNNSKRNFSYELLEKATSYFHQSSKLGQGGSGSVYKGILPDGKPVAIKRLVFNTTQ  361

Query  1363  WADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSW  1184
             W DHFFNEVNLIS I HKNLVKLLGCSITGPESLLVYE++PN SL+D+  A+KN  PLSW
Sbjct  362   WVDHFFNEVNLISDIDHKNLVKLLGCSITGPESLLVYEYIPNLSLHDHLFAKKNIPPLSW  421

Query  1183  EQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSH  1004
             E R KIILGTAEGLAYLHEE+ L IIHRDIKL+NVLLD++FTPKIADFGL RLFPED +H
Sbjct  422   ETRCKIILGTAEGLAYLHEESNLRIIHRDIKLTNVLLDKDFTPKIADFGLARLFPEDATH  481

Query  1003  ISTAVAGTLGYMAP  962
             IST VAGTL    P
Sbjct  482   ISTGVAGTLYVTFP  495



>gb|KCW86686.1| hypothetical protein EUGRSUZ_B03305 [Eucalyptus grandis]
Length=507

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/494 (60%), Positives = 359/494 (73%), Gaps = 5/494 (1%)
 Frame = -2

Query  2443  ASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLV  2264
             AS+   +F  +FF ++     DPRA+E  LIC+NRT P   R+A+  +F  A+DA++P +
Sbjct  8     ASVPLLVFSALFFAAL--CFCDPRANEVDLICSNRTTPLPDRRAFATSFAEAMDAVSPQI  65

Query  2263  DSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFY  2084
             ++++Y   V  AGN TVYAF ECM+DL + DC+LC A+ K QILRC   Q+  RGGRLFY
Sbjct  66    NAQQYASAVGRAGNNTVYAFAECMEDLDRIDCDLCIARAKVQILRCSALQQGTRGGRLFY  125

Query  2083  DGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFT  1904
             DGC++RYDDY FFNES S  D TVCG EDFGGN  +F  N   L   L  +A  N GF  
Sbjct  126   DGCYLRYDDYYFFNESLSPQDTTVCGTEDFGGNQTMFMNNVVELGRNLSLQAPINGGFSV  185

Query  1903  AAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKK  1724
              +V RGN +VYGLAQCW+ V G  C +CL     +I SC PK+EGR LNAGCY  YST+K
Sbjct  186   GSVIRGNVSVYGLAQCWKLVNGSECQNCLNNTAVRIDSCPPKKEGRGLNAGCYFMYSTEK  245

Query  1723  FYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGA  1544
             FY N+T P     G R     +ILA    + A LLI+   AF++R ++V++ +E+K+LG 
Sbjct  246   FYYNNTKPFQINEGERR---LIILAAVSSTLALLLIIALAAFLIRMKLVRKTREKKQLGL  302

Query  1543  MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQ  1364
             ++  VN SK NFSYE LEKAT YF  S+KLGQGGSG VYKG+LPDGK VAIKRL FNTTQ
Sbjct  303   LVDVVNNSKRNFSYELLEKATSYFHQSSKLGQGGSGSVYKGILPDGKPVAIKRLVFNTTQ  362

Query  1363  WADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSW  1184
             W DHFFNEVNLIS I HKNLVKLLGCSITGPESLLVYE++PN SL+D+  A+KN  PLSW
Sbjct  363   WVDHFFNEVNLISDIDHKNLVKLLGCSITGPESLLVYEYIPNLSLHDHLFAKKNIPPLSW  422

Query  1183  EQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSH  1004
             E R KIILGTAEGLAYLHEE+ L IIHRDIKL+NVLLD++FTPKIADFGL RLFPED +H
Sbjct  423   ETRCKIILGTAEGLAYLHEESNLRIIHRDIKLTNVLLDKDFTPKIADFGLARLFPEDATH  482

Query  1003  ISTAVAGTLGYMAP  962
             IST VAGTL    P
Sbjct  483   ISTGVAGTLYVTFP  496



>emb|CDP02086.1| unnamed protein product [Coffea canephora]
Length=657

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/615 (50%), Positives = 409/615 (67%), Gaps = 26/615 (4%)
 Frame = -2

Query  2419  LFIFFLSI-NRSVSDPRASEAALIC-TNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L IF L++ + + SDPR  E+ L C  NR  P +   +Y+  FV  ++ ++ LV    +G
Sbjct  15    LLIFILNLFSFTFSDPRIGESGLFCGLNRPPPNT---SYIPLFVKEMEKISALVTDNNWG  71

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
                +     ++YA  +C +DLS TDC LC+A  +T++ RCLP        R++ DGCF+R
Sbjct  72    HYAMNQTRISIYALAQCYQDLSHTDCLLCYAASRTRLPRCLP----AVSARIYLDGCFLR  127

Query  2065  YDDYVFFNESSS-LSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGR  1889
             YDDY FFNES+  + D   C +     ++G+     AA  G+  R+   N     AA+G 
Sbjct  128   YDDYNFFNESTDPIRDTFNCSS-----SAGVATAEEAASFGKRVRELVDNVST-AAAMGG  181

Query  1888  GNST-----VYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKK  1724
             G +      VYGLAQCW+ +  + C +CLA A   +  CLP  EGR LNAGCY+RYST+K
Sbjct  182   GYAVRDLNGVYGLAQCWKTLSKQGCKECLAKASRNVKGCLPSREGRGLNAGCYLRYSTQK  241

Query  1723  FYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGA  1544
             FY +     ++ SG       V +A++    AF +I    A+ +  R  K ++ER+ LG 
Sbjct  242   FYTDRPQNGSSSSGASKTGKTVAIASSVT--AFCMISAFAAYALYARFKKTKQERRNLGR  299

Query  1543  MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQ  1364
             +  T NKS LNF YETLE+AT+YFD   K+GQGG+G V++G LPDGK +A+KRLFFNT Q
Sbjct  300   ISSTYNKSNLNFKYETLERATNYFDPKTKIGQGGAGSVHRGTLPDGKVIAVKRLFFNTRQ  359

Query  1363  WADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP-LS  1187
             W D FFNEVNLISGI HKNLVKLLGCSI GPESLLVYEFVPN SL  Y   +K  +  LS
Sbjct  360   WVDEFFNEVNLISGIQHKNLVKLLGCSIEGPESLLVYEFVPNMSLDQYLFDKKEVKVVLS  419

Query  1186  WEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKS  1007
             W++R++II G AEG+A+LH   E+ I+HRDIK SNVLLDE  TPKIADFGL R F +DK+
Sbjct  420   WKERFQIIAGIAEGIAFLHGGAEIRIVHRDIKSSNVLLDENLTPKIADFGLARHFADDKT  479

Query  1006  HISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHW  827
             H+ST +AGTLGYMAPEY+V+G+LTEKADVYSFGVLV+E+V G+KN++F + SVSLLQ  W
Sbjct  480   HLSTGIAGTLGYMAPEYLVKGQLTEKADVYSFGVLVLEIVCGRKNNAFVEESVSLLQTVW  539

Query  826   NLFRAGKLYEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS-GDQDI  653
               +++ KL E VD SLE E   +EA+  L+IGL+C QAS   RPSM  VV+M++  +  +
Sbjct  540   QFYKSDKLAEKVDPSLEGEFPAIEASNVLKIGLLCTQASASSRPSMDEVVEMLTDSNGQV  599

Query  652   PQPTQPPFLTSNSAA  608
             P+P QPPF+ S+  A
Sbjct  600   PEPNQPPFINSSVLA  614



>ref|XP_011098445.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Sesamum 
indicum]
Length=661

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/606 (49%), Positives = 392/606 (65%), Gaps = 17/606 (3%)
 Frame = -2

Query  2422  FLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGE  2243
             F  +       S+S+PR SEA L C     P +   +Y+  FV  ++ L+ LV +  +G 
Sbjct  16    FFLLLLFHAPFSLSNPRISEAGLFCGQSRPPPNV--SYIPLFVRGMEVLSQLVTANDWGN  73

Query  2242  TVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRY  2063
               + A N ++Y   +C  DLS  DC  C+A  +T++ RCLP       GR+F DGCF+RY
Sbjct  74    YAVNATNISIYTLAQCYADLSHNDCLQCYAASRTRLPRCLP----AVSGRIFLDGCFLRY  129

Query  2062  DDYVFFNESSSLS-DKTVCGAE--DFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVG  1892
             D Y FFNES   + DK  C +     GG    F ++   L+  L  +A  N  +      
Sbjct  130   DSYAFFNESVDPAWDKVNCNSSVGSAGGVGLEFEKDVRELIDNLTARAVVNGRYAVM---  186

Query  1891  RGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDN  1712
              GN  V+GLA+CW  V  + C  CLA A   IG CLP +EGR LN GCY+RYST+KF+ N
Sbjct  187   -GNKGVFGLAECWNTVNREGCRACLAKASRDIGGCLPGKEGRALNTGCYLRYSTQKFFSN  245

Query  1711  STIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVT  1532
              +    + SG       V +  +  +F  L +    A+    R  K+ +ER  LG +  +
Sbjct  246   QSQETNSNSGASRRGAIVAIVLSVAAFCMLCLFA--AYAAYGRWKKRTQERNNLGRISYS  303

Query  1531  VNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADH  1352
              NKS LNF YETLEKAT+YFD S KLGQGG+G VY+G LP+GKTVA+KRLFF+T QW D 
Sbjct  304   YNKSNLNFKYETLEKATNYFDPSRKLGQGGAGSVYRGTLPNGKTVAVKRLFFSTRQWVDE  363

Query  1351  FFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRY  1172
             FFNEVNLISGI HKNLVKLLGCSI GPESLLVYEFVPN+SL  Y   +   + L+W++RY
Sbjct  364   FFNEVNLISGIEHKNLVKLLGCSIEGPESLLVYEFVPNKSLEQYLLDKNKVKILNWKERY  423

Query  1171  KIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTA  992
              II+GTAEG+A+LH  +E  IIHRDIK SN+LLDE    KIADFGL R F  DK+H+ST 
Sbjct  424   NIIVGTAEGIAFLHGGSEFRIIHRDIKSSNILLDENLDAKIADFGLARNFAADKTHLSTG  483

Query  991   VAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRA  812
             +AGTLGYMAPEY+V+G+LTEKADVYS+GVLV+E+V G+KN++F + S SLLQ  W L++ 
Sbjct  484   IAGTLGYMAPEYLVKGQLTEKADVYSYGVLVLEIVCGRKNNAFVEDSGSLLQTVWKLYKT  543

Query  811   GKLYEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ-DIPQPTQ  638
              +L E+VD  L  +    EA + L++GL+C QAS   RPSM+  V+M++ +  ++P+P+Q
Sbjct  544   DRLTESVDPCLNGDFPATEAVKVLKVGLLCAQASVAQRPSMAEAVRMLTDENYEVPEPSQ  603

Query  637   PPFLTS  620
             PPFL +
Sbjct  604   PPFLNT  609



>ref|XP_004306354.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Fragaria vesca subsp. vesca]
Length=651

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/607 (50%), Positives = 404/607 (67%), Gaps = 24/607 (4%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             S+ DPR SEAAL C     P +   +++  FVA +++L+ L+    +G   + +    +Y
Sbjct  24    SLCDPRTSEAALHCGALKPPPNA--SFIPTFVAEMESLSELITKHHWGTHFVNS-TPPMY  80

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSS  2030
                +C  DLS TDC LC+A  +T+I RCLP         ++ DGCF+RYD Y+F+NE+S 
Sbjct  81    GLAQCFNDLSHTDCLLCYAASRTKIPRCLP----SLSATIYLDGCFLRYDSYIFYNEASV  136

Query  2029  LS-DKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCW  1853
                D  VCG E+   +  +F  N   +V  + R AA N GF  A VG     VYGL QCW
Sbjct  137   PGVDSVVCGGEE-AADEAVFEGNVKEVVERVKRSAAENGGFGVAEVG---GEVYGLGQCW  192

Query  1852  EFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRS  1673
             E V G+ C +CL    + +  C  K EGR LNAGCY+RYST+KFY++      ++   R 
Sbjct  193   ETVGGEGCRECLEKGGAVVRGCGVKTEGRALNAGCYLRYSTRKFYNDQGETEHHEHERRG  252

Query  1672  NHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNK-SKLNFSYET  1496
                 +I+A      AF ++    A+    ++V+ RKE   LG + ++++K S L+F YET
Sbjct  253   ----IIIAIVLAVVAFTMLSLFAAYAGYTKLVQVRKEGSNLGLVSISISKYSSLSFKYET  308

Query  1495  LEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIH  1316
             LEKATDYF+ S K+G+GG G V+KG LP GKTVA+KRLF+NT QW D FFNEVNLISGI 
Sbjct  309   LEKATDYFNSSRKIGEGGGGTVFKGTLPSGKTVAVKRLFYNTKQWVDEFFNEVNLISGIQ  368

Query  1315  HKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAY  1136
             HK+LVKLLGCSI GPESLLVYE+VPN+SL  +   + + Q L+W+QR+ II+GTAEG+AY
Sbjct  369   HKHLVKLLGCSIEGPESLLVYEYVPNRSLDQFLFDKNSDQFLNWKQRFDIIVGTAEGIAY  428

Query  1135  LHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEY  956
             LHE +E+ IIHRDIK SNVLLDE  +PKIADFGL R F  DKSH+ST +AGTLGYMAPEY
Sbjct  429   LHEGSEVRIIHRDIKSSNVLLDENLSPKIADFGLARCFALDKSHLSTGIAGTLGYMAPEY  488

Query  955   VVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASV---SLLQQHWNLFRAGKLYEAVDG  785
             +VQG+LTEKADVYSFGVLV+E+VSG +NS+F Q +    SLL + W  +R+ +L E VD 
Sbjct  489   LVQGQLTEKADVYSFGVLVLEIVSGMRNSTFKQENSNTDSLLHKVWKHYRSNELAEVVDP  548

Query  784   SLE--ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQD--IPQPTQPPFLTSN  617
              L+  E    E +  LQIGL+C QAS  LRPSM+ VV M++ +++  IP P QPPFL+++
Sbjct  549   RLKNHELPAKEVSNVLQIGLLCTQASVALRPSMAEVVLMLTANKETHIPVPNQPPFLSAS  608

Query  616   SAASSGS  596
             +   + S
Sbjct  609   TLEQASS  615



>gb|EYU44774.1| hypothetical protein MIMGU_mgv1a002463mg [Erythranthe guttata]
Length=671

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/616 (49%), Positives = 403/616 (65%), Gaps = 24/616 (4%)
 Frame = -2

Query  2428  WLFLFIFFLS----INRSVSDPRASEAALIC-TNRTAPQSQRQAYVANFVAALDALTPLV  2264
             W+  FIFF++       S+SDPR SEA L C  +R  P S   +Y+  FV A++ L+  V
Sbjct  13    WITPFIFFITALILFPLSLSDPRISEAGLFCGQSRPPPNS---SYIPLFVNAMEVLSQQV  69

Query  2263  DSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFY  2084
              +  +G   + + N +VY   +C  DLS  DC LC+A  +T++ RCLP       GR+F 
Sbjct  70    TANDWGHYAVNSTNISVYNLAQCYGDLSHNDCLLCYAASRTRLPRCLP----AVSGRIFL  125

Query  2083  DGCFVRYDDYVFFNESS-SLSDKTVCGAEDFGGNSGL---FRRNAAALVGELGRKAAAND  1916
             DGCF+RYD Y FFNESS ++ D   C +    G   +   F +N   L+  +   A A+ 
Sbjct  126   DGCFLRYDSYAFFNESSDAVLDTVNCNSSVGVGGGVVDLEFGKNVGELIDNVTASAVASG  185

Query  1915  GFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRY  1736
              +      +G+  V+GLA+CW  V  + C  CLA A  +I +CLP +EGR LN GCY+RY
Sbjct  186   AYAV----QGSKGVFGLAECWNTVSREGCRACLAKANREIRACLPNKEGRALNTGCYLRY  241

Query  1735  STKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERK  1556
             ST+KF+ N +  + + SG   +     LA      AF ++     +    R  K+R+ R 
Sbjct  242   STEKFFSNQSHDSNHNSG--VSRTGATLAIVLSVVAFCMLSFFAGYAAYGRWRKRRQARD  299

Query  1555  RLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFF  1376
              LG +  + NKS LNF YETLEKAT+YFDDS K+GQGG+G VY+G L +GKTVA+KRLFF
Sbjct  300   NLGQISYSYNKSNLNFKYETLEKATNYFDDSRKVGQGGAGSVYRGTLSNGKTVAVKRLFF  359

Query  1375  NTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQ  1196
             +T QW D FFNEVNLISGI H NLVKLLGCSI GPESLLVYEF+PN+SL  Y   +   +
Sbjct  360   STRQWVDEFFNEVNLISGIDHNNLVKLLGCSIEGPESLLVYEFIPNKSLEQYLFDKNKVK  419

Query  1195  PLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPE  1016
              LSW++R  II+G AEGL +LH    + IIHRDIK SNVLLDE   PKIADFGL R F  
Sbjct  420   ILSWKERQNIIVGIAEGLDFLHTGCNMRIIHRDIKSSNVLLDENLDPKIADFGLARCFAA  479

Query  1015  DKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQ  836
             D++H+ST +AGTLGYMAPEY+V+G+LTEKADVYSFGVLV+E+V+G+K+++F + S SLLQ
Sbjct  480   DQTHLSTGIAGTLGYMAPEYLVKGQLTEKADVYSFGVLVLEIVTGRKSNAFVEDSGSLLQ  539

Query  835   QHWNLFRAGKLYEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ  659
               W LF+  KL E+VD  L+ +    E T+ L+IGL+C QAS  LRPSM+ VV+M+  + 
Sbjct  540   TVWKLFKRDKLTESVDPCLKGDFPATETTKVLRIGLLCAQASVALRPSMAEVVRMLRDEN  599

Query  658   -DIPQPTQPPFLTSNS  614
              +IP+P QPPF+ + +
Sbjct  600   YEIPEPRQPPFINTTA  615



>ref|XP_006841049.1| hypothetical protein AMTR_s00085p00156760 [Amborella trichopoda]
 gb|ERN02724.1| hypothetical protein AMTR_s00085p00156760 [Amborella trichopoda]
Length=644

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/599 (52%), Positives = 390/599 (65%), Gaps = 18/599 (3%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNAT--  2216
             S+SDPR + AALIC    +  S   A++ +FV+A+++L   +    +  +V    ++T  
Sbjct  21    SLSDPRINRAALICD--PSRSSNAAAFIQSFVSAMESLNKQIGPSPFSTSVSSGNSSTVR  78

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             VYA  +CM DLS TDC LCFA+C+T++  CLP        R+F DGCF+RYD+Y FFNES
Sbjct  79    VYALAQCMNDLSPTDCLLCFAECRTKLPACLP----SNSARIFLDGCFLRYDNYSFFNES  134

Query  2035  SSLSDKTVCGAEDF-GGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--GRGNSTVYGL  1865
                 D TVCG     G ++  F+R    +V  +   A  N GF  A          VY L
Sbjct  135   FGGDDLTVCGPNKLLGFSTSEFKRRVEDVVRNVSLGAVGNGGFCVAEREGDVAAPAVYAL  194

Query  1864  AQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQS  1685
              QCW  +   SC  CL  A  ++  C    E R L  GCYMRYST+ FYD          
Sbjct  195   GQCWRSLSMGSCKQCLEKAAEELRGCSDAVEARALITGCYMRYSTENFYDEGG--GGGDG  252

Query  1684  GGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFS  1505
             GGR N L VILA     F  ++ +    ++   ++ K+RKERK LG +  T++KS LNF 
Sbjct  253   GGRPN-LAVILAIASSVFVAMMFVSFGVYVAHNKLSKRRKERKDLGRLSTTLSKSCLNFK  311

Query  1504  YETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLIS  1325
             YE LEKATDYF  S KLGQGGSG VYKGVL DG  VA+KRLFFNT QW D FFNEVNLIS
Sbjct  312   YEVLEKATDYFSPSMKLGQGGSGSVYKGVLHDGTIVAVKRLFFNTRQWVDEFFNEVNLIS  371

Query  1324  GIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEG  1145
             GI HKNLV LLGCSI GPESLLVYE+VPN+SL  +   +   Q +SW+QRYKII+G AEG
Sbjct  372   GIQHKNLVGLLGCSIEGPESLLVYEYVPNKSLDQFLFEKNKTQVISWQQRYKIIVGAAEG  431

Query  1144  LAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMA  965
             LA+LHE ++  IIHRDIK SN+L+DE+   KIADFGL R F  DK+H+ST +AGTLGYMA
Sbjct  432   LAFLHEGSKFRIIHRDIKSSNILVDEKLEAKIADFGLARCFSHDKTHLSTGIAGTLGYMA  491

Query  964   PEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDG  785
             PEY+V+G+LTEKADVYSFGVLV+EV+ G+KNS +   S S+LQ  W  F++  L EAVD 
Sbjct  492   PEYLVRGQLTEKADVYSFGVLVLEVICGRKNSVYAPQSGSILQSVWEHFKSNSLAEAVDQ  551

Query  784   SLEER--ARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS-GDQDIPQPTQPPFLTSN  617
              L +   AR +A+  LQIGL+C QAS  LRPSMS VV+M++  D  IP P QPPFL +N
Sbjct  552   GLRDNFPAR-QASNVLQIGLLCTQASANLRPSMSTVVRMLTDDDHPIPLPMQPPFLNTN  609



>ref|XP_006338584.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Solanum tuberosum]
Length=664

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/621 (49%), Positives = 406/621 (65%), Gaps = 25/621 (4%)
 Frame = -2

Query  2458  MNRKMASLSKWLFLFIFFLSINRSVSDPRASEAALIC-TNRTAPQSQRQAYVANFVAALD  2282
             ++R    L  W  + +   ++    +DPR SE+ L+C TNRT P       +  FV  ++
Sbjct  3     LSRSNFPLLNWTVILLLNFAL-ICEADPRISESGLVCGTNRTTPA----IIIPQFVKLME  57

Query  2281  ALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVR  2102
              ++  V    +G   + + N ++YA   C +DL   DC LC+A  +T++ RCLP     +
Sbjct  58    VVSQRVTDNNWGNHYVNSTNISIYALANCYQDLPHQDCLLCYAASRTRLPRCLPG----K  113

Query  2101  GGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSG--LFRRNAAA--LVGELGR  1934
              GR++ DGCF+RYD Y FFNE++  +  TV  +      +G  L   NA+A  L+ EL +
Sbjct  114   SGRIYLDGCFLRYDQYNFFNETTDSAKDTVNCSSSIAVATGQELATLNASAGNLIDELTK  173

Query  1933  KAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNA  1754
              A AN G+  A +    + VYGLAQCW+ V    C  CL  A   I  C P  + R L A
Sbjct  174   TAVANGGYAAANL----NGVYGLAQCWKTVSTSGCKKCLDKASRDIKRCFPNRDARALIA  229

Query  1753  GCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVK  1574
             GCY+RYST+ F ++   P+ N SGG S    VI+A   G  AF ++  S A+  RKR ++
Sbjct  230   GCYLRYSTQNFLND---PSGNSSGGVSKG--VIVAIVLGVTAFTMLALSAAYTARKRSLR  284

Query  1573  QRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVA  1394
             +++ R  LG +  + NKS LNF YE LEKAT+YFD S K+GQGG+G VYKG LP+G  +A
Sbjct  285   RKRARINLGKISNSYNKSSLNFKYENLEKATNYFDPSTKVGQGGNGSVYKGTLPNGNVIA  344

Query  1393  IKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTS  1214
             +KRLFFNT QW D FFNEVNLI GI HKNLVKLLGCSI GPESLLVYEFV N+SL  Y  
Sbjct  345   VKRLFFNTRQWVDDFFNEVNLIHGIEHKNLVKLLGCSIEGPESLLVYEFVTNKSLDQYLF  404

Query  1213  ARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGL  1034
              +   + LSWE+R++II+GTA+G+ +LH  +E+ IIHRDIK SNVLLDE    KIADFGL
Sbjct  405   DKDKVKILSWEERFRIIVGTAQGIDFLHGGSEIRIIHRDIKSSNVLLDENLEAKIADFGL  464

Query  1033  VRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQA  854
              R F  DK+H+ST +AGTLGYMAPEY+V+G+LTEKADVYS+GVLV+E+VSG+K+ +F + 
Sbjct  465   ARCFGADKTHLSTGIAGTLGYMAPEYLVKGQLTEKADVYSYGVLVLEIVSGRKSIAFAED  524

Query  853   SVSLLQQHWNLFRAGKLYEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVK  677
             S SLLQ  W L+   ++ EA+D  L+ +    EA++ L++GL+C QAS  LRPSMS VV+
Sbjct  525   SGSLLQTVWKLYTTNQVTEALDPLLKGDFPPEEASKVLKVGLLCTQASVALRPSMSEVVQ  584

Query  676   MISGD-QDIPQPTQPPFLTSN  617
             M++ +   IP+P QPPFL SN
Sbjct  585   MLTCEGYQIPEPCQPPFLNSN  605



>ref|XP_004232315.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Solanum 
lycopersicum]
Length=668

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/614 (49%), Positives = 401/614 (65%), Gaps = 25/614 (4%)
 Frame = -2

Query  2437  LSKWLFLFIFFLSINRSVSDPRASEAALIC-TNRTAPQSQRQAYVANFVAALDALTPLVD  2261
             L  W+ + +   ++    +DPR SE+ LIC TNRT         +  FV  ++ ++  V 
Sbjct  14    LVNWMVILLLNFAL-ICEADPRISESGLICGTNRTTAA----IIIPQFVKLMEVVSQRVT  68

Query  2260  SKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYD  2081
                +G   + + N ++YA   C +DL   DC LC+A  +T++ RCLP     + GR++ D
Sbjct  69    DNNWGNHGVNSTNISIYALANCYQDLPHQDCLLCYAASRTRLPRCLPG----KSGRIYLD  124

Query  2080  GCFVRYDDYVFFNESS-SLSDKTVCGAED---FGGNSGLFRRNAAALVGELGRKAAANDG  1913
             GCF+RYD Y FFNE++ S  D+  C + +    G        +A  L+ EL + A AN G
Sbjct  125   GCFLRYDHYNFFNETTDSAEDRVNCSSSNGVATGQEVATLNASAGNLIDELTKTAVANGG  184

Query  1912  FFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYS  1733
             +  A +    + VYGLAQCW  +    C  CL  A   I  CLP  + R L AGCY+RYS
Sbjct  185   YAAANL----NGVYGLAQCWRTLSTSGCKKCLDKASRDIKGCLPSRDARALIAGCYLRYS  240

Query  1732  TKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKR  1553
             T+KF ++   P+ N SGG S    VI+A   G  AF ++  S A+  RKR +++++ R  
Sbjct  241   TQKFLND---PSGNSSGGISKG--VIVAIVLGVTAFTMLALSAAYTARKRSLRRKRARIN  295

Query  1552  LGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFN  1373
             LG +  +  KS LNF YE LEKAT+YFD S K+GQGG+G VYKG LP+G  +A+KRLFFN
Sbjct  296   LGKISNSYKKSSLNFKYENLEKATNYFDPSTKVGQGGNGSVYKGTLPNGNVIAVKRLFFN  355

Query  1372  TTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP  1193
             T QW D FFNEVNLI GI HKNLVKLLGCSI GPESLLVYEFV N+SL  Y   +   + 
Sbjct  356   TRQWVDDFFNEVNLIHGIEHKNLVKLLGCSIEGPESLLVYEFVTNKSLDQYLFDKDKVKI  415

Query  1192  LSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPED  1013
             L WE+R++II+GTA+G+ +LH  +E+ IIHRDIK SNVLLDE    KIADFGL R F  D
Sbjct  416   LRWEERFRIIVGTAQGIDFLHGGSEIRIIHRDIKSSNVLLDENLEAKIADFGLARCFGAD  475

Query  1012  KSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQ  833
             K+H+ST +AGTLGYMAPEY+V+G+LTEKADVYS+GVLV+E+VSG+K+ +F + S SLLQ 
Sbjct  476   KTHLSTGIAGTLGYMAPEYLVKGQLTEKADVYSYGVLVLEIVSGRKSIAFAEDSGSLLQT  535

Query  832   HWNLFRAGKLYEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGD-Q  659
              W L+   ++ EA+D  L+ +  R EA++ L++GL+C QAS  LRPSMS VV+M++ +  
Sbjct  536   VWKLYTTNQVTEALDPLLKGDFPREEASKVLKVGLLCTQASVALRPSMSEVVQMLTCEGY  595

Query  658   DIPQPTQPPFLTSN  617
              IP+P QPPFL SN
Sbjct  596   QIPEPCQPPFLNSN  609



>ref|XP_009797283.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Nicotiana 
sylvestris]
Length=663

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/615 (49%), Positives = 403/615 (66%), Gaps = 25/615 (4%)
 Frame = -2

Query  2431  KWLFLFIFFLSINRSVSDPRASEAALIC-TNRTAPQSQRQAYVANFVAALDALTPLVDSK  2255
             KW+ +F+    +    +DPR SEA L+C TNRT+P       +  FV  ++ ++  V  +
Sbjct  12    KWIMIFLVSFGL-ICEADPRISEAGLVCGTNRTSPS----VIIPQFVKLMEVVSQRVPEQ  66

Query  2254  KYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGC  2075
              +G   + + N +++A   C +DL +TDC LC+A  +T++ RCLP     + GR++ DGC
Sbjct  67    GWGSHGVNSTNISIFALANCYEDLPRTDCLLCYAASRTRLPRCLPG----KSGRIYLDGC  122

Query  2074  FVRYDDYVFFNESSSLSDKTVCGAEDFGGNSG----LFRRNAAALVGELGRKAAANDGFF  1907
             F+RYD Y FFNE++   +  V  +   G  SG         A  L+  L   A AN G+ 
Sbjct  123   FLRYDIYDFFNETTDSKEDKVNCSSSIGLASGQELTTLTVTAGNLITNLTGTAVANGGYA  182

Query  1906  TAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTK  1727
              A +    + VYGLAQCW+ V  K C +CL  A  +I  C P  + R L AGCY+RYST+
Sbjct  183   VAHL----NGVYGLAQCWKTVSKKGCRECLDKASREIKGCFPSRDARALIAGCYLRYSTQ  238

Query  1726  KFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLG  1547
              F +    P+   S G S    VI+A   G  A +++   VA+  RKR + +++ER  LG
Sbjct  239   DFLNE---PSQGNSSGVSKG--VIVAIVLGVTALIMLALFVAYAARKRSLTRKRERINLG  293

Query  1546  AMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTT  1367
              +  + N+S LN+ YE LEKAT+YFD S K+GQGG+G VYKG LP+G  +A+KRLFFNT 
Sbjct  294   KISSSYNRSSLNYKYENLEKATNYFDTSTKVGQGGNGSVYKGTLPNGNVIAVKRLFFNTR  353

Query  1366  QWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLS  1187
             QW D FFNEVNLI+GI HKNLVKLLGCSI GPESLLVYEFVPN+SL  Y   +   + LS
Sbjct  354   QWVDEFFNEVNLINGIEHKNLVKLLGCSIEGPESLLVYEFVPNKSLDQYLFDKSKIKILS  413

Query  1186  WEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKS  1007
             WE+R+ II+GTAEGLA+LH  +E+ IIHRDIK SN+LLDE    KIADFGL R F  DK+
Sbjct  414   WEERFHIIVGTAEGLAFLHGGSEIRIIHRDIKSSNILLDENLEAKIADFGLARCFAADKT  473

Query  1006  HISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHW  827
             H+ST +AGTLGYMAPEY+V+G+LTEKADVYS+GVLV+E+V G+KN +F + S SLLQ  W
Sbjct  474   HLSTGIAGTLGYMAPEYLVKGQLTEKADVYSYGVLVLEIVCGRKNIAFAEDSGSLLQTVW  533

Query  826   NLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS-GDQDI  653
              L+   ++ EA+D  L+      EA++ L++GL+C QAS  LRPSM+ VV+M++  D  I
Sbjct  534   KLYTTNQVTEALDPLLKGNFPPEEASKVLKVGLLCTQASVALRPSMTEVVQMLTCEDCQI  593

Query  652   PQPTQPPFLTSNSAA  608
             P+P QPPFL S+  A
Sbjct  594   PEPCQPPFLNSSLLA  608



>ref|XP_009602876.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Nicotiana 
tomentosiformis]
Length=664

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/607 (49%), Positives = 396/607 (65%), Gaps = 26/607 (4%)
 Frame = -2

Query  2383  SDPRASEAALIC-TNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYA  2207
             +DPR SEA L+C TNRT P       +  FV  ++ ++  V    +G   + + N +++A
Sbjct  27    ADPRISEAGLVCGTNRTTPA----VIIPQFVKLMEVVSQRVPEHGWGSHGVNSTNISIFA  82

Query  2206  FGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSL  2027
                C +DL +TDC LC+A  +T++ RCLP     + GR++ DGCF+RYD Y FFNE++  
Sbjct  83    LANCYQDLPRTDCLLCYAASRTRLPRCLPG----KSGRIYLDGCFLRYDIYDFFNETTDS  138

Query  2026  SDKTVCGAEDFGGNSG----LFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQ  1859
              +  V  +   G  SG      +  A  L+  L   A AN G+  A +    + VYGLAQ
Sbjct  139   KEDKVNCSSSIGLASGQELATLKVTAGNLITNLTGTAVANGGYAVAHL----NGVYGLAQ  194

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKF-YDNSTIPATNQSG  1682
             CW+ V  K C +CL  A  +I  C P  + R L AGCY+RYST+ F YD    P+   S 
Sbjct  195   CWKTVSKKGCRECLDKASREIKGCFPSRDARALIAGCYLRYSTQDFLYD----PSVGNSK  250

Query  1681  GRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSY  1502
             G S    VI+A   G  A +++   VA+  RKR + + +ER  LG +  + N+S LN+ Y
Sbjct  251   GVSKG--VIVAIVLGVTALIMLALFVAYAARKRSLTRERERINLGKISSSYNRSSLNYKY  308

Query  1501  ETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISG  1322
             E LEKAT+YFD S K+GQGG+G VYKG LP+G  +A+KRLFFNT QW D FFNEVNLI+G
Sbjct  309   ENLEKATNYFDPSTKVGQGGNGSVYKGTLPNGNVIAVKRLFFNTRQWVDEFFNEVNLING  368

Query  1321  IHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGL  1142
             I HKNLVKLLGCSI GPESLLVYEFVPN+SL  Y   +   + LSWE+R+ II+GTA GL
Sbjct  369   IEHKNLVKLLGCSIEGPESLLVYEFVPNKSLDQYLFDKNKIKILSWEERFHIIVGTASGL  428

Query  1141  AYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAP  962
             A+LH  +E+ IIHRDIK SNVLLDE    KIADFGL R F  DK+H+ST +AGTLGYMAP
Sbjct  429   AFLHGGSEIRIIHRDIKSSNVLLDENLEAKIADFGLARCFAADKTHLSTGIAGTLGYMAP  488

Query  961   EYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGS  782
             EY+V+G+LTEKADVYS+GVLV+E+V G+KN +F   S SLLQ  W L+   ++ EA+D  
Sbjct  489   EYLVKGQLTEKADVYSYGVLVLEIVCGRKNIAFADDSGSLLQTVWKLYTTNQVTEALDPL  548

Query  781   LE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPFLTSNSAA  608
             L+ +    EA++ L++GL+C QAS  LRPSM+ VV+M++  D  IP+P QPPFL S+  A
Sbjct  549   LKGDFPPEEASKVLKVGLLCTQASVALRPSMTEVVQMLTHEDYQIPEPRQPPFLNSSLLA  608

Query  607   SSGSYPN  587
                  P+
Sbjct  609   GVSLKPS  615



>ref|XP_002273718.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Vitis 
vinifera]
Length=659

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/628 (49%), Positives = 396/628 (63%), Gaps = 20/628 (3%)
 Frame = -2

Query  2449  KMASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTP  2270
             K+ S   WL  F    S+  S SDPR SEA L C+     +S  + +V  FV  ++ L+ 
Sbjct  6     KVHSKPTWLISFFILFSL--SSSDPRTSEAGLYCS---PAKSTDKNFVPVFVKEMEFLSQ  60

Query  2269  LVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRL  2090
             LV    +G   + +    +Y   +C +DLS  DC LC+A  +T++ RCLP        R+
Sbjct  61    LVTLNLWGSHFVNS-TPPMYGLAQCHQDLSHLDCLLCYAAGRTKLPRCLP----ATSARI  115

Query  2089  FYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGL-----FRRNAAALVGELGRKAA  1925
             + DGCF+RYD+Y FF+ES      TV  +   G          F +N   ++  +   A 
Sbjct  116   YLDGCFLRYDNYSFFSESVDPDHDTVNCSSGSGAIVDQVAKLEFVKNVHRVINNVTATAV  175

Query  1924  ANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCY  1745
             AN G+  A V  G   VY LA+CW+ V    C  CL  A +++  CLP +EGR LNAGCY
Sbjct  176   ANGGYGVAVVEGGAVGVYALAECWKTVNSSGCRACLQKASNEVRGCLPGKEGRGLNAGCY  235

Query  1744  MRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRK  1565
             +RYST+KFYDN           R+     I+          L     A+     + K ++
Sbjct  236   LRYSTEKFYDNGGESEGGSGSSRTGLTIAIVLAAAALILVSLF---AAYAGYASLSKIKE  292

Query  1564  ERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKR  1385
             ERK LG +   +NKS LNF YETLE+AT+YF+ S KLGQGG+G VY G LP+G+ VA+KR
Sbjct  293   ERKNLGKVASIINKSSLNFKYETLERATEYFNPSRKLGQGGAGSVYMGTLPNGEIVAVKR  352

Query  1384  LFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARK  1205
             L FNT QW D FFNEVNLISGI HKNLVKLLGCSI GPESLLVYE+VPN+SL  +   + 
Sbjct  353   LIFNTRQWVDEFFNEVNLISGIQHKNLVKLLGCSIEGPESLLVYEYVPNRSLDQFMFDKN  412

Query  1204  NHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRL  1025
               Q L+WEQR+ II+GTAEGLAYLH   ++ IIHRDIK SN+LLDE  TPKIADFGL R 
Sbjct  413   KIQTLNWEQRFDIIVGTAEGLAYLHGGLQMRIIHRDIKGSNILLDENLTPKIADFGLARC  472

Query  1024  FPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVS  845
                DK+H+ST +AGTLGYMAPEY+V+G+LTEKADVYSFGVLV+E+V G+KNS F Q S S
Sbjct  473   LGADKTHLSTGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEIVCGRKNSVFTQDSGS  532

Query  844   LLQQHWNLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS  668
             LLQ+ W L+++ KL EA+D  L++     EA+  L+IGL+C QAS  LRPSM+ VV M++
Sbjct  533   LLQRVWKLYKSNKLVEAIDDCLKDDFPEKEASDVLRIGLLCTQASVALRPSMTEVVWMLT  592

Query  667   -GDQDIPQPTQPPFLTSNSAASSGSYPN  587
               D +IP P QPPFL ++   S+ S  N
Sbjct  593   HKDWEIPPPNQPPFLNAHVLESAISRSN  620



>ref|XP_007031540.1| Cysteine-rich RLK 42 [Theobroma cacao]
 gb|EOY02466.1| Cysteine-rich RLK 42 [Theobroma cacao]
Length=665

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/600 (50%), Positives = 394/600 (66%), Gaps = 29/600 (5%)
 Frame = -2

Query  2383  SDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAF  2204
             SDPR S A L+C +   P       + NF  A+  L+  +++  +    + +  + +Y  
Sbjct  38    SDPRISNAGLLCGHSRPPNGTN--LIPNFSEAMRGLSQAINNSHFASYHLNS-TSPMYVL  94

Query  2203  GECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLS  2024
              +C +DLSQTDC LC+A  +T + RCLP       GR+F DGCF+RYD+Y F+ ES S S
Sbjct  95    AQCHQDLSQTDCLLCYAAARTTLPRCLP----SVSGRIFLDGCFLRYDNYSFYQESVSSS  150

Query  2023  -DKTVCGAED---FGGNS---GLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGL  1865
              D   C  ++   F G+S    L  R+    VG + R A  N GF T     G + VY L
Sbjct  151   LDNVSCSPDEATVFDGDSKRVNLIGRSVDYAVGNMTRIALRNGGFGTV----GMNGVYAL  206

Query  1864  AQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQS  1685
             AQCW+ V  + C +CL  A   +  C+PKEEGR +N GCY+RYST KFY       + + 
Sbjct  207   AQCWKSVPAEGCRECLEKAAKAVRGCVPKEEGRGMNTGCYLRYSTNKFY-------SKEG  259

Query  1684  GGRSNH-LPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNF  1508
               + +H + +I+A      AFL++  S A+    R+ K+++E K LG +  + +KS L F
Sbjct  260   EAKHDHEIAIIVAIVSSIAAFLMVSLSAAYATYARLSKRKEELKNLGQISKSFDKSGLKF  319

Query  1507  SYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLI  1328
              YETLEKATDYF  S KLGQGG+G V+ G+LP+GKTVA+KRL +NT QW D FFNEVNLI
Sbjct  320   KYETLEKATDYFSFSRKLGQGGTGSVFMGILPNGKTVAVKRLIYNTRQWVDDFFNEVNLI  379

Query  1327  SGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAE  1148
             S I HKNLVKLLGCSI GPESLLVYE+VPN+SL  +    K    + W+QR+ II+GTAE
Sbjct  380   SRIQHKNLVKLLGCSIEGPESLLVYEYVPNKSLDQFIFDEKKTNLVKWKQRFDIIVGTAE  439

Query  1147  GLAYLH-EETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGY  971
             GLA+LH   + + +IHRDIK SNVLLDE   PKIADFGLVR    DKSH+ST VAGTLGY
Sbjct  440   GLAHLHGGGSHVRLIHRDIKSSNVLLDENLNPKIADFGLVRCLATDKSHLSTGVAGTLGY  499

Query  970   MAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAV  791
             MAPEY+V+G+LTEKADVYSFGVL +E+V GK+N++F + S SLLQ  W L+R+ +L EAV
Sbjct  500   MAPEYLVRGQLTEKADVYSFGVLALEIVCGKRNTTFTKDSGSLLQTVWALYRSNRLAEAV  559

Query  790   DGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPFLTSN  617
             D S+++     EA   LQIGL+C QAS  LRPSM+ VV+M++  D +IP P QPPFL ++
Sbjct  560   DYSIKDDTSAKEAPDVLQIGLLCTQASVSLRPSMAQVVQMLTDKDCEIPSPNQPPFLNAS  619



>ref|XP_010251164.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Nelumbo 
nucifera]
Length=640

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/600 (50%), Positives = 387/600 (65%), Gaps = 21/600 (4%)
 Frame = -2

Query  2386  VSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNAT---  2216
             +SDPR S AAL+C +  +       +V  FV  ++ L   V+ +++G     +  ++   
Sbjct  20    LSDPRISRAALLCGSSRSQTGTN--FVPIFVKEMEGLAQRVNVQRWGTQTTSSSPSSNSP  77

Query  2215  -VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNE  2039
              +Y   +C  DLS TDC LCFA+ +T++  CLP       GR+F DGCF+RYD Y F+NE
Sbjct  78    SIYGLAQCHGDLSLTDCLLCFAESRTKLPSCLP----ANSGRMFLDGCFLRYDTYNFYNE  133

Query  2038  S-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGE----LGRKAAANDGFFTAAVGRGNSTV  1874
             S     DK VCG+ D G      +   A  VG+    +   A  NDGF    V     +V
Sbjct  134   SLDPQHDKVVCGSTDGGILKNDMKLEFANKVGQAIINVTDIALLNDGFGVTEVKNRIFSV  193

Query  1873  YGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPAT  1694
             Y LAQCW+ +    C  CL    S I  C P  +GR LNAGCY+RYST+KFY++ +   T
Sbjct  194   YALAQCWKTLSKNGCRQCLQKGGSAIRGCAPASQGRALNAGCYLRYSTEKFYNDFSEMHT  253

Query  1693  NQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKL  1514
               S        +I+A T  + A  +++   +++  +RI+K RKE+  LG    TVNKS L
Sbjct  254   AGSADTG----LIVAITLAAIALSVLILFGSWVGYRRILKSRKEKSNLGRFASTVNKSNL  309

Query  1513  NFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVN  1334
             NF YETLE ATD+F+ SNK+GQGG+G V+KG LPDG+ +A+KRLFFNT QW D FFNEVN
Sbjct  310   NFKYETLEVATDFFNLSNKIGQGGAGSVFKGTLPDGRVIAVKRLFFNTRQWVDEFFNEVN  369

Query  1333  LISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGT  1154
             LI GI HKNLVKLLGCSI GPESLLVYEFVPN+SL          Q +SW QR+ II+G 
Sbjct  370   LIGGIQHKNLVKLLGCSIEGPESLLVYEFVPNKSLDQILFDDNQTQMISWRQRFNIIVGI  429

Query  1153  AEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLG  974
             AEGLAYLH+ ++  IIHRDIK SN+LLDE  T KIADFGL R F  DK+HIST +AGTLG
Sbjct  430   AEGLAYLHQGSQTRIIHRDIKSSNILLDENLTAKIADFGLARCFGADKTHISTGIAGTLG  489

Query  973   YMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEA  794
             YMAPEY+V+G+LTEKADVYSFGVLV+E+V G+KN+ F Q + S+LQ+ W  F++  L E 
Sbjct  490   YMAPEYLVRGQLTEKADVYSFGVLVLEIVCGRKNTIFVQETGSVLQRVWKHFQSNTLPEC  549

Query  793   VDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ-DIPQPTQPPFLTS  620
             VD  L++   V EA+  LQIGL+C QAS  LRP M  VV+M++     IP P QPPFL S
Sbjct  550   VDPCLKDDFPVKEASDVLQIGLLCTQASVSLRPFMPDVVQMLTDKSVSIPLPRQPPFLNS  609



>ref|XP_010108803.1| Cysteine-rich receptor-like protein kinase 42 [Morus notabilis]
 gb|EXC20318.1| Cysteine-rich receptor-like protein kinase 42 [Morus notabilis]
Length=664

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/610 (50%), Positives = 392/610 (64%), Gaps = 25/610 (4%)
 Frame = -2

Query  2380  DPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNA---TVY  2210
             DPR SEA L C +  +P +   + +  F   +  L+ ++++  +    I   +A   ++Y
Sbjct  31    DPRISEAELYCGDGRSPANT--SIIPTFTKVMQNLSQVMNTSYWAANSINYSSAPKKSIY  88

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSS  2030
                +C +DLS TDC LC+A  +T+I RCLP        RLF DGCF+RYD+Y F+ ES  
Sbjct  89    VLSQCHEDLSHTDCLLCYAAARTRIPRCLPSPY----ARLFLDGCFLRYDNYSFYGESVD  144

Query  2029  LSDKTVCGAEDFGGNSGL-----FRRNAAALVGELGRKAAANDGFFTAAV-GRGNSTVYG  1868
                 TV  +  FG   G      F  +   +VG + R A  N G     V G+G   V+G
Sbjct  145   PVHDTVNCSSRFGAVQGASEKKKFLEDVGFVVGNVTRLALKNGGIGVGEVKGKG---VFG  201

Query  1867  LAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQ  1688
             LAQCWE V    C  C   A S+I  C    EGR LNAGCY+RYST+KFY +      N 
Sbjct  202   LAQCWETVGESGCRVCFRKATSEIKKCGASREGRSLNAGCYLRYSTEKFYSDGK--EANS  259

Query  1687  SGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNF  1508
              G  S    VI+A   G  AF+++   VA+    R+ K R  RK L  + +++ KS LNF
Sbjct  260   GGSSSRSRGVIIAIVLGVVAFVILCLFVAYAAYTRVSKTRARRKNLEQVSISIRKSSLNF  319

Query  1507  SYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLI  1328
              YETLE+ATD+F+ S K+GQGG+G V+KG L DG+ VA+KRL FNT QW D FFNEVNLI
Sbjct  320   KYETLERATDFFNPSTKIGQGGAGSVFKGTLQDGQIVAVKRLIFNTKQWVDEFFNEVNLI  379

Query  1327  SGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAE  1148
             S I HKNLVKLLGCSI GPESLLVYE+VPN+SL  +   +   Q L+W+QR  II+GTAE
Sbjct  380   SVIQHKNLVKLLGCSIEGPESLLVYEYVPNRSLDQFLFEKNKVQILNWKQRLNIIVGTAE  439

Query  1147  GLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYM  968
             GLA+LH  +++ IIHRDIK SNVLLDE+ TPKIADFGLVR F  DKSH+ST +AGTLGYM
Sbjct  440   GLAFLHGGSKVRIIHRDIKSSNVLLDEDLTPKIADFGLVRCFGADKSHLSTGIAGTLGYM  499

Query  967   APEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVD  788
             APEY+V+G+LT+KADVYSFGVLV+E+V G++N +F Q S SLLQ  W L+++ KL EAVD
Sbjct  500   APEYLVRGQLTDKADVYSFGVLVLEIVCGRRNCAFTQDSGSLLQTVWKLYKSDKLVEAVD  559

Query  787   GSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ-DIPQPTQPPFLTSN-  617
               L  +    E    LQIGL+C QAS  LRPSM+ VV M++ ++ +IP P QPPFL ++ 
Sbjct  560   PCLNGDFPSNEVYNMLQIGLLCTQASVALRPSMAEVVSMLTNNEKEIPTPNQPPFLNASV  619

Query  616   --SAASSGSY  593
                  SS SY
Sbjct  620   LGPTTSSKSY  629



>gb|KEH22098.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=654

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/629 (47%), Positives = 401/629 (64%), Gaps = 23/629 (4%)
 Frame = -2

Query  2458  MNRKMASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDA  2279
             M+ K+ +  + +F FI     + ++SDPR SEA L C    APQ  +  ++ +F+  ++ 
Sbjct  1     MSSKINNQPQVIF-FIMSCLFSHTISDPRISEAGLYCGKDKAPQ--KSNFIPSFIKEMEN  57

Query  2278  LTPLVDSKKYG-ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVR  2102
             L+ LV    +G ++V  A    +Y F +C +DLS TDC LC+A  +T + RCLP      
Sbjct  58    LSQLVTDHNWGTQSVNIAEFVPIYGFAQCFQDLSHTDCLLCYAASRTMLPRCLP----SL  113

Query  2101  GGRLFYDGCFVRYDDYVFFNESSS-LSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAA  1925
               R++ DGCF+RYD+Y F++E +  L DK +C + +         R+   +V  + + A 
Sbjct  114   SARIYLDGCFLRYDNYSFYSEETDPLRDKVICTSSE--RLEVQMERSVERVVDVVAKDAG  171

Query  1924  ANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCY  1745
                GF   AVG     VY LAQCW+ +    C DCL+ AV K+  CLP  EGRVLNAGCY
Sbjct  172   DGGGF---AVGEVEG-VYALAQCWKTLGIDGCRDCLSNAVKKVRGCLPNSEGRVLNAGCY  227

Query  1744  MRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRK  1565
             +RYST KF+ +           R+  +   +          L   S +F V K++   +K
Sbjct  228   LRYSTHKFFKDGGGTNGGNGSLRNGAVIAAVLAIAAIIMLAL---SASFAVYKKLSNLKK  284

Query  1564  ERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKR  1385
             E+     +  ++ KS LN+ YETLEKATDYF+ S K+GQGGSG V+KG+LP+G  VA+KR
Sbjct  285   EKNNHDQISSSITKSSLNYKYETLEKATDYFNSSRKIGQGGSGSVFKGILPNGNVVAVKR  344

Query  1384  LFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARK  1205
             L FN  QW D FFNEV+LISGI HKNLVKLLGCSI GPESLLVYE +PN+SL  +   + 
Sbjct  345   LVFNNRQWVDEFFNEVDLISGIEHKNLVKLLGCSIEGPESLLVYEHLPNKSLDQFIFEKS  404

Query  1204  NHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRL  1025
               Q L+W+QR+ II GTAEGLAYLH+ +   IIHRDIK SNVLLD+  +PKIADFGL R 
Sbjct  405   RTQILNWKQRFNIICGTAEGLAYLHQGSIKRIIHRDIKSSNVLLDDNLSPKIADFGLARC  464

Query  1024  FPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVS  845
             F  DK+H+ST +AGTLGYMAPEY+++G+LT+KADVYSFGVLV+E+V G++N+   + S S
Sbjct  465   FATDKTHLSTGIAGTLGYMAPEYLIRGQLTDKADVYSFGVLVLEIVCGRRNNVIREDSGS  524

Query  844   LLQQHWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS  668
             LLQ  W  +R+  L E +D SL ++    E +R L IGL+C QAS  LRPSM+ VVKM+S
Sbjct  525   LLQNVWKHYRSNTLVETIDSSLGDDIPEAEPSRVLHIGLLCTQASASLRPSMTQVVKMLS  584

Query  667   G-DQDIPQPTQPPFLTS---NSAASSGSY  593
               D D+P P QPPF +S   +S +S  SY
Sbjct  585   NSDLDVPTPNQPPFFSSAILDSESSIRSY  613



>ref|XP_010101899.1| Cysteine-rich receptor-like protein kinase 42 [Morus notabilis]
 gb|EXB90356.1| Cysteine-rich receptor-like protein kinase 42 [Morus notabilis]
Length=652

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/615 (48%), Positives = 395/615 (64%), Gaps = 23/615 (4%)
 Frame = -2

Query  2422  FLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGE  2243
              +F   L  + + SDPR SEAA +C       S    ++ NFV  + A++  ++  ++GE
Sbjct  9     LVFHVLLLFSTAKSDPRISEAAHVCDKTL--HSPTSNFIPNFVTLMQAISDQINRNQWGE  66

Query  2242  TVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRY  2063
               + +    +YAF +C  DLS +DC+ CFA  +T + +CLP        R+F DGCF+RY
Sbjct  67    ANVTSPPPEIYAFAQCHDDLSPSDCSACFAASRTMLPKCLP----SVSARIFLDGCFLRY  122

Query  2062  DDYVFFNESSSLS------DKTVCGAED-FGGNSGL---FRRNAAALVGELGRKAAANDG  1913
             D+Y F  ES  +       D + CG      G+  L   F +    +VG L   AA N G
Sbjct  123   DNYSFHGESVGVDGAGDDRDVSKCGPPSAVAGDEFLRSEFAKKVKDVVGVLAETAAINGG  182

Query  1912  FFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYS  1733
             F       G + VY +AQCW+ V  + C  CL AA  +IG C P  EGR + AGCY+RYS
Sbjct  183   FAVGEDRGGVADVYAMAQCWKTVEKEDCRRCLRAAGDRIGECPPAAEGRAMFAGCYLRYS  242

Query  1732  TKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKR  1553
             T++F+    + A ++    S  + +I+A    + AF+L+  + A+   K +   +KE  +
Sbjct  243   TERFFQ---VSAKHEEELDSATVSMIIAGVLSALAFVLLTLTGAYFGLKTVSSNKKEDFQ  299

Query  1552  LGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFN  1373
                +   +  S+LNF YE LEKATD+FD S KLGQGG+G V+KG+LPDG+ VA+KRLFFN
Sbjct  300   T-EIPTALQNSRLNFKYEMLEKATDFFDASRKLGQGGAGSVFKGILPDGRIVAVKRLFFN  358

Query  1372  TTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKN-HQ  1196
             TTQW D FFNEVNLISGI HKNLVKLLGCSI GPESLLVYEFVPN+SL      +KN   
Sbjct  359   TTQWVDEFFNEVNLISGIEHKNLVKLLGCSIEGPESLLVYEFVPNKSLDQIIFDKKNPAN  418

Query  1195  PLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPE  1016
              LSW+QR+ II GTAEGLAYLH    + IIHRDIK SN+LL E   PKIADFGL R    
Sbjct  419   VLSWQQRFNIISGTAEGLAYLHGGCGVKIIHRDIKTSNILLGENLNPKIADFGLARSVAT  478

Query  1015  DKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQ  836
             D++HIST +AGTLGYMAPEY+V+G+LT+KADVY++GVL++E+VS +KNS+F   S S+L 
Sbjct  479   DRTHISTGIAGTLGYMAPEYLVRGQLTDKADVYAYGVLILEIVSSRKNSAFTLGSSSVLH  538

Query  835   QHWNLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-D  662
               W L++A K+ E+VD +L++     EA+  LQIGL+C QAS  LRPSMS VV+M+S  +
Sbjct  539   SVWKLYKANKVVESVDPALKDDFPAEEASNVLQIGLLCTQASVALRPSMSEVVQMLSDRE  598

Query  661   QDIPQPTQPPFLTSN  617
              +IP P QPPFL ++
Sbjct  599   HEIPLPMQPPFLNAS  613



>ref|XP_011047329.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Populus 
euphratica]
Length=665

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/617 (49%), Positives = 397/617 (64%), Gaps = 24/617 (4%)
 Frame = -2

Query  2440  SLSKWLFLFIFFLS---INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTP  2270
             +L  WLFL + + +    + S+SDPR +++ L C N     S+    +  F   ++ L+ 
Sbjct  14    NLQSWLFLSLIYSASFLFSLSLSDPRITQSGLYCGN-----SKSTVLIPTFTKEMETLSQ  68

Query  2269  LVDSKKYGETVIG-AGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGR  2093
             L+ +  +    +  +   T YA  +C +DLSQTDC LC+A  +T++ RCLP       GR
Sbjct  69    LITTSHFATNNLNHSSTLTFYALAQCHEDLSQTDCLLCYAASRTKLPRCLP----SLSGR  124

Query  2092  LFYDGCFVRYDDYVFFNESSSLS-DKTVCGAE--DFGGNSGLFRRNAAALVGELGRKAAA  1922
             ++ DGCF+RYD+Y F+ ES S S D   CG E  D       F       VG +  KA  
Sbjct  125   IYLDGCFLRYDNYSFYQESVSSSFDTFKCGNEYLDDDDKHLEFLTRVGYAVGNVTIKAVE  184

Query  1921  NDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYM  1742
             N GF    V      +Y LAQCW+ V    C  CL  A      C+PK+EGR +NAGCY+
Sbjct  185   NRGFAVVNV----DGIYALAQCWDSVGRDGCRGCLEMAGKAARGCVPKKEGRGMNAGCYL  240

Query  1741  RYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKE  1562
             RYST KFYDN      N  G   + L + +A    + A L++    A+    R++K ++E
Sbjct  241   RYSTDKFYDNGGGDERNARG--FSGLGIAIAVVLATAACLMLSIFAAYASYVRLLKAKRE  298

Query  1561  RKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRL  1382
             R  LG +  + NKS LNF YE LEKATD+F  S KLGQGG+G V+ G LP+G+TVA+KRL
Sbjct  299   RNNLGKVPFSFNKSSLNFKYEILEKATDFFSPSRKLGQGGAGSVFIGTLPNGETVAVKRL  358

Query  1381  FFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKN  1202
              FNT QW D FFNEVNLISGI HKNLVKLLGCSI GPESLLVYE V N+SL  +   +  
Sbjct  359   IFNTRQWVDEFFNEVNLISGIQHKNLVKLLGCSIEGPESLLVYEHVRNKSLDQFLFDKTK  418

Query  1201  HQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLF  1022
              + L+W+QR+KIILGTAEGLAYLH  +++ IIHRDIK SNVLLD+   PKIADFGLVR F
Sbjct  419   RRTLNWKQRFKIILGTAEGLAYLHGGSQVRIIHRDIKSSNVLLDDNLNPKIADFGLVRCF  478

Query  1021  PEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSL  842
               DKSH+ST +AGT+GYMAPEY+++G+LT+KADVYSFGVLV+E++ GK+ ++F + S SL
Sbjct  479   GADKSHLSTGIAGTIGYMAPEYLIRGQLTDKADVYSFGVLVLEILGGKRCNAFVENSGSL  538

Query  841   LQQHWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS-  668
             LQ  W L+R+ +L +AVD  L +E    EA+  LQIGL+C QAS  LRPSM+ VV  ++ 
Sbjct  539   LQTVWRLYRSNRLVDAVDPCLRDEFPTREASCVLQIGLLCTQASAALRPSMAQVVHFLTN  598

Query  667   GDQDIPQPTQPPFLTSN  617
              D +IP P QPP++ ++
Sbjct  599   NDCEIPPPNQPPYMNTS  615



>ref|XP_008443549.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Cucumis 
melo]
Length=662

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/598 (49%), Positives = 389/598 (65%), Gaps = 27/598 (5%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             S+SDPR S++  IC     P S R  ++  F+  ++A++ L+ ++ +    + +    ++
Sbjct  30    SLSDPRISQSGSICGTVKPPPSSR--FIPTFIEEMEAISELLTTRSWTTHFVNS-TPPMF  86

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESS-  2033
             A  +C  DLS TDC LC+A  +T + RCLP        R+F DGCF+RYD+Y F+ ES+ 
Sbjct  87    ALSQCFNDLSHTDCLLCYAASRTSLPRCLP----AISARIFLDGCFLRYDNYSFYKESTD  142

Query  2032  SLSDKTVCGAE----DFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGL  1865
             SL D   C +E    D     G F  N  A+V  +   A    GF    VG  N  ++GL
Sbjct  143   SLRDSVNCTSELGEIDESERLG-FGENVRAVVETVTTTAMEKGGF---GVGEVNG-MFGL  197

Query  1864  AQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQ-  1688
             AQCW  V  + C  CL  A   IG CLP +EGR +NAGCY+RYST KFY++      +  
Sbjct  198   AQCWGSVEPEGCRACLEKAKRSIGRCLPSKEGRAMNAGCYLRYSTVKFYNDKDEERDHDG  257

Query  1687  -SGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLN  1511
              SG R+     ++     S A L++  S  F    RI K +KE+KR   + V+   S LN
Sbjct  258   FSGRRA-----VVTIALASAASLIVFFSAVFACYTRISKFKKEKKRQSLIPVSFKDSDLN  312

Query  1510  FSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNL  1331
             F YETLEKAT+YF+ SNK+GQGG+G VYKG LP+G+ VA+KRL F+T QW D FFNEVNL
Sbjct  313   FKYETLEKATNYFNPSNKIGQGGAGSVYKGTLPNGQIVAVKRLVFHTRQWVDEFFNEVNL  372

Query  1330  ISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTA  1151
             I GI HKNLV LLGCSI GPESLLVYE+VPN SL  +   +   Q L+W+QR+ II+GTA
Sbjct  373   IRGIQHKNLVALLGCSIEGPESLLVYEYVPNGSLDQFIFDKNKAQILTWKQRFNIIVGTA  432

Query  1150  EGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGY  971
             EGLA+LHE  ++ IIHRDIK SNVLLDE F PKIADFGL R F  D+SH+ST +AGTLGY
Sbjct  433   EGLAHLHEGCKIRIIHRDIKSSNVLLDENFNPKIADFGLARHFAADQSHLSTGIAGTLGY  492

Query  970   MAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAV  791
             +APEY+V+G+LTEKADVYSFGVL++E+V G++NSSF + S  LLQ  W+L++  +L  A+
Sbjct  493   IAPEYLVRGQLTEKADVYSFGVLILEIVCGRRNSSFTENSTPLLQTVWDLYKTERLTAAI  552

Query  790   DGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGD--QDIPQPTQPPFL  626
             D SL ++    EA   LQIGL+C QA   LRPSM+ +VK+++ D  + +  P QPPFL
Sbjct  553   DTSLNKDYPAKEAMDVLQIGLLCTQALASLRPSMATIVKLLTSDVERKVGIPEQPPFL  610



>ref|XP_007140970.1| hypothetical protein PHAVU_008G156400g [Phaseolus vulgaris]
 gb|ESW12964.1| hypothetical protein PHAVU_008G156400g [Phaseolus vulgaris]
Length=664

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/606 (49%), Positives = 398/606 (66%), Gaps = 25/606 (4%)
 Frame = -2

Query  2380  DPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATV--YA  2207
             DPR +EA L C    AP   +  Y+ +F   +++++ LV +  +G  V+    +++  Y 
Sbjct  29    DPRITEAGLYCGTTKAPL--KANYIPSFTKEMESISQLVTNHNWGTHVVNISGSSIPIYG  86

Query  2206  FGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNE-SSS  2030
             F +C KDLS TDC LC+A  +T++ RCLP        R++ DGCF+RYD+Y F+ E S  
Sbjct  87    FAQCFKDLSNTDCLLCYAASRTKLPRCLP----SVSARIYLDGCFLRYDNYSFYAEVSDP  142

Query  2029  LSDKTVCGAEDFGGNSGLFRRNAAALVGEL----GRKAAANDGFFTAAVGRGNSTVYGLA  1862
             L D   C ++         R      VG +      +A A  G F      G   VY LA
Sbjct  143   LRDTLNCTSQHGTVVDKTERLELEESVGRVVESVTNRALAKGGGFAVGEVEG---VYALA  199

Query  1861  QCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSG  1682
             QCW  +    C +CL  A  ++  CLPK +GR LNAGCY+RYST KFY+         +G
Sbjct  200   QCWNTIGSDGCRECLRKAGKEVRGCLPKRDGRALNAGCYLRYSTNKFYNED-----GDAG  254

Query  1681  GRSNHLP--VILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNF  1508
             G++  L   VI+A    + A L+++ S +++   ++ + +KE   LG +  +++KS LN+
Sbjct  255   GKNGFLRRGVIIAEVLAAAAVLMLILSASYVAFTKLTRIKKENNNLGHISSSISKSSLNY  314

Query  1507  SYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLI  1328
              YETLEKATDYF+ S KLGQGG+G V+KG+LP+ K +A+KRL FN  QW D FFNEVNLI
Sbjct  315   KYETLEKATDYFNSSRKLGQGGAGSVFKGILPNKKVIAVKRLIFNNRQWVDEFFNEVNLI  374

Query  1327  SGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAE  1148
             SGI HKNLVKLLGCSI GPESLLVYE++P +SL  +   +   Q L+W+QR+ IILGTAE
Sbjct  375   SGIEHKNLVKLLGCSIEGPESLLVYEYLPKKSLDQFIFEKNRTQILNWKQRFNIILGTAE  434

Query  1147  GLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYM  968
             GLAYLHE T++ IIHRDIK SNVLLD+  TPKIADFGLVR F  DKSH+ST +AGTLGYM
Sbjct  435   GLAYLHEGTKIRIIHRDIKSSNVLLDDNLTPKIADFGLVRCFGADKSHLSTGIAGTLGYM  494

Query  967   APEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVD  788
             APEY+++G+LT+KADVYSFGVLV+EVV G++N+ F + S SLLQ  W L+R+  L EAVD
Sbjct  495   APEYLIRGQLTDKADVYSFGVLVLEVVCGRRNNVFREDSGSLLQTVWKLYRSNTLTEAVD  554

Query  787   GSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPFLTSNS  614
               L ++    EA+R  +IGL+C QAS  LRPS+S VV M++  ++D+P P QPPFL++  
Sbjct  555   PCLGDDYPATEASRVFRIGLLCTQASASLRPSISQVVYMLTNSNEDVPTPNQPPFLSTGM  614

Query  613   AASSGS  596
               S GS
Sbjct  615   LDSDGS  620



>gb|KDP45316.1| hypothetical protein JCGZ_09565 [Jatropha curcas]
Length=669

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/597 (49%), Positives = 389/597 (65%), Gaps = 24/597 (4%)
 Frame = -2

Query  2380  DPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATV--YA  2207
             DPR +++ L+C N T        ++  FV  ++ L+ L+++  +    +   N+TV  YA
Sbjct  31    DPRITQSGLVCGNSTQTMKTPSGFIPAFVKEMETLSQLINNTHFATYHL---NSTVPMYA  87

Query  2206  FGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSL  2027
               +C  DLSQ DC LCFA  +T++ RCLP        R++ DGCF+RYD Y FF ES S 
Sbjct  88    LAQCHHDLSQNDCLLCFAASRTKLPRCLP----SASARIYLDGCFLRYDKYNFFKESVSF  143

Query  2026  S-DKTVCGAE-----DFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGL  1865
             + D   C  E     D       F  +    +G +  KA  N GF  A    G   VY L
Sbjct  144   AFDAVNCSQENVSRLDDENEKVKFATSVGYALGNVSSKAIKNGGFGVA----GTDGVYAL  199

Query  1864  AQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQS  1685
              QCW+ +    C  CL  A  ++  C+P++EGR +NAGCY+RYST KFY +        +
Sbjct  200   VQCWDSIGEDGCRKCLEKAEKEVQRCVPRKEGRAMNAGCYLRYSTDKFYGDGG--ELGDA  257

Query  1684  GGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFS  1505
              G S     I      +  F+L L ++ +   +R++K+++ER  L  + ++ +KS LNF 
Sbjct  258   HGFSGLGIAIAIVLAAAALFMLSLFAI-YARYRRLLKEKEERINLEKVSISFHKSSLNFK  316

Query  1504  YETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLIS  1325
             YETLEKATDYF+ S K+GQGG+G V+ G L +G+T+A+KRL FNT QW D FFNEVNLIS
Sbjct  317   YETLEKATDYFNSSRKIGQGGAGSVFVGNLANGQTIAVKRLIFNTRQWVDEFFNEVNLIS  376

Query  1324  GIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEG  1145
             GI HKNLVKLLGCSI GPESLLVYE++PN+SL  +       + L+W++R+ II+GTAEG
Sbjct  377   GIQHKNLVKLLGCSIEGPESLLVYEYIPNKSLDQFIFGNTKTRTLNWKERFNIIVGTAEG  436

Query  1144  LAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMA  965
             LAYLH  +++ IIHRDIK SNVLLDE F PKIADFGLVR F  DK+H+ST +AGT+GYMA
Sbjct  437   LAYLHGGSQVRIIHRDIKSSNVLLDENFNPKIADFGLVRCFGTDKTHLSTGIAGTIGYMA  496

Query  964   PEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDG  785
             PEY+V+G+LTEKADVYSFGVLV+E+V GK+ ++F + S SLLQ  W L+R+ +L EAVD 
Sbjct  497   PEYLVRGQLTEKADVYSFGVLVLEIVMGKRCNAFIEDSKSLLQTVWQLYRSNRLVEAVDS  556

Query  784   SLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPFLTS  620
              L E   V EA+R LQIGL+C QAS  LRPSM  VV+M++  D +IP P QPPF+ +
Sbjct  557   CLREEFPVQEASRVLQIGLLCTQASVSLRPSMEQVVEMLTNTDCEIPLPNQPPFMNA  613



>ref|XP_003555067.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Glycine max]
Length=673

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/607 (49%), Positives = 394/607 (65%), Gaps = 22/607 (4%)
 Frame = -2

Query  2386  VSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGE---TVIGAGNAT  2216
             VS+PR +EA L C    AP   +  Y+ +F+  +++L+ LV S  +G     + G+G++ 
Sbjct  36    VSNPRITEAGLYCGTSKAPL--KANYIPSFIKEMESLSQLVTSNNWGTHSVKISGSGSSI  93

Query  2215  -VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNE  2039
              +Y F +C +DLS TDC LC+A  +T++ RCLP        R++ DGCF+RYD+Y F++E
Sbjct  94    PIYGFAQCFRDLSHTDCLLCYAASRTRLPRCLP----SVSARIYLDGCFLRYDNYSFYSE  149

Query  2038  SSSLSDKTV----CGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVY  1871
              +  S   V      A D      L  R    +   +       +GF    V      VY
Sbjct  150   GTDPSRDAVNCTGVAAGDEAERVELQERVGRVVDNVVNIAERDGNGFGVGEV----EGVY  205

Query  1870  GLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATN  1691
              LAQCW  +    C +CL  A  ++  CLPK+EGR LNAGCY+RYST+KFY N    A  
Sbjct  206   ALAQCWNTLGSGGCRECLRKAGREVKGCLPKKEGRALNAGCYLRYSTQKFY-NEDGDAGG  264

Query  1690  QSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLN  1511
              +G       ++      +   +L L S ++    +  K +KE   LG +  +++KS LN
Sbjct  265   GNGFLRRRGVIVAEVLAAAAVIMLAL-SASYAAFTKFSKIKKENNNLGQISSSISKSSLN  323

Query  1510  FSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNL  1331
             + YETLEKATDYF+ S K+GQGG+G V+KG+LP+GK VA+KRL FN  QW D FFNEVNL
Sbjct  324   YKYETLEKATDYFNSSRKVGQGGAGSVFKGILPNGKVVAVKRLIFNNRQWVDEFFNEVNL  383

Query  1330  ISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTA  1151
             ISGI HKNLVKLLGCSI GPESLLVYE++P +SL  +   +   Q L+W+QR+ IILGTA
Sbjct  384   ISGIEHKNLVKLLGCSIEGPESLLVYEYLPKKSLDQFIFEKNRTQILNWKQRFNIILGTA  443

Query  1150  EGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGY  971
             EGLAYLHE T++ IIHRDIK SNVLLDE  TPKIADFGL R F  DKSH+ST +AGTLGY
Sbjct  444   EGLAYLHEGTKIRIIHRDIKSSNVLLDENLTPKIADFGLARCFGGDKSHLSTGIAGTLGY  503

Query  970   MAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAV  791
             MAPEY+++G+LT+KADVYS+GVLV+E+VSG++N+ F + S SLLQ  W L+R+  L EAV
Sbjct  504   MAPEYLIRGQLTDKADVYSYGVLVLEIVSGRRNNVFREDSGSLLQTAWKLYRSNTLTEAV  563

Query  790   DGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPFLTSN  617
             D SL ++    EA+R LQIGL+C QAS  LRPSMS VV M+S  + D+P P QPPFL + 
Sbjct  564   DPSLGDDFPPSEASRVLQIGLLCTQASASLRPSMSQVVYMLSNTNLDVPTPNQPPFLNTG  623

Query  616   SAASSGS  596
                S  S
Sbjct  624   MLDSDSS  630



>ref|XP_006378230.1| hypothetical protein POPTR_0010s05380g [Populus trichocarpa]
 ref|XP_006378231.1| hypothetical protein POPTR_0010s05380g [Populus trichocarpa]
 gb|ERP56027.1| hypothetical protein POPTR_0010s05380g [Populus trichocarpa]
 gb|ERP56028.1| hypothetical protein POPTR_0010s05380g [Populus trichocarpa]
Length=417

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/407 (68%), Positives = 319/407 (78%), Gaps = 6/407 (1%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L  F+ F  +N S+SDPRA++AALICTNRTA   +RQ +VANF+AALDA+TPL+  +KY 
Sbjct  8     LLSFLCFF-VNLSLSDPRATQAALICTNRTAAMPERQTFVANFLAALDAVTPLILRQKYA  66

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
               + G G+ TVYAFGECMKDL  TDCNLCFAQCKTQ+LRCLPFQR +RGGR+F DGC+VR
Sbjct  67    AVINGTGSTTVYAFGECMKDLDGTDCNLCFAQCKTQVLRCLPFQRGIRGGRIFCDGCYVR  126

Query  2065  YDDYVFFNESSSLSDKTVCGAEDF-GGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGR  1889
             YDDY FFNE+ S  DKT+C + DF GGN  +F  N   L+  L   A  NDGF+  +V R
Sbjct  127   YDDYDFFNETLSTQDKTICASADFSGGNKTVFSANVLELMRNLSVSAPKNDGFYVGSVDR  186

Query  1888  GNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNS  1709
             GN +V+GLAQCWEFV G +C+ CL  AVS+IGSC PKEEGR LNAGCY+RYSTKKFYDNS
Sbjct  187   GNVSVFGLAQCWEFVNGSACETCLTNAVSRIGSCTPKEEGRALNAGCYLRYSTKKFYDNS  246

Query  1708  TIP-ATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVT  1532
             T P   N+S GR   L VILA T  S A  L++ +  F VR+R+V++R+ RK LGA+LVT
Sbjct  247   TSPIGRNKSRGR---LTVILAVTSSSVAVALMIATTVFFVRRRVVEKRRARKELGALLVT  303

Query  1531  VNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADH  1352
             VNKSKLNFSYE+LEKAT+YF  SNKLGQGGSG VYKG L DG TVAIKRL FNT QW DH
Sbjct  304   VNKSKLNFSYESLEKATNYFHLSNKLGQGGSGSVYKGTLSDGTTVAIKRLLFNTRQWVDH  363

Query  1351  FFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSA  1211
             FFNEVNLISGI HKNL KLLGCSITGPESLLVYE+VPNQSL+DY S 
Sbjct  364   FFNEVNLISGIQHKNLAKLLGCSITGPESLLVYEYVPNQSLHDYFSG  410



>gb|KHG06976.1| Cysteine-rich receptor-like protein kinase 42 [Gossypium arboreum]
Length=596

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/538 (53%), Positives = 366/538 (68%), Gaps = 16/538 (3%)
 Frame = -2

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             +YA  +C +DLSQTDC LC+A  +T+I RCLPF       R+F DGCF+RYD+Y FF ES
Sbjct  24    IYALAQCHQDLSQTDCLLCYAASRTKIPRCLPFN----SARIFLDGCFLRYDNYSFFKES  79

Query  2035  SSLS-DKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQ  1859
              S S DK +C  ++         +     VG++ + A  N GF TAAV      V+ LAQ
Sbjct  80    VSSSFDKVICSNDNIAKVDEKRTKRVGYAVGKVTKVALRNGGFGTAAV----DGVFALAQ  135

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGG  1679
             CW+ V  + C +CL  A  K+  C PK EGR L  GCY+RYSTKKF++   +  T  + G
Sbjct  136   CWKSVPFEGCQECLQKAEMKVRGCSPKAEGRGLYTGCYLRYSTKKFFNE--MGETEHNHG  193

Query  1678  RSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYE  1499
              S    +I   +  S AF+++   VA++   R+ K++KE + LG + +   KS L F YE
Sbjct  194   VSGIAFIIAIISATS-AFIMLSVLVAYVTYARLSKRKKELENLGQIWINFEKSGLKFKYE  252

Query  1498  TLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGI  1319
             TLEKATDYF  S KLGQGG+G V+ G+LP+GK VA+KRL +NT QW D FFNEVNLIS I
Sbjct  253   TLEKATDYFSLSRKLGQGGTGSVFMGMLPNGKIVAVKRLIYNTRQWVDEFFNEVNLISKI  312

Query  1318  HHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLA  1139
              HKNLVKLLGCSI GPESLLVYE++PN+SL  +    K  + L W+ R+ II GTAEGLA
Sbjct  313   QHKNLVKLLGCSIEGPESLLVYEYIPNKSLDQFIFDEKKAKLLKWKHRFDIIFGTAEGLA  372

Query  1138  YLH-EETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAP  962
             +LH  E+++ IIHRDIK SNVLLDE   PKIADFGLVR    DKSH+ST VAGTLGYMAP
Sbjct  373   HLHGGESQIRIIHRDIKSSNVLLDENLNPKIADFGLVRCLAPDKSHLSTGVAGTLGYMAP  432

Query  961   EYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGS  782
             EY+++G+LTEKADVYSFG+LV+E+V GK+N++F + S SLLQ  W L+R+ +L EAVD  
Sbjct  433   EYLIRGQLTEKADVYSFGILVLEIVCGKRNATFSKDSSSLLQAVWTLYRSNRLAEAVDPC  492

Query  781   LEER--ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPFLTSN  617
             + +   A+V     LQIGL+C QAS  LRPSM  VV+M++  D +IP P QPPF+  N
Sbjct  493   IRDEILAKVSPDYVLQIGLLCTQASVSLRPSMVEVVQMLTDKDCEIPIPNQPPFINGN  550



>ref|XP_010663147.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Vitis 
vinifera]
Length=667

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/626 (47%), Positives = 401/626 (64%), Gaps = 27/626 (4%)
 Frame = -2

Query  2428  WLFLFIFFLSINRSVSDPRASEAALICTN-RTAPQSQRQAYVANFVAALDALTPLVDSKK  2252
             W+ L    L  + S+SDPR S+A L+C + ++AP      Y+ NF+  ++A+   +  + 
Sbjct  13    WISLVYSMLLFSLSLSDPRISQAGLLCGDTKSAPS----IYIPNFIQVMEAIAKSMVQQG  68

Query  2251  YGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCF  2072
             +G   I   +  ++   +C  DLS+ DC  CFA+ +T++ RCLP        R++ DGCF
Sbjct  69    WGYANI-TKSPVIFGLSQCYSDLSKDDCLSCFAESRTKLPRCLP----AIAARIYLDGCF  123

Query  2071  VRYDDYVFFNESSSLSDKTVCGAEDFGG-----NSGLFRRNAAALVGELGRKAAANDGFF  1907
             +RYD+Y FFNES   +   V  +E  G          F +    ++  + + A    GF 
Sbjct  124   LRYDNYSFFNESIDPNHDMVRCSEPSGVLKDNYTRSEFSKKVDEVINNVTKTAVQKQGFA  183

Query  1906  TAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTK  1727
              A +  G    Y LAQCW+ V  K C DCL  A S +  CLP  EGR LNAGCY+RYST+
Sbjct  184   VAGMKGGAVVAYALAQCWKTVDQKGCRDCLVNAESAVRRCLPGSEGRALNAGCYLRYSTE  243

Query  1726  KFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLI--LGS-VAFIVRKRIVKQRKERK  1556
             KFY++ T     +SG   +   +I+A      A  L+  LG+ V +I+  +  ++R    
Sbjct  244   KFYNDGT---AKKSGKGLSDTGMIIAFILSVLAVCLLAFLGAFVGYILLSK--RKRNNNN  298

Query  1555  RLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFF  1376
              L  +   +N+S LNF YETLE+AT++FD S KLGQGG+G V+KG LPDG+TVA+KRLFF
Sbjct  299   ALARIPTCINRSDLNFKYETLERATNFFDSSRKLGQGGAGSVFKGTLPDGRTVAVKRLFF  358

Query  1375  NTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQ  1196
             NT QW D FFNEVNLIS I HKNLV LLGCSI GPESLLVYE+VPN+S+      +   Q
Sbjct  359   NTRQWVDEFFNEVNLISRIQHKNLVGLLGCSIEGPESLLVYEYVPNKSVDQILFGKDGTQ  418

Query  1195  PLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPE  1016
              LSW+QR++II+GTAEGLAYLH  +E+ IIHRDIK SN+LLDE   PKIADFGL R    
Sbjct  419   GLSWQQRFEIIVGTAEGLAYLHGGSEVKIIHRDIKGSNILLDENLNPKIADFGLARCVAP  478

Query  1015  DKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQ  836
             DKSH+ST +AGTLGYMAPEY+V+G+L+EKADVY++GVL++E+V G+KN  F Q S S+LQ
Sbjct  479   DKSHVSTGIAGTLGYMAPEYLVRGQLSEKADVYAYGVLILEIVCGRKNCIFVQGSDSVLQ  538

Query  835   QHWNLFRAGKLYEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ  659
               W  +++  +  +VD SL+ +    EA   +QIGL+C QAS  LRPSMS VV+M++ DQ
Sbjct  539   TVWKHYKSNSVVRSVDPSLKGDFPLNEARNVVQIGLLCTQASFALRPSMSQVVQMLT-DQ  597

Query  658   D--IPQPTQPPFLTSNSAASSGSYPN  587
             +  IP+P QPPFL ++    S S  N
Sbjct  598   NSVIPEPMQPPFLNASVLDPSNSLKN  623



>emb|CBI15002.3| unnamed protein product [Vitis vinifera]
Length=696

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/619 (47%), Positives = 397/619 (64%), Gaps = 27/619 (4%)
 Frame = -2

Query  2407  FLSINRSVSDPRASEAALICTN-RTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIG  2231
              L  + S+SDPR S+A L+C + ++AP      Y+ NF+  ++A+   +  + +G   I 
Sbjct  1     MLLFSLSLSDPRISQAGLLCGDTKSAPS----IYIPNFIQVMEAIAKSMVQQGWGYANI-  55

Query  2230  AGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYV  2051
               +  ++   +C  DLS+ DC  CFA+ +T++ RCLP        R++ DGCF+RYD+Y 
Sbjct  56    TKSPVIFGLSQCYSDLSKDDCLSCFAESRTKLPRCLP----AIAARIYLDGCFLRYDNYS  111

Query  2050  FFNESSSLSDKTVCGAEDFGG-----NSGLFRRNAAALVGELGRKAAANDGFFTAAVGRG  1886
             FFNES   +   V  +E  G          F +    ++  + + A    GF  A +  G
Sbjct  112   FFNESIDPNHDMVRCSEPSGVLKDNYTRSEFSKKVDEVINNVTKTAVQKQGFAVAGMKGG  171

Query  1885  NSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNST  1706
                 Y LAQCW+ V  K C DCL  A S +  CLP  EGR LNAGCY+RYST+KFY++ T
Sbjct  172   AVVAYALAQCWKTVDQKGCRDCLVNAESAVRRCLPGSEGRALNAGCYLRYSTEKFYNDGT  231

Query  1705  IPATNQSGGRSNHLPVILATTFGSFAFLLI--LGS-VAFIVRKRIVKQRKERKRLGAMLV  1535
                  +SG   +   +I+A      A  L+  LG+ V +I+  +  ++R     L  +  
Sbjct  232   ---AKKSGKGLSDTGMIIAFILSVLAVCLLAFLGAFVGYILLSK--RKRNNNNALARIPT  286

Query  1534  TVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWAD  1355
              +N+S LNF YETLE+AT++FD S KLGQGG+G V+KG LPDG+TVA+KRLFFNT QW D
Sbjct  287   CINRSDLNFKYETLERATNFFDSSRKLGQGGAGSVFKGTLPDGRTVAVKRLFFNTRQWVD  346

Query  1354  HFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQR  1175
              FFNEVNLIS I HKNLV LLGCSI GPESLLVYE+VPN+S+      +     LSW+QR
Sbjct  347   EFFNEVNLISRIQHKNLVGLLGCSIEGPESLLVYEYVPNKSVDQILFGKNPTSCLSWQQR  406

Query  1174  YKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHIST  995
             ++II+GTAEGLAYLH  +E+ IIHRDIK SN+LLDE   PKIADFGL R    DKSH+ST
Sbjct  407   FEIIVGTAEGLAYLHGGSEVKIIHRDIKGSNILLDENLNPKIADFGLARCVAPDKSHVST  466

Query  994   AVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFR  815
              +AGTLGYMAPEY+V+G+L+EKADVY++GVL++E+V G+KN  F Q S S+LQ  W  ++
Sbjct  467   GIAGTLGYMAPEYLVRGQLSEKADVYAYGVLILEIVCGRKNCIFVQGSDSVLQTVWKHYK  526

Query  814   AGKLYEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQD--IPQP  644
             +  +  +VD SL+ +    EA   +QIGL+C QAS  LRPSMS VV+M++ DQ+  IP+P
Sbjct  527   SNSVVRSVDPSLKGDFPLNEARNVVQIGLLCTQASFALRPSMSQVVQMLT-DQNSVIPEP  585

Query  643   TQPPFLTSNSAASSGSYPN  587
              QPPFL ++    S S  N
Sbjct  586   MQPPFLNASVLDPSNSLKN  604



>ref|XP_006446554.1| hypothetical protein CICLE_v10014520mg [Citrus clementina]
 gb|ESR59794.1| hypothetical protein CICLE_v10014520mg [Citrus clementina]
Length=664

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/621 (48%), Positives = 398/621 (64%), Gaps = 29/621 (5%)
 Frame = -2

Query  2431  KWLFLFIFFLS---INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVD  2261
             +WLFLFI  +        +SDPR SE  + C+   A +S+   +V  FV  ++ L+ L+ 
Sbjct  6     QWLFLFIITIIIIMFRLCLSDPRISEPTIFCS---ANKSKTSNFVPAFVKEMEILSQLIT  62

Query  2260  SKKYGET--VIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLF  2087
             +  +  T  +       +YA  +C  DLS TDC LCFA  +T++ RCLP         +F
Sbjct  63    ANTHFATFNLNKTPYVPIYALAQCHLDLSHTDCLLCFAASRTKLPRCLP----SLSATIF  118

Query  2086  YDGCFVRYDDYVFFNESSSLS-DKTVCGAEDF-----GGNSGL--FRRNAAALVGELGRK  1931
             +DGCF+RYD Y F+ ES S S D   C AE+        N  +  F  +    VG + R 
Sbjct  119   FDGCFLRYDIYSFYQESVSPSLDDVKCSAENATVENENENDAVDGFVESVGYAVGNVSRI  178

Query  1930  AAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIG-SCLPKEEGRVLNA  1754
             A    G F A    G   VY LAQCWE +    C +CL  A  ++  SC  ++EGR  NA
Sbjct  179   AVEKGGGFGAVKVMG---VYALAQCWESLGRDGCRECLDKAGMRVRRSCRMRKEGRGFNA  235

Query  1753  GCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVK  1574
             GCY+RYST KF+++      ++   R   L V++A    + AFL++    A+    R+ K
Sbjct  236   GCYLRYSTDKFFNHDDETGDDRGSSR---LGVMIAIVLSTTAFLMLSLFAAYAAYARLSK  292

Query  1573  QRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVA  1394
              +++R  LG    ++ KS L+F YETLEKAT+YF+ S KLGQGG+G VY G LP+G TVA
Sbjct  293   MKEDRNNLGLYATSIKKSCLSFKYETLEKATNYFNPSKKLGQGGAGSVYMGSLPNGTTVA  352

Query  1393  IKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTS  1214
             +KRL FNT QW D FFNEVNLIS I HKNLVKLLGCSI GPESLLVYE+VPN+SL  +  
Sbjct  353   VKRLIFNTRQWVDEFFNEVNLISSIEHKNLVKLLGCSIEGPESLLVYEYVPNRSLDQFIF  412

Query  1213  ARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGL  1034
              +   + L+W +R+ IILGTAEGLAYLH  +E  IIHRDIK SN+LLD++FTPKIADFGL
Sbjct  413   DKNKTKLLNWNKRFNIILGTAEGLAYLHGGSETRIIHRDIKTSNILLDKDFTPKIADFGL  472

Query  1033  VRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQA  854
              R F  D++H+STAVAGTLGYMAPEY+V+G+LTEKADVYSFG+L+IE+V G+++++F   
Sbjct  473   ARCFAADRTHVSTAVAGTLGYMAPEYLVRGQLTEKADVYSFGILIIEIVCGRRSNAFSHD  532

Query  853   SVSLLQQHWNLFRAGKLYEAVDGSLEERARVE-ATRQLQIGLVCVQASPELRPSMSAVVK  677
             S S LQ+ W L+R+ KL EAVD +L++    E     LQIGL+C QA+  LRPSM+  + 
Sbjct  533   SASPLQRVWTLYRSNKLVEAVDPNLKDDFPAEQVCNVLQIGLLCTQAAAALRPSMAQAIM  592

Query  676   MISGDQ-DIPQPTQPPFLTSN  617
             +++    +IP P+QPPFL S+
Sbjct  593   LLTNKVCEIPTPSQPPFLNSS  613



>ref|XP_010027537.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
 gb|KCW83355.1| hypothetical protein EUGRSUZ_B00290 [Eucalyptus grandis]
Length=640

 Score =   548 bits (1411),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 295/620 (48%), Positives = 393/620 (63%), Gaps = 27/620 (4%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             +FL +F  S   S+ DPR SEA ++C             V+NF+  +  +   V   ++ 
Sbjct  11    VFLVLFSSSFLPSLGDPRISEAGILCLKSNVTS------VSNFLDVMQKVLAKVAEDRWA  64

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
                I +    +YA  +C  DLS+ DC LCFA  +T + RC     L   GRL+ DGCF+R
Sbjct  65    NDSITSPLPEIYALAQCHGDLSRDDCILCFAHSRTLLSRC---TILDTKGRLYLDGCFIR  121

Query  2065  YDDYVFFNESSSLSDKTVCGAEDFGGNSGL-----FRRNAAALVGELGRKAAANDGF--F  1907
              D Y F NE+       V  A     ++       F      ++  +   A  N GF  F
Sbjct  122   SDYYNFLNETVDPQHDLVKCANQSSVSADQQARQQFVDKVDRVLTNVSAVAPGNKGFAVF  181

Query  1906  TAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTK  1727
               A   G + VY LAQCW  +  K C +CLA A+ +  +C P +EGR +NAGC+MRYST+
Sbjct  182   GEARRGGVAGVYALAQCWNTLDEKGCRECLANAMIRARNCTPGDEGRAMNAGCFMRYSTQ  241

Query  1726  KFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLG  1547
             +FY   T+P    + G S  L +I+A      A   +L   A++  +++ K+R+ +K+L 
Sbjct  242   RFY---TVP----TDGDSLKLGIIIAIALSVAAATSLLIVSAYVGYRKLSKKREVQKKLF  294

Query  1546  AMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTT  1367
              +   V KS LNF+YE+LEKATD+FD+S KLGQGGSG VY+G+LPDG+ VA+KRL FNT 
Sbjct  295   GVPAIVRKSNLNFNYESLEKATDFFDESRKLGQGGSGSVYEGILPDGRVVAVKRLVFNTR  354

Query  1366  QWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLS  1187
             QW D FFNEVNLISGI HKNLV+LLGCSI GPESLLVYE+VPN+SL      +     LS
Sbjct  355   QWVDDFFNEVNLISGIQHKNLVRLLGCSIEGPESLLVYEYVPNRSLDQILFVKNATHVLS  414

Query  1186  WEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKS  1007
             W++R  II GTAEGLA+LH    + IIHRDIK SNVLLDE+ T KIADFGL R    +KS
Sbjct  415   WQERVNIISGTAEGLAFLHGPCGVKIIHRDIKSSNVLLDEDLTAKIADFGLARCLDPEKS  474

Query  1006  HISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHW  827
             H+ST +AGTLGYMAPEY+V+G+LTEKADVY+FGVLV+E++SG+KNS F QAS S+LQ  W
Sbjct  475   HLSTGIAGTLGYMAPEYLVKGQLTEKADVYAFGVLVLEILSGRKNSIFGQASGSVLQSVW  534

Query  826   NLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISGDQD--  656
               +++ +L E +D +L+ +  + EA   +QI L+C QASP+LRPSMS VV+M++ DQ+  
Sbjct  535   KRYKSNRLAECIDPALKGKFPISEALNVIQIALLCTQASPDLRPSMSEVVEMLN-DQECI  593

Query  655   IPQPTQPPFLTSNSAASSGS  596
             +P P QPPFL +N      S
Sbjct  594   VPMPMQPPFLNNNPIPDDSS  613



>ref|XP_010027527.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Eucalyptus 
grandis]
Length=654

 Score =   548 bits (1411),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 298/609 (49%), Positives = 396/609 (65%), Gaps = 29/609 (5%)
 Frame = -2

Query  2380  DPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAFG  2201
             DPR SEA ++C       +     V+NF+  +  +   V+   +    + +    +YA  
Sbjct  36    DPRVSEAGILCLQSNVTSTAN--IVSNFLDVMRKIAATVNEDLWANDSVTSPLPEIYALA  93

Query  2200  ECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES-SSLS  2024
             +C  DLS  DC LCFAQ +T + RC     L   GRL+ DGCF+R D Y FFNE+     
Sbjct  94    QCHGDLSHDDCLLCFAQSRTILPRC---TVLNTKGRLYLDGCFIRSDYYNFFNETIDPQH  150

Query  2023  DKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAA----NDGF--FTAAVGRGNSTVYGLA  1862
             D   C  +         R+  A  V  +    +A    N GF  F  A   G + VY LA
Sbjct  151   DMVKCANQSSVSADQQARQQFADKVDRVLTNVSAGAPENKGFAVFGEARRGGVAGVYALA  210

Query  1861  QCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSG  1682
             QCW  +  K C +CLA A+ +  +C P EEGR +NAGC+MRYST++FY   T+P    + 
Sbjct  211   QCWNTLDEKGCRECLANAMIRARNCTPGEEGRAMNAGCFMRYSTQRFY---TVP----TD  263

Query  1681  GRSNHLPVILATTFGSFAF--LLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNF  1508
             G S  L +I+A +    A   LLI+G  A++  +++ K+R+ +K+L  +   V KS LNF
Sbjct  264   GDSLKLGIIIAISLSVAAATSLLIVG--AYVGYRKLSKKREVQKKLFGVPEIVRKSNLNF  321

Query  1507  SYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLI  1328
             +YE+LE+ATD+FD+S KLGQGG+G VYKG+LPDG+ VA+KRL FNT QW D FFNEVNLI
Sbjct  322   NYESLERATDFFDESRKLGQGGAGSVYKGILPDGRIVAVKRLVFNTRQWVDDFFNEVNLI  381

Query  1327  SGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAE  1148
             +GI HKNLV+LLGCSI GPESLLVYE+VPN+SL      +     LSW++R  II GTAE
Sbjct  382   TGIQHKNLVRLLGCSIEGPESLLVYEYVPNRSLDQILFVKNAIHVLSWQERLNIISGTAE  441

Query  1147  GLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYM  968
             GLA+LH    + IIHRDIK SNVLLDE+ T KIADFGL R    + SH+ST +AGTLGYM
Sbjct  442   GLAFLHGPCGVKIIHRDIKSSNVLLDEDLTAKIADFGLARCLDPENSHLSTGIAGTLGYM  501

Query  967   APEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVD  788
             APEY+V+G+LTEKADVY+FGVLV+E++SG+KNS F QAS S+LQ  W  +++ +L E +D
Sbjct  502   APEYLVKGQLTEKADVYAFGVLVLEILSGRKNSIFGQASGSVLQSVWKQYKSNRLSECID  561

Query  787   GSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISGDQD--IPQPTQPPFLTSN  617
              +L+ +  + EA   +QI L+C QASP+LRPSMS VV+M++ DQ+  +P PTQPPFL +N
Sbjct  562   PALKGKFPISEALNVIQIALLCTQASPDLRPSMSEVVEMLN-DQECIVPMPTQPPFLNNN  620

Query  616   SAA--SSGS  596
             +    SSGS
Sbjct  621   AIPDDSSGS  629



>ref|XP_006470280.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Citrus sinensis]
Length=664

 Score =   548 bits (1411),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 299/621 (48%), Positives = 398/621 (64%), Gaps = 29/621 (5%)
 Frame = -2

Query  2431  KWLFLFIFFLS---INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVD  2261
             +WLFLFI           +SDPR SE  + C+   A +S+   +V  FV  ++ L+ L+ 
Sbjct  6     QWLFLFIIITIIIMFRLCLSDPRISEPTIFCS---AKKSKTSNFVPAFVKEMEILSQLIT  62

Query  2260  SKKYGET--VIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLF  2087
             +  +  T  +    +  +YA  +C  DLS TDC LCFA  +T++ RCLP         +F
Sbjct  63    ANTHFATFNLNKTPHVPIYALAQCHLDLSHTDCLLCFAASRTKLPRCLP----SLSAAIF  118

Query  2086  YDGCFVRYDDYVFFNESSSLS-DKTVCGAEDF-----GGNSGL--FRRNAAALVGELGRK  1931
             +DGCF+RYD Y F+ ES S S D   C AE+        N  +  F  +    VG + R 
Sbjct  119   FDGCFLRYDIYSFYQESVSPSLDDVKCSAENATVENENENDAVDGFVESVGYAVGNVSRI  178

Query  1930  AAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIG-SCLPKEEGRVLNA  1754
             A    G F A    G   VY LAQCWE +    C +CL  A  ++  SC  ++EGR  NA
Sbjct  179   AVEKGGGFGAVKVMG---VYALAQCWESLGRDGCRECLDKAGMRVRRSCRMRKEGRGFNA  235

Query  1753  GCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVK  1574
             GCY+RYST KF+++      ++   R   L V++A    + AFL++    A+    R  K
Sbjct  236   GCYLRYSTDKFFNHDDETGDDRGSSR---LGVMIAIVLSTTAFLMLSLFAAYAAYARSSK  292

Query  1573  QRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVA  1394
              +++R  LG    ++ KS L+F YETLEKAT+YF+ S KLGQGG+G VY G LP+G TVA
Sbjct  293   MKEDRNNLGLYATSMKKSCLSFKYETLEKATNYFNPSKKLGQGGAGSVYMGSLPNGTTVA  352

Query  1393  IKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTS  1214
             +KRL FNT QW D FFNEVNLIS I HKNLVKLLGCSI GPESLLVYE+VPN+SL  +  
Sbjct  353   VKRLIFNTRQWVDEFFNEVNLISSIEHKNLVKLLGCSIEGPESLLVYEYVPNRSLDQFIF  412

Query  1213  ARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGL  1034
              +   + L+W +R+ IILGTAEGLAYLH  +E  IIHRDIK SN+LLD++FTPKIADFGL
Sbjct  413   DKNKTKLLNWNKRFNIILGTAEGLAYLHGGSETRIIHRDIKTSNILLDKDFTPKIADFGL  472

Query  1033  VRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQA  854
              R F  D++H+STAVAGTLGYMAPEY+V+G+LTEKADVYSFG+L+IE+V G+++++F Q 
Sbjct  473   ARCFAADRTHVSTAVAGTLGYMAPEYLVRGQLTEKADVYSFGILIIEIVCGRRSNAFSQD  532

Query  853   SVSLLQQHWNLFRAGKLYEAVDGSLEERARVEAT-RQLQIGLVCVQASPELRPSMSAVVK  677
             S S LQ+ W L+R+ KL EAVD +L++    E     LQIGL+C QA+  LRPSM+  + 
Sbjct  533   SASPLQRVWTLYRSNKLVEAVDPNLKDDFPAEQVCNVLQIGLLCTQAAAALRPSMAQAIM  592

Query  676   MISGDQ-DIPQPTQPPFLTSN  617
             +++    +IP P+QPPFL S+
Sbjct  593   LLTNKVCEIPTPSQPPFLNSS  613



>ref|XP_002524667.1| kinase, putative [Ricinus communis]
 gb|EEF37686.1| kinase, putative [Ricinus communis]
Length=605

 Score =   543 bits (1400),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 284/542 (52%), Positives = 370/542 (68%), Gaps = 19/542 (4%)
 Frame = -2

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             +Y   +C +DLSQTDC LC+A  +T+I RCLP        R+F DGCF+RYD+Y FF ES
Sbjct  24    MYVLAQCHQDLSQTDCLLCYAVSRTKIPRCLP----SVSARIFLDGCFLRYDNYNFFEES  79

Query  2035  SSLS-DKTVCGAEDFGGNSG-----LFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTV  1874
              S+S D+  C  E+  G++G      F ++    +G +  KA  N GF    +      V
Sbjct  80    VSVSFDEVKCSQENVSGSNGENDKLRFVKSVEHAIGNVSSKAVENGGFGVVGI----EGV  135

Query  1873  YGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPAT  1694
             Y LAQCWE V    C +CL  A  ++  C  K+EGR LNAGCY+RYST++FY+   +   
Sbjct  136   YALAQCWESVGKDGCRECLRKAGKEVKGCGAKKEGRGLNAGCYLRYSTERFYN---VGGE  192

Query  1693  NQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKL  1514
              ++G   + L V +A    + A L++     + V  R +K + ER  L  + +  +K+ L
Sbjct  193   LEAGHTISGLGVAIAVVLAAAAVLMLSIFAVYAVYVRRMKNKAERINLEKISINFSKTSL  252

Query  1513  NFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVN  1334
             NF YETLEKATDYF+ S K+GQGG+G VY G LP+G+TVA+KRL FNT QW D FFNEVN
Sbjct  253   NFKYETLEKATDYFNASRKIGQGGAGSVYAGTLPNGETVAVKRLTFNTRQWVDEFFNEVN  312

Query  1333  LISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGT  1154
             LISGI HKNLVKLLGCSI GPESLLVYE+VPN+SL  +   +     L+W+QR+ II+GT
Sbjct  313   LISGIQHKNLVKLLGCSIEGPESLLVYEYVPNKSLDQFIFGKDKPTTLNWKQRFDIIVGT  372

Query  1153  AEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLG  974
             AEGLAYLH  ++  IIHRDIK SNVLLDE+FTPKIADFGLVR F  DKSH+ST +AGT+G
Sbjct  373   AEGLAYLHGGSQERIIHRDIKSSNVLLDEDFTPKIADFGLVRCFGADKSHLSTGIAGTMG  432

Query  973   YMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEA  794
             YMAPEY+++G+LTEKADVYSFGVLV+E+V GK+ ++F + S SLLQ  W L+R  +L EA
Sbjct  433   YMAPEYLIRGQLTEKADVYSFGVLVLEIVMGKRCNAFTEDSKSLLQTVWQLYRLNRLVEA  492

Query  793   VDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGD-QDIPQPTQPPFLTS  620
              D SL ++ +  E +R LQ GL+C QAS  LRPSM+ VV M++    +IP P+QPPF+ +
Sbjct  493   ADPSLRDDFSAEEVSRVLQTGLLCTQASVALRPSMAEVVVMLTNSGGEIPLPSQPPFMNA  552

Query  619   NS  614
              S
Sbjct  553   TS  554



>ref|XP_007215016.1| hypothetical protein PRUPE_ppa002530mg [Prunus persica]
 gb|EMJ16215.1| hypothetical protein PRUPE_ppa002530mg [Prunus persica]
Length=661

 Score =   545 bits (1403),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 295/632 (47%), Positives = 401/632 (63%), Gaps = 38/632 (6%)
 Frame = -2

Query  2443  ASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLV  2264
             A  + W+  F    S+  S+SDPR ++A L C     P +   +++  FV  +++L+ L+
Sbjct  3     AKTTTWVIFFFLVFSV--SLSDPRTNQATLSCGTLKPPPNA--SFIPTFVKEMESLSQLI  58

Query  2263  DSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFY  2084
              +  +G   + +    +Y   +C +DLS TDC LC+A  +T+I RCLP         +F 
Sbjct  59    TTHHWGTHFVNS-TPPMYGLAQCFQDLSHTDCLLCYAASRTKIPRCLP----SLSATIFL  113

Query  2083  DGCFVRYDDYVFFNESSSLS-DKTVCGAE-----------DFGGNSGLFRRNAAALVGEL  1940
             DGC++RYD+Y F+ + +  S D  +C +            +F  N G   RN        
Sbjct  114   DGCYLRYDNYSFYQQPTDPSRDAVICSSSSKPEIENEDRMEFVKNVGFAIRNVT------  167

Query  1939  GRKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVL  1760
               KAA ++G F  A  +G  +VY LAQCW+ V    C  CL      +  C PK+EGR L
Sbjct  168   --KAAVDNGGFGVAQVKG--SVYALAQCWKTVGRDGCRACLEKGGEAVRGCAPKKEGRAL  223

Query  1759  NAGCYMRYSTKKFYDNSTIP--ATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRK  1586
             NAGCY+RYST+KFY++        +   G S    +I+A    + AF+L+    A+    
Sbjct  224   NAGCYLRYSTEKFYNDEEQAEHMADHGHGLSVSRGIIIAVVLAAAAFILLSLFAAYAGYA  283

Query  1585  RIVKQRKERKRLGAMLVTVNK-SKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPD  1409
             ++V+ ++ER  +G   +++NK S L F YETLEKATDYF+ S K+GQGG G V+KG LP+
Sbjct  284   KLVQIKQERSGVGLASISINKYSSLKFKYETLEKATDYFNSSRKIGQGGGGSVFKGTLPN  343

Query  1408  GKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSL  1229
             GKTVA+KRL +NT QW D FFNEVNLISGI HK+LVKLLGCSI GPESLLVYE+VPN+SL
Sbjct  344   GKTVAVKRLIYNTRQWVDDFFNEVNLISGIQHKHLVKLLGCSIEGPESLLVYEYVPNKSL  403

Query  1228  YDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKI  1049
               +   +   + L+W +R  II+GTAEGLAYLHE + + IIHRDIK  NVLLDE  +PKI
Sbjct  404   DHFLFDKNKVRILTWNERLNIIVGTAEGLAYLHEGSTIRIIHRDIKSGNVLLDENLSPKI  463

Query  1048  ADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNS  869
             ADFGL R F  D+SH+ST +AGTLGYMAPEY+VQG+LTEKADVYSFGVLV+E+VSGK+NS
Sbjct  464   ADFGLARCFAADQSHLSTGIAGTLGYMAPEYLVQGQLTEKADVYSFGVLVLEIVSGKRNS  523

Query  868   SFYQ---ASVSLLQQHWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELR  701
             +F Q    S SLL + W L+ +  L  A+D  L ++    EA+R LQIGL+C QAS  LR
Sbjct  524   TFRQDWDDSDSLLHKVWKLYISNDLARAIDPCLRDDFPAEEASRVLQIGLLCTQASVALR  583

Query  700   PSMSAVVKMISGDQDIPQPTQPPFLTSNSAAS  605
             PSM+ VV M++  + +  P QPPFL +  +++
Sbjct  584   PSMAEVVAMLTNKERVAVPNQPPFLNATGSST  615



>ref|XP_008230569.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Prunus 
mume]
Length=663

 Score =   544 bits (1401),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 293/629 (47%), Positives = 395/629 (63%), Gaps = 30/629 (5%)
 Frame = -2

Query  2443  ASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLV  2264
             A  + W+  F    S+  S+SDPR +EA L C     P +   +++  FV  ++ L+ L+
Sbjct  3     AKTTTWVIFFFLVFSV--SLSDPRTNEATLSCGTLKPPPNT--SFIPTFVKEMEILSQLI  58

Query  2263  DSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFY  2084
              +  +G   + +    +Y   +C +DLS TDC LC+A  +T++ RCLP         +F 
Sbjct  59    TTHHWGTHFVNS-TPPMYGLAQCFQDLSHTDCLLCYAASRTKLPRCLP----SLSATIFL  113

Query  2083  DGCFVRYDDYVFFNESSSLS-DKTVCGA----EDFGGNSGLFRRNAAALVGELGRKAAAN  1919
             DGC++RYD+Y F+ +S+  S D  +C      E    +   F RN    +  + + A  N
Sbjct  114   DGCYLRYDNYSFYQQSTDPSRDAVICSPSSKHELENEDRMEFVRNVGFAIRNVTKAAVDN  173

Query  1918  DGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMR  1739
              GF  A V     +VY LAQCW+ V    C  CL      +  C PK+EGR LNAGCY+R
Sbjct  174   GGFGVAQV---KGSVYALAQCWKTVGRDGCRACLEKGGEAVRGCAPKKEGRALNAGCYLR  230

Query  1738  YSTKKFYDNSTIPATNQSGGR----SNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQ  1571
             YST+KFY++          G     S  + + +     +F FL +    A+    ++V+ 
Sbjct  231   YSTEKFYNDEEQGEHMADHGHGLSVSRGIIIAVVLAAAAFIFLSLFA--AYAGYAKLVQI  288

Query  1570  RKERKRLGAMLVTVNK-SKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVA  1394
             ++ER  +G   +++NK S L F YETLEKATDYF+ S K+GQGG G V+KG LP+GKTVA
Sbjct  289   KQERSGVGLASISINKYSSLKFKYETLEKATDYFNSSRKIGQGGGGSVFKGTLPNGKTVA  348

Query  1393  IKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTS  1214
             +KRL +NT QW D FFNEVNLISGI HK+LVKLLGCSI GPESLLVYE+VPN+SL  +  
Sbjct  349   VKRLIYNTRQWVDDFFNEVNLISGIQHKHLVKLLGCSIEGPESLLVYEYVPNKSLDHFLF  408

Query  1213  ARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGL  1034
              +   Q L+W +R  II+GTAEGLAYLHE + + IIHRDIK  NVLLDE  +PKIADFGL
Sbjct  409   DKNKVQILTWNERLNIIIGTAEGLAYLHEGSTIRIIHRDIKSGNVLLDENLSPKIADFGL  468

Query  1033  VRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQ-  857
              R F  D+SH+ST +AGTLGYMAPEY+VQG+LTE+ADVYSFGVLV+E+VSGK+NS+F Q 
Sbjct  469   ARCFAADQSHLSTGIAGTLGYMAPEYLVQGQLTERADVYSFGVLVLEIVSGKRNSTFRQD  528

Query  856   --ASVSLLQQHWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSA  686
                  SLL + W L+ +  L  AVD  L ++    EA+R LQIGL+C QAS  LRPSM+ 
Sbjct  529   WDDPDSLLHKVWKLYISNDLARAVDPCLRDDFPAEEASRVLQIGLLCTQASVALRPSMAE  588

Query  685   VVKMISGDQD--IPQPTQPPFLTSNSAAS  605
             VV M++  +   +P P QPPFL +  +++
Sbjct  589   VVAMLTNKERAAVPNPNQPPFLNATGSST  617



>emb|CAN69244.1| hypothetical protein VITISV_038880 [Vitis vinifera]
Length=653

 Score =   542 bits (1396),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 284/571 (50%), Positives = 367/571 (64%), Gaps = 15/571 (3%)
 Frame = -2

Query  2287  LDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRL  2108
             ++ L+ LV    +G   + +    +Y   +C +DLS  DC LC+A  +T++ RCLP    
Sbjct  1     MEFLSQLVTLNLWGSHFVNS-TPPMYGLAQCHQDLSHLDCLLCYAAGRTKLPRCLP----  55

Query  2107  VRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGL-----FRRNAAALVGE  1943
                 R++ DGCF+RYD+Y FF+ES      TV  +   G          F +N   ++  
Sbjct  56    ATSARIYLDGCFLRYDNYSFFSESVDPDHDTVNCSSGSGAIVDQVAKLEFVKNVHRVINN  115

Query  1942  LGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRV  1763
             +   A AN G+  A V  G   VY LA+CW+ V    C  CL  A +++  CLP +EGR 
Sbjct  116   VTATAVANGGYGVAVVEGGAVGVYALAECWKTVNSSGCRACLQKASNEVRGCLPGKEGRG  175

Query  1762  LNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKR  1583
             LNAGCY+RYST+KFYDN           R+     I+          L      +    +
Sbjct  176   LNAGCYLRYSTEKFYDNGGESEGGSGSSRTGLTIAIVLAAAALILVSLFAAYAGYASLSK  235

Query  1582  IVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGK  1403
             I   ++ERK LG +   +NKS LNF YETLE+AT+YF+ S KLGQGG+G VY G LP+G+
Sbjct  236   I---KEERKNLGKVASIINKSSLNFKYETLERATEYFNPSRKLGQGGAGSVYMGTLPNGE  292

Query  1402  TVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYD  1223
              VA+KRL FNT QW D FFNEVNLISGI HKNLVKLLGCSI GPESLLVYE+VPN+S   
Sbjct  293   IVAVKRLIFNTRQWVDEFFNEVNLISGIQHKNLVKLLGCSIEGPESLLVYEYVPNRSJDQ  352

Query  1222  YTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIAD  1043
             +   +   Q L+WEQR+ II+GTAEGLAYLH   ++ IIHRDIK SN+LLDE  TPKIAD
Sbjct  353   FMFDKNKIQTLNWEQRFDIIVGTAEGLAYLHGGLQMRIIHRDIKGSNILLDENLTPKIAD  412

Query  1042  FGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSF  863
             FGL R    DK+H+ST +AGTLGYMAPEY+V+G+LTEKADVYSFGVLV+E+V G+KNS F
Sbjct  413   FGLARCLGADKTHLSTGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEIVCGRKNSVF  472

Query  862   YQASVSLLQQHWNLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSA  686
              Q S SLLQ+ W L+++ KL EA+D  L++     EA+  L+IGL+C QAS  LRPSM+ 
Sbjct  473   TQDSGSLLQRVWKLYKSNKLVEAIDDCLKDDFPEKEASDVLRIGLLCTQASVALRPSMTE  532

Query  685   VVKMIS-GDQDIPQPTQPPFLTSNSAASSGS  596
             VV M++  D +IP P QPPFL ++   S+ S
Sbjct  533   VVWMLTHKDWEIPPPNQPPFLNAHVLESAIS  563



>gb|KHG04179.1| Cysteine-rich receptor-like protein kinase 42 [Gossypium arboreum]
Length=656

 Score =   541 bits (1394),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 299/616 (49%), Positives = 391/616 (63%), Gaps = 28/616 (5%)
 Frame = -2

Query  2431  KWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKK  2252
             +W+FL I  L ++ ++ DPR + A L C    A       YV +F   +  L+  + +  
Sbjct  12    RWVFLLISSLLVSSTLGDPRITNAGLFCGVSQALNGTN--YVPDFTELMKELSDGISNNH  69

Query  2251  YGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCF  2072
             +    + + +  +Y   +C +DL QTDC LC+A+ +T+I RCLP     R  R+F DGCF
Sbjct  70    FASYRLNS-SLPMYGLTQCYEDLKQTDCLLCYAEARTRIPRCLP-----RSARIFLDGCF  123

Query  2071  VRYD-DYVFFNESSSLSDKTVCGAEDF-------GGNSGLFRRNAAALVGELGRKAAAND  1916
             +RYD D  FF E+ S  D   C   +             LF  N    VG +   A    
Sbjct  124   LRYDYDNNFFQEAVSPVDTVNCSTNNVTMYREVNNRRVNLFETNVEYAVGNVTSIALRKG  183

Query  1915  GFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRY  1736
              F TA V      +Y LAQCWE +  + C  CL  A   +  C+P +EGR LNAGCY+RY
Sbjct  184   RFGTAGV----DGIYALAQCWESLTPEGCRQCLQNASMSVRRCMPGDEGRALNAGCYLRY  239

Query  1735  STKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERK  1556
             ST+KFY+     A +   G S  + VI+A    + AFL +  S A+I+  ++ K+R+E +
Sbjct  240   STRKFYNEGGDSADDH--GIS--IGVIIAIVSATSAFLTLAISAAYIIYTKVSKRRRELE  295

Query  1555  RLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFF  1376
              LG +    +KS L F YETLEKATDYF  S KLGQGG+G V+ G+LPDGKTVA+KRL +
Sbjct  296   NLGRISKKFDKSGLKFKYETLEKATDYFSLSRKLGQGGAGSVFMGILPDGKTVAVKRLVY  355

Query  1375  NTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQ  1196
             NT QW D FFNEVNLIS I HKNLVKLLG SI GPESLLVYE+VPN+SL  +    +  +
Sbjct  356   NTRQWVDDFFNEVNLISRIQHKNLVKLLGASIEGPESLLVYEYVPNKSLDQFIFDEEKSK  415

Query  1195  PLSWEQRYKIILGTAEGLAYLH-EETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFP  1019
              L+W+QR  II+GTAEGLA+LH   + + IIHRDIK SNVLLD+    KIADFGLVR   
Sbjct  416   LLNWKQRLNIIVGTAEGLAHLHGGGSHVRIIHRDIKCSNVLLDDNLNAKIADFGLVRCLA  475

Query  1018  EDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLL  839
              +KSH+ST +AGTLGYMAPEY+V+G+L+EKADVYSFGVLV+E+V GKKNSSF   + SLL
Sbjct  476   TEKSHLSTGIAGTLGYMAPEYLVRGQLSEKADVYSFGVLVLEIVCGKKNSSF-TTTGSLL  534

Query  838   QQHWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-  665
             Q  W L+R+  L EA+D  + +E +  EA   LQ+GL+C QAS  LRPSM+ VV+M++  
Sbjct  535   QTVWTLYRSNVLAEAIDPCIRDEMSEKEAPEVLQVGLLCTQASVLLRPSMAEVVQMLTDK  594

Query  664   DQDIPQPTQPPFLTSN  617
             D +IP P QPPFL +N
Sbjct  595   DYEIPTPNQPPFLNAN  610



>ref|XP_004141193.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Cucumis sativus]
 ref|XP_004164734.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Cucumis sativus]
Length=601

 Score =   539 bits (1388),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 285/563 (51%), Positives = 373/563 (66%), Gaps = 23/563 (4%)
 Frame = -2

Query  2287  LDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRL  2108
             ++A++ L+ ++ +    + +    ++A  +C  DLS TDC LC+A  +T + RCLP    
Sbjct  1     MEAISELLTTRSWTTHFVNS-TPPMFALSQCFNDLSHTDCLLCYAASRTSLPRCLP----  55

Query  2107  VRGGRLFYDGCFVRYDDYVFFNESS-SLSDKTVCGAE--DFGGNSGL-FRRNAAALVGEL  1940
                 R+F DGCF+RYD+Y F+ ES+ S+ D   C +E  +   +  L F  N   +V  +
Sbjct  56    AISARIFLDGCFLRYDNYSFYKESTDSVRDSVNCTSELGEIDQSERLVFGENVRVVVETV  115

Query  1939  GRKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVL  1760
               KA    GF    V    S ++GLAQCW  V  + C  CL  A   IGSCLP +EGR +
Sbjct  116   TTKAMEKGGFGMGEV----SGMFGLAQCWGSVEPEGCRACLEKAKRSIGSCLPSKEGRAM  171

Query  1759  NAGCYMRYSTKKFYDNSTIPATNQ--SGGRSNHLPVILATTFGSFAFLLILGSVAFIVRK  1586
             NAGCY+RYST KFY++      +   SG R+     ++     S A L+I  S  F    
Sbjct  172   NAGCYLRYSTVKFYNDKDEDRDHDGFSGRRA-----VVTIALASAASLIIFFSAVFACYT  226

Query  1585  RIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDG  1406
             RI K +KE+KR   + V++  S LNF YETLEKAT+YF+ SNK+GQGG+G VYKG LP+G
Sbjct  227   RISKFKKEKKRQSLIPVSLKDSDLNFKYETLEKATNYFNLSNKIGQGGAGSVYKGTLPNG  286

Query  1405  KTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLY  1226
             + VA+KRL F+T QW D FFNEVNLI GI HKNLV LLGCSI GPESLLVYEFV N SL 
Sbjct  287   QIVAVKRLVFHTRQWVDEFFNEVNLIRGIQHKNLVALLGCSIEGPESLLVYEFVSNGSLD  346

Query  1225  DYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIA  1046
              +   +   Q LSW+QR+ II+GTAEGLA+LHE  ++ IIHRDIK SNVLLDE F PKIA
Sbjct  347   HFIFDKNKAQILSWKQRFNIIVGTAEGLAHLHEGCKIRIIHRDIKSSNVLLDENFNPKIA  406

Query  1045  DFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSS  866
             DFGL R F  D+SH+ST +AGTLGYMAPEY+V+G+LTEKADVYSFGVL++E+V G++NSS
Sbjct  407   DFGLARHFGADQSHLSTGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLILEIVCGRRNSS  466

Query  865   FYQASVSLLQQHWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMS  689
             F + S  LLQ  W+L++  +L EA+D SL ++    EA   LQIGL+C QA   LRPSM+
Sbjct  467   FTENSTPLLQTVWDLYKTERLTEAIDTSLNKDYPAKEAMDILQIGLLCTQALASLRPSMA  526

Query  688   AVVKMISGD--QDIPQPTQPPFL  626
              +VK+++ D  + +  P QPPFL
Sbjct  527   TIVKLLTSDVERKVGIPEQPPFL  549



>ref|XP_006579769.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Glycine max]
Length=667

 Score =   541 bits (1394),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 294/607 (48%), Positives = 384/607 (63%), Gaps = 22/607 (4%)
 Frame = -2

Query  2419  LFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGET  2240
             L  FF   + ++SDPR SE    C+ + +P S    Y   F   ++ L  +V  + +G  
Sbjct  24    LLCFF--SHSALSDPRISEVGHYCSTQKSPTSGD--YFPIFTKEMEKLQEVVTKQNWGTH  79

Query  2239  VIGAGNAT-VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRY  2063
               G  + T +Y   +C +DLS  DC  CFA  +T++ RCLP        R++ DGCF+RY
Sbjct  80    SEGMSSTTPIYGLAQCFQDLSSIDCLQCFASSRTKLPRCLP----SVSARIYLDGCFLRY  135

Query  2062  DDYVFFNESSSLSDKTVCGAEDFGGNSG----LFRRNAAALVGELGRKAAANDGFFTAAV  1895
             D+Y F+ E +     TV     +G   G    L    + A V E   + A N+G    AV
Sbjct  136   DNYSFYTEDTDPLRDTVNCTSQYGAVVGDGEKLVFAESVAKVVESVVRVAVNEGRGIFAV  195

Query  1894  GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYD  1715
             G G   VY LAQCW+ V  K C DCL  A +++  CLPK EGR LN GCY+RYST KFY+
Sbjct  196   GEGGG-VYALAQCWKTVGVKGCSDCLRKAENEVKGCLPKREGRALNTGCYLRYSTVKFYN  254

Query  1714  NSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLV  1535
                     Q    S    ++ A +  + A +++  + +++      K+RK+   + A   
Sbjct  255   QGG--EDGQGDDSSRKRAIVAAGSVLAAAVVVLTLAASYVA---FTKKRKKNNFIEAP-P  308

Query  1534  TVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWAD  1355
             ++  S LN+ YETLEKATDYF  S K+GQGG+G VYKG LP+G  VA+KRL FN  QW D
Sbjct  309   SLKNSSLNYKYETLEKATDYFSSSRKIGQGGAGSVYKGTLPNGNDVAVKRLVFNNRQWVD  368

Query  1354  HFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQR  1175
              FFNEVNLISG+ HKNLVKLLGCSI GPESL+VYE++PN+SL  +   +   + L W+QR
Sbjct  369   DFFNEVNLISGMQHKNLVKLLGCSIEGPESLIVYEYLPNKSLDQFIFEKDITRILKWKQR  428

Query  1174  YKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHIST  995
             ++IILGTAEGLAYLH  +E+ IIHRDIK SNVLLDE   PKIADFGL R F  DK+H+ST
Sbjct  429   FEIILGTAEGLAYLHGGSEIRIIHRDIKSSNVLLDENLNPKIADFGLARCFGTDKTHLST  488

Query  994   AVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFR  815
              +AGTLGYMAPEY++QG+LT+KADVYSFGVLV+E+ SG+KN+ F + S SLLQ  W L++
Sbjct  489   GIAGTLGYMAPEYLIQGQLTDKADVYSFGVLVLEIASGRKNNVFREDSGSLLQTVWKLYQ  548

Query  814   AGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ-DIPQPT  641
             + +L EAVD  L E+    EA+R  QIGL+C QAS  LRPSM+ VV ++S    D P P 
Sbjct  549   SNRLGEAVDPGLGEDFPAREASRVFQIGLLCTQASASLRPSMTQVVSILSNSNLDAPIPK  608

Query  640   QPPFLTS  620
             QPPFL S
Sbjct  609   QPPFLNS  615



>emb|CAN61087.1| hypothetical protein VITISV_034611 [Vitis vinifera]
Length=668

 Score =   540 bits (1391),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 290/624 (46%), Positives = 391/624 (63%), Gaps = 36/624 (6%)
 Frame = -2

Query  2428  WLFLFIFFLSINRSVSDPRASEAALICTN-RTAPQSQRQAYVANFVAALDALTPLVDSKK  2252
             W+ L    L  + S+SDPR S+A L+C + ++AP      Y+ NF+  ++A+   +  + 
Sbjct  13    WISLVYSMLLFSLSLSDPRISQAGLLCGDTKSAPS----IYIPNFIQVMEAIAKSMVQQG  68

Query  2251  YGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCF  2072
             +G   I   +  ++   +C  DLS+ DC  CFA+ +T++ RCLP        R++ DGCF
Sbjct  69    WGYANI-TKSPVIFGLSQCYSDLSKDDCLSCFAESRTKLPRCLP----AIAARIYLDGCF  123

Query  2071  VRYDDYVFFNESSSLSDKTVCGAEDFGG------NSGLFRRNAAALVGELGRKAAANDGF  1910
             +RYD+Y FFNES   +   +    +  G          F +    ++  + + A    GF
Sbjct  124   LRYDNYSFFNESIDPNHMDMVRCSEPSGVLKDNYTRSEFSKKVDEVINNVTKTAVQKQGF  183

Query  1909  FTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYST  1730
               A +  G    Y LAQCW+ V  K C DCL  A S +  CLP  EGR LNAGCY+RYST
Sbjct  184   AVAGMKGGAVVAYALAQCWKTVDQKGCRDCLVNAESAVRRCLPGSEGRALNAGCYLRYST  243

Query  1729  KKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRL  1550
             +KFY++ T     +SG   +   +I+A      A  L+    AF+    + K+++     
Sbjct  244   EKFYNDGT---AKKSGKGLSDTGMIIAFILSVLAVCLLAFJGAFVGYILLSKRKRSLN--  298

Query  1549  GAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNT  1370
                        LNF YETLE+AT++FD S KLGQGG+G V+KG LPDG+TVA+KRLFFNT
Sbjct  299   -----------LNFKYETLERATNFFDSSRKLGQGGAGSVFKGTLPDGRTVAVKRLFFNT  347

Query  1369  TQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPL  1190
              QW D FFNEVNLIS I HKNLV LLGCSI GPESLLVYE+VPN+S+      +   Q L
Sbjct  348   RQWVDEFFNEVNLISRIQHKNLVGLLGCSIEGPESLLVYEYVPNKSVDQILFGKDGTQGL  407

Query  1189  SWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDK  1010
             SW+QR++II+GTAEGLAYLH  +E+ IIHRDIK SN+LLDE   PKIADFGL R    DK
Sbjct  408   SWQQRFEIIVGTAEGLAYLHGGSEVKIIHRDIKGSNILLDENLNPKIADFGLARCVAPDK  467

Query  1009  SHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQH  830
             SH+ST +AGTLGYMAPEY+V+G+L+EKADVY++GVL++E+V G+KN  F Q S S+LQ  
Sbjct  468   SHVSTGIAGTLGYMAPEYLVRGQLSEKADVYAYGVLILEIVCGRKNCIFVQGSDSVLQTV  527

Query  829   WNLFRAGKLYEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQD-  656
             W  +++  +  +VD SL+ +    EA   +QIGL+C QAS  LRPSMS VV+M++ DQ+ 
Sbjct  528   WKHYKSNSVVRSVDPSLKGDFPLNEARNVVQIGLLCTQASFALRPSMSQVVQMLT-DQNS  586

Query  655   -IPQPTQPPFLTSNSAASSGSYPN  587
              IP+P QPPFL ++    S S  N
Sbjct  587   VIPEPMQPPFLNASVLDPSNSLKN  610



>ref|XP_010033300.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
Length=692

 Score =   540 bits (1392),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 300/611 (49%), Positives = 384/611 (63%), Gaps = 28/611 (5%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNAT--  2216
             ++SDPR  EA L C N +A        V  FV  +++L+ L+ ++ +   V     A   
Sbjct  44    ALSDPRIFEAGLSCGNASASAPN---IVPMFVRDMESLSQLMTTRHFATQVTRPSGAAAA  100

Query  2215  ----VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVF  2048
                 VY   +C +DLSQTDC LCFA  +T++ RCL         R+++DGCF+RYD Y F
Sbjct  101   AAAAVYGLSQCHRDLSQTDCLLCFAAGRTKLPRCL----TSPAARIYFDGCFLRYDRYDF  156

Query  2047  FNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALV----GELGRKAAANDGFFTAAVGRGN  1883
             F E+   + D   C   D G   G  R   AA V    G   R A    G F  A   G 
Sbjct  157   FTEAVDPVYDSANC-TSDRGSVDGPAREGFAAAVEFAVGNATRAATGVGGGFGVAEAGG-  214

Query  1882  STVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTI  1703
                Y LAQCWE +    C  CL  A + +  C+P  +GR LNAGCY+RYST KFY +   
Sbjct  215   --AYALAQCWESISSDGCGVCLEKAKTAVRRCVPSRDGRGLNAGCYLRYSTVKFYSDQGA  272

Query  1702  PATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNK  1523
                +Q    S+ + + +A    + A +++    A+    R+ +       L  + +  +K
Sbjct  273   SEADQG---SSSIGITVAVVLVAVACIMLSMFAAYACYARVSRLEGGNIHLHKISIG-DK  328

Query  1522  SKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFN  1343
             S LNF YETLEKAT+YF  S KLGQGG G VYKG LP+GK VA+KRL FNT QW D FFN
Sbjct  329   SSLNFKYETLEKATNYFHHSKKLGQGGGGSVYKGTLPNGKVVAVKRLIFNTRQWVDEFFN  388

Query  1342  EVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKII  1163
             EVNLISGI HKNLVKLLGCSI GPESLLVYE+VPN+SL DY S +   + L+W+QR  II
Sbjct  389   EVNLISGIEHKNLVKLLGCSIEGPESLLVYEYVPNRSLDDYISDKNKIRILNWKQRMSII  448

Query  1162  LGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAG  983
              GTAEG+AYLH   +  IIHRDIK SNVLLDE  TPKIADFGL R F  D++H+ST +AG
Sbjct  449   TGTAEGIAYLHGGCKERIIHRDIKGSNVLLDENLTPKIADFGLARCFGPDETHLSTGIAG  508

Query  982   TLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKL  803
             TLGYMAPEY+V+G+LTEKADVYSFGVLV+E++ G+K+SSF + +VSLLQ  WN +++  L
Sbjct  509   TLGYMAPEYLVRGQLTEKADVYSFGVLVLEIICGRKSSSFREETVSLLQMVWNFYKSDNL  568

Query  802   YEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS-GDQDIPQPTQPPF  629
              EAVD  L+ E    EA+  L+IGL+C QAS   RP M+ VV+M++  D  IPQPTQPPF
Sbjct  569   VEAVDSCLKGEFPAQEASNVLRIGLLCTQASAAARPFMAEVVQMLTREDFAIPQPTQPPF  628

Query  628   LTSNSAASSGS  596
             L +N++  + S
Sbjct  629   LNANASGPATS  639



>gb|KHN45751.1| Cysteine-rich receptor-like protein kinase 42 [Glycine soja]
Length=607

 Score =   537 bits (1383),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 288/574 (50%), Positives = 376/574 (66%), Gaps = 20/574 (3%)
 Frame = -2

Query  2287  LDALTPLVDSKKYGE---TVIGAGNAT-VYAFGECMKDLSQTDCNLCFAQCKTQILRCLP  2120
             +++L+ LV S  +G     + G+G++  +Y F +C +DLS TDC LC+A  +T++ RCLP
Sbjct  1     MESLSQLVTSNNWGTHSVKISGSGSSIPIYGFAQCFRDLSHTDCLLCYAASRTRLPRCLP  60

Query  2119  FQRLVRGGRLFYDGCFVRYDDYVFFNESSSLSDKTV----CGAEDFGGNSGLFRRNAAAL  1952
                     R++ DGCF+RYD+Y F++E +  S   V      A D      L  R    +
Sbjct  61    ----SVSARIYLDGCFLRYDNYSFYSEGTDPSRDAVNCTGVAAGDEAERVELQERVGRVV  116

Query  1951  VGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEE  1772
                +       +GF    V      VY LAQCW  +    C +CL  A  ++  CLPK+E
Sbjct  117   DNVVNIAERDGNGFGVGEV----EGVYALAQCWNTLGSGGCRECLRKAGREVKGCLPKKE  172

Query  1771  GRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIV  1592
             GR LNAGCY+RYST+KFY N    A   +G       ++      +   +L L S ++  
Sbjct  173   GRALNAGCYLRYSTQKFY-NEDGDAGGGNGFLRRRGVIVAEVLAAAAVIMLAL-SASYAA  230

Query  1591  RKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLP  1412
               +  K +KE   LG +  +++KS LN+ YETLEKATDYF+ S K+GQGG+G V+KG+LP
Sbjct  231   FTKFSKIKKENNNLGQISSSISKSSLNYKYETLEKATDYFNSSRKVGQGGAGSVFKGILP  290

Query  1411  DGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQS  1232
             +GK VA+KRL FN  QW D FFNEVNLISGI HKNLVKLLGCSI GPESLLVYE++P +S
Sbjct  291   NGKVVAVKRLIFNNRQWVDEFFNEVNLISGIEHKNLVKLLGCSIEGPESLLVYEYLPKKS  350

Query  1231  LYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPK  1052
             L  +   +   Q L+W+QR+ IILGTAEGLAYLHE T++ IIHRDIK SNVLLDE  TPK
Sbjct  351   LDQFIFEKNRTQILNWKQRFNIILGTAEGLAYLHEGTKIRIIHRDIKSSNVLLDENLTPK  410

Query  1051  IADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN  872
             IADFGL R F  DKSH+ST +AGTLGYMAPEY+++G+LT+KADVYS+GVLV+E+VSG++N
Sbjct  411   IADFGLARCFGGDKSHLSTGIAGTLGYMAPEYLIRGQLTDKADVYSYGVLVLEIVSGRRN  470

Query  871   SSFYQASVSLLQQHWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPS  695
             + F + S SLLQ  W L+R+  L EAVD SL ++    EA+R LQIGL+C QAS  LRPS
Sbjct  471   NVFREDSGSLLQTAWKLYRSNTLTEAVDPSLGDDFPPSEASRVLQIGLLCTQASASLRPS  530

Query  694   MSAVVKMISG-DQDIPQPTQPPFLTSNSAASSGS  596
             MS VV M+S  + D+P P QPPFL +    S  S
Sbjct  531   MSQVVYMLSNTNLDVPTPNQPPFLNTGMLDSDSS  564



>gb|KCW52910.1| hypothetical protein EUGRSUZ_J02225 [Eucalyptus grandis]
Length=732

 Score =   541 bits (1393),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 300/611 (49%), Positives = 384/611 (63%), Gaps = 28/611 (5%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNAT--  2216
             ++SDPR  EA L C N +A        V  FV  +++L+ L+ ++ +   V     A   
Sbjct  84    ALSDPRIFEAGLSCGNASASAPN---IVPMFVRDMESLSQLMTTRHFATQVTRPSGAAAA  140

Query  2215  ----VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVF  2048
                 VY   +C +DLSQTDC LCFA  +T++ RCL         R+++DGCF+RYD Y F
Sbjct  141   AAAAVYGLSQCHRDLSQTDCLLCFAAGRTKLPRCLTSP----AARIYFDGCFLRYDRYDF  196

Query  2047  FNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALV----GELGRKAAANDGFFTAAVGRGN  1883
             F E+   + D   C   D G   G  R   AA V    G   R A    G F  A   G 
Sbjct  197   FTEAVDPVYDSANC-TSDRGSVDGPAREGFAAAVEFAVGNATRAATGVGGGFGVAEAGG-  254

Query  1882  STVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTI  1703
                Y LAQCWE +    C  CL  A + +  C+P  +GR LNAGCY+RYST KFY +   
Sbjct  255   --AYALAQCWESISSDGCGVCLEKAKTAVRRCVPSRDGRGLNAGCYLRYSTVKFYSDQGA  312

Query  1702  PATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNK  1523
                +Q    S+ + + +A    + A +++    A+    R+ +       L  + +  +K
Sbjct  313   SEADQG---SSSIGITVAVVLVAVACIMLSMFAAYACYARVSRLEGGNIHLHKISIG-DK  368

Query  1522  SKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFN  1343
             S LNF YETLEKAT+YF  S KLGQGG G VYKG LP+GK VA+KRL FNT QW D FFN
Sbjct  369   SSLNFKYETLEKATNYFHHSKKLGQGGGGSVYKGTLPNGKVVAVKRLIFNTRQWVDEFFN  428

Query  1342  EVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKII  1163
             EVNLISGI HKNLVKLLGCSI GPESLLVYE+VPN+SL DY S +   + L+W+QR  II
Sbjct  429   EVNLISGIEHKNLVKLLGCSIEGPESLLVYEYVPNRSLDDYISDKNKIRILNWKQRMSII  488

Query  1162  LGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAG  983
              GTAEG+AYLH   +  IIHRDIK SNVLLDE  TPKIADFGL R F  D++H+ST +AG
Sbjct  489   TGTAEGIAYLHGGCKERIIHRDIKGSNVLLDENLTPKIADFGLARCFGPDETHLSTGIAG  548

Query  982   TLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKL  803
             TLGYMAPEY+V+G+LTEKADVYSFGVLV+E++ G+K+SSF + +VSLLQ  WN +++  L
Sbjct  549   TLGYMAPEYLVRGQLTEKADVYSFGVLVLEIICGRKSSSFREETVSLLQMVWNFYKSDNL  608

Query  802   YEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS-GDQDIPQPTQPPF  629
              EAVD  L+ E    EA+  L+IGL+C QAS   RP M+ VV+M++  D  IPQPTQPPF
Sbjct  609   VEAVDSCLKGEFPAQEASNVLRIGLLCTQASAAARPFMAEVVQMLTREDFAIPQPTQPPF  668

Query  628   LTSNSAASSGS  596
             L +N++  + S
Sbjct  669   LNANASGPATS  679



>ref|XP_003554810.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Glycine max]
Length=666

 Score =   538 bits (1386),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 292/612 (48%), Positives = 387/612 (63%), Gaps = 26/612 (4%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             +F+ + F S   ++SDPR SE    C+ + +  S    Y+  F   ++ L  LV  + +G
Sbjct  19    IFIVLCFFS-QSALSDPRISEVGHYCSTQKSQTSGD--YLPIFTKEMEKLLELVTKQNWG  75

Query  2245  ETVIGAGNAT---VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGC  2075
                 G  + T   +Y   +C +DLS  DC  CFA  +T++ RCLP        R++ DGC
Sbjct  76    THSEGMSSTTTTPIYGLAQCFQDLSSIDCLQCFAASRTKLPRCLP----SVSARIYLDGC  131

Query  2074  FVRYDDYVFFNESSSLSDKTVCGAEDFG--GNSGLFRRNAAALVGELGRKAAAND---GF  1910
             F+RYD+Y F+ E+      TV    ++G  G   +F  +   +V  + R A  N+   GF
Sbjct  132   FLRYDNYSFYTENYDPLRDTVNCTSEYGSEGERLVFAESVGKVVESVVRVAVNNNEGRGF  191

Query  1909  FTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYST  1730
             F  AVG G   VY LAQCW+ V  K C DCL  A +++  CLPK EGR LN GCY+RYST
Sbjct  192   F--AVGEGGG-VYALAQCWKTVGVKGCSDCLRKAENEVKGCLPKREGRALNTGCYLRYST  248

Query  1729  KKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRL  1550
              KFY+            R     +I A +  + A +++  +V+++       +++ +   
Sbjct  249   VKFYNQGGQDGQGDDSSRKR--VIIAAGSVLAAAVVVLTLAVSYVA----FTKKRRKNNF  302

Query  1549  GAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNT  1370
               +  ++  S LN+ YETLEKATDYF  S K+GQGGSG VYKG LP+G  VA+KRL FN 
Sbjct  303   IEVPPSLKNSSLNYKYETLEKATDYFSSSRKIGQGGSGSVYKGTLPNGNDVAVKRLVFNN  362

Query  1369  TQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPL  1190
              QW D FFNEVNLISG+ HKNLVKLLGCSI GPESL+VYE++PN+SL  +   +   + L
Sbjct  363   RQWVDDFFNEVNLISGMQHKNLVKLLGCSIEGPESLIVYEYLPNKSLDQFIFEKDITRIL  422

Query  1189  SWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDK  1010
              W+QR++IILGTAEGLAYLH  +E+ IIHRDIK SNVLLDE  +PKIADFGL R F  DK
Sbjct  423   KWKQRFEIILGTAEGLAYLHGGSEIRIIHRDIKSSNVLLDENLSPKIADFGLARCFGTDK  482

Query  1009  SHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQH  830
             +H+ST +AGTLGYMAPEY++QG+LT+KADVYSFGVLV+E+ SG+KN+ F + S SLLQ  
Sbjct  483   THLSTGIAGTLGYMAPEYLIQGQLTDKADVYSFGVLVLEIASGRKNNVFREDSGSLLQTV  542

Query  829   WNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ-D  656
             W L+++ +L EAVD  L E+    EA+R  QIGL+C QAS  LRP M  V  M+S    D
Sbjct  543   WKLYQSNRLGEAVDPGLGEDFPAREASRVFQIGLLCTQASASLRPFMVQVASMLSNSNLD  602

Query  655   IPQPTQPPFLTS  620
             +P P QPPFL S
Sbjct  603   VPIPKQPPFLNS  614



>ref|XP_010042287.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
Length=645

 Score =   536 bits (1381),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 293/613 (48%), Positives = 392/613 (64%), Gaps = 22/613 (4%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             +FL +F    + S+ DPR SEA ++C       +     ++NF+  +  +   V    + 
Sbjct  11    VFLVLFSSLFSPSLGDPRVSEAGILCLRSNVTSTAN--VLSNFLDVMRKIAAKVTENCWA  68

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
                + +    +YA  +C  DLS +DC LCF Q +  + RC       + GRL+ DGCF+R
Sbjct  69    NDSVTSPLPEIYALAQCHGDLSHSDCVLCFVQSRNILPRCNVLD--AKPGRLYLDGCFIR  126

Query  2065  YDDYVFFNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAA----NDGF--F  1907
              D Y F+NE+     D   C  +         R+     V  + R  +A    N GF  F
Sbjct  127   SDYYNFYNETIDPQHDMVKCANQSNDSAHQQARQQFVDKVDRVLRNVSAVAPENKGFAVF  186

Query  1906  TAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTK  1727
               A   G + VY LAQCW  +  K C +CLA A+ K  +C P +EGR +NAGC+MRYST+
Sbjct  187   EEARRGGVAGVYALAQCWNTLDKKGCRECLANAMIKARNCTPGDEGRAMNAGCFMRYSTE  246

Query  1726  KFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLG  1547
             +FY   T+P    + G S+ L +I+A      A   ++   A++  +++ K+R+ +K+L 
Sbjct  247   RFY---TVP----TDGDSSKLGIIIAIASSVAAATSLVFIGAYVGYRKLSKKREVQKKLF  299

Query  1546  AMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTT  1367
              +   V KS LNF+YE+LEKATD+FD+S KLGQGG+G VYKG+LPDG+ VA+K L FNT 
Sbjct  300   GIPAIVRKSNLNFNYESLEKATDFFDESKKLGQGGAGSVYKGILPDGRVVAVKVLVFNTR  359

Query  1366  QWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLS  1187
             QW D FFNEVNLISGI HKNLV LLGCS+ GPESLLVYE+VPN+SL +    +   + LS
Sbjct  360   QWVDDFFNEVNLISGIQHKNLVCLLGCSMEGPESLLVYEYVPNRSLDEILFIKNATRILS  419

Query  1186  WEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKS  1007
             W++R  II GTAEGLA+LH    + IIHRDIK SNVLLDE+ T KIADFGL R    +KS
Sbjct  420   WQERLNIISGTAEGLAFLHGPCGVKIIHRDIKSSNVLLDEDLTAKIADFGLARCLDPEKS  479

Query  1006  HISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHW  827
             H+ST +AGTLGYMAPEY+V+G+LTEKADVYSFGVLV+E++SG+KNS F QAS S+LQ  W
Sbjct  480   HLSTGIAGTLGYMAPEYLVKGQLTEKADVYSFGVLVLEILSGRKNSIFGQASGSVLQSVW  539

Query  826   NLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISGDQD--  656
               ++A  L E +D  L+ +  V EA   LQI L+C QASP+LRPSMS VV+M++ DQ+  
Sbjct  540   KQYKANSLAECIDPVLKGKFPVSEALNVLQIALLCTQASPDLRPSMSEVVEMLN-DQECA  598

Query  655   IPQPTQPPFLTSN  617
             +P P QPPFL +N
Sbjct  599   VPVPMQPPFLNNN  611



>ref|XP_007151008.1| hypothetical protein PHAVU_004G011000g [Phaseolus vulgaris]
 gb|ESW23002.1| hypothetical protein PHAVU_004G011000g [Phaseolus vulgaris]
Length=670

 Score =   536 bits (1382),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 294/598 (49%), Positives = 382/598 (64%), Gaps = 23/598 (4%)
 Frame = -2

Query  2389  SVSDPRASEAALIC-TNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNAT-  2216
             ++SDPR SE    C T + +P      Y   F   ++ L  LV    +G    G  +AT 
Sbjct  36    ALSDPRISEVGFFCGTQKASPSGN---YFPIFTKEMEKLHELVKKNNWGTHSEGLSSATP  92

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             +YA  +C +DLS  DC  CFA  +T++ RCLP         ++ DGCF+RYD+Y F++E 
Sbjct  93    IYALVQCFQDLSNLDCLQCFATSRTKLPRCLP----SVSAHIYLDGCFLRYDNYSFYSED  148

Query  2035  SSLSDKTVCGAEDFGGNSGLFRR----NAAALVGELGRKAAANDGFFTAAVGRGNSTVYG  1868
             +     TV    ++GG +G   R    N+   V E   + A N+G    AVG G   VY 
Sbjct  149   TDPLRDTVNCTTEYGGVAGEAERLVFGNSVGKVVENVVRVAGNEGR-GFAVGEGEG-VYA  206

Query  1867  LAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQ  1688
             LAQCW+ V GK C DCL  A ++I  CLPK+EGR LN+GCY+RYS+ KFY+       + 
Sbjct  207   LAQCWKTVGGKGCRDCLKKAENEIRGCLPKKEGRALNSGCYLRYSSDKFYNQG---GEDG  263

Query  1687  SGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNF  1508
              G  S+   +I+       A +++L  +   V     K+RK    +  +  ++  S LN+
Sbjct  264   EGDDSSRKRIIITAVSVLAAAVVVLSLLVTYVA--FTKKRKNNNFI-EIPSSLKNSSLNY  320

Query  1507  SYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLI  1328
              YE LEKATDYF    KLGQGG+G V+KG LP+GK VA+KRL FN  QW D FFNEVNLI
Sbjct  321   KYEILEKATDYFSSPRKLGQGGAGSVFKGTLPNGKDVAVKRLVFNNRQWVDDFFNEVNLI  380

Query  1327  SGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAE  1148
             SGI+HKNLVKLLGCSI GPESL+VYE++PN+SL  +   +   + L W+QR++I++G AE
Sbjct  381   SGINHKNLVKLLGCSIEGPESLIVYEYLPNKSLDHFLFEKDKTRILKWKQRFEIVVGIAE  440

Query  1147  GLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYM  968
             GLAYLH  +E+ IIHRDIK SNVLLDE   PKIADFGL R F  DK+H+ST +AGTLGYM
Sbjct  441   GLAYLHGGSEIRIIHRDIKSSNVLLDENLNPKIADFGLARCFGADKTHLSTGIAGTLGYM  500

Query  967   APEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVD  788
             APEY++QG+LT+KADVYSFGVLV+E  SG+KN+ F + S SLLQ  W L+++ +L EAVD
Sbjct  501   APEYLIQGQLTDKADVYSFGVLVLETASGRKNNVFREDSDSLLQTVWKLYQSNRLGEAVD  560

Query  787   GSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPFLTS  620
               L  E    EA+R  QIGL+C QAS  LRPSM+ V  M+S  D D+P P QPPFL S
Sbjct  561   PCLGNEFPAREASRVFQIGLLCTQASASLRPSMAQVACMLSNSDLDVPIPKQPPFLNS  618



>ref|XP_006283294.1| hypothetical protein CARUB_v10004332mg [Capsella rubella]
 gb|EOA16192.1| hypothetical protein CARUB_v10004332mg [Capsella rubella]
Length=651

 Score =   535 bits (1379),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 282/611 (46%), Positives = 380/611 (62%), Gaps = 35/611 (6%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             S  D R + + L C  R+   S    Y+  FV  + +L+  + ++++    +     ++Y
Sbjct  28    SSDDQRTTVSGLFCGGRSK-SSADPNYIPTFVEDMHSLSLKLTTRRFATQSLNT-TPSIY  85

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES-S  2033
             A  +C  DLS +DC LC+A  +T++ RCLP        R+F DGCF+RY+ Y F+ ES S
Sbjct  86    AMIQCHDDLSPSDCQLCYAIARTRLPRCLPSS----SARIFLDGCFLRYETYEFYGESVS  141

Query  2032  SLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCW  1853
             + SD   C       N  +  +     V E   + A   G F  A   G S V+ LAQCW
Sbjct  142   ATSDSYSCS------NDTVLDQQLGFRVSETAARVAVRKGGFGVA---GESGVHALAQCW  192

Query  1852  EFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRS  1673
             E +  + C  CL  AV ++  C+ + EGR +N GCY+RYS  KFY        N  G  +
Sbjct  193   ESLGKEDCRVCLEKAVKELKRCVSRREGRAMNTGCYLRYSDHKFY--------NGDGHHN  244

Query  1672  NHLP----VILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFS  1505
              H+     VI+A    + AF+L++    +++  ++ K ++E+K LG +    N SK  F 
Sbjct  245   IHVRFNKGVIVAIVLTTSAFVLLILLATYVIMIKVSKTKQEQKNLGLISRKFNNSKTKFK  304

Query  1504  YETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLIS  1325
             YETLEKATDYF+   KLGQGG+G V+ G L +GK VA+KRL FNT +W + FFNEVNLIS
Sbjct  305   YETLEKATDYFNTKKKLGQGGNGTVFLGTLANGKNVAVKRLVFNTREWVEEFFNEVNLIS  364

Query  1324  GIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEG  1145
             GI HKNLVKLLGCSI GPESLLVYE+VPN+SL  +       + L+W QR  IILGTAEG
Sbjct  365   GIQHKNLVKLLGCSIEGPESLLVYEYVPNKSLDHFLFDESKSKVLNWSQRLNIILGTAEG  424

Query  1144  LAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMA  965
             LAYLH  + + IIHRDIK SNVLLDE+  PKIADFGLVR F  DK+H+ST +AGTLGYMA
Sbjct  425   LAYLHGGSPVRIIHRDIKTSNVLLDEQLNPKIADFGLVRCFGYDKTHLSTGIAGTLGYMA  484

Query  964   PEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDG  785
             PEY+V+G+LTEKADVYSFGVLV+E+  G +N+SF   +  LLQ+ W+L+   +L EA+D 
Sbjct  485   PEYIVRGQLTEKADVYSFGVLVLEIACGTRNNSFVPVTGHLLQRVWSLYTLNRLGEALDS  544

Query  784   SL------EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPFL  626
              L      E+ ++ EA + L++GL+C QASP LRPSM  V++M++  D  IP PT PPFL
Sbjct  545   CLKDELLQEQGSKAEACKVLRVGLLCTQASPSLRPSMEEVIRMLTERDHLIPAPTNPPFL  604

Query  625   TSNSAASSGSY  593
              ++       Y
Sbjct  605   RTSPLTKDLEY  615



>gb|KHN27450.1| Cysteine-rich receptor-like protein kinase 42 [Glycine soja]
Length=673

 Score =   536 bits (1381),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 291/609 (48%), Positives = 384/609 (63%), Gaps = 20/609 (3%)
 Frame = -2

Query  2419  LFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGET  2240
             L  FF   + ++SDPR SE    C+ + +P S    Y   F   ++ L  +V  + +G  
Sbjct  24    LLCFF--SHSALSDPRISEVGHYCSTQKSPTSGD--YFPIFTKEMEKLQEVVTKQNWGTH  79

Query  2239  VIGAGNAT-VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRG--GRLFYDGCFV  2069
               G  + T +Y   +C +DLS  DC  CFA  +T++ R     R +     R++ DGCF+
Sbjct  80    SEGMSSTTPIYGLAQCFQDLSSVDCLQCFASSRTKLPRWTKLPRCLPSVSARIYLDGCFL  139

Query  2068  RYDDYVFFNESSSLSDKTVCGAEDFGGNSG----LFRRNAAALVGELGRKAAANDGFFTA  1901
             RYD+Y F+ E +     TV     +G   G    L    + A V E   + A N+G    
Sbjct  140   RYDNYSFYTEDTDPLRDTVNCTSQYGAVVGDGEKLVFAESVAKVVESVVRVAVNEGRGIF  199

Query  1900  AVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKF  1721
             AVG G   VY LAQCW+ V  K C DCL  A +++  CLPK EGR LN GCY+RYST KF
Sbjct  200   AVGEGGG-VYALAQCWKTVGVKGCSDCLRKAENEVKGCLPKREGRALNTGCYLRYSTVKF  258

Query  1720  YDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAM  1541
             Y+        Q    S    ++ A +  + A +++  + +++      K+RK+   +  +
Sbjct  259   YNQGG--EDGQGDDSSRKRAIVAAGSVLAAAVVVLTLAASYVA---FTKKRKKNNFI-EV  312

Query  1540  LVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQW  1361
               ++  S LN+ YETLEKATDYF  S K+GQGG+G VYKG LP+G  VA+KRL FN  QW
Sbjct  313   PPSLKNSSLNYKYETLEKATDYFSSSRKIGQGGAGSVYKGTLPNGNDVAVKRLVFNNRQW  372

Query  1360  ADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWE  1181
              D FFNEVNLISG+ HKNLVKLLGCSI GPESL+VYE++PN+SL  +   +   + L W+
Sbjct  373   VDDFFNEVNLISGMQHKNLVKLLGCSIEGPESLIVYEYLPNKSLDQFIFEKDITRILKWK  432

Query  1180  QRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHI  1001
             QR++IILGTAEGLAYLH  +E+ IIHRDIK SNVLLDE   PKIADFGL R F  DK+H+
Sbjct  433   QRFEIILGTAEGLAYLHGGSEIRIIHRDIKSSNVLLDENLNPKIADFGLARCFGTDKTHL  492

Query  1000  STAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNL  821
             ST +AGTLGYMAPEY++QG+LT+KADVYSFGVLV+E+ SG+KN+ F + S SLLQ  W L
Sbjct  493   STGIAGTLGYMAPEYLIQGQLTDKADVYSFGVLVLEIASGRKNNVFREDSGSLLQTVWKL  552

Query  820   FRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ-DIPQ  647
             +++ +L EAVD  L E+    EA+R  QIGL+C QAS  LRPSM+ VV ++S    D+P 
Sbjct  553   YQSNRLGEAVDPGLGEDFPAREASRVFQIGLLCTQASASLRPSMTQVVSILSNSNLDVPI  612

Query  646   PTQPPFLTS  620
             P QPPFL S
Sbjct  613   PKQPPFLNS  621



>gb|KCW83357.1| hypothetical protein EUGRSUZ_B00292 [Eucalyptus grandis]
Length=590

 Score =   533 bits (1373),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 287/554 (52%), Positives = 374/554 (68%), Gaps = 27/554 (5%)
 Frame = -2

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             +YA  +C  DLS  DC LCFAQ +T + RC     L   GRL+ DGCF+R D Y FFNE+
Sbjct  25    IYALAQCHGDLSHDDCLLCFAQSRTILPRC---TVLNTKGRLYLDGCFIRSDYYNFFNET  81

Query  2035  -SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAA----NDGF--FTAAVGRGNST  1877
                  D   C  +         R+  A  V  +    +A    N GF  F  A   G + 
Sbjct  82    IDPQHDMVKCANQSSVSADQQARQQFADKVDRVLTNVSAGAPENKGFAVFGEARRGGVAG  141

Query  1876  VYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPA  1697
             VY LAQCW  +  K C +CLA A+ +  +C P EEGR +NAGC+MRYST++FY   T+P 
Sbjct  142   VYALAQCWNTLDEKGCRECLANAMIRARNCTPGEEGRAMNAGCFMRYSTQRFY---TVP-  197

Query  1696  TNQSGGRSNHLPVILATTFGSFAF--LLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNK  1523
                + G S  L +I+A +    A   LLI+G  A++  +++ K+R+ +K+L  +   V K
Sbjct  198   ---TDGDSLKLGIIIAISLSVAAATSLLIVG--AYVGYRKLSKKREVQKKLFGVPEIVRK  252

Query  1522  SKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFN  1343
             S LNF+YE+LE+ATD+FD+S KLGQGG+G VYKG+LPDG+ VA+KRL FNT QW D FFN
Sbjct  253   SNLNFNYESLERATDFFDESRKLGQGGAGSVYKGILPDGRIVAVKRLVFNTRQWVDDFFN  312

Query  1342  EVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKII  1163
             EVNLI+GI HKNLV+LLGCSI GPESLLVYE+VPN+SL      +     LSW++R  II
Sbjct  313   EVNLITGIQHKNLVRLLGCSIEGPESLLVYEYVPNRSLDQILFVKNAIHVLSWQERLNII  372

Query  1162  LGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAG  983
              GTAEGLA+LH    + IIHRDIK SNVLLDE+ T KIADFGL R    + SH+ST +AG
Sbjct  373   SGTAEGLAFLHGPCGVKIIHRDIKSSNVLLDEDLTAKIADFGLARCLDPENSHLSTGIAG  432

Query  982   TLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKL  803
             TLGYMAPEY+V+G+LTEKADVY+FGVLV+E++SG+KNS F QAS S+LQ  W  +++ +L
Sbjct  433   TLGYMAPEYLVKGQLTEKADVYAFGVLVLEILSGRKNSIFGQASGSVLQSVWKQYKSNRL  492

Query  802   YEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISGDQD--IPQPTQPP  632
              E +D +L+ +  + EA   +QI L+C QASP+LRPSMS VV+M++ DQ+  +P PTQPP
Sbjct  493   SECIDPALKGKFPISEALNVIQIALLCTQASPDLRPSMSEVVEMLN-DQECIVPMPTQPP  551

Query  631   FLTSNSAA--SSGS  596
             FL +N+    SSGS
Sbjct  552   FLNNNAIPDDSSGS  565



>ref|XP_010041377.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
 gb|KCW44396.1| hypothetical protein EUGRSUZ_L02117 [Eucalyptus grandis]
Length=590

 Score =   532 bits (1371),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 283/560 (51%), Positives = 374/560 (67%), Gaps = 21/560 (4%)
 Frame = -2

Query  2266  VDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLF  2087
             V   ++    I +    +YA  +C  DLS+ DC LCFA+ +T + RC     L   GRL+
Sbjct  8     VAEDRWANDSITSPLPEIYALAQCHGDLSRDDCILCFARSRTSLSRC---TILDTKGRLY  64

Query  2086  YDGCFVRYDDYVFFNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAA----  1922
              DGCF+R D Y FFNE+     D   C  +     +   R+  AA V  +    +A    
Sbjct  65    LDGCFIRSDYYNFFNETVDPQHDMVKCANQSSVSANQQARQQFAAKVDRVLTNVSAVAPE  124

Query  1921  NDGF--FTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGC  1748
             N GF  F  A   G + VY LAQCW  +  K C +CLA A+ +  +C P +EGR +NAGC
Sbjct  125   NMGFAVFGEARRGGVAGVYALAQCWNTLDEKGCRECLANAMIRARNCTPGDEGRAMNAGC  184

Query  1747  YMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQR  1568
             +MRYST++FY   T+P    + G S  L +I+A +    A   +L   A++  +++ K+R
Sbjct  185   FMRYSTQRFY---TVP----TDGDSLKLGIIIAISLSVAAATSLLFVGAYVGYRKLSKKR  237

Query  1567  KERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIK  1388
             + +K+L  +   V KS LNF+YE+LEKAT++FD+S KLGQGG+G VYKG+LPDG+ VA+K
Sbjct  238   EVQKKLFGVPEIVRKSNLNFNYESLEKATNFFDESRKLGQGGAGSVYKGILPDGRVVAVK  297

Query  1387  RLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSAR  1208
             RL FNT QW D FFNEVNLI+GI HKNLV+LLGCSI GPESLLVYE+VPN+SL      +
Sbjct  298   RLVFNTRQWVDDFFNEVNLITGIQHKNLVRLLGCSIEGPESLLVYEYVPNRSLDQILFVK  357

Query  1207  KNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVR  1028
                  LSW++R  II GTAEGLA+LH    + IIHRDIK SNVLLDE+ T KIADFGL R
Sbjct  358   NATHVLSWQERLNIISGTAEGLAFLHGPCGVKIIHRDIKSSNVLLDEDLTAKIADFGLAR  417

Query  1027  LFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASV  848
                 +KSH+ST +AGTLGYMAPEY+V+G+LTEKADVY+FGVLV+E++SG+KNS F QAS 
Sbjct  418   CLDPEKSHLSTGIAGTLGYMAPEYLVKGQLTEKADVYAFGVLVLEILSGRKNSIFGQASG  477

Query  847   SLLQQHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI  671
             S+LQ  W  +++  L E +D +L+ +  V EA   +QI L+C QASP+LRPSMS VV+M+
Sbjct  478   SVLQSVWKQYKSNSLAECIDPALKGKFPVSEALNVIQIALLCTQASPDLRPSMSEVVEML  537

Query  670   SGDQD--IPQPTQPPFLTSN  617
             + DQ+  +P PTQPPFL +N
Sbjct  538   N-DQECIVPMPTQPPFLNNN  556



>ref|XP_002511372.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF51974.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=614

 Score =   533 bits (1373),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 276/574 (48%), Positives = 369/574 (64%), Gaps = 18/574 (3%)
 Frame = -2

Query  2287  LDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRL  2108
             ++++   V ++++G+  +      VYA  +C  DLS  DC LCF+Q + ++ RCLP    
Sbjct  1     MESIQQQVSTREWGDASVTFPAPEVYALAQCHGDLSSLDCKLCFSQGRVKLPRCLP----  56

Query  2107  VRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFG---GNS--GLFRRNAAALVGE  1943
                 R++ DGCF+RYD+Y FF+ES +    +V  ++  G    NS    F++  A ++  
Sbjct  57    KSAARIYLDGCFIRYDNYSFFHESINPDYDSVNCSQPTGVLVDNSLHMEFKKKVAEVIKN  116

Query  1942  LGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRV  1763
             +  KA  N  F T     G    Y LAQCW  +    C DCL  A S +  C P   G+ 
Sbjct  117   VTEKALENGTFATVEAKAGAIPAYALAQCWNSLTYAECRDCLVMAGSPLRQCAPGGGGQA  176

Query  1762  LNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKR  1583
             L  GCYMRYST++F++ S+      +    +   +I A    + AF+++    AFI  +R
Sbjct  177   LYTGCYMRYSTERFFNTSS----ESNDEDDSDAGIIGAIALAAVAFIVLASFGAFIGYER  232

Query  1582  IVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGK  1403
             + K++K++  L     T N   +NF YE LEKAT++F+D  KLGQGG+G VYKG LPDG+
Sbjct  233   LSKRKKDQDNLRRFPETSN---MNFKYEVLEKATNFFNDETKLGQGGAGSVYKGSLPDGR  289

Query  1402  TVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYD  1223
             TVA+KRL +NT QW D FFNEVNLISGI H NLVKLLGCSI GPESLLVYE+VPN+SL  
Sbjct  290   TVAVKRLVYNTRQWVDQFFNEVNLISGIRHANLVKLLGCSIEGPESLLVYEYVPNRSLDQ  349

Query  1222  YTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIAD  1043
                 +     LSW+QRY IILGTAEGLAYLH    + IIHRDIK SN+LLDE+  PKIAD
Sbjct  350   ILFVKSTIHILSWQQRYHIILGTAEGLAYLHGGCGVKIIHRDIKTSNILLDEKLIPKIAD  409

Query  1042  FGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSF  863
             FGL R F  D +HI+T +AGTLGYMAPEY+++G+LTEKADVYSFGVLV+E+ SGKKNS +
Sbjct  410   FGLARCFAADNTHITTGIAGTLGYMAPEYLIRGQLTEKADVYSFGVLVLEIASGKKNSVY  469

Query  862   YQASVSLLQQHWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSA  686
              Q S S+L   W  ++A  L EA+D +L +E    +A   LQIGL+C QAS  LRPSM+ 
Sbjct  470   SQGSGSILHNVWKHYKARTLAEAIDPALKDEHPGKDAENVLQIGLLCTQASASLRPSMTE  529

Query  685   VVKMISGDQ-DIPQPTQPPFLTSNSAASSGSYPN  587
             VV+M++  + +IP P QPPFL ++  ++ GS  N
Sbjct  530   VVEMLTNKECEIPTPMQPPFLNASVLSAGGSTEN  563



>gb|KDO55201.1| hypothetical protein CISIN_1g007248mg [Citrus sinensis]
Length=611

 Score =   533 bits (1372),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 278/544 (51%), Positives = 363/544 (67%), Gaps = 21/544 (4%)
 Frame = -2

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             +YA  +C  DLS TDC LCFA  +T++ RCLP         +F+DGCF+RYD Y F+ ES
Sbjct  27    IYALAQCHLDLSHTDCLLCFAASRTKLPRCLP----SLSATIFFDGCFLRYDIYSFYQES  82

Query  2035  SSLS-DKTVCGAEDF-----GGNSGL--FRRNAAALVGELGRKAAANDGFFTAAVGRGNS  1880
              S S D   C AE+        N  +  F  +    VG + R A    G F A    G  
Sbjct  83    VSPSLDDVKCSAENATVENENENDAVDGFVESVGYAVGNVSRIAVEKGGGFGAVKVMG--  140

Query  1879  TVYGLAQCWEFVRGKSCDDCLAAAVSKIG-SCLPKEEGRVLNAGCYMRYSTKKFYDNSTI  1703
              VY LAQCWE +    C +CL  A  ++  SC  ++EGR  NAGCY+RYST KF+++   
Sbjct  141   -VYALAQCWESLGRDGCRECLDKAGMRVRRSCRMRKEGRGFNAGCYLRYSTDKFFNHDDE  199

Query  1702  PATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNK  1523
                ++   R   L V++A    + AFL++    A+    R+ K +++R  LG    ++ K
Sbjct  200   TGDDRGSSR---LGVMIAIVLSTTAFLMLSLFAAYAAYARLSKMKEDRNNLGLYATSMKK  256

Query  1522  SKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFN  1343
             S L+F YETLEKAT+YF+ S KLGQGG+G VY G LP+G TVA+KRL FNT QW D FFN
Sbjct  257   SCLSFKYETLEKATNYFNPSKKLGQGGAGSVYMGSLPNGTTVAVKRLIFNTRQWVDEFFN  316

Query  1342  EVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKII  1163
             EVNLIS I HKNLVKLLGCSI GPESLLVYE+VPN+SL  +   +   + L+W +R+ II
Sbjct  317   EVNLISSIEHKNLVKLLGCSIEGPESLLVYEYVPNRSLDQFIFDKNKTKLLNWNKRFNII  376

Query  1162  LGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAG  983
             LGTAEGLAYLH  +E  IIHRDIK SN+LLD++FTPKIADFGL R F  D++H+STAVAG
Sbjct  377   LGTAEGLAYLHGGSETRIIHRDIKTSNILLDKDFTPKIADFGLARCFAADRTHVSTAVAG  436

Query  982   TLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKL  803
             TLGYMAPEY+V+G+LTEKADVYSFG+L+IE+V G+++++F Q S S LQ+ W L+R+ KL
Sbjct  437   TLGYMAPEYLVRGQLTEKADVYSFGILIIEIVCGRRSNAFSQDSASPLQRVWTLYRSNKL  496

Query  802   YEAVDGSLEERARVEAT-RQLQIGLVCVQASPELRPSMSAVVKMISGDQ-DIPQPTQPPF  629
              EAVD +L++    E     LQIGL+C QA+  LRPSM+  + +++    +IP P+QPPF
Sbjct  497   VEAVDPNLKDDFPAEQVCNVLQIGLLCTQAAAALRPSMAQAIMLLTNKVCEIPTPSQPPF  556

Query  628   LTSN  617
             L S+
Sbjct  557   LNSS  560



>ref|XP_010441173.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Camelina 
sativa]
Length=651

 Score =   533 bits (1374),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 280/617 (45%), Positives = 385/617 (62%), Gaps = 37/617 (6%)
 Frame = -2

Query  2425  LFLFIFFLS--INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKK  2252
             +FL+ FF+   ++ S  D R + + L C  R+   S    ++  FV  + +L+  + +++
Sbjct  14    IFLYSFFVLPFLSSSTDDQRTTVSGLFCGGRSR-SSADPNFIPTFVEDMHSLSLKLTTRR  72

Query  2251  YGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCF  2072
             +    +     +V+A  +C  DLS +DC LC+A  +T++ RCLP        R+F DGCF
Sbjct  73    FATQSLNT-TPSVFALIQCHNDLSPSDCQLCYAIARTRLPRCLPSS----SARIFLDGCF  127

Query  2071  VRYDDYVFFNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV  1895
             +RY+ Y F+ ES S+ SD+  C       N  +      + V E   + A     F  A 
Sbjct  128   LRYETYEFYGESVSATSDRFSCS------NDTVLDPQFGSRVSETAARVAVTQRGFGVA-  180

Query  1894  GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYD  1715
               G S V+ LAQCWE +  + C  CL  AV ++  C+ + EGR +N GCY+RYS  KFY 
Sbjct  181   --GESGVHALAQCWESLGKEDCRVCLEKAVKEVKRCVSRREGRAMNTGCYLRYSDHKFY-  237

Query  1714  NSTIPATNQSGGRSNHL----PVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLG  1547
                    N  G    H+     VI+A    + AF++++    + +  ++ K ++E+K LG
Sbjct  238   -------NGDGHHKIHVIFNKGVIVAIVLTTSAFVMVILLATYAIMIKVSKTKQEQKNLG  290

Query  1546  AMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTT  1367
              +    N SK  F YETLEKATDYF+   KLG+GG+G V+ G LP+GK VA+KRL FNT 
Sbjct  291   LISRKFNNSKTKFKYETLEKATDYFNSKKKLGEGGNGTVFLGTLPNGKNVAVKRLVFNTR  350

Query  1366  QWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLS  1187
             +W + FFNEVNLISGI HKNLVKLLGCSI GPESLLVYE+VPN+SL  +       + L+
Sbjct  351   EWVEEFFNEVNLISGIQHKNLVKLLGCSIEGPESLLVYEYVPNKSLDHFLFDECKSKVLN  410

Query  1186  WEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKS  1007
             W QR  IILGTAEGLAYLH  + + IIHRDIK SNVLLDE+  PKIADFGL R F  DK+
Sbjct  411   WSQRLNIILGTAEGLAYLHGGSPVRIIHRDIKTSNVLLDEQLNPKIADFGLARCFGPDKT  470

Query  1006  HISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHW  827
             H+ST +AGTLGYMAPEYVV+G+LTEKAD+YSFGVLV+E+  G +N++F   +  LLQ+ W
Sbjct  471   HLSTGIAGTLGYMAPEYVVRGQLTEKADIYSFGVLVLEISCGTRNNAFVPVTGHLLQRVW  530

Query  826   NLFRAGKLYEAVDGSLEERAR------VEATRQLQIGLVCVQASPELRPSMSAVVKMISG  665
             NL+   +L EA++  L++  R       EA R L++GL+C QASP LRPSM  V++M++ 
Sbjct  531   NLYTLNRLVEALESCLKDEVRQEQGREAEACRVLRVGLLCTQASPSLRPSMEEVIRMLTE  590

Query  664   DQD-IPQPTQPPFLTSN  617
              +  IP PT PPFL ++
Sbjct  591   SEYLIPSPTNPPFLRTS  607



>ref|NP_198854.3| cysteine-rich receptor-like protein kinase 42 [Arabidopsis thaliana]
 sp|Q9FNE1.1|CRK42_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 42; 
Short=Cysteine-rich RLK42; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB11593.1| receptor-like serine/threonine kinase [Arabidopsis thaliana]
 gb|AED94540.1| cysteine-rich receptor-like protein kinase 42 [Arabidopsis thaliana]
Length=651

 Score =   531 bits (1369),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 282/618 (46%), Positives = 381/618 (62%), Gaps = 37/618 (6%)
 Frame = -2

Query  2422  FLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGE  2243
             F F+ FLS   S  D R + + L C  R+   S    Y+  FV  + +L+  + ++++  
Sbjct  19    FFFLPFLS--SSSDDQRTTVSGLFCGGRSK-SSADPNYIPTFVEDMHSLSLKLTTRRFAT  75

Query  2242  TVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRY  2063
               + +   ++YA  +C  DLS +DC LC+A  +T+I RCLP        R+F DGCF+RY
Sbjct  76    ESLNS-TTSIYALIQCHDDLSPSDCQLCYAIARTRIPRCLPSS----SARIFLDGCFLRY  130

Query  2062  DDYVFFNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRG  1886
             + Y F++ES S  SD   C       N  +        V E   + A   G F  A   G
Sbjct  131   ETYEFYDESVSDASDSFSCS------NDTVLDPRFGFQVSETAARVAVRKGGFGVA---G  181

Query  1885  NSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNST  1706
              + V+ LAQCWE +  + C  CL  AV ++  C+ + EGR +N GCY+RYS  KFY    
Sbjct  182   ENGVHALAQCWESLGKEDCRVCLEKAVKEVKRCVSRREGRAMNTGCYLRYSDHKFY----  237

Query  1705  IPATNQSGGRSNHL----PVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAML  1538
                 N  G    H+     VI+A    + AF++++    +++  ++ K ++E++ LG + 
Sbjct  238   ----NGDGHHKFHVLFNKGVIVAIVLTTSAFVMLILLATYVIMTKVSKTKQEKRNLGLVS  293

Query  1537  VTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWA  1358
                N SK  F YETLEKATDYF     LGQGG+G V+ G+LP+GK VA+KRL FNT  W 
Sbjct  294   RKFNNSKTKFKYETLEKATDYFSHKKMLGQGGNGTVFLGILPNGKNVAVKRLVFNTRDWV  353

Query  1357  DHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQ  1178
             + FFNEVNLISGI HKNLVKLLGCSI GPESLLVYE+VPN+SL  +       + L+W Q
Sbjct  354   EEFFNEVNLISGIQHKNLVKLLGCSIEGPESLLVYEYVPNKSLDQFLFDESQSKVLNWSQ  413

Query  1177  RYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHIS  998
             R  IILGTAEGLAYLH  + + IIHRDIK SNVLLD++  PKIADFGL R F  DK+H+S
Sbjct  414   RLNIILGTAEGLAYLHGGSPVRIIHRDIKTSNVLLDDQLNPKIADFGLARCFGLDKTHLS  473

Query  997   TAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLF  818
             T +AGTLGYMAPEYVV+G+LTEKADVYSFGVLV+E+  G + ++F   +  LLQ+ WNL+
Sbjct  474   TGIAGTLGYMAPEYVVRGQLTEKADVYSFGVLVLEIACGTRINAFVPETGHLLQRVWNLY  533

Query  817   RAGKLYEAVDGSLEER------ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQ  659
                +L EA+D  L++       +  EA + L++GL+C QASP LRPSM  V++M++  D 
Sbjct  534   TLNRLVEALDPCLKDEFLQVQGSEAEACKVLRVGLLCTQASPSLRPSMEEVIRMLTERDY  593

Query  658   DIPQPTQPPFLTSNSAAS  605
              IP PT PPFL  +S  +
Sbjct  594   PIPSPTSPPFLRVSSLTT  611



>ref|XP_010027508.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 isoform 
X1 [Eucalyptus grandis]
Length=640

 Score =   531 bits (1368),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 291/612 (48%), Positives = 385/612 (63%), Gaps = 25/612 (4%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             +FL +F  S   S+ DPR SEA ++C             V+NF+  +  +   V   ++ 
Sbjct  11    VFLVLFSSSFLPSLGDPRISEAGILCLKSNV------TSVSNFLNVMLKVLAKVTEDRWA  64

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
                + +    +YA  +C  DLS  DC LCFAQ +T + RC     L   GRL+ DGCF+R
Sbjct  65    NDSVTSPLPEIYALAQCHGDLSYDDCLLCFAQSRTILPRC---TILDTKGRLYLDGCFIR  121

Query  2065  YDDYVFFNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAA----NDGF--F  1907
              D Y FFNE+     D   C  +         R+  A  V  +    +A    N GF  F
Sbjct  122   SDYYNFFNETIDPQHDMVKCANQSSVSADQQVRQQFATKVDRVLTNVSAVAPENKGFAVF  181

Query  1906  TAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTK  1727
               A   G + VY LAQCW  +  K C +CLA A+ +  +C P +EGR +NAGC+MRYST+
Sbjct  182   GEARRGGVAGVYALAQCWNTLDKKGCRECLANAMIRARNCTPGDEGRAMNAGCFMRYSTQ  241

Query  1726  KFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLG  1547
              FY       T  + G S+ L + +A      A   ++   A++  +++ K+R+ +K+L 
Sbjct  242   SFY-------TVHTDGDSSKLGIKIAIASSVAAATSLVLVGAYVGYRQLSKKREVQKKLF  294

Query  1546  AMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTT  1367
              +   V K  LNF+YE+LEKATD+FD+S KLGQGG+G V+KG+LPDG+ VA+KRL FNT 
Sbjct  295   GVPAIVRKLNLNFNYESLEKATDFFDESRKLGQGGAGSVFKGILPDGRVVAVKRLVFNTR  354

Query  1366  QWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLS  1187
             +W D  FNEVNLISGI HKNLV+LLGCSI GPESLLVYE+VPN+SL      +   + LS
Sbjct  355   EWVDDLFNEVNLISGIQHKNLVRLLGCSIEGPESLLVYEYVPNRSLDQILFVKNATRILS  414

Query  1186  WEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKS  1007
             W++R  II GTAEGLA+LH    + IIHRDIK SNVLLDE+ T KIADFGL R    +KS
Sbjct  415   WQERLNIISGTAEGLAFLHGPCGVKIIHRDIKSSNVLLDEDLTAKIADFGLARCLDPEKS  474

Query  1006  HISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHW  827
             H+ST +AGTLGYMAPEY+V+G+LTEKADVYSFGVLV+E++SG+KN  F QAS S+LQ  W
Sbjct  475   HLSTGIAGTLGYMAPEYLVKGQLTEKADVYSFGVLVLEILSGRKNRIFGQASGSVLQSVW  534

Query  826   NLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDI-  653
               +++  L E +D  L+ +  V EA   +QI L+C QASP+LRPSMS VV+M+   + I 
Sbjct  535   KQYKSNSLAECIDPVLKGKFPVSEALNVIQIALLCTQASPDLRPSMSEVVEMLKDRECIV  594

Query  652   PQPTQPPFLTSN  617
             P PTQPPFL +N
Sbjct  595   PVPTQPPFLNNN  606



>ref|XP_009125135.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Brassica 
rapa]
Length=656

 Score =   531 bits (1367),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 278/610 (46%), Positives = 378/610 (62%), Gaps = 35/610 (6%)
 Frame = -2

Query  2380  DPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGA-------GN  2222
             +PR + + L C   +   S    Y+  FV  + +L+  + ++ +    I +         
Sbjct  33    EPRTAVSGLFC-GVSNSSSTDPNYIPTFVDDMQSLSSKLTTRHFATQSINSLSSNSETQT  91

Query  2221  ATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFN  2042
              +VYA  +C  DLS +DC LC+A  +T+I RCLP        R+F DGCF+RYD Y F+ 
Sbjct  92    TSVYALVQCHNDLSPSDCQLCYAIARTRIPRCLPSS----SARIFLDGCFLRYDTYEFYG  147

Query  2041  ES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGL  1865
             ES S+ SD+  C       N  +        V E+  +AA   G F  A   G S V+ L
Sbjct  148   ESISAASDRYSCS------NDTVLDPQFGIRVSEMAVRAAVKHGGFGVA---GESGVHAL  198

Query  1864  AQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQS  1685
             AQCWE V  + C DCL  A+ ++  C+ + EGR +N+GCY+RYS  KFY+       +  
Sbjct  199   AQCWESVGKEGCRDCLEKAIGQVKRCVSRREGRAMNSGCYLRYSDHKFYNGHGHSVLH--  256

Query  1684  GGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFS  1505
             G  +  + V +  T  +   L++L +   IV+  + K+++E++ LG +      SK  F 
Sbjct  257   GLYNKGVVVAIVLTMSAIVMLILLATYVIIVK--VSKKKQEQRNLGLVSRRFKNSKTKFK  314

Query  1504  YETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLIS  1325
             YETLEKATDYF    KLG+GG+G V+ G+LP+GK+VA+KRL FNT +W + FFNEVNLIS
Sbjct  315   YETLEKATDYFSTKKKLGEGGNGTVFLGILPNGKSVAVKRLVFNTREWVEEFFNEVNLIS  374

Query  1324  GIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEG  1145
             GI HKNLVKLLGCSI GPESLLVYE+VPN+SL ++       + L+W QR  IILGTAEG
Sbjct  375   GIQHKNLVKLLGCSIEGPESLLVYEYVPNKSLDNFLFDESKIKSLNWNQRLNIILGTAEG  434

Query  1144  LAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMA  965
             LAYLH  + + IIHRDIK SNVLLD++  PK+ADFGL R    DK+H+ST +AGTLGYMA
Sbjct  435   LAYLH-GSPVRIIHRDIKTSNVLLDDQLNPKVADFGLARCLGTDKTHLSTGIAGTLGYMA  493

Query  964   PEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDG  785
             PEYVV+G+LTEKADVYS+GVLV+E+  G +N+ F   +  LL + WNL+R  +L EA+D 
Sbjct  494   PEYVVRGQLTEKADVYSYGVLVLEIACGTRNNVFVPGAGHLLHRVWNLYRLNRLVEALDP  553

Query  784   SLEER-------ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPF  629
              L +        ++ E  + L +GL+C QASP LRPSM  V+ M++  D  IP PT PPF
Sbjct  554   CLNDEKLLQVQGSQAEVCKVLSVGLLCAQASPSLRPSMEEVISMLTERDYPIPSPTNPPF  613

Query  628   LTSNSAASSG  599
             L  +S A+ G
Sbjct  614   LRISSLATEG  623



>ref|XP_008245018.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Prunus 
mume]
Length=648

 Score =   530 bits (1365),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 287/619 (46%), Positives = 389/619 (63%), Gaps = 25/619 (4%)
 Frame = -2

Query  2422  FLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGE  2243
             FL I+    + S S+PR SEA   C +  A  +    ++ NFV  +D ++  V++K++GE
Sbjct  15    FLIIYAFLFSSSTSEPRISEAGRFCGH--ARHNSSSNFIPNFVTVMDFISNDVNAKRWGE  72

Query  2242  TVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRY  2063
               I +    VYAF +C  DLS  DC  CFA  +T++  CLP        R++ DGCF+ Y
Sbjct  73    YTIASPEPEVYAFAQCYDDLSPIDCAACFAVSRTKLPLCLP----STSARIYLDGCFLGY  128

Query  2062  DDYVFFNESSSLSDKTV-CG--AEDFG-GNSGLFRRNAAALVGELGRKAAANDGFFTAAV  1895
             DD+ F ++S     K V C   A D     +  F R    ++G +  KA +++GF     
Sbjct  129   DDHEFSHQSLDEEHKNVKCSGPAVDVSKSKTEEFARKVEDVIGNVTEKAVSHEGFGVFEQ  188

Query  1894  GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIG-SCLPKEEGRVLNAGCYMRYSTKKFY  1718
               G   VY LAQCW+ +    C +CL  A   +   C+P  EGR + AGCY+RYST++FY
Sbjct  189   RGGVENVYALAQCWKTINESGCRECLEEAGDSLRRECVPGLEGRAMFAGCYLRYSTERFY  248

Query  1717  DNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAML  1538
                 I + ++   +  H   I+AT   +    L++   A +  KR+ K+ +       + 
Sbjct  249   G---IESDSEDCVKVEH---IVATILSAMVLCLLVLFGAVMAYKRLSKRNEVYNGPIQIS  302

Query  1537  VTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWA  1358
             ++V+K+ LNF YE LEKAT++FD S KLGQGG+G V+KGVLPDG+TVA+KRL+FNT QW 
Sbjct  303   ISVHKNNLNFKYEMLEKATNFFDASRKLGQGGAGSVFKGVLPDGRTVAVKRLYFNTRQWV  362

Query  1357  DHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQ  1178
             D FFNEVNLISGI H+NLVKLLGCSI GPESLLVYE+VPN+SL      +     LSW+Q
Sbjct  363   DDFFNEVNLISGIQHQNLVKLLGCSIEGPESLLVYEYVPNKSLDQVLFDKDTLHILSWKQ  422

Query  1177  RYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHIS  998
             R+ II G AEGL YLH    + IIHRDIK SN+LLDE   PKIADFGL R    DKSH+S
Sbjct  423   RFDIICGIAEGLVYLHGSCGVKIIHRDIKASNILLDENLIPKIADFGLARCVGPDKSHLS  482

Query  997   TAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLF  818
             T +AGTLGYMAPEY+V+G+LT+KADVY+FGV+V+E+VSG+KN  F + S S+L   W  +
Sbjct  483   TGIAGTLGYMAPEYLVRGQLTDKADVYAFGVMVLEIVSGRKNRVFAEGSSSILYAVWKHY  542

Query  817   RAGKLYEAVD----GSLEERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ-DI  653
             +A  + EAVD    G   ER   EA+  L+IGL+C QAS  +RPSM+ VV+M++  +  I
Sbjct  543   KARNITEAVDPILKGGFPER---EASDVLRIGLLCTQASLAVRPSMTEVVQMLTDKECVI  599

Query  652   PQPTQPPFLTSNSAASSGS  596
             P P +PPFL ++  +S  S
Sbjct  600   PSPKRPPFLNASILSSDVS  618



>ref|XP_002300041.2| hypothetical protein POPTR_0001s35060g [Populus trichocarpa]
 gb|EEE84846.2| hypothetical protein POPTR_0001s35060g [Populus trichocarpa]
Length=667

 Score =   530 bits (1366),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 290/626 (46%), Positives = 391/626 (62%), Gaps = 40/626 (6%)
 Frame = -2

Query  2440  SLSKWLFLFIFFLS---INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTP  2270
             +L  WLFL + + +    + S+SDPR +++ L C N     S+    +  F   +  L+ 
Sbjct  14    NLQSWLFLSLIYSASFLFSLSLSDPRITQSGLYCGN-----SKYTVPIPTFTKEMGTLSQ  68

Query  2269  LVDSKKYGETVIG-AGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGR  2093
             L+ +  +    +  +   T YA  +C +DLSQTDC LC+A  +T++  CLP       GR
Sbjct  69    LLTTSHFATNNLNHSSTLTFYALAQCHQDLSQTDCLLCYAASRTKLPLCLP----SLSGR  124

Query  2092  LFYDGCFVRYDDYVFFNESSSLS-DKTVCGAEDFGGNSGL----FRRNAAALVGELGRKA  1928
             ++ DGCF+RYD+Y F+ ES S S D   CG E    +       F       VG +  +A
Sbjct  125   IYLDGCFLRYDNYSFYQESVSSSFDTFKCGNEYLDVDDDDKHLDFPTRVGYAVGNVTIQA  184

Query  1927  AANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGC  1748
               N GF    V      +Y LAQCW+ V  + C  CL  A      C+PK+EGR +NAGC
Sbjct  185   VENGGFAVVNV----DGIYALAQCWDSVGREGCRGCLEMAGKAARGCVPKKEGRGMNAGC  240

Query  1747  YMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATT-------FGSFAFLLILGSVAFIVR  1589
             Y+RYST KFY+N      ++   R N L    AT          + A L++    A+   
Sbjct  241   YLRYSTDKFYNNG---GGDERNARGNFLHQYFATVSLLCFVVLATAACLMLSIFAAYASY  297

Query  1588  KRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPD  1409
              R++K ++          ++  S LNF YE LEKATD+F  S KLGQGG+G V+ G LP+
Sbjct  298   VRLLKAKR------GNYCSLKISNLNFKYEILEKATDFFSPSRKLGQGGAGSVFIGTLPN  351

Query  1408  GKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSL  1229
             G+TVA+KRL FNT QW D FFNEVNLISGI HKNLVKLLGCSI GPESLLVYE+V N+SL
Sbjct  352   GETVAVKRLIFNTRQWVDEFFNEVNLISGIQHKNLVKLLGCSIEGPESLLVYEYVRNKSL  411

Query  1228  YDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKI  1049
               +   +   + L+W+QR++IILGTAEGLAYLH  +++ IIHRDIK SNVLLD+   PKI
Sbjct  412   DQFLFDKTKSRTLNWKQRFEIILGTAEGLAYLHGGSQVRIIHRDIKSSNVLLDDNLNPKI  471

Query  1048  ADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNS  869
             ADFGLVR F  DKSH+ST +AGT+GYMAPEY+++G+LT+KADVYSFGVLV+E++ GK+ +
Sbjct  472   ADFGLVRCFGADKSHLSTGIAGTIGYMAPEYLIRGQLTDKADVYSFGVLVLEILGGKRCN  531

Query  868   SFYQASVSLLQQHWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSM  692
             +F + S SLLQ  W L+R+ +L +AVD  L +E    EA+  LQIGL+C QAS  LRPSM
Sbjct  532   AFVENSGSLLQTVWRLYRSNRLVDAVDPCLRDEFPTREASCVLQIGLLCTQASAALRPSM  591

Query  691   SAVVKMIS-GDQDIPQPTQPPFLTSN  617
             + VV  ++  D +IP P QPP++ ++
Sbjct  592   AQVVHFLTNNDCEIPPPNQPPYMNTS  617



>ref|XP_010528239.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Tarenaya 
hassleriana]
Length=654

 Score =   530 bits (1364),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 285/613 (46%), Positives = 382/613 (62%), Gaps = 45/613 (7%)
 Frame = -2

Query  2380  DPRASEAALIC--TNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNAT---  2216
             DPR +E+ L C   NR+   S    ++  F+  + +L+  + ++++   V  + N+T   
Sbjct  26    DPRTTESGLFCGGANRS---SADPGFILTFIQEMRSLSQELTTRRF---VTHSVNSTSFH  79

Query  2215  ------VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDY  2054
                   +YA  +C  DLS+T+C LCFA  +T++ RCLP        R+F DGCF+RYDDY
Sbjct  80    RSKTTAIYALAQCHDDLSKTECLLCFALARTRLPRCLPSA----AARIFLDGCFLRYDDY  135

Query  2053  VFFNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNST  1877
              F++ES S+ SD  +C  +    +   +  +    +G   R A  N GF  A   RG   
Sbjct  136   RFYDESVSATSDNYLCSNDTVLVDPLQYSDHVNRAMGNAVRTAVGNGGFGIAE-ERG---  191

Query  1876  VYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPA  1697
              + LAQCWE V  + C  CL  AV ++  C+ + EGR +N GCY+RYS  KFY++     
Sbjct  192   AHALAQCWESVGKEGCRVCLEKAVGEVKRCVSRREGRGMNTGCYIRYSDHKFYND-----  246

Query  1696  TNQSGGRSNHLP---VILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVN  1526
                 G   +H P   VI+A   G+FA + +     + +  ++   ++ER+ LG +    N
Sbjct  247   ----GHGESHGPKSRVIVAIALGTFALVTVFLFATYAILAKLSNTKQERRNLGLISARFN  302

Query  1525  KSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFF  1346
              S+  + YETLEKATDYF     LGQGG+G V+ G L  G++VA+KRL FNT QW + FF
Sbjct  303   NSRTKYKYETLEKATDYFSSKRILGQGGNGTVFLGTLASGESVAVKRLVFNTRQWVEEFF  362

Query  1345  NEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKI  1166
             NEVNLISGIHHKNLVKLLGCSI GPESLLVYEFVPN+SL  +    K  + L+W+QR  I
Sbjct  363   NEVNLISGIHHKNLVKLLGCSIEGPESLLVYEFVPNKSLDQFLFDDKRSKVLNWKQRLNI  422

Query  1165  ILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVA  986
             I GTAEGLAYLH  + + IIHRDIK SNVLLDE+  PKIADFGL R F  DK+H+ST +A
Sbjct  423   IKGTAEGLAYLHGGSPVRIIHRDIKTSNVLLDEQLDPKIADFGLARCFGHDKTHLSTGIA  482

Query  985   GTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGK  806
             GTLGYMAPEYVV+G+LTEKADVYSFGVLV+E+  G +NS F     SLLQ+ W L+   +
Sbjct  483   GTLGYMAPEYVVRGQLTEKADVYSFGVLVLEIACGTRNSVFVPGLGSLLQRVWKLYTLNR  542

Query  805   LYEAVDGSLE------ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQ  647
             L EA+   L+      +  + EA   L++GL+C QAS  LRPSM+ V++M++  D  IP 
Sbjct  543   LQEALHPCLKDELLQTQETQAEAFTTLRVGLLCTQASATLRPSMTEVIRMLTERDCGIPI  602

Query  646   PTQPPFLTSNSAA  608
             P+ PPFL  NS A
Sbjct  603   PSSPPFLRINSLA  615



>ref|XP_007036266.1| Cysteine-rich RLK 42, putative [Theobroma cacao]
 gb|EOY20767.1| Cysteine-rich RLK 42, putative [Theobroma cacao]
Length=649

 Score =   529 bits (1363),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 288/619 (47%), Positives = 390/619 (63%), Gaps = 41/619 (7%)
 Frame = -2

Query  2428  WLFLFIFFLSINRSVSDPRASEAALIC--TNRTAPQSQRQAYVANFVAALDALTPLVDSK  2255
             W+F   FF     S SD +A EA L+C  TN T+     +++V N    + AL+  V +K
Sbjct  16    WVFSSCFF----PSPSDSQALEARLMCGTTNETS-----RSFVGNVNRVMGALSESVAAK  66

Query  2254  KYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGC  2075
              +G   +      V+  G+C KD+   DC LC    + ++ RC+P       GR++ D C
Sbjct  67    GWGTFSVNDPPFNVFGLGQCYKDVKGDDCRLCLDTAREELERCIP----ATSGRIYLDRC  122

Query  2074  FVRYDDYVFFNES-SSLSDKTVCGAEDFGGNSGL-------FRRNAAALVGELGRKAAAN  1919
             F R+D+Y F+NE   +  D+  CG+     N+ +       F+     ++  + +     
Sbjct  123   FQRFDNYSFYNEGVDAKYDRATCGSPT---NASIDSYIYQDFQNKLDQVIMNVTKMTLKK  179

Query  1918  DGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMR  1739
             +G+    V  G  TVY LAQCW+ +   SC +CL  A   +  C P  EGR + +GCYMR
Sbjct  180   NGYGVTEVKGGLVTVYALAQCWKTIDAGSCGECLRNAGLGLRKCAPGAEGRAMFSGCYMR  239

Query  1738  YSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKER  1559
             YST +F+D++     NQ  GR   + + LA T  +F  L  +G  AFI  KR+ K++++ 
Sbjct  240   YSTNRFFDHAETD-DNQGFGRWLIIGMALAAT--AFTVLATIG--AFISYKRLSKKKEDG  294

Query  1558  KRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLF  1379
               L  +  T N++ L+F YE LEKAT+ FD+S KLGQGG+G V+KG+LP+GKTVA+KRLF
Sbjct  295   --LDDIPATGNQTSLSFKYEVLEKATNSFDESRKLGQGGAGSVFKGILPNGKTVAVKRLF  352

Query  1378  FNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNH  1199
             FNT QW D FFNEVNLISG+ HKNLV+LLGCSI GPESLLVYE+VPN+SL      +   
Sbjct  353   FNTRQWVDQFFNEVNLISGVQHKNLVRLLGCSIEGPESLLVYEYVPNRSLDQILFVKNTI  412

Query  1198  QPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFP  1019
               LSW QR+ II GTAEGLAYLH  +   IIHRDIK SN+LLDE  TPKIADFGL R   
Sbjct  413   HILSWSQRFNIICGTAEGLAYLHGGSGAKIIHRDIKTSNILLDENLTPKIADFGLARCVA  472

Query  1018  EDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLL  839
              DKSH+STA+AGTLGYMAPEY+V+G+LTEKADVY+FGV+V+E+ +G+KNS F + S S+L
Sbjct  473   SDKSHVSTAIAGTLGYMAPEYLVRGQLTEKADVYAFGVVVLEIATGRKNSVFSEGSSSIL  532

Query  838   QQHWNLFRAGKLYEAVD----GSLEERARVEATRQLQIGLVCVQASPELRPSMSAVVKMI  671
                W  ++A  + +A+D    G  EER   EA+  L +GL+C QAS  LRPSM+ VV+M+
Sbjct  533   YSVWKNYKADTITQAIDSGLRGRFEER---EASSVLLVGLLCTQASAALRPSMAEVVQML  589

Query  670   SGDQ-DIPQPTQPPFLTSN  617
             +    +IP P QPPFL ++
Sbjct  590   TDKSCEIPSPKQPPFLNAS  608



>emb|CDY11684.1| BnaC06g12920D [Brassica napus]
Length=650

 Score =   527 bits (1357),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 280/614 (46%), Positives = 375/614 (61%), Gaps = 46/614 (7%)
 Frame = -2

Query  2380  DPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGA-------GN  2222
             +PR + + L C  R +  S    Y+  FV  + +L+  + ++ +    I +         
Sbjct  27    EPRTAVSGLFCGVRNS-SSTDPNYIPTFVDDMQSLSSKLTTRHFATQSINSLSSDSETQT  85

Query  2221  ATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFN  2042
              +V+A  +C  DLS +DC LC+A  +T+I RCLP        R+F DGCF+RYD Y F++
Sbjct  86    TSVFALAQCHNDLSPSDCQLCYAIARTRIPRCLPSS----SARIFLDGCFLRYDTYEFYD  141

Query  2041  ES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGL  1865
             ES S+ SD+  C       N  +        V E+  +AA   G F  A   G S V+ L
Sbjct  142   ESISAASDRYSCS------NDTVLDPQFGIRVSEMAVRAAVRHGGFGVA---GESGVHAL  192

Query  1864  AQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQS  1685
             AQCWE V  + C DCL  A+ ++  C+ + EGR +N+GCY+RYS  KFY        N  
Sbjct  193   AQCWESVGKEGCRDCLEKAIGQVKRCVSRREGRAMNSGCYLRYSDHKFY--------NGH  244

Query  1684  GGRSNH------LPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNK  1523
             G R  H      + V +  T  +   L++L +   IV+    KQ  E++ LG +      
Sbjct  245   GHRVLHGLYNKGVVVAIVLTMSALVMLILLATYVIIVKVSKTKQ-AEQRNLGLVSRRFKN  303

Query  1522  SKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFN  1343
             SK  F YETLEKATDYF     LG+GG+G V+ G+LP+GK+VA+KRL FNT +W + FFN
Sbjct  304   SKTKFKYETLEKATDYFSTKKTLGEGGNGTVFLGILPNGKSVAVKRLVFNTREWVEEFFN  363

Query  1342  EVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKII  1163
             EVNLISGI HKNLVKLLGCSI GPESLLVYE+VPN+SL ++       + L W QR  II
Sbjct  364   EVNLISGIQHKNLVKLLGCSIEGPESLLVYEYVPNKSLDNFLFDESKSKSLKWNQRLNII  423

Query  1162  LGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAG  983
             LGTAEGLAYLH  + + IIHRDIK SNVLLD++  PK+ADFGL R    DK+H+ST +AG
Sbjct  424   LGTAEGLAYLH-GSPVRIIHRDIKTSNVLLDDQLNPKVADFGLARCLGTDKTHLSTGIAG  482

Query  982   TLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKL  803
             TLGYMAPEYVV+G+LTEKADVYS+GVLV+E+  G +N+ F   +  LL + WNL+R  +L
Sbjct  483   TLGYMAPEYVVRGQLTEKADVYSYGVLVLEIACGTRNNVFVPGAGHLLHRVWNLYRLNRL  542

Query  802   YEAVDGSLEER-------ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQ  647
              EA+D  L +        ++ E  + L +GL+C QASP LRPSM  V++M++  D  IP 
Sbjct  543   VEALDPCLNDEKLLQVQGSQAEVCKVLCVGLLCAQASPSLRPSMDEVIRMLTERDYPIPS  602

Query  646   PTQPPFLTSNSAAS  605
             PT PPFL  +S A+
Sbjct  603   PTNPPFLRISSLAT  616



>ref|XP_009377193.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Pyrus 
x bretschneideri]
Length=677

 Score =   528 bits (1359),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 302/629 (48%), Positives = 401/629 (64%), Gaps = 35/629 (6%)
 Frame = -2

Query  2428  WLFLFIFFLSI-NRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKK  2252
             W+F   F LSI + +VSDPR ++A L C +R     Q  +++  FV  ++ L+  + + +
Sbjct  8     WVF---FLLSIFSSAVSDPRTTQADLYCGSRKP--GQNPSFIPTFVKEMEGLSQQISTHR  62

Query  2251  YGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCF  2072
             +G   + +    +Y   +C  DLS TDC LC+A  +T+I RCLP         +F DGCF
Sbjct  63    WGTHFVNS-TTPMYGLAQCFNDLSHTDCLLCYAASRTKIPRCLP----SLSATIFLDGCF  117

Query  2071  VRYDDYVFFNESSSLS-DKTVCGA--------EDFGGNSGL----FRRNAAALVGELGRK  1931
             +RYD Y F+ +S+  S D  VCG         E+FG N G         AA   G  G  
Sbjct  118   LRYDSYRFYRQSTDPSRDTVVCGPSKQDKIEKEEFGRNVGFAIGNATAAAAGNGGGWGNA  177

Query  1930  AAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAG  1751
              AA  G     V     +V+ LAQCW+ V    C  CL   +     C P +EGR LNAG
Sbjct  178   TAAAAGNGGFGVAEVKGSVFALAQCWKTVGSAGCQSCLEKGIKAAMGCAPSKEGRALNAG  237

Query  1750  CYMRYSTKKFYDNS--TIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIV  1577
             CY+RYST+KFY+++       +Q  G S    +I+A    + AFLL+  S A+    ++ 
Sbjct  238   CYLRYSTEKFYNDAGGAEHVADQGHGLSASRGIIIAVILAAAAFLLLSLSAAYAGYAKLA  297

Query  1576  KQRKERKRLGAMLVTVNK-SKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKT  1400
             + ++ER   G    ++NK S L F YETLEKATDYFD S K+GQGG G V+KG LP+G+T
Sbjct  298   RIKQERSNAGLAATSINKYSSLKFKYETLEKATDYFDSSRKIGQGGGGSVFKGTLPNGET  357

Query  1399  VAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDY  1220
             VA+KRL +NT QW D FFNEVNLISGI HK+LVKLLGCSI GPESLLVYE+VPN+SL  +
Sbjct  358   VAVKRLIYNTRQWVDEFFNEVNLISGIQHKHLVKLLGCSIEGPESLLVYEYVPNRSLDHF  417

Query  1219  TSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADF  1040
                +   Q L+W++R+ II+GTAEGLAYLHE + + IIHRDIK SNVLLDE  +PKIADF
Sbjct  418   LFDKNKVQILNWKERFDIIVGTAEGLAYLHEGSAVRIIHRDIKSSNVLLDENLSPKIADF  477

Query  1039  GLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFY  860
             GL R F  ++SHIST +AGT GYMAPEY+ QG+LTEKADVYSFGVLV+E+VSG++N++F 
Sbjct  478   GLARCFASEQSHISTGIAGTFGYMAPEYLTQGQLTEKADVYSFGVLVLEIVSGQRNNTFR  537

Query  859   QAS--VSLLQQHWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMS  689
               S   SLL + W L+R+ +L + VD  L E+    +A+  L+IGL+C QAS  LRPSM+
Sbjct  538   SESDPDSLLHRVWKLYRSNELAKVVDPCLGEDFPAGDASNVLRIGLLCTQASVALRPSMA  597

Query  688   AVVKMISGDQDI----PQPTQPPFLTSNS  614
              VV+M++ D++I    P P QPPFL S +
Sbjct  598   EVVEMLT-DREIMAAVPSPKQPPFLNSTT  625



>ref|XP_010450675.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Camelina 
sativa]
Length=651

 Score =   526 bits (1356),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 279/617 (45%), Positives = 383/617 (62%), Gaps = 37/617 (6%)
 Frame = -2

Query  2425  LFLFIFFLS--INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKK  2252
             +FL+ FF+   ++ S  D R + + L C  R+   S    ++  FV  + +L+  + +++
Sbjct  14    IFLYSFFVLPFLSSSTDDQRTTVSGLFCGGRSR-SSADPNFIPTFVEDMHSLSLKLTTRR  72

Query  2251  YGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCF  2072
             +    +     +V+A  +C  DLS +DC LC+A  +T++ RCLP        R+F DGCF
Sbjct  73    FATQSLNT-TPSVFALIQCHNDLSPSDCQLCYAIARTRLPRCLPSS----SARIFLDGCF  127

Query  2071  VRYDDYVFFNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV  1895
             +RY+ Y F+ ES S+ SD   C       N+ +      + V E   + A     F  A 
Sbjct  128   LRYETYEFYGESVSATSDSYSCS------NNTVLDPQFGSRVSETAARVAVTQRGFGVAE  181

Query  1894  GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYD  1715
               G   V+ LAQCWE +  + C  CL  AV ++  C+ + EGR +N GCY+RYS  KFY 
Sbjct  182   ESG---VHALAQCWESLGKEDCRVCLEKAVKEVKRCVSRREGRAMNTGCYLRYSDHKFY-  237

Query  1714  NSTIPATNQSGGRSNHLP----VILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLG  1547
                    N  G    H+     VI+A    + AF++++    + +  ++ K ++E+K LG
Sbjct  238   -------NGDGHHKIHVIFNKGVIVAIVLTTSAFVMVILLATYAIMIKVSKTKQEQKNLG  290

Query  1546  AMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTT  1367
              +    N SK  F YETLEKATDYF+   KLG+GG+G V+ G L + K VA+KRL FNT 
Sbjct  291   LISRKFNNSKTKFKYETLEKATDYFNSKKKLGEGGNGTVFLGTLANCKNVAVKRLVFNTR  350

Query  1366  QWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLS  1187
             +W + FFNEVNLISGI HKNLVKLLGCSI GPESLLVYE+VPN+SL  +       + L+
Sbjct  351   EWVEEFFNEVNLISGIQHKNLVKLLGCSIEGPESLLVYEYVPNKSLDHFLFDECKSKVLN  410

Query  1186  WEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKS  1007
             W QR  IILGTAEGLAYLH  + + IIHRDIK SNVLLDE+  PKIADFGL R F  DK+
Sbjct  411   WSQRLNIILGTAEGLAYLHGGSPVRIIHRDIKTSNVLLDEQLNPKIADFGLARCFGPDKT  470

Query  1006  HISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHW  827
             H+ST +AGTLGYMAPEYVV+G+LTEKADVYSFGVLV+E+  GK+N++F   +  LLQ+ W
Sbjct  471   HLSTGIAGTLGYMAPEYVVRGQLTEKADVYSFGVLVLEISCGKRNNAFVPVTGHLLQRVW  530

Query  826   NLFRAGKLYEAVDGSLEERAR------VEATRQLQIGLVCVQASPELRPSMSAVVKMISG  665
             NL+   +L EA+D  L++  R       EA + L++GL+C QASP LRPSM  V++M++ 
Sbjct  531   NLYTLNRLVEALDSCLKDEVRQEQGREAEACKVLRVGLLCTQASPSLRPSMEEVIRMLTE  590

Query  664   DQD-IPQPTQPPFLTSN  617
              +  IP PT PPFL ++
Sbjct  591   SEYLIPSPTNPPFLRTS  607



>ref|XP_010435908.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Camelina 
sativa]
Length=653

 Score =   526 bits (1355),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 279/617 (45%), Positives = 383/617 (62%), Gaps = 37/617 (6%)
 Frame = -2

Query  2425  LFLFIFFLS--INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKK  2252
             +FL+ FF+   ++ S  D R + + L C  R+   S    ++  FV  + +L+  + +++
Sbjct  15    IFLYSFFVLPFLSSSTDDQRTTVSGLFCGGRSR-SSADPNFIPTFVEDMHSLSLKLTTRR  73

Query  2251  YGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCF  2072
             +    +     +V+A  +C  DLS +DC LC+A  +T++ RCLP        R+F DGCF
Sbjct  74    FATQSLKT-TPSVFALIQCHNDLSPSDCQLCYAIARTRLPRCLPSS----SARIFLDGCF  128

Query  2071  VRYDDYVFFNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV  1895
             +RY+ Y F+ ES S+ SD   C       N  +      + V E   + A     F  A 
Sbjct  129   LRYETYEFYGESVSATSDSYSCS------NDTVLDPQFGSRVSETAARVAVTQRGFGVA-  181

Query  1894  GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYD  1715
               G S V+ LAQCWE +  + C  CL  AV ++  C+ + EGR +N GCY+RYS  KFY 
Sbjct  182   --GESGVHALAQCWESLGKEDCRVCLEKAVKEVKRCVSRREGRAMNTGCYLRYSDHKFY-  238

Query  1714  NSTIPATNQSGGRSNHLP----VILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLG  1547
                    N  G    H+     VI+A    + AF++++    + +  ++ K ++E+K LG
Sbjct  239   -------NGDGHHKIHVIFNKGVIVAIVLTTSAFVMVILLATYAIMIKVSKTKQEQKNLG  291

Query  1546  AMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTT  1367
              +    N SK  F YETLEKATDYF+   KLG+GG+G V+ G L +GK VA+KRL FNT 
Sbjct  292   LISRKFNNSKTKFKYETLEKATDYFNCKKKLGEGGNGTVFLGTLANGKNVAVKRLVFNTR  351

Query  1366  QWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLS  1187
             +W + FFNEVNLISGI HKNLVKLLGCSI GPESLLVYE+VPN+SL  +       + L+
Sbjct  352   EWVEEFFNEVNLISGIQHKNLVKLLGCSIEGPESLLVYEYVPNKSLDHFLFDECKSKVLN  411

Query  1186  WEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKS  1007
             W QR  IILGTAEGLAYLH  + + IIHRDIK SNVLLDE+  PKIADFGL R F  DK+
Sbjct  412   WSQRLNIILGTAEGLAYLHGGSPVRIIHRDIKTSNVLLDEQLNPKIADFGLARCFGPDKT  471

Query  1006  HISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHW  827
             H+ST +AGTLGYMAPEYVV+G+LTEKADVYSFGVLV+E+  G +N++F   +  LLQ+ W
Sbjct  472   HLSTGIAGTLGYMAPEYVVRGQLTEKADVYSFGVLVLEIACGTRNNAFVPVTGHLLQRVW  531

Query  826   NLFRAGKLYEAVDGSLEERAR------VEATRQLQIGLVCVQASPELRPSMSAVVKMISG  665
             NL+   +L EA++  L++  R       EA + L++GL+C QASP LRPSM  V++M++ 
Sbjct  532   NLYTLNRLVEALESCLKDEVRQEQGREAEACKVLRVGLLCTQASPSLRPSMEEVIRMLTE  591

Query  664   DQD-IPQPTQPPFLTSN  617
              +  IP PT PPFL ++
Sbjct  592   REYLIPSPTNPPFLRTS  608



>ref|XP_002870713.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46972.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=651

 Score =   526 bits (1355),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 281/618 (45%), Positives = 383/618 (62%), Gaps = 37/618 (6%)
 Frame = -2

Query  2422  FLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGE  2243
             F F+ FLS   S  D R + + L C  R+   S    Y+  FV  + +L+  + ++++  
Sbjct  19    FFFLPFLS--SSDDDLRTTVSGLFCGGRSK-SSTDPNYIPTFVEDMHSLSLKLTTRRFAT  75

Query  2242  TVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRY  2063
               + +   ++YA  +C  DLS +DC LC+A  +T++ RCLP        R+F DGCF+RY
Sbjct  76    ESLNS-TPSIYALIQCHDDLSPSDCQLCYAIARTRLPRCLP----SSSARIFLDGCFLRY  130

Query  2062  DDYVFFNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRG  1886
             + Y F++ES S  SD   C  +        FR      V E   + A   G F  A   G
Sbjct  131   ETYEFYDESVSDTSDSFSCSNDTVLDPLFGFR------VSETAVRVAVRKGGFGVA---G  181

Query  1885  NSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNST  1706
              S V+ LAQCWE +  + C  CL  A+ ++  C+ + EGR +N GCY+RYS  KFY    
Sbjct  182   ESGVHALAQCWESLGKEDCRVCLEKAIKEVKRCVSRREGRAMNTGCYLRYSDHKFY----  237

Query  1705  IPATNQSGGRSNHL----PVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAML  1538
                 N  G  + H+     VI+A    + AF++++    +++  ++ K ++E++ LG + 
Sbjct  238   ----NGDGHHNFHVFFNKGVIVAIVLTTSAFVMLILLATYVIMIKVSKTKQEQRNLGLVS  293

Query  1537  VTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWA  1358
                N SK  F YETLEKATDYF     LGQGG+G V+ G+LP+GK VA+KRL FNT +W 
Sbjct  294   RKFNNSKTKFKYETLEKATDYFSPKKILGQGGNGTVFLGILPNGKNVAVKRLVFNTREWV  353

Query  1357  DHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQ  1178
             + FFNEVNLISGI HKNLVKLLGCSI GPESLLVYE+VPN+SL  +       + L+W Q
Sbjct  354   EEFFNEVNLISGIQHKNLVKLLGCSIEGPESLLVYEYVPNKSLDQFLFDETQSKVLNWSQ  413

Query  1177  RYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHIS  998
             R  IILGTAEGLAYLH  + + IIHRDIK SNVLLD++  PKIADFGL R F  DK+H+S
Sbjct  414   RLNIILGTAEGLAYLHGGSPVRIIHRDIKTSNVLLDDQLNPKIADFGLARCFGLDKTHLS  473

Query  997   TAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLF  818
             T +AGTLGYMAPEYVV+G+LTEKADVYSFGVLV+E+  G +N++F   +  LLQ+ WNL+
Sbjct  474   TGIAGTLGYMAPEYVVRGQLTEKADVYSFGVLVLEIACGTRNNAFEPMTGHLLQRVWNLY  533

Query  817   RAGKLYEAVDGSLEER------ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQ  659
                +L E +D  L++       +  EA + L++GL+C QASP LRPSM  V++M++  D 
Sbjct  534   TLNRLVEPLDPCLKDEFLQVQGSEDEACKVLRVGLLCTQASPWLRPSMEEVIRMLTERDY  593

Query  658   DIPQPTQPPFLTSNSAAS  605
               P PT PPFL  +S  +
Sbjct  594   PFPSPTNPPFLRISSLTT  611



>ref|XP_006338204.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Solanum tuberosum]
Length=641

 Score =   525 bits (1353),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 288/603 (48%), Positives = 382/603 (63%), Gaps = 30/603 (5%)
 Frame = -2

Query  2383  SDPRASEAALIC-TNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGET-VIGAGNATVY  2210
             +DPR SEA  +C TN T P       +  +   +  +T LV    +G +  + + + ++Y
Sbjct  26    ADPRISEAGQVCGTNMTLPS----IIIPQYTKEMQVITQLVSEHGWGSSYAVNSTDISIY  81

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESS-  2033
             A   C +DL   DC  CF    + +  CLP       GR++ DGCF+RYD Y FF E++ 
Sbjct  82    ALANCYQDLPPNDCVQCFLISCSTLPTCLP----AVSGRVYLDGCFIRYDYYNFFGETTD  137

Query  2032  SLSDKTVCGAEDFG-----GNSGLFRRNAAALVGELGRKAA-ANDGFFTAAVGRGNSTVY  1871
             S  DK  C +  FG      +       A  L+  + +KA   NDG+   A G+ N  VY
Sbjct  138   SFKDKVNCSSS-FGRAVTDSDQLALAAAAGNLIENVTKKAINENDGY---AKGKLNG-VY  192

Query  1870  GLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATN  1691
             GLAQCW  V  + C +CL  A   I  CLP  + R L AGCY+RYST  F  + +  ATN
Sbjct  193   GLAQCWRTVSKQGCRECLDKASEAIKGCLPNRDARALMAGCYLRYSTHNFLSHHS-QATN  251

Query  1690  QSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLN  1511
             +   +     VI+   F   AF ++   VA++ RK+ +K+++E   LG +  +  +S LN
Sbjct  252   KGLSKG----VIIVIVFAMIAFSMLFLFVAYVARKKSLKRKQEFINLGKISNSYKRSSLN  307

Query  1510  FSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNL  1331
             F YE LEKAT YFD S  +GQGG+G VYKG LP+GK VA+KRLFFNT  W D FFNEVNL
Sbjct  308   FKYEYLEKATHYFDPSTIVGQGGNGSVYKGTLPNGKVVAVKRLFFNTRHWVDEFFNEVNL  367

Query  1330  ISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTA  1151
             I GI HKNLVKLLGCSI GPESLLVYEFVPN+SL  Y + +   + LSW++R  II+GTA
Sbjct  368   IHGIEHKNLVKLLGCSIEGPESLLVYEFVPNKSLDQYLNDKNKIKVLSWKERLHIIVGTA  427

Query  1150  EGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGY  971
             EGLA+LH  +++ IIHRDIK SNVLLDE F  KIADFGL R    DK+H+ST +AGTLGY
Sbjct  428   EGLAFLHGGSDMKIIHRDIKSSNVLLDENFEAKIADFGLARCLAADKTHLSTGIAGTLGY  487

Query  970   MAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQ-ASVSLLQQHWNLFRAGKLYEA  794
             MAPEY+V+G+LTE ADVYS+GVLV+E+V G+KN S  +  S  LLQ  W L+   ++ +A
Sbjct  488   MAPEYLVKGQLTEMADVYSYGVLVLEIVCGRKNISLAEDDSGYLLQTVWKLYTTNQVTKA  547

Query  793   VDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPFLTS  620
             +D  L++  +  E ++ L++GL+C QAS  LRPSMS VV+M++   Q IP+P QPPFL S
Sbjct  548   LDPILKDDFSPEEVSKVLKVGLLCTQASVTLRPSMSDVVQMLTTFGQPIPEPCQPPFLRS  607

Query  619   NSA  611
             +S+
Sbjct  608   SSS  610



>gb|KCW83338.1| hypothetical protein EUGRSUZ_B00270 [Eucalyptus grandis]
Length=608

 Score =   524 bits (1350),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 282/597 (47%), Positives = 382/597 (64%), Gaps = 33/597 (6%)
 Frame = -2

Query  2386  VSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYA  2207
             VSDPR ++  LIC N T  +      + NF A +  ++  V ++++    +      VY 
Sbjct  26    VSDPRIAQVGLICENATVAEKG----IHNFNAVVREISKSVANQRWSNYSVAKPPPAVYG  81

Query  2206  FGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSL  2027
               +C  DL + +C LCFA+ +  IL C P       GRL+ DGCF+RYD Y F+NE    
Sbjct  82    LAQCHGDLIEAECFLCFAESRPWILPCFP-----NFGRLYMDGCFLRYDVYDFYNE----  132

Query  2026  SDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTA---AVGRGNSTVYGLAQC  1856
                TV    D    SG        ++  +  +A  N GF  A   AVG G + VY LAQC
Sbjct  133   ---TVDPTRDMLKESGRVPDRVDRVLRNVSARAVRNKGFAVAGEDAVG-GVAGVYALAQC  188

Query  1855  WEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGR  1676
             W  +    C  CL  A S+  SC P+EE R +NAGC++RYST KFY+   +P    SGG 
Sbjct  189   WSTLDAGGCRVCLENATSRARSCAPREEARAMNAGCFLRYSTTKFYN---VPV---SGGS  242

Query  1675  SN-HLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYE  1499
             S   + + + ++  +   L+++G  A+I  K+  K+++ +  L  +  + +K  L F Y+
Sbjct  243   SRVRITIAITSSAAATTSLVLIG--AYIGYKKYSKKKQVQNNLMQLRASKSKFSLYFKYK  300

Query  1498  TLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGI  1319
             TLEKAT++FDDS KLGQGG G VYKG+LPDGK VA+KRL FNT QWAD FFNEVNLISGI
Sbjct  301   TLEKATNFFDDSRKLGQGGGGSVYKGILPDGKVVAVKRLVFNTCQWADDFFNEVNLISGI  360

Query  1318  HHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP-LSWEQRYKIILGTAEGL  1142
              HKNL++LLGCSI GPESLLVYE+ P +SL D      +  P L+WE+R  II+GTAEGL
Sbjct  361   RHKNLMRLLGCSIEGPESLLVYEYFPKRSL-DLVLFVNDATPILTWEERLHIIIGTAEGL  419

Query  1141  AYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAP  962
             AYLH    + IIHRDIK SN+LLDE  T KI+DFGL R    DKSH+ST +AGTLGYMAP
Sbjct  420   AYLHGGCGVKIIHRDIKTSNILLDENLTAKISDFGLARCIALDKSHLSTGIAGTLGYMAP  479

Query  961   EYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGS  782
             EY+++G+LTEKADVY+FGVLV+E++SG+KNS + + S S+LQ  W  +++  L   +D +
Sbjct  480   EYLMRGQLTEKADVYAFGVLVLEILSGRKNSVYIRGSSSVLQSVWKHYKSNNLAACIDPA  539

Query  781   LEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI-SGDQDIPQPTQPPFLTSN  617
             L+ +  + EA+  LQIGL+C QA  ELRP MS VV+M+   ++ +PQP+QPPF+ ++
Sbjct  540   LQGKFPILEASNVLQIGLLCTQAYMELRPPMSGVVEMLHDKNRVVPQPSQPPFVNAS  596



>gb|KHN23515.1| Cysteine-rich receptor-like protein kinase 42 [Glycine soja]
Length=605

 Score =   524 bits (1350),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 279/566 (49%), Positives = 366/566 (65%), Gaps = 23/566 (4%)
 Frame = -2

Query  2287  LDALTPLVDSKKYGETVIGAGNAT---VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPF  2117
             ++ L  LV  + +G    G  + T   +Y   +C +DLS  DC  CFA  +T++ RCLP 
Sbjct  1     MEKLLELVTKQNWGTHSEGMSSTTTTPIYGLAQCFQDLSSIDCLQCFAASRTKLPRCLP-  59

Query  2116  QRLVRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFG--GNSGLFRRNAAALVGE  1943
                    R++ DGCF+RYD+Y F+ E+      TV    ++G  G   +F  +   +V  
Sbjct  60    ---SVSARIYLDGCFLRYDNYSFYTENYDPLRDTVNCTSEYGSEGERLVFAESVGKVVES  116

Query  1942  LGRKAAAND---GFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEE  1772
             + R A  N+   GFF  AVG G   VY LAQCW+ V  K C DCL  A +++  CLPK E
Sbjct  117   VVRVAVNNNEGRGFF--AVGEGGG-VYALAQCWKTVGVKGCSDCLRKAENEVKGCLPKRE  173

Query  1771  GRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIV  1592
             GR LN GCY+RYST KFY+            R     +I A +  + A +++  +V+++ 
Sbjct  174   GRALNTGCYLRYSTVKFYNQGGQDGQGDDSSRKR--VIIAAGSVLAAAVVVLTLAVSYVA  231

Query  1591  RKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLP  1412
                   +++ +     +  ++  S LN+ YETLEKATDYF  S K+GQGGSG VYKG LP
Sbjct  232   ----FTKKRRKNNFIEVPPSLKNSSLNYKYETLEKATDYFSSSRKIGQGGSGSVYKGTLP  287

Query  1411  DGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQS  1232
             +G  VA+KRL FN  QW D FFNEVNLISG+ HKNLVKLLGCSI GPESL+VYE++PN+S
Sbjct  288   NGNDVAVKRLVFNNRQWVDDFFNEVNLISGMQHKNLVKLLGCSIEGPESLIVYEYLPNKS  347

Query  1231  LYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPK  1052
             L  +   +   + L W+QR++IILGTAEGLAYLH  +E+ IIHRDIK SNVLLDE  +PK
Sbjct  348   LDQFIFEKDITRILKWKQRFEIILGTAEGLAYLHGGSEIRIIHRDIKSSNVLLDENLSPK  407

Query  1051  IADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN  872
             IADFGL R F  DK+H+ST +AGTLGYMAPEY++QG+LT+KADVYSFGVLV+E+ SG+KN
Sbjct  408   IADFGLARCFGTDKTHLSTGIAGTLGYMAPEYLIQGQLTDKADVYSFGVLVLEIASGRKN  467

Query  871   SSFYQASVSLLQQHWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPS  695
             + F + S SLLQ  W L+++ +L EAVD  L E+    EA+R  QIGL+C QAS  LRP 
Sbjct  468   NVFREDSGSLLQTVWKLYQSNRLGEAVDPGLGEDFPAREASRVFQIGLLCTQASASLRPF  527

Query  694   MSAVVKMISGDQ-DIPQPTQPPFLTS  620
             M+ V  M+S    D+P P QPPFL S
Sbjct  528   MAQVASMLSNSNLDLPIPKQPPFLNS  553



>ref|XP_006405500.1| hypothetical protein EUTSA_v10027683mg [Eutrema salsugineum]
 gb|ESQ46953.1| hypothetical protein EUTSA_v10027683mg [Eutrema salsugineum]
Length=645

 Score =   525 bits (1353),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 282/608 (46%), Positives = 380/608 (63%), Gaps = 33/608 (5%)
 Frame = -2

Query  2407  FLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGA  2228
             F+  + S SDPR + A L C  R    S    Y+  FV  + +L+  + ++++    I +
Sbjct  21    FIPFSYSSSDPRTAVAGLYCGKRNN-SSADPNYIPTFVDDMQSLSLKLTTRRFATQSINS  79

Query  2227  GNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVF  2048
                +V+A  +C  DLS +DC LC+A  +T++ RCLP        R+F DGCF+RY+ Y F
Sbjct  80    -TPSVFAMVQCHNDLSPSDCQLCYAIARTRLPRCLPSS----SARIFLDGCFLRYETYEF  134

Query  2047  FNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVY  1871
             + ES S+ SD+  C  +        FR      V E   +AA   G F  A   G S V+
Sbjct  135   YGESISAASDRYSCSNDTVLDPQFGFR------VSETAARAAVRRGGFGVA---GESGVH  185

Query  1870  GLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATN  1691
              LAQCWE +  + C  CL  AV ++  C+ + EGR +N+GC++RYS  KFY+N      +
Sbjct  186   ALAQCWESLGREECRVCLEKAVGEVKRCVSRREGRAMNSGCFLRYSDHKFYNN------D  239

Query  1690  QSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLN  1511
             + G  +  + V +  T  +F  L++L +   IV+  + K ++E++ LG +      SK  
Sbjct  240   RHGIHNKGVIVAIVLTMSAFVMLVLLATYVIIVK--VSKTKQEKRNLGLVSKKFKNSKTK  297

Query  1510  FSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNL  1331
             F YETLEKATDYF     LGQGG+G V+ GVLP+GK VA+KRL FNT +W + FFNEVNL
Sbjct  298   FKYETLEKATDYFSPKKTLGQGGNGTVFLGVLPNGKNVAVKRLVFNTREWVEEFFNEVNL  357

Query  1330  ISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTA  1151
             ISGI HKNLVKLLGCSI GPESLLVYE+V N+SL ++       + L+W  R  IILG A
Sbjct  358   ISGIQHKNLVKLLGCSIEGPESLLVYEYVANKSLDNFLFDESKSKVLNWCVRLNIILGAA  417

Query  1150  EGLAYLH--EETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTL  977
             EGLAYLH  + + + IIHRDIK SNVLLD++  PKIADFGL R    DK+H+ST +AGTL
Sbjct  418   EGLAYLHGGDGSPVRIIHRDIKTSNVLLDDQLNPKIADFGLARCLGLDKTHLSTGIAGTL  477

Query  976   GYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYE  797
             GYMAPEYVV+G+LTEKADVYS+GVLV+E+  G +N+ F   +  LLQ+ WNL+R  +L E
Sbjct  478   GYMAPEYVVRGQLTEKADVYSYGVLVLEIACGTRNNVFVPGAGHLLQRVWNLYRLNRLVE  537

Query  796   AVDGSLEER------ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQ  638
             A+D  L+E       +  EA + L +GL+C QASP LRPSM  V+ M++  D  IP PT 
Sbjct  538   ALDPCLKEELLQAQCSEAEACKVLCVGLLCAQASPSLRPSMEEVILMLTERDYPIPSPTN  597

Query  637   PPFLTSNS  614
             PPFL  +S
Sbjct  598   PPFLRISS  605



>ref|XP_010027455.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 isoform 
X2 [Eucalyptus grandis]
Length=666

 Score =   526 bits (1355),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 286/601 (48%), Positives = 382/601 (64%), Gaps = 27/601 (4%)
 Frame = -2

Query  2389  SVSDPRASEAALIC--TNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNAT  2216
             + SDPR + A L+C  +N T   +    + A     LD+    V  +++G   + +    
Sbjct  35    AASDPRIAVAGLLCGQSNGTVNGTVTPIFTAVMREILDS----VADRRWGNYSLASPPPA  90

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             VY   +C  DL +TDC LCFA+ +T+I RCLP       GRL+ +GCF+RYD Y F+NE+
Sbjct  91    VYGLAQCHGDLIETDCLLCFAESRTRIPRCLP-----NFGRLYLEGCFLRYDGYDFYNET  145

Query  2035  -SSLSDKTVCGAEDF--GGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--GRGNSTVY  1871
                  DK  C +           F      ++  +   A  N GF  A     +G + VY
Sbjct  146   VDPTHDKLNCSSNSTVPAERVAEFSYRVDRVLRNVSASAVQNGGFAVAGEDGAKGAAGVY  205

Query  1870  GLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATN  1691
              LAQCW  +    C  CL  AVSK  +C P  E R +NAGC++RYST KFY   ++P   
Sbjct  206   ALAQCWSTLDAGGCRVCLENAVSKARNCTPAGEARAMNAGCFLRYSTTKFY---SVPV--  260

Query  1690  QSGGRSN-HLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKL  1514
              SGG S   + V +A++  +   L+++G+  +I  K+  K++  R  L  +  +++KS L
Sbjct  261   -SGGPSRVRITVAIASSAAAAISLVLIGT--YIGYKKYSKEKLVRHSLMKLPASISKSSL  317

Query  1513  NFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVN  1334
              F YETLEKATD+F DS KLG+GG+G VYKG+LP+GK VA+KRL FNT QW D FFNEVN
Sbjct  318   YFKYETLEKATDFFHDSRKLGEGGAGSVYKGILPNGKVVAVKRLVFNTRQWVDDFFNEVN  377

Query  1333  LISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGT  1154
             LI+GI HKNLV+LLGCSI GPESLLVYE++PN+SL            ++WE+R +I+ GT
Sbjct  378   LINGIQHKNLVRLLGCSIEGPESLLVYEYIPNRSLDQVLFVNDATHVMTWEERLRIVTGT  437

Query  1153  AEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLG  974
             AEGLAYLH    + IIHRDIK SN+LLDE    KIADFGL R    DKSH+ST +AGTLG
Sbjct  438   AEGLAYLHGGCGVKIIHRDIKSSNILLDENLMAKIADFGLARCIAPDKSHLSTGIAGTLG  497

Query  973   YMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEA  794
             YMAPEY+V+G+LTEKADVY+FGVLV+E++SG+K+S F Q S S+LQ  WN +++  L   
Sbjct  498   YMAPEYLVRGQLTEKADVYAFGVLVLEILSGRKSSIFAQGSGSVLQSVWNHYKSSNLAAC  557

Query  793   VDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI-SGDQDIPQPTQPPFLTS  620
             VD +L  +  V EA+  LQI L+C QAS ELRP+MS VV+M+ S D  +P+P QPPFL +
Sbjct  558   VDPALRGKFPVQEASDVLQISLLCTQASMELRPTMSRVVEMLRSRDHAVPEPKQPPFLNA  617

Query  619   N  617
             +
Sbjct  618   S  618



>gb|KCW83327.1| hypothetical protein EUGRSUZ_B00255 [Eucalyptus grandis]
Length=659

 Score =   526 bits (1354),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 289/613 (47%), Positives = 383/613 (62%), Gaps = 29/613 (5%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGET--VIGAGNAT  2216
             + SDPR +   L C  R A  +     V +F+A +  ++  V  +++G+    +      
Sbjct  26    AASDPRIAVVGLFC--RNANGTVAGNVVPDFIAVMREISGSVAHRRWGKANYSLAPPPTA  83

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             VY   +C  DL +TDC LCFA+ +T+I RCLP       GRL+ DGCF+RYD Y F+NE+
Sbjct  84    VYGLAQCHGDLIETDCLLCFAESRTRIPRCLP-----NFGRLYLDGCFLRYDGYDFYNET  138

Query  2035  -SSLSDKTVCGAEDF--GGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--GRGNSTVY  1871
                  D   C +        +  F      ++ ++   A  N GF  A     +G + VY
Sbjct  139   VDPTHDNLNCSSNSTVPAERAAEFSYRVDRVLRDVSASAVQNGGFAVAGEDGAKGAAGVY  198

Query  1870  GLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATN  1691
              LAQCW  +    C  CL  A SK  +C P  E R +NAGC++RYST KFY   ++P   
Sbjct  199   ALAQCWSTLDAGGCRVCLENAASKARNCTPAGEARAMNAGCFLRYSTTKFY---SVPV--  253

Query  1690  QSGGRSN-HLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKL  1514
              SGG S  H+ V +A++  +   L+++G  A+I  K+  K++  +  L  +  +V KS L
Sbjct  254   -SGGPSRVHITVAIASSAAAAISLVLIG--AYIGYKKYSKEKLVQHSLMRLPASVRKSNL  310

Query  1513  NFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVN  1334
              F YETLEKATD+F D  KLGQGG+G VYKG+LPDGK VA+KRL FNT QW D FFNEVN
Sbjct  311   YFKYETLEKATDFFHDLRKLGQGGAGSVYKGILPDGKVVAVKRLVFNTCQWVDDFFNEVN  370

Query  1333  LISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGT  1154
             LI+GI HKNLV+LLGCSI GPESLLVYE++PN SL            L+WE+R +II GT
Sbjct  371   LINGIQHKNLVRLLGCSIEGPESLLVYEYIPNGSLDQVLFVNDATHVLTWEERLRIITGT  430

Query  1153  AEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLG  974
             AEGLAYLH    + IIHRDIK SN+LLDE    KIADFGL R    D SH+ST +AGTLG
Sbjct  431   AEGLAYLHGGCGVKIIHRDIKSSNILLDENLMAKIADFGLARCIAPDNSHLSTGIAGTLG  490

Query  973   YMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEA  794
             YMAPEY+V+G+LTEKADVY+FGVLV+E++SG+K+S F Q S S+LQ  W  +++  L   
Sbjct  491   YMAPEYLVRGQLTEKADVYAFGVLVLEILSGRKSSVFAQGSSSVLQSVWKHYKSNNLAAC  550

Query  793   VDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPFLT-  623
             VD +L+ +  V EA+  LQI L+C QAS ELRP+MS VV+M+   D  +P+P QPPFL  
Sbjct  551   VDPALQGKFPVPEASDMLQISLLCTQASMELRPTMSVVVEMLRNRDHAVPEPKQPPFLNA  610

Query  622   ---SNSAASSGSY  593
                S+ +++  SY
Sbjct  611   SVLSDESSTGSSY  623



>ref|XP_010027449.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
Length=668

 Score =   526 bits (1354),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 289/613 (47%), Positives = 383/613 (62%), Gaps = 29/613 (5%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGET--VIGAGNAT  2216
             + SDPR +   L C  R A  +     V +F+A +  ++  V  +++G+    +      
Sbjct  35    AASDPRIAVVGLFC--RNANGTVAGNVVPDFIAVMREISGSVAHRRWGKANYSLAPPPTA  92

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             VY   +C  DL +TDC LCFA+ +T+I RCLP       GRL+ DGCF+RYD Y F+NE+
Sbjct  93    VYGLAQCHGDLIETDCLLCFAESRTRIPRCLP-----NFGRLYLDGCFLRYDGYDFYNET  147

Query  2035  -SSLSDKTVCGAEDF--GGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--GRGNSTVY  1871
                  D   C +        +  F      ++ ++   A  N GF  A     +G + VY
Sbjct  148   VDPTHDNLNCSSNSTVPAERAAEFSYRVDRVLRDVSASAVQNGGFAVAGEDGAKGAAGVY  207

Query  1870  GLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATN  1691
              LAQCW  +    C  CL  A SK  +C P  E R +NAGC++RYST KFY   ++P   
Sbjct  208   ALAQCWSTLDAGGCRVCLENAASKARNCTPAGEARAMNAGCFLRYSTTKFY---SVPV--  262

Query  1690  QSGGRSN-HLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKL  1514
              SGG S  H+ V +A++  +   L+++G  A+I  K+  K++  +  L  +  +V KS L
Sbjct  263   -SGGPSRVHITVAIASSAAAAISLVLIG--AYIGYKKYSKEKLVQHSLMRLPASVRKSNL  319

Query  1513  NFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVN  1334
              F YETLEKATD+F D  KLGQGG+G VYKG+LPDGK VA+KRL FNT QW D FFNEVN
Sbjct  320   YFKYETLEKATDFFHDLRKLGQGGAGSVYKGILPDGKVVAVKRLVFNTCQWVDDFFNEVN  379

Query  1333  LISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGT  1154
             LI+GI HKNLV+LLGCSI GPESLLVYE++PN SL            L+WE+R +II GT
Sbjct  380   LINGIQHKNLVRLLGCSIEGPESLLVYEYIPNGSLDQVLFVNDATHVLTWEERLRIITGT  439

Query  1153  AEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLG  974
             AEGLAYLH    + IIHRDIK SN+LLDE    KIADFGL R    D SH+ST +AGTLG
Sbjct  440   AEGLAYLHGGCGVKIIHRDIKSSNILLDENLMAKIADFGLARCIAPDNSHLSTGIAGTLG  499

Query  973   YMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEA  794
             YMAPEY+V+G+LTEKADVY+FGVLV+E++SG+K+S F Q S S+LQ  W  +++  L   
Sbjct  500   YMAPEYLVRGQLTEKADVYAFGVLVLEILSGRKSSVFAQGSSSVLQSVWKHYKSNNLAAC  559

Query  793   VDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPFLT-  623
             VD +L+ +  V EA+  LQI L+C QAS ELRP+MS VV+M+   D  +P+P QPPFL  
Sbjct  560   VDPALQGKFPVPEASDMLQISLLCTQASMELRPTMSVVVEMLRNRDHAVPEPKQPPFLNA  619

Query  622   ---SNSAASSGSY  593
                S+ +++  SY
Sbjct  620   SVLSDESSTGSSY  632



>gb|KCW83326.1| hypothetical protein EUGRSUZ_B00254 [Eucalyptus grandis]
Length=657

 Score =   525 bits (1353),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 286/601 (48%), Positives = 382/601 (64%), Gaps = 27/601 (4%)
 Frame = -2

Query  2389  SVSDPRASEAALIC--TNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNAT  2216
             + SDPR + A L+C  +N T   +    + A     LD+    V  +++G   + +    
Sbjct  26    AASDPRIAVAGLLCGQSNGTVNGTVTPIFTAVMREILDS----VADRRWGNYSLASPPPA  81

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             VY   +C  DL +TDC LCFA+ +T+I RCLP       GRL+ +GCF+RYD Y F+NE+
Sbjct  82    VYGLAQCHGDLIETDCLLCFAESRTRIPRCLP-----NFGRLYLEGCFLRYDGYDFYNET  136

Query  2035  -SSLSDKTVCGAEDF--GGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--GRGNSTVY  1871
                  DK  C +           F      ++  +   A  N GF  A     +G + VY
Sbjct  137   VDPTHDKLNCSSNSTVPAERVAEFSYRVDRVLRNVSASAVQNGGFAVAGEDGAKGAAGVY  196

Query  1870  GLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATN  1691
              LAQCW  +    C  CL  AVSK  +C P  E R +NAGC++RYST KFY   ++P   
Sbjct  197   ALAQCWSTLDAGGCRVCLENAVSKARNCTPAGEARAMNAGCFLRYSTTKFY---SVPV--  251

Query  1690  QSGGRSN-HLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKL  1514
              SGG S   + V +A++  +   L+++G+  +I  K+  K++  R  L  +  +++KS L
Sbjct  252   -SGGPSRVRITVAIASSAAAAISLVLIGT--YIGYKKYSKEKLVRHSLMKLPASISKSSL  308

Query  1513  NFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVN  1334
              F YETLEKATD+F DS KLG+GG+G VYKG+LP+GK VA+KRL FNT QW D FFNEVN
Sbjct  309   YFKYETLEKATDFFHDSRKLGEGGAGSVYKGILPNGKVVAVKRLVFNTRQWVDDFFNEVN  368

Query  1333  LISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGT  1154
             LI+GI HKNLV+LLGCSI GPESLLVYE++PN+SL            ++WE+R +I+ GT
Sbjct  369   LINGIQHKNLVRLLGCSIEGPESLLVYEYIPNRSLDQVLFVNDATHVMTWEERLRIVTGT  428

Query  1153  AEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLG  974
             AEGLAYLH    + IIHRDIK SN+LLDE    KIADFGL R    DKSH+ST +AGTLG
Sbjct  429   AEGLAYLHGGCGVKIIHRDIKSSNILLDENLMAKIADFGLARCIAPDKSHLSTGIAGTLG  488

Query  973   YMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEA  794
             YMAPEY+V+G+LTEKADVY+FGVLV+E++SG+K+S F Q S S+LQ  WN +++  L   
Sbjct  489   YMAPEYLVRGQLTEKADVYAFGVLVLEILSGRKSSIFAQGSGSVLQSVWNHYKSSNLAAC  548

Query  793   VDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI-SGDQDIPQPTQPPFLTS  620
             VD +L  +  V EA+  LQI L+C QAS ELRP+MS VV+M+ S D  +P+P QPPFL +
Sbjct  549   VDPALRGKFPVQEASDVLQISLLCTQASMELRPTMSRVVEMLRSRDHAVPEPKQPPFLNA  608

Query  619   N  617
             +
Sbjct  609   S  609



>gb|KDP31073.1| hypothetical protein JCGZ_11449 [Jatropha curcas]
Length=610

 Score =   523 bits (1346),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 272/567 (48%), Positives = 360/567 (63%), Gaps = 25/567 (4%)
 Frame = -2

Query  2287  LDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRL  2108
             ++++   V   K+G   I + +  VY   +C  DLS  DC LCF+  + ++ RC+P    
Sbjct  1     MESIQQQVSRNKWGSASITSPSPQVYGLAQCHSDLSSLDCQLCFSLGRIKLPRCVP----  56

Query  2107  VRGGRLFYDGCFVRYDDYVFFNES-SSLSDKTVCGAE--DFGGNS--GLFRRNAAALVGE  1943
                GR++ DGCF+RYD Y FFNES +S  D   C     D   NS    F +  A ++  
Sbjct  57    KSAGRIYLDGCFLRYDSYSFFNESVNSKYDAVNCSQPTGDLIDNSLHMEFSKKVADIIKN  116

Query  1942  LGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRV  1763
             +  +A  N  F T     G +  Y LAQCW  +    C DCL  A S++  C P  +G+ 
Sbjct  117   VTDRALQNGTFATVEAKGGVAPAYALAQCWNSLTYAHCRDCLVKAGSQLRECAPSSQGQA  176

Query  1762  LNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKR  1583
             L  GCYMRYST+KF+       T++S  +     +I A    + AFL++    AFI  +R
Sbjct  177   LFTGCYMRYSTEKFFKT-----TSKSKHQGFDNGIIGAIVLAAIAFLVLASFGAFIGYRR  231

Query  1582  IVKQRKE---RKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLP  1412
             +  ++++   R+R  AM      S LNF YE LEKAT+YF D  KLGQGG+G V+KG L 
Sbjct  232   LSTEKEDLTVRRRFSAM------SNLNFKYEVLEKATNYFSDEMKLGQGGAGSVFKGNLT  285

Query  1411  DGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQS  1232
             DG+ VA+KRL +NT QW D FFNEVNLISGI HKNLV+LLGCSI GPESLLVYE+VPN+S
Sbjct  286   DGRIVAVKRLVYNTRQWVDQFFNEVNLISGIQHKNLVRLLGCSIEGPESLLVYEYVPNRS  345

Query  1231  LYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPK  1052
             L     A+     LSW QRY IILGTAEGLAYLH  + + IIHRDIK SN+LLDE+ TPK
Sbjct  346   LDQILFAKDTVNILSWPQRYNIILGTAEGLAYLHGGSGVKIIHRDIKTSNILLDEKLTPK  405

Query  1051  IADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN  872
             IADFGL R F  D +HIST +AGTLGYMAPEY+++G+LTEKADVY FGVLV+E+ +GKKN
Sbjct  406   IADFGLARCFTADNTHISTGIAGTLGYMAPEYLIRGQLTEKADVYGFGVLVLEIATGKKN  465

Query  871   SSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPS  695
             S + Q S S+L   W  ++A ++ EA+D  L +     EA   LQ+GL+C QAS  LRP+
Sbjct  466   SVYSQGSSSILHSVWRHYKAKRIIEAIDPKLRDILPCKEAEIVLQLGLLCTQASASLRPT  525

Query  694   MSAVVKMISGDQ-DIPQPTQPPFLTSN  617
             M+ +++M++  +  +P P QPPFL ++
Sbjct  526   MAEIIQMLTDKECQMPSPKQPPFLNAS  552



>emb|CDX67454.1| BnaA07g14940D [Brassica napus]
Length=657

 Score =   525 bits (1351),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 277/610 (45%), Positives = 375/610 (61%), Gaps = 34/610 (6%)
 Frame = -2

Query  2380  DPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGA-------GN  2222
             +PR + + L C   +   S    Y+  FV  + +L+  + ++ +    I +         
Sbjct  33    EPRTAVSGLFC-GVSNSSSTDPNYIPTFVDDMQSLSSKLTTRHFATQSINSLSSNSETQT  91

Query  2221  ATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFN  2042
              +VYA  +C  DLS +DC LC+A  +T+I RCLP        R+F DGCF+RYD Y F++
Sbjct  92    TSVYALVQCHNDLSPSDCQLCYAIARTRIPRCLPSS----SARIFLDGCFLRYDTYEFYD  147

Query  2041  ES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGL  1865
             ES S+ SD+  C       N  +        V E+  +AA   G F      G S V+ L
Sbjct  148   ESISAASDRYSCS------NDTVLDPQFGIRVSEMAVRAAVKHGGFGVV---GESGVHAL  198

Query  1864  AQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQS  1685
             AQCWE V  + C DCL  A +++  C+ + EGR +N+GCY+RYS  KFY+       +  
Sbjct  199   AQCWESVGKEGCSDCLEKATAQVKRCVSRREGRAMNSGCYLRYSDHKFYNGHGHSVLH--  256

Query  1684  GGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFS  1505
             G  +  + V +  T  +   L++L +   IV K   K++ E++ LG +      SK  F 
Sbjct  257   GLYNKGVVVAIVLTMSAIVMLILLATYVIIV-KVSKKKQAEQRNLGLVSRRFKNSKTKFK  315

Query  1504  YETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLIS  1325
             YETLEKATDYF    KLG+GG+G V+ G+LP+GK+VA+KRL FNT +W +  FNEVNLIS
Sbjct  316   YETLEKATDYFSTKKKLGEGGNGTVFLGILPNGKSVAVKRLVFNTREWVEELFNEVNLIS  375

Query  1324  GIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEG  1145
             GI HKNLVKLLGCSI GPESLLVYE+VPN+SL ++       + L+W QR  IILGTAEG
Sbjct  376   GIQHKNLVKLLGCSIEGPESLLVYEYVPNKSLDNFLFDESKIKSLNWNQRLNIILGTAEG  435

Query  1144  LAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMA  965
             LAYLH  + + IIHRDIK SNVLLD++  PK+ADFGL R    DK+H+ST +AGTLGYMA
Sbjct  436   LAYLH-GSPVRIIHRDIKTSNVLLDDQLNPKVADFGLARCLGTDKTHLSTGIAGTLGYMA  494

Query  964   PEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDG  785
             PEYVV+G+LTEKADVYS+GVLV+E+  G +N+ F   +  LL + WNL+R  +L EA+D 
Sbjct  495   PEYVVRGQLTEKADVYSYGVLVLEIACGTRNNVFVPGAGHLLHRVWNLYRLNRLVEALDP  554

Query  784   SLEER-------ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPF  629
              L +        ++ E  + L +GL+C QASP LRPSM  V+ M++  D  IP PT PPF
Sbjct  555   CLNDEKLLQVQGSQAEVCKVLSVGLLCAQASPSLRPSMEEVISMLTERDYPIPSPTNPPF  614

Query  628   LTSNSAASSG  599
             L  +S A+ G
Sbjct  615   LRISSLATEG  624



>ref|XP_010249418.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Nelumbo 
nucifera]
Length=635

 Score =   523 bits (1348),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 282/600 (47%), Positives = 374/600 (62%), Gaps = 24/600 (4%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             S+SDPR +     C   +   S    +++  V   + L  L+  + +G  V       VY
Sbjct  25    SLSDPRITTIDQQCGYTSFQGSVDVDHISKVVQGENGLAQLLGEQGWGAQVSNT-YPPVY  83

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSS  2030
                +C +DLS  DC LCF + ++++  CLP       GR++ DGCF+RYDDY FF E+  
Sbjct  84    ILAQCQQDLSPEDCLLCFNESQSKLSNCLP----ATSGRVYLDGCFIRYDDYNFFTEAVD  139

Query  2029  -------LSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVY  1871
                     S      AED+      F +     +  +   A +  GF    V  G   +Y
Sbjct  140   PRYDIVKCSSSKDVAAEDYMKLE--FAKKVGDAIVNVTTSAVSEGGFAVTEVKGGVVAIY  197

Query  1870  GLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATN  1691
              +AQCW  +  +SC +CL  A + +  C P +EGR L +GCY+RYST++F+   T   + 
Sbjct  198   AMAQCWGSLAEESCRECLQEAGNLVRGCAPAKEGRGLLSGCYLRYSTERFFAEYTEDLSE  257

Query  1690  QSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLN  1511
              +         ++A    S AF L+    A +  KR+   +K +  + A+ +  + S LN
Sbjct  258   TA--------FVIAIALASLAFSLLALFGACVGYKRLSMIKKGKISIVAIPIYSSMSHLN  309

Query  1510  FSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNL  1331
             F YE LEKATD F+ +NKLGQGG+G V+KG LPDGK VA+KRLFFNT QW D FFNEVNL
Sbjct  310   FKYEILEKATDSFNVNNKLGQGGAGSVFKGTLPDGKAVAVKRLFFNTRQWVDEFFNEVNL  369

Query  1330  ISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTA  1151
             I+GI HKNLVKLLGCSI GPESLL+YE+VPN+SL  +   +   Q L+WEQR+ II+G A
Sbjct  370   INGIQHKNLVKLLGCSIEGPESLLIYEYVPNKSLDQFLFDKYKVQILTWEQRFNIIVGIA  429

Query  1150  EGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGY  971
             EG+AYLH  +E  IIHRDIK SNVLLDE+ T KIADFGL R F  DK+H+ST +AGTLGY
Sbjct  430   EGIAYLHGGSETRIIHRDIKSSNVLLDEDLTAKIADFGLARCFTADKTHLSTGIAGTLGY  489

Query  970   MAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAV  791
             MAPEY+V+G+LTEKADVYSFGVLV+E+V G+KNS F Q + S+LQ  WN F++  L E+V
Sbjct  490   MAPEYLVRGQLTEKADVYSFGVLVLEIVCGRKNSVFTQDTGSVLQTVWNNFKSNTLPESV  549

Query  790   DGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPFLTSN  617
             D  L++   V EA+  LQIGL+C Q S  LRPSMS VV+M++  D  IP P QPPFL ++
Sbjct  550   DKCLKDEFSVKEASNALQIGLLCTQTSVSLRPSMSDVVQMLTNEDFPIPLPVQPPFLNAS  609



>ref|XP_006483911.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Citrus sinensis]
Length=642

 Score =   522 bits (1344),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 278/618 (45%), Positives = 382/618 (62%), Gaps = 34/618 (6%)
 Frame = -2

Query  2428  WLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKY  2249
             +LFL    L + R   DPR     + C ++    S    +V NFV  ++ ++  + +  +
Sbjct  5     FLFLVGSLLMLVRVAGDPRVHTVNITCGHQLEHNSS--IFVPNFVTTMENISEQMRTSGF  62

Query  2248  GETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFV  2069
             G  V G+G    Y   +C  DLS  DC LC+A+ +T + +C P+     GGR++ DGCF+
Sbjct  63    GLAVTGSGLDINYGLAQCYGDLSLLDCVLCYAEARTLLPQCYPYN----GGRIYLDGCFM  118

Query  2068  RYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--  1895
             R ++Y FF E     D+ VCG      +S  F+ +A   V      A +N G+    V  
Sbjct  119   RSENYSFFGEYEGPEDRAVCGNGTRKNSS--FQESARKAVMRAVASAPSNGGYARVQVQV  176

Query  1894  -GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFY  1718
              G  N + Y L  CW+ +   SC+ CLA A + I  CLP  EGR LN GC+MRYS K F 
Sbjct  177   SGAANKSAYVLVNCWKTLNSSSCEACLANASASILGCLPWSEGRALNTGCFMRYSDKDFL  236

Query  1717  DNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRK-ERKRLGA-  1544
             +    P   +S G       ++A    S    L++ +V  ++  RI KQR  ERKR G+ 
Sbjct  237   NKE--PGKGRSRG-------MIAAIVVSVVSALVVLAVGIVIGTRIWKQRSIERKRRGSN  287

Query  1543  ----MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFF  1376
                 ++ T+N   LNF Y TLEKAT  FD++NKLGQGG G VYKGVLPDG+ +A+KRLFF
Sbjct  288   DAEKLVKTLNDDSLNFKYSTLEKATGSFDEANKLGQGGFGTVYKGVLPDGREIAVKRLFF  347

Query  1375  NTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQ  1196
             N    A +F+NEVN+IS + HKNLV+LLGCS +GPESLLVYEF+PNQSL  +       +
Sbjct  348   NNRHRAANFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEFLPNQSLDRFIFDSAKAK  407

Query  1195  PLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPE  1016
              L+WE+RY+IILGT EGL YLHE++++ IIHRDIK SN+LLD     KIADFGL R F E
Sbjct  408   TLTWEKRYEIILGTVEGLVYLHEQSKIRIIHRDIKASNILLDSRLRAKIADFGLARSFQE  467

Query  1015  DKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSL  842
             DKSHISTA+AGTLGYMAPEY+  G+LTEKADVYSFG+L++E+V+G++N  S   + + SL
Sbjct  468   DKSHISTAIAGTLGYMAPEYLAHGQLTEKADVYSFGMLLLEIVTGRQNNRSKNSEYTDSL  527

Query  841   LQQHWNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELRPSMSAVV  680
             L   W  F+AG++ E  D +L      +   + E  R + +GL+C Q +P LRP+MS V+
Sbjct  528   LTITWKHFQAGRVEELYDKNLMLHNYHDSNVKYEVLRAIHVGLLCTQENPSLRPTMSRVL  587

Query  679   KMISGDQDIPQPTQPPFL  626
             +M++ ++ +P PT PPF+
Sbjct  588   QMLTTEEQLPGPTSPPFI  605



>gb|KDO82327.1| hypothetical protein CISIN_1g006514mg [Citrus sinensis]
Length=642

 Score =   522 bits (1344),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 277/618 (45%), Positives = 382/618 (62%), Gaps = 34/618 (6%)
 Frame = -2

Query  2428  WLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKY  2249
             +LFL    L + R   DPR     + C ++    S    +V NFV  ++ ++  + +  +
Sbjct  5     FLFLVGSLLMLVRVAGDPRVHTVNITCGHQLEHNSS--IFVPNFVTTMENISEQMRTSGF  62

Query  2248  GETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFV  2069
             G  V G+G    Y   +C  DLS  DC LC+A+ +T + +C P+     GGR++ DGCF+
Sbjct  63    GLAVTGSGLDINYGLAQCYGDLSLLDCVLCYAEARTLLPQCYPYN----GGRIYLDGCFM  118

Query  2068  RYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--  1895
             R ++Y FF E     D+ VCG      +S  F+ +A   V      A +N G+    V  
Sbjct  119   RSENYSFFGEYEGPEDRAVCGNGTRKNSS--FQESARKAVMRAVASAPSNGGYARVQVQV  176

Query  1894  -GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFY  1718
              G  N + Y L  CW+ +   SC+ CLA A + I  CLP  EGR LN GC+MRYS K F 
Sbjct  177   SGAANKSAYVLVNCWKTLNSSSCEACLANASASILGCLPWSEGRALNTGCFMRYSDKDFL  236

Query  1717  DNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRK-ERKRLGA-  1544
             +    P   +S G       ++A    S    L++ +V  ++  R+ KQR  ERKR G+ 
Sbjct  237   NKE--PGKGRSRG-------MIAAIVVSVVSALVVLAVGIVIGTRVWKQRSIERKRRGSN  287

Query  1543  ----MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFF  1376
                 ++ T+N   LNF Y TLEKAT  FD++NKLGQGG G VYKGVLPDG+ +A+KRLFF
Sbjct  288   DAEKLVKTLNDDSLNFKYSTLEKATGSFDEANKLGQGGFGTVYKGVLPDGREIAVKRLFF  347

Query  1375  NTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQ  1196
             N    A +F+NEVN+IS + HKNLV+LLGCS +GPESLLVYEF+PNQSL  +       +
Sbjct  348   NNRHRAANFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEFLPNQSLDRFIFDSAKAK  407

Query  1195  PLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPE  1016
              L+WE+RY+IILGT EGL YLHE++++ IIHRDIK SN+LLD     KIADFGL R F E
Sbjct  408   TLTWEKRYEIILGTVEGLVYLHEQSKIRIIHRDIKASNILLDSRLRAKIADFGLARSFQE  467

Query  1015  DKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSL  842
             DKSHISTA+AGTLGYMAPEY+  G+LTEKADVYSFG+L++E+V+G++N  S   + + SL
Sbjct  468   DKSHISTAIAGTLGYMAPEYLAHGQLTEKADVYSFGMLLLEIVTGRQNNRSKNSEYTDSL  527

Query  841   LQQHWNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELRPSMSAVV  680
             L   W  F+AG++ E  D +L      +   + E  R + +GL+C Q +P LRP+MS V+
Sbjct  528   LTITWKHFQAGRVEELYDKNLMLHNYHDSNVKYEVLRAIHVGLLCTQENPSLRPTMSRVL  587

Query  679   KMISGDQDIPQPTQPPFL  626
             +M++ ++ +P PT PPF+
Sbjct  588   QMLTTEEQLPGPTSPPFI  605



>ref|XP_011040494.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Populus 
euphratica]
Length=595

 Score =   519 bits (1337),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 270/572 (47%), Positives = 362/572 (63%), Gaps = 22/572 (4%)
 Frame = -2

Query  2287  LDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRL  2108
             +D+L   V S+ +G   I +    +Y   +C  DLS  DC +CF Q + ++ RCLP    
Sbjct  1     MDSLQKQVGSRNWGCDFITSPLLQIYGLAQCHDDLSSLDCKICFFQGRVKLPRCLP----  56

Query  2107  VRGGRLFYDGCFVRYDDYVFFNES-SSLSDKTVCGAEDFGGNSGL----FRRNAAALVGE  1943
                 R++ +GCF+RYD Y FF+E+   ++D  VCG              F++  A  +  
Sbjct  57    ATSARIYLNGCFIRYDKYNFFHEAIDPMNDAVVCGEPTNALTDNFLHMEFKQRLAVAIQN  116

Query  1942  LGRKAAANDGFFTAAVGRGNS-TVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGR  1766
             +   A  N G F AA  +G   ++Y LAQCW  +    C  CL  A SK+  C P  EG 
Sbjct  117   VTAMALGN-GKFAAAEAKGRIFSIYALAQCWNTLDKDECRKCLVKAGSKLSQCAPGSEGS  175

Query  1765  VLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRK  1586
                AGCYM+YST  F+  S      +S  R ++  +++A T  +  F+++    AFI  +
Sbjct  176   AFFAGCYMKYSTHHFFKESV-----ESKARYDNTGIVVAVTLSTVVFVVLASFGAFIGYE  230

Query  1585  RIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDG  1406
             R+ K++ ++  L    ++ N S LNF+YE LEKAT+YFDDS KLGQGG+G V+KG LPDG
Sbjct  231   RLSKRKGDKTNL---RLSPNSS-LNFTYEVLEKATEYFDDSRKLGQGGAGSVFKGTLPDG  286

Query  1405  KTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLY  1226
             +TVA+KRL ++T QW D FFNEVNLISGI HKNLV LLGCSI GPESLLVYE+VPN+SL 
Sbjct  287   RTVAVKRLVYSTRQWVDQFFNEVNLISGIQHKNLVILLGCSIEGPESLLVYEYVPNRSLD  346

Query  1225  DYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIA  1046
                  +     L+W+QR+ IILGTA GLAYLH    + IIHRDIK SN+LLDE+ TPKIA
Sbjct  347   QILFIKNTLHILNWQQRFNIILGTARGLAYLHGGCGVTIIHRDIKTSNILLDEKLTPKIA  406

Query  1045  DFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSS  866
             DFGL R    D +HIST +AGTLGYMAPEY+V+G+LTEK DVY FGVL++E+ +GKKNS 
Sbjct  407   DFGLARCVATDNTHISTGIAGTLGYMAPEYLVRGQLTEKVDVYGFGVLLLEIATGKKNSV  466

Query  865   FYQASVSLLQQHWNLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMS  689
             F Q S S+L   W  ++A  + + VD  L    ++ +A + LQIGL+C QAS  LRPSM+
Sbjct  467   FSQGSSSILHSVWKHYKANTITDMVDPGLRGMFSQKQAEKVLQIGLLCTQASSRLRPSMN  526

Query  688   AVVKMISGDQ-DIPQPTQPPFLTSNSAASSGS  596
              VV+M++  Q  IP P QPPFL ++  +  G+
Sbjct  527   GVVQMLTDAQCQIPSPKQPPFLNASVLSPDGN  558



>ref|XP_008341436.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Malus 
domestica]
Length=663

 Score =   521 bits (1341),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 298/618 (48%), Positives = 396/618 (64%), Gaps = 27/618 (4%)
 Frame = -2

Query  2428  WLFLFIFFLSI-NRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKK  2252
             W+F   F LSI + +VSDPR ++A+L C +R     Q  +++  FV  ++ L+    +  
Sbjct  8     WVF---FLLSIFSSAVSDPRTTQASLYCGSRKP--GQNXSFIPTFVKEMEGLSQQXSTHH  62

Query  2251  YGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCF  2072
             +G   + +    +Y   +C  DLS TDC LC+A  +T+I  CLP         +F DGCF
Sbjct  63    WGTQFVNS-TTPMYGLAQCFNDLSHTDCLLCYAASRTKIPXCLP----SLAATIFLDGCF  117

Query  2071  VRYDDYVFFNESSSLS-DKTVCG-AEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAA  1898
             +RYD Y F+ +S+  S D  VCG ++        F RN    +G     AA N GF  A 
Sbjct  118   LRYDSYRFYRQSTDPSRDTVVCGXSKQXKIEKXEFGRNVGFAIGNATAAAAGNGGFGVAE  177

Query  1897  VGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFY  1718
             V     +V+ LAQCW+      C  CL         C P +EGR LNAGCY+RYST+KFY
Sbjct  178   V---KGSVFALAQCWKTXGSAGCXSCLEKGXKAAMGCAPSKEGRALNAGCYLRYSTEKFY  234

Query  1717  DNS--TIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGA  1544
             +++       +   G S    +I+A    + AFLL+  S A+    ++ + ++ER  +G 
Sbjct  235   NDAGGAEQVADHGHGLSVSRGIIIAXILAAAAFLLLSLSGAYAXYAKLARIKQERSNVGL  294

Query  1543  MLVTVNK-SKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTT  1367
                ++NK S L F YETLEKATDYF+ S K+GQGG G V+KG LP G+TVA+KRL +NT 
Sbjct  295   AATSINKYSSLKFRYETLEKATDYFNSSRKIGQGGGGSVFKGTLPSGETVAVKRLIYNTR  354

Query  1366  QWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLS  1187
             QW D FFNEVNLISGI HK+LVKLLGCSI GPESLLVYE+VPN+SL  +   +   Q L+
Sbjct  355   QWVDEFFNEVNLISGIQHKHLVKLLGCSIEGPESLLVYEYVPNRSLDHFLFDKNKVQILN  414

Query  1186  WEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKS  1007
             W++R++II+GTAEGLAYLHE   + IIHRDIK SNVLLDE  +PKIADFGLVR F  ++S
Sbjct  415   WKERFEIIVGTAEGLAYLHEGCAVRIIHRDIKSSNVLLDENLSPKIADFGLVRCFASEQS  474

Query  1006  HISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQAS--VSLLQQ  833
             HIST +AGT GYMAPEY++QG+LTEKADVYSFGVLV+E+VSG++NS+F   S   SLL +
Sbjct  475   HISTGIAGTFGYMAPEYLIQGQLTEKADVYSFGVLVLEIVSGQRNSTFRSESDPDSLLHR  534

Query  832   HWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQD  656
              W L+R+  L   VD  L E+    +A+  L+IGL+C QAS  LRPSM+ VV+M++ D++
Sbjct  535   VWKLYRSNXLAXVVDPCLGEDFPAGDASNVLRIGLLCTQASVALRPSMAEVVEMLT-DRE  593

Query  655   I----PQPTQPPFLTSNS  614
             I    P P QPPFL S +
Sbjct  594   IMAAVPSPKQPPFLNSTT  611



>emb|CDP13194.1| unnamed protein product [Coffea canephora]
Length=651

 Score =   520 bits (1339),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 281/625 (45%), Positives = 378/625 (60%), Gaps = 23/625 (4%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L L    +  + SV  PRA     +C ++   +     +V NFVA ++ ++  + SK +G
Sbjct  14    LILVAIMVLPDASVGAPRAQTVEFMCGHQL--EHNTTLFVPNFVATMENISDQMRSKGFG  71

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
              ++ G G  T Y   +C  DLS  DC LC+A+ +T + +C PF     GGR+F DGCF+R
Sbjct  72    VSITGKGPDTNYGLAQCYGDLSLLDCVLCYAEARTVLPQCFPFN----GGRIFLDGCFMR  127

Query  2065  YDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV---  1895
              ++Y FF E     D  VCG       S  F+  A   V +    A  ++G+  AA+   
Sbjct  128   AENYSFFQEFKGPQDHAVCGNRT--RKSSTFQEAARRAVLQAATGAPNSNGYARAALQVS  185

Query  1894  GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYD  1715
             G  N + Y LA CW+ +   SC  CL  A   I  CLP  EGR LN GC+MRYS   F +
Sbjct  186   GTSNESAYVLADCWKTLNANSCRACLENASKSILGCLPWSEGRALNTGCFMRYSDINFLN  245

Query  1714  NSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLV  1535
                IP + +S G    + V   ++    A   I+G+  F   KRI K+RK       ++ 
Sbjct  246   --PIPGSGRSRGTVVVIVVAAVSSAIVLAVGAIMGAY-FWKNKRIQKKRKGSNDAEKLVK  302

Query  1534  TVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWAD  1355
             T++ S LNF Y TLEKAT  FD++NKLGQGG G VYKGVLPDG+ +A+KRLFFN    A 
Sbjct  303   TLHDSSLNFKYSTLEKATGSFDEANKLGQGGFGTVYKGVLPDGREIAVKRLFFNNKHRAA  362

Query  1354  HFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQR  1175
              F+NEVN+IS + HKNLV+LLGCS +GPESLLVYEF+PN+SL  +       + L+WE+R
Sbjct  363   DFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEFLPNKSLDRFIFDANKGKALNWEKR  422

Query  1174  YKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHIST  995
             ++II+GTAEGL YLHE T+  IIHRDIK SN+LLD     KIADFGL R F EDKSHIST
Sbjct  423   FEIIIGTAEGLVYLHENTKCRIIHRDIKASNILLDSRLRSKIADFGLARSFQEDKSHIST  482

Query  994   AVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHWNL  821
             A+AGTLGYMAPEY+  G+LT+KADVYSFGVL++E+VSG++N  S   + S SL+   W  
Sbjct  483   AIAGTLGYMAPEYLAHGQLTDKADVYSFGVLLLEIVSGRQNNRSKTTEYSDSLVTIAWKH  542

Query  820   FRAGKLYEAVDGS------LEERARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS-GD  662
             F  GK+ E  D +      L    R E  R + IGL+C Q  P LRPSMS  +++++  D
Sbjct  543   FLQGKVEELFDPNLMLQNYLNMNVRAEVLRVVHIGLLCTQEIPSLRPSMSTALRILAKKD  602

Query  661   QDIPQPTQPPFLTSNSAASSGSYPN  587
             + +P PT PPF+  ++   + ++ N
Sbjct  603   EQLPTPTNPPFIDESTMELNDTFEN  627



>ref|XP_010251167.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Nelumbo 
nucifera]
Length=651

 Score =   519 bits (1336),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 276/624 (44%), Positives = 387/624 (62%), Gaps = 26/624 (4%)
 Frame = -2

Query  2443  ASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLV  2264
             A L  +LF F+  L +  +V DPR     + C ++   +    A+V NFVA ++ ++  +
Sbjct  7     APLLSFLFFFMVSLLLKATVGDPRTQTVKIFCGHQK--EHNTTAFVPNFVATMENISDQM  64

Query  2263  DSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFY  2084
              +  +G +V+G+G    +   +C  DLS  DC LC+A+ +T + +C P+     GGR+F 
Sbjct  65    RTTGFGTSVVGSGPDANFGLAQCYGDLSLLDCVLCYAEARTILPQCFPYN----GGRIFL  120

Query  2083  DGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFT  1904
             DGCF+R ++Y FF E +  +D+ VCG     G    F+ +A   + E    A  N G+  
Sbjct  121   DGCFMRAENYSFFQEFTGPNDQPVCGNATRMGQR--FQESARRAISEAVAAAPNNGGYAR  178

Query  1903  AAV---GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYS  1733
             AAV   G  N + Y LA C + +   SC  CL +A + +  CLP  EGR LN GC+MRYS
Sbjct  179   AAVPVSGSVNQSAYVLANCLKTLNASSCRACLDSASAFVTGCLPWSEGRALNTGCFMRYS  238

Query  1732  TKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVR-KRIVKQRKERK  1556
              K F ++ T   +  S G +  + V + ++    A  + +G+  +I R +RI K+R+   
Sbjct  239   DKDFLNSETTNGS--SKGNTVVMVVAILSSVAVVAVGVAIGT--YIWRHRRIQKKRRGSN  294

Query  1555  RLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFF  1376
                 +  T+N S LNF Y TLEKAT  FDD+NKLG GG G VYKGVLPDG+ +A+KRLFF
Sbjct  295   DAVKLAKTLNDSSLNFKYSTLEKATGSFDDANKLGHGGFGTVYKGVLPDGREIAVKRLFF  354

Query  1375  NTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQ  1196
             N    A  F+NEVN+IS + HKNLV+LLGCS +GPESLLVYEF+PN+SL  +       +
Sbjct  355   NNKHRAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEFLPNKSLDRFLFDSNRGK  414

Query  1195  PLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPE  1016
              L+WE+R++II+GT+EGL YLHE  ++ IIHRDIK SN+LLD +   KIADFGL R F E
Sbjct  415   ALNWEKRFEIIVGTSEGLVYLHENNKIRIIHRDIKASNILLDSKLRAKIADFGLARSFQE  474

Query  1015  DKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSL  842
             DKSHISTA+AGTLGYMAPEY+  G+LTEKADVYSFGVL++E+V+G++N  S   + S SL
Sbjct  475   DKSHISTAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIVTGRQNNRSKTSEYSDSL  534

Query  841   LQQHWNLFRAGKLYEAVDGSL-------EERARVEATRQLQIGLVCVQASPELRPSMS-A  686
             +   W  F+ G + +  D +L           + +  R + +GL+C Q  P LRPSMS A
Sbjct  535   VNSVWRKFQEGTVEDLFDPNLMLHNYDINSTIKKDILRVVHVGLLCTQEVPSLRPSMSKA  594

Query  685   VVKMISGDQDIPQPTQPPFLTSNS  614
             +  M+  D+D+P PT PPF+  N+
Sbjct  595   LHMMLKKDEDLPAPTNPPFIDENT  618



>ref|XP_010027454.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 isoform 
X1 [Eucalyptus grandis]
Length=680

 Score =   520 bits (1338),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 289/615 (47%), Positives = 386/615 (63%), Gaps = 41/615 (7%)
 Frame = -2

Query  2389  SVSDPRASEAALIC--TNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNAT  2216
             + SDPR + A L+C  +N T   +    + A     LD+    V  +++G   + +    
Sbjct  35    AASDPRIAVAGLLCGQSNGTVNGTVTPIFTAVMREILDS----VADRRWGNYSLASPPPA  90

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             VY   +C  DL +TDC LCFA+ +T+I RCLP       GRL+ +GCF+RYD Y F+NE+
Sbjct  91    VYGLAQCHGDLIETDCLLCFAESRTRIPRCLP-----NFGRLYLEGCFLRYDGYDFYNET  145

Query  2035  -SSLSDKTVCGAEDF--GGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--GRGNSTVY  1871
                  DK  C +           F      ++  +   A  N GF  A     +G + VY
Sbjct  146   VDPTHDKLNCSSNSTVPAERVAEFSYRVDRVLRNVSASAVQNGGFAVAGEDGAKGAAGVY  205

Query  1870  GLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATN  1691
              LAQCW  +    C  CL  AVSK  +C P  E R +NAGC++RYST KFY   ++P   
Sbjct  206   ALAQCWSTLDAGGCRVCLENAVSKARNCTPAGEARAMNAGCFLRYSTTKFY---SVPV--  260

Query  1690  QSGGRSN-HLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKL  1514
              SGG S   + V +A++  +   L+++G+  +I  K+  K++  R  L  +  +++KS L
Sbjct  261   -SGGPSRVRITVAIASSAAAAISLVLIGT--YIGYKKYSKEKLVRHSLMKLPASISKSSL  317

Query  1513  NFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVN  1334
              F YETLEKATD+F DS KLG+GG+G VYKG+LP+GK VA+KRL FNT QW D FFNEVN
Sbjct  318   YFKYETLEKATDFFHDSRKLGEGGAGSVYKGILPNGKVVAVKRLVFNTRQWVDDFFNEVN  377

Query  1333  LISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDY------------TSARKNH--Q  1196
             LI+GI HKNLV+LLGCSI GPESLLVYE++PN+SL               +SA  N    
Sbjct  378   LINGIQHKNLVRLLGCSIEGPESLLVYEYIPNRSLDQVLFVPGGPNKRIESSAAVNDATH  437

Query  1195  PLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPE  1016
              ++WE+R +I+ GTAEGLAYLH    + IIHRDIK SN+LLDE    KIADFGL R    
Sbjct  438   VMTWEERLRIVTGTAEGLAYLHGGCGVKIIHRDIKSSNILLDENLMAKIADFGLARCIAP  497

Query  1015  DKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQ  836
             DKSH+ST +AGTLGYMAPEY+V+G+LTEKADVY+FGVLV+E++SG+K+S F Q S S+LQ
Sbjct  498   DKSHLSTGIAGTLGYMAPEYLVRGQLTEKADVYAFGVLVLEILSGRKSSIFAQGSGSVLQ  557

Query  835   QHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI-SGD  662
               WN +++  L   VD +L  +  V EA+  LQI L+C QAS ELRP+MS VV+M+ S D
Sbjct  558   SVWNHYKSSNLAACVDPALRGKFPVQEASDVLQISLLCTQASMELRPTMSRVVEMLRSRD  617

Query  661   QDIPQPTQPPFLTSN  617
               +P+P QPPFL ++
Sbjct  618   HAVPEPKQPPFLNAS  632



>gb|KCW45208.1| hypothetical protein EUGRSUZ_L01155 [Eucalyptus grandis]
Length=621

 Score =   517 bits (1332),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 280/602 (47%), Positives = 375/602 (62%), Gaps = 34/602 (6%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             + SDPR + A L+C             +  F A +  +   V  +++G   + +    VY
Sbjct  26    AASDPRITIAGLLCGK------SNWTVIPIFTAVMREIFDSVADRRWGNYSLVSPPTAVY  79

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESS-  2033
                +C  DL++T+C  CF +  T+I RCLP       GRL+ DGCF+RYD Y F+NE+  
Sbjct  80    GLAQCHGDLNETECRHCFTKSLTRIPRCLP-----NFGRLYLDGCFLRYDGYDFYNETVD  134

Query  2032  ------SLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--GRGNST  1877
                   + S  ++  AE   G S    R    ++  +   A  N+GF  A      G + 
Sbjct  135   PTHDMLNCSSNSMVPAERAAGFSDRVER----VLKNVSASAVQNEGFAVAGEDGAEGAAG  190

Query  1876  VYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPA  1697
             VY LAQCW  +    C  CL  A SK  +C P  E R +NAGC++RYS  KFY+   +P 
Sbjct  191   VYALAQCWSTLDAGGCRVCLENAASKARNCTPAGEARAMNAGCFLRYSNTKFYN---VPV  247

Query  1696  TNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSK  1517
             +    G S  + + +A      A  L+L S A+I  K+  K+++ +  L  +  +++K +
Sbjct  248   S----GVSFEVRITIAIASSVTAISLVLIS-AYIGYKKYSKKKRVQNSLMQLRASMSKFR  302

Query  1516  LNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEV  1337
             L F YETLEKAT++FDDS KLGQGG G VYKG+LPD K VA+KRL FNT QW D  FNEV
Sbjct  303   LYFKYETLEKATNFFDDSRKLGQGGGGSVYKGILPDKKVVAVKRLVFNTRQWVDDLFNEV  362

Query  1336  NLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILG  1157
             NLISGI HKNLVKLLGCSI GPESLLVYE++ N+SL          + L+WE+R  II+G
Sbjct  363   NLISGIQHKNLVKLLGCSIEGPESLLVYEYLSNRSLDQVLLVNNATRVLTWEERLHIIIG  422

Query  1156  TAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTL  977
             TAEGLAYLH    + IIHRDIK SNVLLDE  T KIADFGL R    DKSH+ST +AGT+
Sbjct  423   TAEGLAYLHGGCGVKIIHRDIKASNVLLDENLTAKIADFGLARCIALDKSHLSTGIAGTI  482

Query  976   GYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYE  797
             GYMAPEY+++G+LTEKADVY+FGVLV+E+++G+KNS + + S S+LQ  W  +++  L  
Sbjct  483   GYMAPEYLMRGQLTEKADVYAFGVLVLEILTGRKNSVYTRGSSSVLQSVWKHYKSNNLAA  542

Query  796   AVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI-SGDQDIPQPTQPPFLT  623
              +D +L+ +  V EA+  LQIGL+C QAS ELRP MS VV+M+ + DQ +PQP QPPFL 
Sbjct  543   CIDPALQGKFPVLEASNVLQIGLLCTQASMELRPPMSGVVEMLHNKDQVVPQPNQPPFLN  602

Query  622   SN  617
             ++
Sbjct  603   AS  604



>ref|XP_010045537.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
Length=589

 Score =   516 bits (1329),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 281/597 (47%), Positives = 377/597 (63%), Gaps = 52/597 (9%)
 Frame = -2

Query  2386  VSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYA  2207
             VSDPR ++  LIC N T  +      + NF A +  ++  V ++++    +      VY 
Sbjct  26    VSDPRIAQVGLICENATVAEKG----IHNFNAVVREISKSVANQRWSNYSVAKPPPAVYG  81

Query  2206  FGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSL  2027
               +C  DL + +C LCFA+ +  IL C P       GRL+ DGCF+RYD Y F+NE    
Sbjct  82    LAQCHGDLIEAECFLCFAESRPWILPCFP-----NFGRLYMDGCFLRYDVYDFYNE----  132

Query  2026  SDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTA---AVGRGNSTVYGLAQC  1856
                TV    D                     KA  N GF  A   AVG G + VY LAQC
Sbjct  133   ---TVDPTRDM-------------------LKAVRNKGFAVAGEDAVG-GVAGVYALAQC  169

Query  1855  WEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGR  1676
             W  +    C  CL  A S+  SC P+EE R +NAGC++RYST KFY+   +P    SGG 
Sbjct  170   WSTLDAGGCRVCLENATSRARSCAPREEARAMNAGCFLRYSTTKFYN---VPV---SGGS  223

Query  1675  SN-HLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYE  1499
             S   + + + ++  +   L+++G  A+I  K+  K+++ +  L  +  + +K  L F Y+
Sbjct  224   SRVRITIAITSSAAATTSLVLIG--AYIGYKKYSKKKQVQNNLMQLRASKSKFSLYFKYK  281

Query  1498  TLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGI  1319
             TLEKAT++FDDS KLGQGG G VYKG+LPDGK VA+KRL FNT QWAD FFNEVNLISGI
Sbjct  282   TLEKATNFFDDSRKLGQGGGGSVYKGILPDGKVVAVKRLVFNTCQWADDFFNEVNLISGI  341

Query  1318  HHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP-LSWEQRYKIILGTAEGL  1142
              HKNL++LLGCSI GPESLLVYE+ P +SL D      +  P L+WE+R  II+GTAEGL
Sbjct  342   RHKNLMRLLGCSIEGPESLLVYEYFPKRSL-DLVLFVNDATPILTWEERLHIIIGTAEGL  400

Query  1141  AYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAP  962
             AYLH    + IIHRDIK SN+LLDE  T KI+DFGL R    DKSH+ST +AGTLGYMAP
Sbjct  401   AYLHGGCGVKIIHRDIKTSNILLDENLTAKISDFGLARCIALDKSHLSTGIAGTLGYMAP  460

Query  961   EYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGS  782
             EY+++G+LTEKADVY+FGVLV+E++SG+KNS + + S S+LQ  W  +++  L   +D +
Sbjct  461   EYLMRGQLTEKADVYAFGVLVLEILSGRKNSVYIRGSSSVLQSVWKHYKSNNLAACIDPA  520

Query  781   LEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI-SGDQDIPQPTQPPFLTSN  617
             L+ +  + EA+  LQIGL+C QA  ELRP MS VV+M+   ++ +PQP+QPPF+ ++
Sbjct  521   LQGKFPILEASNVLQIGLLCTQAYMELRPPMSGVVEMLHDKNRVVPQPSQPPFVNAS  577



>ref|XP_002265829.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Vitis 
vinifera]
Length=654

 Score =   518 bits (1333),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 276/632 (44%), Positives = 382/632 (60%), Gaps = 33/632 (5%)
 Frame = -2

Query  2425  LFLFIFFLS-INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKY  2249
             LFLFI  LS I  S  DPR+    + C N+  P+     +V NFVA ++ ++  V +  +
Sbjct  16    LFLFIITLSVIELSAGDPRSRMIQITCANQ--PEHNSTIFVPNFVAMMENISNQVRTSGF  73

Query  2248  GETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFV  2069
             G  + G+G    Y   +C  DLS  DC LC+A+ +T + +C P+     GGR++ DGCF+
Sbjct  74    GVAISGSGPDANYGLAQCYGDLSLLDCVLCYAEARTVLPQCFPYN----GGRIYLDGCFM  129

Query  2068  RYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--  1895
             R  +Y F  E +  SD  +CG E    ++  F+ +A   + +    A  N+G+  + V  
Sbjct  130   RAQNYSFIEEYTGPSDHALCGNETRKNST--FQESARQAIKQAVADAPNNNGYARSKVIV  187

Query  1894  -GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFY  1718
              G  N + Y LA CW  +   SC  CL  A S I  CLP  EGR LN GC+MRYS   F 
Sbjct  188   PGTANESAYVLADCWRTLNASSCRACLENASSSILGCLPWSEGRALNTGCFMRYSDTDFL  247

Query  1717  DNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIV--RKRIVKQRKERKRLGA  1544
             +         +G     + +I+     +   LL+LG++   +  +++I K+R+       
Sbjct  248   NKEP-----DNGSSRGTVIIIVVPAVSAVIVLLVLGAIGVYIWKQRKIQKKRRGSNDAIK  302

Query  1543  MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQ  1364
             ++ T++ S LNF Y TLEKAT  FD+ NKLGQGG G VYKGVL DG+ +A+KRLFFN   
Sbjct  303   LVKTLHDSSLNFKYATLEKATGSFDNENKLGQGGFGTVYKGVLTDGREIAVKRLFFNNRH  362

Query  1363  WADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSW  1184
              A  F+NEVN+IS + HKNLV+LLGCS +GPESLLVYE++PN+SL  +       + L+W
Sbjct  363   RAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEYLPNKSLDRFIFDTNRGKALNW  422

Query  1183  EQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSH  1004
             E+R +II+GTAEGLAYLHE +   IIHRDIK SN+LLD +   KIADFGL R F EDKSH
Sbjct  423   EKRCEIIIGTAEGLAYLHENSTNRIIHRDIKASNILLDSKMRAKIADFGLARSFQEDKSH  482

Query  1003  ISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQH  830
             I+TA+AGTLGYMAPEY+  G+LTEK DVYSFGVL++E+V+G++N  S   + S S++   
Sbjct  483   ITTAIAGTLGYMAPEYLAHGQLTEKVDVYSFGVLLLEIVTGRQNNRSKTSEYSDSIVTIA  542

Query  829   WNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS  668
             W  F+ G L E  D +L          + E  R +QI L+C Q +P LRPSMS  ++M++
Sbjct  543   WKHFQLGTLEELFDPNLMLHNYHNGNIKNEVLRVMQIALLCTQEAPSLRPSMSKALQMLT  602

Query  667   -GDQDIPQPTQPPFLTS-----NSAASSGSYP  590
               D+ +P PT PPF+       N A ++ SYP
Sbjct  603   KKDEHLPTPTNPPFIDERTMELNEACANPSYP  634



>ref|XP_010029936.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
 gb|KCW83621.1| hypothetical protein EUGRSUZ_B00516 [Eucalyptus grandis]
Length=620

 Score =   516 bits (1329),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 293/628 (47%), Positives = 399/628 (64%), Gaps = 42/628 (7%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L L  FF S+  +VS+PR +EA  IC N T   +     V+N +AA+  ++  + ++ +G
Sbjct  15    LALSSFFFSL--AVSNPRITEAGRICENFTGIVAGN--VVSNGIAAMSEVSDSIAAQGWG  70

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
             +  + +    +Y   +C  DL++T+C LCF +  T+I RCLP       GRL+ DGCF+R
Sbjct  71    KYSLASPPPAMYFLTQCHGDLTETECLLCFTESWTRITRCLP-----SFGRLYLDGCFLR  125

Query  2065  YDDYVFFNE-----------SSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAAN  1919
             Y  Y F+NE           SS+L+      AE       + R  +A+ V   G   A  
Sbjct  126   YGSYDFYNETVDPTRDMLKCSSNLTAPAERVAELSDRVDRVLRNVSASAVRNKGFAVAGE  185

Query  1918  DGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMR  1739
             DG     VG G + VY LAQCW  +   SC  CL  A S   SC P+EE R +NAGC++R
Sbjct  186   DG-----VG-GVAGVYALAQCWSTLDAGSCRFCLENATSMARSCAPREEARAMNAGCFLR  239

Query  1738  YSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKER  1559
             YST KFYD   +P    SGG S     I  T+  + A  L+L   A+I  K+  ++++ +
Sbjct  240   YSTTKFYD---VP---DSGGSSRVRITIAITSSATAATSLVLIG-AYIGYKKYSEKKQMQ  292

Query  1558  KRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLF  1379
               L  +  + +K  L F Y+TLEKAT++FDDS KLGQGG G VYKG+LPDGK VA+KRL 
Sbjct  293   NNLMQLRASKSKFSLYFKYKTLEKATNFFDDSRKLGQGGGGSVYKGILPDGKIVAVKRLV  352

Query  1378  FNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNH  1199
             FNT QWAD FFNEVNLISGI HKNL+++LGCSI GPESLLVYE++P +SL D      + 
Sbjct  353   FNTCQWADDFFNEVNLISGIRHKNLMRILGCSIEGPESLLVYEYLPKRSL-DLVLFVNDA  411

Query  1198  QP-LSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLF  1022
              P L+WE+R  II+GTAEGLAYLH    + IIHRDIK +N+LLD+  T KI+DFGL R  
Sbjct  412   TPVLTWEERLHIIIGTAEGLAYLHGGCGVKIIHRDIKTNNILLDKNLTAKISDFGLARCI  471

Query  1021  PEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSL  842
               DKSH+ST +AGTLGYMAPEY+++G LTEKADVY+FGVLV+E++SG+KNS + + S S+
Sbjct  472   ALDKSHLSTGIAGTLGYMAPEYLMRGHLTEKADVYAFGVLVLEILSGRKNSVYTRGSSSV  531

Query  841   LQQHWNLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG  665
             LQ  W  +++  L   +D +L+ +   +E ++ LQI L+C QA  ELRP MS VV+M+  
Sbjct  532   LQLVWKHYKSNNLAACIDSALQGKFPMLEVSKVLQISLLCTQAYMELRPPMSGVVEMLH-  590

Query  664   DQD--IPQPTQPPFLTSN---SAASSGS  596
             D++  +PQP+QPPF+ ++     +SSGS
Sbjct  591   DKNCVLPQPSQPPFVNASLMFDTSSSGS  618



>ref|XP_010040445.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
Length=631

 Score =   516 bits (1330),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 283/606 (47%), Positives = 375/606 (62%), Gaps = 41/606 (7%)
 Frame = -2

Query  2389  SVSDPRASEAALIC--TNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNAT  2216
             + SDPR + A L+C  +N T         +  F A +  +   V  +++G   + +    
Sbjct  35    AASDPRITIAGLLCGKSNWTV--------IPIFTAVMREIFDSVADRRWGNYSLVSPPTA  86

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             VY   +C  DL++T+C  CF +  T+I RCLP       GRL+ DGCF+RYD Y F+NE+
Sbjct  87    VYGLAQCHGDLNETECRHCFTKSLTRIPRCLP-----NFGRLYLDGCFLRYDGYDFYNET  141

Query  2035  S-------SLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--GRGN  1883
                     + S  ++  AE   G S    R    ++  +   A  N+GF  A      G 
Sbjct  142   VDPTHDMLNCSSNSMVPAERAAGFSDRVER----VLKNVSASAVQNEGFAVAGEDGAEGA  197

Query  1882  STVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTI  1703
             + VY LAQCW  +    C  CL  A SK  +C P  E R +NAGC++RYS  KFY     
Sbjct  198   AGVYALAQCWSTLDAGGCRVCLENAASKARNCTPAGEARAMNAGCFLRYSNTKFY-----  252

Query  1702  PATNQSGGRSNHLPVILATTFGS--FAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTV  1529
                N+ G R     V +     S   A  L+L S A+I  K+  K+++ +  L  +  ++
Sbjct  253   ---NEEGERKKSFEVRITIAIASSVTAISLVLIS-AYIGYKKYSKKKRVQNSLMQLRASM  308

Query  1528  NKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHF  1349
             +K +L F YETLEKAT++FDDS KLGQGG G VYKG+LPD K VA+KRL FNT QW D  
Sbjct  309   SKFRLYFKYETLEKATNFFDDSRKLGQGGGGSVYKGILPDKKVVAVKRLVFNTRQWVDDL  368

Query  1348  FNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYK  1169
             FNEVNLISGI HKNLVKLLGCSI GPESLLVYE++ N+SL          + L+WE+R  
Sbjct  369   FNEVNLISGIQHKNLVKLLGCSIEGPESLLVYEYLSNRSLDQVLLVNNATRVLTWEERLH  428

Query  1168  IILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAV  989
             II+GTAEGLAYLH    + IIHRDIK SNVLLDE  T KIADFGL R    DKSH+ST +
Sbjct  429   IIIGTAEGLAYLHGGCGVKIIHRDIKASNVLLDENLTAKIADFGLARCIALDKSHLSTGI  488

Query  988   AGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAG  809
             AGT+GYMAPEY+++G+LTEKADVY+FGVLV+E+++G+KNS + + S S+LQ  W  +++ 
Sbjct  489   AGTIGYMAPEYLMRGQLTEKADVYAFGVLVLEILTGRKNSVYTRGSSSVLQSVWKHYKSN  548

Query  808   KLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI-SGDQDIPQPTQP  635
              L   +D +L+ +  V EA+  LQIGL+C QAS ELRP MS VV+M+ + DQ +PQP QP
Sbjct  549   NLAACIDPALQGKFPVLEASNVLQIGLLCTQASMELRPPMSGVVEMLHNKDQVVPQPNQP  608

Query  634   PFLTSN  617
             PFL ++
Sbjct  609   PFLNAS  614



>ref|XP_010045441.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
 gb|KCW83345.1| hypothetical protein EUGRSUZ_B00279 [Eucalyptus grandis]
Length=624

 Score =   516 bits (1329),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 284/615 (46%), Positives = 387/615 (63%), Gaps = 29/615 (5%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L L  FF S+  +VSDPR +EA LIC N T   +     +   +A ++ ++  + ++ +G
Sbjct  15    LALSSFFFSL--AVSDPRITEAGLICENSTWIVTGNLVSIG--IAIMNKVSDSIAARGWG  70

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
             +  + +    VY   +C  DL++T+C LCF +   +I RCLP       GRL+ DGCF+R
Sbjct  71    KYSLASPLPAVYGLAQCHGDLTETECRLCFTESWPRIARCLP-----NFGRLYLDGCFLR  125

Query  2065  YDDYVFFNES-SSLSDKTVCG------AEDFGGNSGLFRRNAAALVGELGRKAAANDGFF  1907
             Y  Y F+NE+     D   C       AE       + R  +A+ V   G   A  DG  
Sbjct  126   YGSYDFYNETVDPTHDMHKCSSNLTVLAELSDRVDRVLRNVSASAVRNKGFAVAGEDG--  183

Query  1906  TAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTK  1727
                VG G + VY LAQCW  +    C  CL  A S   SC P EE RV+NAGC++RYST 
Sbjct  184   ---VG-GVAGVYALAQCWSTLDAGGCRVCLENATSMARSCAPGEEARVMNAGCFLRYSTT  239

Query  1726  KFYD--NSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKR  1553
             KFY+  +S       SGG S+ + + +A T  + A   ++   A+I  K+  K+++ +  
Sbjct  240   KFYNVPSSKFYIVPGSGG-SSRVRITIAITSSAIAATSLVLIGAYIGYKKYSKKKQMQNN  298

Query  1552  LGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFN  1373
             L  +  + +K  L F YETLEKAT++FDDS KLGQGG G VYKG+LPDGK +A+KRL FN
Sbjct  299   LMQLRASKSKFSLYFKYETLEKATNFFDDSRKLGQGGGGSVYKGILPDGKVIAVKRLVFN  358

Query  1372  TTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP  1193
             T QW D FFNEVNLISGI HKNL++LLGCSI GPESLLVYE++P +SL D      +  P
Sbjct  359   TCQWVDDFFNEVNLISGIQHKNLMRLLGCSIEGPESLLVYEYLPKRSL-DLVLFVNDATP  417

Query  1192  -LSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPE  1016
              L+WE+R  II+GTAEGLAYLH    + IIHRDIK SN+LLDE  T KI+DFGL R    
Sbjct  418   VLTWEERLHIIIGTAEGLAYLHGGCGVKIIHRDIKTSNILLDENLTAKISDFGLARCIAL  477

Query  1015  DKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQ  836
             DKSH+ST +AGTLGYMAPEY+++G LTEKADVY+FGV+V+E++SG+KNS + + S S+L 
Sbjct  478   DKSHLSTGIAGTLGYMAPEYIMRGLLTEKADVYAFGVMVLEILSGRKNSVYARGSSSVLH  537

Query  835   QHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI-SGD  662
               W  +++  L   +D +L+ +  + EA+  LQI L+C Q   ELRP MS VV+M+   +
Sbjct  538   SVWKHYKSNNLAACIDPALQGKFPILEASNVLQISLLCTQTCMELRPPMSGVVEMLHDKN  597

Query  661   QDIPQPTQPPFLTSN  617
             + +PQP+QPPF+ ++
Sbjct  598   RVVPQPSQPPFVNAS  612



>ref|XP_008393012.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Malus 
domestica]
Length=641

 Score =   516 bits (1330),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 273/613 (45%), Positives = 376/613 (61%), Gaps = 26/613 (4%)
 Frame = -2

Query  2428  WLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKY  2249
             ++FL       + SVS PR SEA   C +     +    ++ NFV  ++ ++  V++K++
Sbjct  13    YIFLIFSAFFFSPSVSHPRISEAGRFCGH--GKHNSSSNFIPNFVNVMNFISNNVNAKRW  70

Query  2248  GETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFV  2069
             GE +I +    VYA  +C  DLS T+C+ CFA  +T++  CLP        R++ DGCF+
Sbjct  71    GEYIIASPAPEVYALAQCYDDLSPTECSACFAVSRTKLPLCLP----STSARIYLDGCFL  126

Query  2068  RYDDYVFFNESSSLSDKTV-CGAEDFGGN---SGLFRRNAAALVGELGRKAAANDGFFTA  1901
              YDD+ F +++     K V C +     +   +  F R    ++  +   A ++ GF   
Sbjct  127   GYDDHEFSHQAVDDEYKNVKCVSSRIDASKFRTKEFARKVEGVIRNVTELAVSHGGFGVF  186

Query  1900  AVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKF  1721
                 G  +VY LAQCW+ +    C +CL  A + +  C+P  EGR + AGC++RYS + F
Sbjct  187   GKRGGVESVYALAQCWKTINASGCRECLEEAGASLVGCVPGVEGRAMFAGCFLRYSNENF  246

Query  1720  YDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAM  1541
             Y            G ++ +   +AT   + A  L+     F+  KR  K+ +       +
Sbjct  247   Y--------GIEDGSNDSVRQTVATILIAMASSLLALFGVFMAYKRFYKRTEVYNNPIGV  298

Query  1540  LVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQW  1361
              ++++K+ LNF YE LEKATD+FD   KLGQGG+G V+KGVLPDG+TVA+KRL+FNT QW
Sbjct  299   SISIHKNNLNFKYEMLEKATDFFDALRKLGQGGAGSVFKGVLPDGRTVAVKRLYFNTRQW  358

Query  1360  ADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWE  1181
              D FFNEVNLISGIHHKNLV+LLGCSI GPESLLVYE+V N+SL          Q LSW+
Sbjct  359   VDEFFNEVNLISGIHHKNLVRLLGCSIEGPESLLVYEYVANKSLDQVLFGNDTRQILSWQ  418

Query  1180  QRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHI  1001
             QR+ II G AEGL YLHE   + IIHRDIK SN+LLDE   PKIADFGL R    DKSH+
Sbjct  419   QRFDIICGIAEGLVYLHESCGVKIIHRDIKASNILLDENLIPKIADFGLARCVGPDKSHL  478

Query  1000  STAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNL  821
             ST +AGTLGYMAPEY+V+G+LT+KADVY+FGV+V+E+V GKKN  F + S S+L   W  
Sbjct  479   STGIAGTLGYMAPEYLVRGQLTDKADVYAFGVMVLEIVCGKKNRVFVEGSSSVLYSVWKH  538

Query  820   FRAGKLYEAVD----GSLEERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQD-  656
             ++   + E VD    G   ER    A+  LQIGL+C QAS  +RPSM+ VV+M++ ++  
Sbjct  539   YKEKNITETVDPTLKGGFPERG---ASDVLQIGLMCTQASLAVRPSMAEVVRMLTDEKHV  595

Query  655   IPQPTQPPFLTSN  617
             IP P QPPF  ++
Sbjct  596   IPSPKQPPFXNAS  608



>ref|XP_006438315.1| hypothetical protein CICLE_v10030934mg [Citrus clementina]
 gb|ESR51555.1| hypothetical protein CICLE_v10030934mg [Citrus clementina]
Length=642

 Score =   516 bits (1329),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 278/619 (45%), Positives = 380/619 (61%), Gaps = 36/619 (6%)
 Frame = -2

Query  2428  WLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKY  2249
             +LFL    L + R   DPR     + C ++    S    +V NFV  ++ ++  + +  +
Sbjct  5     FLFLVGSLLMLVRVAGDPRVHTVNITCGHQLEHNSS--IFVPNFVTTMENISEQMRTSGF  62

Query  2248  GETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFV  2069
             G  V G+G    Y   +C  DLS  DC LC+A+ +T + +C P+     GGR++ DGCF+
Sbjct  63    GLAVTGSGLDINYGLAQCYGDLSLLDCVLCYAEARTLLPQCYPYN----GGRIYLDGCFM  118

Query  2068  RYDDYVFFNESSSLSDKTVCGAEDFGGNSGL-FRRNAAALVGELGRKAAANDGFFTAAV-  1895
             R ++Y FF E     D+ VCG    G    L F+ +A   V      A +N G+    V 
Sbjct  119   RSENYSFFGEYEGPEDRAVCGN---GTRKNLSFQESARKAVMRAVASAPSNGGYARVQVQ  175

Query  1894  --GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKF  1721
               G  N + Y L  CW+ +   SC+ CLA A + I  CLP  EGR LN GC+MRYS K F
Sbjct  176   VSGAANKSAYVLTNCWKTLNSSSCEACLANASASILGCLPWSEGRALNTGCFMRYSDKDF  235

Query  1720  YDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRK-ERKRLGA  1544
              +    P   +S G       ++A    S    L++ +V  ++  RI KQR  ERKR G+
Sbjct  236   LNKE--PGKGRSRG-------MIAAIVVSVVSALVVLAVGIVIGTRIWKQRSIERKRRGS  286

Query  1543  -----MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLF  1379
                  ++ T+N   LNF Y TLEKAT  FD++NKLGQGG G VYKGVLPDG+ +A+KRLF
Sbjct  287   NDAEKLVKTLNDDSLNFKYSTLEKATGSFDEANKLGQGGFGTVYKGVLPDGREIAVKRLF  346

Query  1378  FNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNH  1199
             FN    A +F+NEVN+IS + HKNLV+LLGCS +GPESLLVYEF+PNQSL  +       
Sbjct  347   FNNRHRAANFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEFLPNQSLDRFIFDSAKA  406

Query  1198  QPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFP  1019
             + L+WE+RY+IILGT EGL YLHE++++ IIHRDIK SN+LLD     KIADFGL R F 
Sbjct  407   KTLTWEKRYEIILGTVEGLVYLHEQSKIRIIHRDIKASNILLDSRLRAKIADFGLARSFQ  466

Query  1018  EDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVS  845
             EDKSHISTA+AGTLGYMAPEY+  G+LTEKADVYSFG+L++E+V+G++N  S   + + S
Sbjct  467   EDKSHISTAIAGTLGYMAPEYLAHGQLTEKADVYSFGMLLLEIVTGRQNNRSKNSEYTDS  526

Query  844   LLQQHWNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELRPSMSAV  683
             LL   W  F+AG + E  D +L      +   + E  R + +GL+  Q +P LRP+MS V
Sbjct  527   LLTITWKHFQAGTVEELYDKNLMLHNYHDSNVKYEVLRVIHVGLLSTQENPSLRPTMSRV  586

Query  682   VKMISGDQDIPQPTQPPFL  626
             ++M++ ++ +P PT PPF+
Sbjct  587   LQMLTTEEQLPGPTSPPFI  605



>ref|XP_006840433.1| hypothetical protein AMTR_s00045p00163010 [Amborella trichopoda]
 gb|ERN02108.1| hypothetical protein AMTR_s00045p00163010 [Amborella trichopoda]
Length=644

 Score =   516 bits (1328),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 286/631 (45%), Positives = 391/631 (62%), Gaps = 38/631 (6%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             + +F+  LS +    D +      +C N +A       +  NF+AA+++++  +    +G
Sbjct  9     VVIFLAILSASSLADDSQFPVIKRLCYNVSALDPA--TFDVNFIAAMESVSQQIARDGFG  66

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
              +V G     VY  G+C+  LS  DC LC+AQ +  +  CLP    V GGR++ DGCF+R
Sbjct  67    TSVSGNSTNRVYGLGQCLGYLSSIDCRLCYAQSRVSLPVCLP----VEGGRIYLDGCFLR  122

Query  2065  YDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRG  1886
             Y+++ F +E+    D  VC       N   FR     L G+L R  +  +G + A    G
Sbjct  123   YENWNFPSEAMDDKDTVVCDYSKNSSNPNDFRE----LAGKLVRNLSLGEGHYRAGRFDG  178

Query  1885  NS-TVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNS  1709
             +  TVYG+AQCW  +  ++C DCL +A + +  CLP +EGR LNAGC++RYST  FY   
Sbjct  179   SRMTVYGVAQCWRSLDSRACSDCLTSAANGVRGCLPAKEGRALNAGCFLRYSTSPFY---  235

Query  1708  TIPATNQSG-GRSNHLPVI-LATTFGS-FAFLLILGSVAFIVRKRIVK------QRKERK  1556
                   QSG GR + +    LA   GS FA  L++ SVA I+ +R  +         + +
Sbjct  236   ----LQQSGSGRGSIVTRHQLAVALGSIFAGALVI-SVAIILGRRRRRGRDSSFDSDDME  290

Query  1555  RLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFF  1376
                 ++  +++S L F YE L KAT  F+D+NKLGQGG G VYKGVL DG+ VA+KRLFF
Sbjct  291   GSSEIIKAISQSHLGFKYEDLRKATKNFEDANKLGQGGYGSVYKGVLSDGRVVAVKRLFF  350

Query  1375  NTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQ  1196
             NT QW D FFNEVNLIS + HKNLVKLLGCS+ GPESLLVYE++ N SL  +       +
Sbjct  351   NTRQWIDQFFNEVNLISRVQHKNLVKLLGCSVEGPESLLVYEYLSNSSLDRFLFDPFRRK  410

Query  1195  PLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPE  1016
              L W +R+ II+GTAEGLAYLH+ +E+ IIHRDIK SN+LLDE+F PKIADFGL R F E
Sbjct  411   LLDWRRRFDIIVGTAEGLAYLHDASEVRIIHRDIKASNILLDEKFRPKIADFGLARYFAE  470

Query  1015  DKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASV---S  845
             D+SH+ST +AGTLGYMAPEYV+ G+LTEKAD+YS+GVLV+E+V+G+KN++    SV   S
Sbjct  471   DQSHLSTGIAGTLGYMAPEYVIHGQLTEKADIYSYGVLVLEMVTGRKNNNSISTSVEGHS  530

Query  844   LLQQHWNLFRAGKLYEAVDGSLEERARVEA-TRQLQIGLVCVQASPELRPSMSAVVK-MI  671
             L+   W  + +  L E VD +++     E   R   +GL+C QASP LRP M  VV+ ++
Sbjct  531   LMSLIWKQYSSNTLLEIVDPNIQGLCSEEQLLRVFHVGLLCTQASPTLRPPMWKVVELLV  590

Query  670   SGDQDIPQPTQPPFL-----TSNSAASSGSY  593
             S  +++P PTQPPF+      SNS  S  SY
Sbjct  591   SMGKELPLPTQPPFIDVKGVESNSDGSETSY  621



>ref|XP_011071116.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Sesamum 
indicum]
 ref|XP_011071117.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Sesamum 
indicum]
 ref|XP_011071118.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Sesamum 
indicum]
 ref|XP_011071119.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Sesamum 
indicum]
 ref|XP_011071120.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Sesamum 
indicum]
Length=647

 Score =   516 bits (1328),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 277/623 (44%), Positives = 378/623 (61%), Gaps = 28/623 (4%)
 Frame = -2

Query  2458  MNRKMASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDA  2279
             M + + S S  + + +  L  +   +DPRA     IC   T  +     YV NFVA ++ 
Sbjct  2     MKKAITSPSIMIIVLVILLLPDSLFADPRAHTIKFICG--TQLEHNTTIYVPNFVATMEN  59

Query  2278  LTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRG  2099
             ++  + +  +G  V G+G  T Y   +C  DLS  DC LC+A+ +T + +C P    V G
Sbjct  60    ISAQIRNSGFGIAVTGSGPDTNYGLAQCYGDLSSVDCVLCYAEARTVLPQCYP----VNG  115

Query  2098  GRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAAN  1919
             GR++ DGCF+R ++Y FF E +   D  VCG      ++  F+ +    + ++   A  N
Sbjct  116   GRIYLDGCFMRAENYSFFQEYTGPGDHAVCGNRTRQDSA--FQASTRQALTQVVSAAPIN  173

Query  1918  DGFFTAAV---GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGC  1748
              G+  A V   G  N + Y LA CW+ +   +C  CL  A + I  CLP  EGR LN GC
Sbjct  174   KGYARAQVAVAGTSNQSAYVLADCWKTINANACRACLENASASILRCLPSSEGRALNTGC  233

Query  1747  YMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSV--AFIVRKRIVK  1574
             +MRYS   F +   IP    S GR     +++     S A +LI+G+V   ++ + R + 
Sbjct  234   FMRYSDTNFLN--PIPRNGNSRGRV----ILIVIAAVSAAAVLIIGAVIGVYLWKSRTI-  286

Query  1573  QRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVA  1394
             Q+K +     ++ T+N S LNF Y TLEKAT  FD++NKLGQGG G VYKGVLPDG+ +A
Sbjct  287   QKKRKGDAEKLVKTLNDSSLNFKYSTLEKATGSFDEANKLGQGGFGTVYKGVLPDGREIA  346

Query  1393  IKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTS  1214
             +KRLFFN    A  F+NEVN+IS + HKNLV+LLGCS +GPESLLVYEF+PN SL  +  
Sbjct  347   VKRLFFNNRHRAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEFMPNMSLDRFIF  406

Query  1213  ARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGL  1034
                  + L+WE+R++II+GTAEGL YLHE T++ IIHRDIK SN+LLD     KIADFGL
Sbjct  407   DSSKGKALNWEKRFEIIIGTAEGLVYLHENTKIRIIHRDIKASNILLDSRLRAKIADFGL  466

Query  1033  VRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFY  860
              R F EDKSHISTA+AGTLGYMAPEY+  G+LTEKADVYSFGVL+IE+V+G+ N  S   
Sbjct  467   ARTFQEDKSHISTAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLIEIVTGRSNNRSKTT  526

Query  859   QASVSLLQQHWNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELRP  698
             + S SL+   W  F+   + E  D +L          R E  R + +GL+C Q  P LRP
Sbjct  527   EYSDSLVTIAWTHFQQRTVEELFDPNLMLHNYHNVNIRNEILRVVHVGLLCTQEIPSLRP  586

Query  697   SMSAVVKMISGDQDIPQPTQPPF  629
             SMS  ++M+  ++++P PT PPF
Sbjct  587   SMSKALRMLVKNENLPAPTSPPF  609



>ref|XP_010045541.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Eucalyptus 
grandis]
Length=618

 Score =   513 bits (1322),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 289/616 (47%), Positives = 383/616 (62%), Gaps = 37/616 (6%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L L  FF S+  +VSDPR +EA LIC N  +P       V+N +A L+ ++  + ++++G
Sbjct  15    LALSSFFFSL--AVSDPRITEAGLICEN--SPWIVTGNVVSNLIATLNEISDRIAAQRWG  70

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
             +  + +    VY   +C  DL +T+C LCF +   QI RCLP       GRL+ DGCF+R
Sbjct  71    KYSLASPPPAVYGLTQCHGDLIETECRLCFTESWIQIARCLP-----NFGRLYLDGCFLR  125

Query  2065  YDDYVFFNE-----------SSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAAN  1919
             Y  Y F+NE           SS+L+      AE       + R  +A+ V   G   A  
Sbjct  126   YGSYDFYNETVDPTHDMLKCSSNLTVPAERVAEFSDRVDRVLRNISASAVRNKGFAVAGE  185

Query  1918  DGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMR  1739
             DG       RG + VY  AQCW  +   SC  CL  A S   SC P EE R +NAGC++R
Sbjct  186   DGV------RGVAGVYAFAQCWSTLDAGSCRVCLENATSMARSCAPGEEARAMNAGCFLR  239

Query  1738  YSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKER  1559
             YST KFYD   +P    SGG S     I  T+  + A  L+L   A+I  K+  K  K++
Sbjct  240   YSTTKFYD---VP---DSGGSSRVRITIAITSSAAAATSLVLIG-AYIGYKKYSK--KKQ  290

Query  1558  KRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLF  1379
               L  +  +  K  L F Y+TLEKAT++FDDS KLGQGG G VYKG+LPDGK VA+KRL 
Sbjct  291   NNLMQLRASKTKFSLYFKYKTLEKATNFFDDSRKLGQGGGGSVYKGILPDGKVVAVKRLV  350

Query  1378  FNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNH  1199
             FNT QWAD FFNEVNLISG+ HKNL+++LGCSI GPESL+VYE++P +SL          
Sbjct  351   FNTCQWADDFFNEVNLISGMRHKNLMRILGCSIEGPESLIVYEYLPKRSLDLVLFVNDTT  410

Query  1198  QPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFP  1019
               L+WE+R  II+G AEGLAYLH    + IIHRDIK SN+LLDE  T KI DFGL R   
Sbjct  411   PVLTWEERLHIIIGIAEGLAYLHGGCGVKIIHRDIKSSNILLDENLTAKILDFGLARCIA  470

Query  1018  EDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLL  839
              DKSH+ST +AGTLGYMAPEY+++G+LTEKADVY+FGVLV+E++SG+KNS + + S S+L
Sbjct  471   LDKSHLSTGIAGTLGYMAPEYIMRGQLTEKADVYAFGVLVLEILSGRKNSVYTRGSSSVL  530

Query  838   QQHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI-SG  665
             Q  W  +++  L    D +L+ +  + EA+  LQI L+C QA  ELRP MS VV+M+   
Sbjct  531   QSVWKHYKSNNLAACSDPALQGKFPILEASNVLQISLLCTQACMELRPPMSRVVEMLHDK  590

Query  664   DQDIPQPTQPPFLTSN  617
             ++ +PQP+QPPF+ ++
Sbjct  591   NRVVPQPSQPPFVNAS  606



>ref|XP_010045527.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
 gb|KCW83331.1| hypothetical protein EUGRSUZ_B00259 [Eucalyptus grandis]
Length=637

 Score =   513 bits (1321),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 282/626 (45%), Positives = 390/626 (62%), Gaps = 30/626 (5%)
 Frame = -2

Query  2452  RKMASLSKWLFLFIFFLS--INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDA  2279
             R   ++S +  L +  LS   + + SDPR +EA  IC +     +++   + N++A +  
Sbjct  11    RSSTTISTYFALPLLALSSFFSLATSDPRITEAGFICGSSNGLLTEK--VIPNYIAIMRE  68

Query  2278  LTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRG  2099
             ++  V  +++G+  + +    +Y   +C  DL + DC LC A  ++++  C+P       
Sbjct  69    ISESVADQRWGKYSLASPPPALYGLAQCYGDLFENDCLLCHALSRSRLYGCVP-----NF  123

Query  2098  GRLFYDGCFVRYDDYVFFNES-SSLSDKTVCGAE-----DFGGNSGLFRRNAAALVGELG  1937
             GRL+ DGCF+RYD Y F+NE+     D   C +      D       F      ++  + 
Sbjct  124   GRLYLDGCFLRYDGYDFYNETVDPTHDMLKCSSNSTVPADQRERVAEFSDRVDRVLRNVS  183

Query  1936  RKAAANDGFFTAA---VGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGR  1766
               A  N+GF  A    VG G + VY LAQCW  V    C  CL  A SK  SC P EE R
Sbjct  184   ASAVQNEGFAVAGEDGVG-GVAGVYALAQCWSTVDAGGCSVCLENATSKARSCAPGEEAR  242

Query  1765  VLNAGCYMRYSTKKFYDNSTIPATNQSGGRSN-HLPVILATTFGSFAFLLILGSVAFIVR  1589
              +NAGC++RYST KFY+   IP    +GG S   + + +A++  +   L+++G  A+I  
Sbjct  243   AMNAGCFLRYSTTKFYN---IPV---NGGSSRVRITIAIASSAAAVTSLVLIG--AYIGY  294

Query  1588  KRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPD  1409
             K+  K+++    L  + +TV+K  L F YETLEKAT++FDDS KLGQGG G VYKG LP+
Sbjct  295   KKYFKKKRVHHSLTQLPMTVSKFSLYFKYETLEKATNFFDDSRKLGQGGGGSVYKGNLPN  354

Query  1408  GKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSL  1229
             GK VA+KRL FNT QW D+FFNEVNLI+GI HKNLVKLLGCSI GPESLL+YE++PN SL
Sbjct  355   GKVVAVKRLVFNTLQWVDNFFNEVNLINGIRHKNLVKLLGCSIEGPESLLIYEYLPNGSL  414

Query  1228  YDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKI  1049
                  +      L+WE R  II G+AEGLA+LH    + IIHRDIK SNVLLD+  T KI
Sbjct  415   DQVLFSDTETHVLTWEARLHIITGSAEGLAHLHGGCGVKIIHRDIKASNVLLDKNLTAKI  474

Query  1048  ADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNS  869
             ADFGL R    D+SH+ST +AGTLGYMAPEY+++G+LTEKADVY+FGVLV+E++SGKKNS
Sbjct  475   ADFGLARCIAPDESHLSTGIAGTLGYMAPEYLMRGQLTEKADVYAFGVLVLEILSGKKNS  534

Query  868   SFYQASVSLLQQHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSM  692
             ++ Q S S+L   W  +++  L   +D +L  +  V E +R LQI L+C QA  ELRP M
Sbjct  535   TYTQGSSSVLNSVWKHYKSNNLAACIDPALRGKFPVLEVSRLLQISLLCTQACMELRPPM  594

Query  691   SAVVKMISG-DQDIPQPTQPPFLTSN  617
             S V++M+   D+ +PQP QPPF+ ++
Sbjct  595   SEVIEMLHDKDRVVPQPNQPPFVNAS  620



>ref|NP_001238666.1| protein kinase family protein [Glycine max]
 gb|ACM89504.1| protein kinase family protein [Glycine max]
Length=392

 Score =   503 bits (1295),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 255/365 (70%), Positives = 302/365 (83%), Gaps = 5/365 (1%)
 Frame = -2

Query  1591  RKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLP  1412
             RK +V +R+ER++ GA+L TVNKSKLN  YE LEKAT+YF+++NKLGQGGSG VYKGV+P
Sbjct  32    RKNVVTRRRERRQFGALLATVNKSKLNMPYEVLEKATNYFNEANKLGQGGSGSVYKGVMP  91

Query  1411  DGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQS  1232
             DG TVAIKRL +NTTQWA+HFF EVNLISGIHHKNLVKLLGCSITGPESLLVYE+VPNQS
Sbjct  92    DGNTVAIKRLSYNTTQWAEHFFTEVNLISGIHHKNLVKLLGCSITGPESLLVYEYVPNQS  151

Query  1231  LYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPK  1052
             L+D+ S R+  QPL+WE R KIILG AEG+AYLHEE+ + IIHRDIKLSN+LL+E+FTPK
Sbjct  152   LHDHFSVRRTSQPLTWEMRQKIILGIAEGMAYLHEESHVRIIHRDIKLSNILLEEDFTPK  211

Query  1051  IADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN  872
             IADFGL RLFPEDKSHISTA+AGTLGYMAPEY+V+GKLTEKADVYSFGVLVIE+VSGKK 
Sbjct  212   IADFGLARLFPEDKSHISTAIAGTLGYMAPEYIVRGKLTEKADVYSFGVLVIEIVSGKKI  271

Query  871   SSFYQASVSLLQQHWNLFRAGKLYEAVDGSLE-ERARVEATRQLQIGLVCVQASPELRPS  695
             SS+   S SLLQ  W+L+ + +LYE VD +LE      EA + LQIGL+C QAS ELRPS
Sbjct  272   SSYIMNSSSLLQTVWSLYGSNRLYEVVDPTLEGAFPAEEACQLLQIGLLCAQASAELRPS  331

Query  694   MSAVVKMISGDQDIPQPTQPPFLTSNSAASSGSYPNRGGvtpysqpssstqssVNTMTES  515
             MS VVKM++ + +IPQP QPPF+ S+S+  S S    G      QP S+TQSS NT++ES
Sbjct  332   MSVVVKMVNNNHEIPQPAQPPFINSSSSEFSKS----GLPGYNFQPGSNTQSSGNTISES  387

Query  514   WIDPR  500
              I+PR
Sbjct  388   QIEPR  392



>ref|XP_006477547.1| PREDICTED: cysteine-rich receptor-like protein kinase 1-like 
[Citrus sinensis]
Length=629

 Score =   512 bits (1318),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 270/544 (50%), Positives = 356/544 (65%), Gaps = 19/544 (3%)
 Frame = -2

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             VYA+ +C +DLSQTDC  CF+  K +  RCLP        R+F DGCF+RYD+Y FF E+
Sbjct  66    VYAYMQCHEDLSQTDCESCFSALKQKANRCLPSD----SARIFLDGCFLRYDNYDFFGEA  121

Query  2035  -SSLSDKTVCGAEDFGGNS--GLFRRNAAALVGELGRKAAANDGFFTAAVGRGN-STVYG  1868
                + DK  C A      S    F      ++  +     +N G F    G+G  +TVY 
Sbjct  122   VDPIHDKFNCSARHLDDESLSKQFEEKVIEVITNVTIVTKSN-GRFGQVEGKGGIATVYA  180

Query  1867  LAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQ  1688
             LAQC +F+  K C  CL  A  ++  C    EGR + AGCY+R+ST++F++ +       
Sbjct  181   LAQCLKFLDNKGCSQCLDEAALRLKGCSKSGEGRAMFAGCYVRFSTERFFNPNYQKKETP  240

Query  1687  SGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNF  1508
              G + + L   +     +F FL  +G  A I  KR+ + RK +  LG +L T   S LNF
Sbjct  241   EGDKISKL---VMAGVCAFTFLSSIG--ACIGYKRLSEMRKGQVLLGTVLCT---SSLNF  292

Query  1507  SYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLI  1328
              YE LE+ATD+FD+S KLGQGG+G V++G LPDG+ +A+KRLFFN+ QW D FFNEVNLI
Sbjct  293   KYEILERATDFFDNSRKLGQGGAGSVFRGTLPDGRNIAVKRLFFNSRQWVDQFFNEVNLI  352

Query  1327  SGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAE  1148
             SGI HKN+V+LLGCSI GPESLLVYE+VPN+SL      +     LSW+QR+ II GTAE
Sbjct  353   SGIQHKNVVRLLGCSIEGPESLLVYEYVPNRSLDQILFVKNTIHILSWQQRFTIICGTAE  412

Query  1147  GLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYM  968
             GLA+LH  + + IIHRDIK SN+LLDE+ TPKIADFGL R    DK+H+ST +AGTLGYM
Sbjct  413   GLAHLHGGSGIKIIHRDIKTSNILLDEKLTPKIADFGLARHVAPDKTHVSTGIAGTLGYM  472

Query  967   APEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVD  788
             APEY+V+G+LTEKADVY+FGVLVIEV SG++NS F + S S+L   W  ++A ++ +++D
Sbjct  473   APEYLVRGQLTEKADVYAFGVLVIEVASGRRNSVFSEGSSSVLHTVWKHYKANRITQSMD  532

Query  787   GSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPFLTSNS  614
               L  R    EA+R LQIGL+C QA   LRPSM+ VV M++  D +IP P QPPFL ++ 
Sbjct  533   PGLTGRFPENEASRVLQIGLLCTQAPVALRPSMAEVVHMLNNIDYEIPPPKQPPFLNASV  592

Query  613   AASS  602
              + S
Sbjct  593   ISPS  596



>ref|XP_010045542.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
 gb|KCW83348.1| hypothetical protein EUGRSUZ_B00282 [Eucalyptus grandis]
Length=628

 Score =   512 bits (1318),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 283/620 (46%), Positives = 388/620 (63%), Gaps = 35/620 (6%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L L  FF S+  +VSDPR +EA LIC N T         +   +A +   +  + ++ +G
Sbjct  15    LALSSFFFSL--AVSDPRITEARLICQNSTWIVPGNVVSIG--IAIMSKFSYSIAAQGWG  70

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
             +  + +    VY   +C  DL++T+C LCF +   +I RCLP       GRL+ DGCF+R
Sbjct  71    KYSLASPLPAVYGLAQCHGDLTETECRLCFTESWPRIARCLP-----NFGRLYLDGCFLR  125

Query  2065  YDDYVFFNE-----------SSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAAN  1919
             Y  Y F+NE           SS+L+      AE       + R  +A+ V   G   A  
Sbjct  126   YGSYDFYNETVDPTHDMHKCSSNLTVPAEIMAELSDRVDRVLRNVSASAVRNKGFAVAGE  185

Query  1918  DGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMR  1739
             DG     VG G + VY LAQCW  +    C  CL  A S   SC P EE RV+NAGC++R
Sbjct  186   DG-----VG-GVAGVYALAQCWSTLDAGGCRVCLENATSMARSCAPGEEARVMNAGCFLR  239

Query  1738  YSTKKFYD--NSTIPATNQSGGRSN-HLPVILATTFGSFAFLLILGSVAFIVRKRIVKQR  1568
             YST KFY+  +S       SGG S   + + + ++  +   L+++G  A+I  K+  +++
Sbjct  240   YSTTKFYNVPSSKFYIVPGSGGSSRVRITIAIISSATAATSLVLIG--AYIGYKKYSEKK  297

Query  1567  KERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIK  1388
             + +  L  +  + +K  L F Y+TLEKAT++FDDS KLGQGG G VYKG+LPDGK VA+K
Sbjct  298   QMQNNLMQLRASKSKFSLYFKYKTLEKATNFFDDSRKLGQGGGGSVYKGILPDGKVVAVK  357

Query  1387  RLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSAR  1208
             RL FNT QWAD FFNEVNLISGI HKNL+++LGCSI GPESLLVYE++P +SL       
Sbjct  358   RLVFNTCQWADDFFNEVNLISGIRHKNLMRILGCSIEGPESLLVYEYLPKRSLDLVLFVN  417

Query  1207  KNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVR  1028
                  ++WE+R  II+GTAEGLAYLH    + IIHRDIK SN+LLDE  T KI+DFGL R
Sbjct  418   DATTVITWEERLHIIIGTAEGLAYLHGGCGVKIIHRDIKTSNILLDENLTAKISDFGLAR  477

Query  1027  LFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASV  848
                 DKSH+ST +AGTLGYMAPEY+++G+LTEKADVY+FGVLV+E++SG+KNS + + S 
Sbjct  478   CIAMDKSHLSTGIAGTLGYMAPEYLMRGQLTEKADVYAFGVLVLEILSGRKNSVYTRGSS  537

Query  847   SLLQQHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI  671
             S+LQ  W  +++  L   +D +L+ +  + E +  LQI L+C QA  ELRP MS VV+M+
Sbjct  538   SVLQLVWKHYKSNNLVACIDPALQGKFPILEVSNVLQISLLCTQACMELRPPMSGVVEML  597

Query  670   SGDQD--IPQPTQPPFLTSN  617
               D++  +PQP+QPPF+ ++
Sbjct  598   H-DKNCVVPQPSQPPFVNAS  616



>ref|XP_010040242.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
Length=633

 Score =   512 bits (1318),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 286/639 (45%), Positives = 397/639 (62%), Gaps = 39/639 (6%)
 Frame = -2

Query  2452  RKMASLSKWLFLFIFFLS--INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDA  2279
             R   ++S +  L +  LS   + + SDPR +EA  IC +     +++   + N++A +  
Sbjct  11    RSSTTISTYFALPLLALSSFFSLATSDPRITEAGFICGSSNGLLTEK--VIPNYIAIMRE  68

Query  2278  LTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRG  2099
             ++  V  +++G+  + +    +Y   +C  DL + DC LC A  ++++  C+P       
Sbjct  69    ISESVADQRWGKYSLASPPPALYGLAQCYGDLFENDCLLCHALSRSRLYGCVP-----NF  123

Query  2098  GRLFYDGCFVRYDDYVFFNES-SSLSDKTVCGAE-----DFGGNSGLFRRNAAALVGELG  1937
             GRL+ DGCF+RYD Y F+NE+     D   C +      D       F      ++  + 
Sbjct  124   GRLYLDGCFLRYDGYDFYNETVDPTHDMLKCSSNSTVPADQRERVAEFSDRVDRVLRNVS  183

Query  1936  RKAAANDGFFTAA---VGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGR  1766
               A  N+GF  A    VG G + VY LAQCW  V    C  CL  A SK  SC P EE R
Sbjct  184   ASAVQNEGFAVAGEDGVG-GVAGVYALAQCWSTVDAGGCSVCLENATSKARSCAPGEEAR  242

Query  1765  VLNAGCYMRYSTKKFYDNSTIPATNQSGGRSN-HLPVILATTFGSFAFLLILGSVAFIVR  1589
              +NAGC++RYST KFY+   IP    +GG S   + + +A++  +   L+++G  A+I  
Sbjct  243   AMNAGCFLRYSTTKFYN---IPV---NGGSSRVRITIAIASSAAAVTSLVLIG--AYIGY  294

Query  1588  KRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPD  1409
             K+  K+++    L  + +TV+K  L F YETLEKAT++FDDS KLGQGG G VYKG LP+
Sbjct  295   KKYFKKKRVHHSLTQLPMTVSKFSLYFKYETLEKATNFFDDSRKLGQGGGGSVYKGNLPN  354

Query  1408  GKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSL  1229
             GK VA+KRL FNT QW D+FFNEVNLI+GI HKNLVKLLGCSI GPESLL+YE++PN SL
Sbjct  355   GKVVAVKRLVFNTLQWVDNFFNEVNLINGIRHKNLVKLLGCSIEGPESLLIYEYLPNGSL  414

Query  1228  YDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKI  1049
                  +      L+WE R  II G+AEGLA+LH    + IIHRDIK SNVLLD+  T KI
Sbjct  415   DQVLFSDNETHVLTWEARLHIITGSAEGLAHLHGGCGVKIIHRDIKASNVLLDKNLTAKI  474

Query  1048  ADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNS  869
             ADFGL R    D+SH+ST +AGTLGYMAPEY+++G+LTEKADVY+FGVLV+E++SGKKNS
Sbjct  475   ADFGLARCIAPDESHLSTVIAGTLGYMAPEYLMRGQLTEKADVYAFGVLVLEILSGKKNS  534

Query  868   SFYQASVSLLQQHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSM  692
             ++ Q S S+    WN +++  L   +D +L  +  + EA+R LQI L+C QA  ELRP M
Sbjct  535   TYTQGSSSV----WNHYKSNNLAACIDLALRGKFPILEASRLLQISLLCTQACMELRPPM  590

Query  691   SAVVKMISG-DQDIPQPTQPPFLTS-----NSAASSGSY  593
             S V++M+   D+ +PQP QPPF+ +     NS++ S +Y
Sbjct  591   SEVIEMLHDKDRVVPQPNQPPFVNASVLFDNSSSRSSTY  629



>gb|KCW45358.1| hypothetical protein EUGRSUZ_L00960 [Eucalyptus grandis]
Length=630

 Score =   511 bits (1316),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 283/615 (46%), Positives = 378/615 (61%), Gaps = 28/615 (5%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L L  FF ++  +VS P+ +EA L C N T   +       +F A +  ++  V  ++ G
Sbjct  15    LALSSFFFAL--AVSVPQITEAGLHCNNSTEIVTSNNF---SFRAVMREISESVADQRRG  69

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
                + +    VY   +C   L + DC LCFA+ +T+I RCLP       G+L+ DGCF+R
Sbjct  70    NYSVTSPPPVVYGLAQCEGGLIEMDCPLCFAEIRTRIPRCLP-----NFGQLYRDGCFLR  124

Query  2065  YDDYVFFNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGR-------KAAANDGF  1910
             YD Y F+NE+     D   C +     NS +    A      + R       KA  N GF
Sbjct  125   YDGYDFYNETVDPTHDMLNCSS-----NSTVPAERATEFSERVDRVLRYVLAKALQNGGF  179

Query  1909  FTAA--VGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRY  1736
               A      G   VY  AQCW  +    C  CL  A S   SC P EE R +NAGC++RY
Sbjct  180   AVAGEDAPEGAVGVYAWAQCWSTLDAGGCRVCLENATSMARSCAPGEEARAMNAGCFLRY  239

Query  1735  STKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERK  1556
             ST KFYD  +  ++  S  ++  +P+++A    +   + ++   A+I  K   K+++ + 
Sbjct  240   STTKFYDLDSRGSSEVSITKAV-VPIVVAIAPSAAVVISLVLIGAWIGYKEYSKKKRVQN  298

Query  1555  RLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFF  1376
              L  +  +++K +L F YETLEKAT++F DS KLGQGG+G VYKG+LPD K VAIKRL  
Sbjct  299   SLMQLRASMSKFRLYFKYETLEKATNFFHDSRKLGQGGAGSVYKGILPDKKVVAIKRLVI  358

Query  1375  NTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQ  1196
             NT QWAD  FNEVNLISGI HKNLVKLLGCSI GPESLLVYE++ N+SL          +
Sbjct  359   NTQQWADDLFNEVNLISGIQHKNLVKLLGCSIEGPESLLVYEYLSNKSLDQVLLVNNATR  418

Query  1195  PLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPE  1016
              L+WE+R  II+G AEGLAYLH    + IIHRDIK SN+LLDE  T KIADFGL R    
Sbjct  419   ILTWEERLHIIIGIAEGLAYLHGGYGVKIIHRDIKASNILLDENLTAKIADFGLARCISP  478

Query  1015  DKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQ  836
             DKSH+ T +AGT+GYMAPEY+V+G+LTEKADVY+FGVLV+E+++G+KNS + Q S S+LQ
Sbjct  479   DKSHLCTGIAGTIGYMAPEYLVRGQLTEKADVYAFGVLVLEILTGRKNSVYTQGSSSILQ  538

Query  835   QHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI-SGD  662
               W  +++  L   +D +L+ +  V EA+  LQIGL+C QAS ELRP MS VV+M+   D
Sbjct  539   SVWKHYKSTNLAACIDPTLQGKFLVLEASNVLQIGLLCTQASMELRPPMSRVVEMLHDKD  598

Query  661   QDIPQPTQPPFLTSN  617
             Q +PQP QPPFL ++
Sbjct  599   QVVPQPNQPPFLNAS  613



>ref|XP_009618146.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Nicotiana 
tomentosiformis]
Length=675

 Score =   512 bits (1319),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 279/617 (45%), Positives = 373/617 (60%), Gaps = 23/617 (4%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L  FIF  S   S+ DPR S A + C  RT        +   ++  +  L+  +   K  
Sbjct  16    LIFFIFLFS--PSLCDPRTSVANISCKPRTNVSITSDLF-PKYMEIMGTLSDFISENKSA  72

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
                + + +  +Y   +C  DLSQ +C LCF + K ++  C+P      GG ++ DGCF+R
Sbjct  73    TYSLSSNSPDIYGLAKCHNDLSQDECKLCFVEAKDKLNTCIP----APGGSVYLDGCFLR  128

Query  2065  YDDYVFFNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALV----GELGRKAAANDGFFTA  1901
             Y++Y FF+ES    S   VCG      N    +R+ AA V      +   +  N GF   
Sbjct  129   YENYDFFDESVQKNSSSYVCGVPTDITNDQYMKRDFAARVDRAIANVTSMSVVNKGFGAT  188

Query  1900  AVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKF  1721
              V  G   VY L QCW+ +  + C  CL  A   I  CLP  EG+ +NAGCY+RYS+ KF
Sbjct  189   IVKSGLLAVYALGQCWDSLDVEICTKCLNNAGDMIRKCLPAAEGKAMNAGCYLRYSSNKF  248

Query  1720  YDNSTIPATNQSGGRSNHL----PVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKR  1553
             + +  +   ++   +  ++     ++L T  G FA   ILG  AF+  +R   ++   KR
Sbjct  249   FGDGALVLADKGPTKRKNIWIIAAIVLLTILGIFA---ILG--AFLGYRRYSTEQGGTKR  303

Query  1552  LGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFN  1373
             +  +   +  SKLNF YE LEKAT  FD  NKLGQGGSG VYKG+LPDGKTVA+KRL +N
Sbjct  304   VHKIPRALETSKLNFKYEMLEKATGGFDPLNKLGQGGSGSVYKGILPDGKTVAVKRLLYN  363

Query  1372  TTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP  1193
             T QWA+ FFNEVNLISGI HKN+VKLLGCSI GPESLLV++FV N++L      +   Q 
Sbjct  364   TRQWAEEFFNEVNLISGIQHKNVVKLLGCSIEGPESLLVFDFVSNKNLDQVLFDKNKRQF  423

Query  1192  LSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPED  1013
             +SW +R++IILG AEGLAYLHE ++  IIHRDIK SN+L+DE+  PKIADFGL R F   
Sbjct  424   VSWNERFQIILGIAEGLAYLHEGSKAKIIHRDIKNSNILVDEQLIPKIADFGLARRFAPH  483

Query  1012  KSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQ  833
             K+H+ST VAGTLGY+APEY++QG LTEKADVYSFGV+ IEV    KN+ F   S S+LQ 
Sbjct  484   KTHVSTGVAGTLGYLAPEYLLQGCLTEKADVYSFGVVAIEVACCIKNNVFVSDSRSVLQT  543

Query  832   HWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ-  659
              W  ++  K+ E++D  L  +    EA+R LQ+GL+C Q     RPSMS VVK++   + 
Sbjct  544   VWRNYKLNKITESIDSRLMSDFQEQEASRVLQLGLLCTQTRRFSRPSMSQVVKILRNKET  603

Query  658   DIPQPTQPPFLTSNSAA  608
             ++P P QPPF  S+  A
Sbjct  604   EVPVPMQPPFQNSSLLA  620



>gb|KDO82325.1| hypothetical protein CISIN_1g008239mg [Citrus sinensis]
Length=363

 Score =   500 bits (1288),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 239/357 (67%), Positives = 287/357 (80%), Gaps = 5/357 (1%)
 Frame = -2

Query  2287  LDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRL  2108
             +D +TPL+  ++Y   V G G A+VYAFGECMKDLS  DCNLCFAQCKTQ+L+CLPFQ  
Sbjct  1     MDIVTPLIARQRYAAVVNGTGTASVYAFGECMKDLSPNDCNLCFAQCKTQVLKCLPFQLA  60

Query  2107  VRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKA  1928
              RGGR+FYDGC++RYDDY FFNES S  D+TVCG++DFGGN+ +F  NA  LV  L  +A
Sbjct  61    TRGGRVFYDGCYLRYDDYDFFNESLSSQDRTVCGSKDFGGNNTVFGANAIELVRNLSVQA  120

Query  1927  AANDGFFTAAV--GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNA  1754
               NDGFF  +V   +GN +V+GLAQCWEFV G +C++CL  AVS+I SC  KEEGRVLNA
Sbjct  121   VKNDGFFVGSVTFSKGNVSVHGLAQCWEFVNGSACENCLENAVSRIASCTQKEEGRVLNA  180

Query  1753  GCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVK  1574
             GCY+RYST++FY+NS       +GG  N L VILAT+  + A LL+   VAF VR+++++
Sbjct  181   GCYLRYSTQRFYNNSGPDPVPGNGG-DNKLAVILATS--AVALLLVFSLVAFFVRRKLLQ  237

Query  1573  QRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVA  1394
             +R+ERK+LGA+ V VNKSKLNFSYETLEKAT+YF +SNKLGQGGSG VYKG LP G+ VA
Sbjct  238   KRRERKQLGALQVAVNKSKLNFSYETLEKATNYFHESNKLGQGGSGSVYKGTLPGGEAVA  297

Query  1393  IKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYD  1223
             +KRLF+NTTQW DHFFNEVNLISGI+HKNLVKLLGCSITGPESLLVYEFVPNQSL D
Sbjct  298   VKRLFYNTTQWVDHFFNEVNLISGINHKNLVKLLGCSITGPESLLVYEFVPNQSLLD  354



>ref|XP_009616730.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Nicotiana 
tomentosiformis]
 ref|XP_009616731.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Nicotiana 
tomentosiformis]
Length=652

 Score =   511 bits (1316),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 276/635 (43%), Positives = 386/635 (61%), Gaps = 29/635 (5%)
 Frame = -2

Query  2425  LFLFIFFLSI-NRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKY  2249
             LF+ +  L + N S ++PR+    +IC N+   +     YV NFVA ++ ++  + ++ Y
Sbjct  12    LFVILSILLLPNVSEAEPRSQTVQIICGNQL--EHNTTIYVPNFVATMETISEQMRTRGY  69

Query  2248  GETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFV  2069
             G  V G G    Y   +C  DLS  DC LC+A+ +T + +C PF     GGR++ DGCF+
Sbjct  70    GVAVTGTGLDANYGLAQCYGDLSLLDCVLCYAEARTVLPQCFPFN----GGRIYLDGCFM  125

Query  2068  RYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--  1895
             R ++Y F+++     D+ VCG     G+  LF++ A   V +    A  N+G+ +A V  
Sbjct  126   RAENYTFYDQYLGPEDRHVCGNRTRKGS--LFQQTARRAVQQAVANAPNNNGYASAEVAV  183

Query  1894  -GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFY  1718
              G  N T Y LA CW  +   SC  CL  A + +  CLP  EGR L  GC+MRYS   F 
Sbjct  184   PGATNETAYVLADCWRTLSANSCRACLQNASASMMGCLPWSEGRALYTGCFMRYSDVNFL  243

Query  1717  DNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVR-KRIVKQRKERKRLGAM  1541
             +   +  +  S    N + +++A        ++      ++ + K+I K+RK    +  +
Sbjct  244   N--ALATSGDSSSNGNVVVIVIAVVSAVVVLVVGAVIAFYMWKNKQIQKKRKGSNDVEKL  301

Query  1540  LVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQW  1361
             + T++ S LNF Y TLEKAT  FD++NKLGQGG G VYKGVLPDG+ +A+KRLFFN    
Sbjct  302   VKTLHDSSLNFKYSTLEKATGSFDEANKLGQGGFGTVYKGVLPDGREIAVKRLFFNNKHR  361

Query  1360  ADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWE  1181
             A  F+NEVN+IS + HKNLV+LLGCS +GPESLLVYEF+PNQSL  +       + L+WE
Sbjct  362   AADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEFLPNQSLDRFIFDPSKGKTLNWE  421

Query  1180  QRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHI  1001
             +R+ II+GTAEGL YLHE  +  IIHRDIK SN+LLD     KIADFGL R F EDKSHI
Sbjct  422   KRFDIIIGTAEGLVYLHENNKTRIIHRDIKASNILLDSRLRAKIADFGLARSFQEDKSHI  481

Query  1000  STAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHW  827
             STA+AGTLGYMAPEY+  G+LTEKADVYSFGVL++E+V+G++N  S   + S SL+   W
Sbjct  482   STAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIVTGRQNNRSKHTEYSDSLISIAW  541

Query  826   NLFRAGKLYEAVDGSLEER------ARVEATRQLQIGLVCVQASPELRPSMSAVVKM-IS  668
               F+ G++ E  D +L  R       + E  R + +GL+C Q  P LRPSMS  ++M + 
Sbjct  542   QHFQHGRVEELFDPNLMLRNYHTINVKNEVLRVVHVGLLCTQEVPGLRPSMSKALQMLVK  601

Query  667   GDQDIPQPTQPPFLTSNSAA-----SSGSYPNRGG  578
              ++++P PT PPF+   +        + SYP+R G
Sbjct  602   KEEELPAPTNPPFIDEKTMELHDPWDTPSYPHREG  636



>gb|KDO82326.1| hypothetical protein CISIN_1g008239mg [Citrus sinensis]
Length=359

 Score =   499 bits (1286),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 239/357 (67%), Positives = 287/357 (80%), Gaps = 5/357 (1%)
 Frame = -2

Query  2287  LDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRL  2108
             +D +TPL+  ++Y   V G G A+VYAFGECMKDLS  DCNLCFAQCKTQ+L+CLPFQ  
Sbjct  1     MDIVTPLIARQRYAAVVNGTGTASVYAFGECMKDLSPNDCNLCFAQCKTQVLKCLPFQLA  60

Query  2107  VRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKA  1928
              RGGR+FYDGC++RYDDY FFNES S  D+TVCG++DFGGN+ +F  NA  LV  L  +A
Sbjct  61    TRGGRVFYDGCYLRYDDYDFFNESLSSQDRTVCGSKDFGGNNTVFGANAIELVRNLSVQA  120

Query  1927  AANDGFFTAAV--GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNA  1754
               NDGFF  +V   +GN +V+GLAQCWEFV G +C++CL  AVS+I SC  KEEGRVLNA
Sbjct  121   VKNDGFFVGSVTFSKGNVSVHGLAQCWEFVNGSACENCLENAVSRIASCTQKEEGRVLNA  180

Query  1753  GCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVK  1574
             GCY+RYST++FY+NS       +GG  N L VILAT+  + A LL+   VAF VR+++++
Sbjct  181   GCYLRYSTQRFYNNSGPDPVPGNGG-DNKLAVILATS--AVALLLVFSLVAFFVRRKLLQ  237

Query  1573  QRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVA  1394
             +R+ERK+LGA+ V VNKSKLNFSYETLEKAT+YF +SNKLGQGGSG VYKG LP G+ VA
Sbjct  238   KRRERKQLGALQVAVNKSKLNFSYETLEKATNYFHESNKLGQGGSGSVYKGTLPGGEAVA  297

Query  1393  IKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYD  1223
             +KRLF+NTTQW DHFFNEVNLISGI+HKNLVKLLGCSITGPESLLVYEFVPNQSL D
Sbjct  298   VKRLFYNTTQWVDHFFNEVNLISGINHKNLVKLLGCSITGPESLLVYEFVPNQSLLD  354



>ref|XP_010045540.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
 gb|KCW83343.1| hypothetical protein EUGRSUZ_B00276 [Eucalyptus grandis]
Length=628

 Score =   509 bits (1310),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 280/619 (45%), Positives = 384/619 (62%), Gaps = 33/619 (5%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L L  FF S+  +VSDPR +EA LIC N T         +   +A +   +    ++ +G
Sbjct  15    LALSSFFFSL--AVSDPRITEARLICQNSTWIIPGNVVSIG--IAIMSKFSYSFAAQGWG  70

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
             +  + +    VY   +C  DL++T+C LCF +   +I  CLP       GR++ DGCF+R
Sbjct  71    KYSLASPLPAVYGLAQCHGDLTETECRLCFTESWPRIAHCLP-----NFGRVYLDGCFLR  125

Query  2065  YDDYVFFNE-----------SSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAAN  1919
             Y  Y F+NE           SS+L+      AE       + R  +A+ V   G   A  
Sbjct  126   YGSYDFYNETVDPTHDMHKCSSNLTVPAEIVAELSDRVDRVLRNVSASAVRNKGFAVAGE  185

Query  1918  DGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMR  1739
             DG     VG G + VY LAQCW  +    C  CL  A S   SC P EE RV+NAGC++R
Sbjct  186   DG-----VG-GVAGVYALAQCWSTLDAGGCRVCLENATSMARSCAPGEEARVMNAGCFLR  239

Query  1738  YSTKKFYD--NSTIPATNQSGGRSN-HLPVILATTFGSFAFLLILGSVAFIVRKRIVKQR  1568
             YST KFY+  +S       SGG S   + + + ++  +   L+++G  A+I  K+  +++
Sbjct  240   YSTTKFYNVPSSKFYIVPGSGGSSRVRITIAIISSATAATSLVLIG--AYIGYKKYSEKK  297

Query  1567  KERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIK  1388
             + +  L  +  + +K  L F Y+TLEKAT++FDDS KLGQGG G VYKG+LPDGK VA+K
Sbjct  298   QMQNNLMQLRASKSKFSLYFKYKTLEKATNFFDDSRKLGQGGGGSVYKGILPDGKVVAVK  357

Query  1387  RLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSAR  1208
             RL FNT QWAD FFNEVNLISGI HKNL+++LGCSI GPESLLVYE++P +SL       
Sbjct  358   RLVFNTCQWADEFFNEVNLISGIQHKNLMRILGCSIEGPESLLVYEYLPKRSLDLVLFVN  417

Query  1207  KNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVR  1028
                  ++WE+R  II+GTAEGLAYLH    + IIHRDIK SN+LLDE  T KI+DFGL R
Sbjct  418   DATTVITWEERLHIIIGTAEGLAYLHGGCGVKIIHRDIKTSNILLDENLTAKISDFGLAR  477

Query  1027  LFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASV  848
                 DKSH+ST +AGTLGYMAPEY+++G+LTEKADVY+FGVLV+E++SG+KNS + + S 
Sbjct  478   CIAMDKSHLSTGIAGTLGYMAPEYLMRGQLTEKADVYAFGVLVLEILSGRKNSVYTRGSS  537

Query  847   SLLQQHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI  671
             S+LQ  W  +++  L   +D +L+ +  + E +  LQI L+C QA  ELRP MS VV+M+
Sbjct  538   SVLQSVWKHYKSNNLVACIDPALQGKFPILEVSNVLQISLLCTQACMELRPPMSGVVEML  597

Query  670   SG-DQDIPQPTQPPFLTSN  617
                +  +PQP+QPPF+ ++
Sbjct  598   HDKNHVVPQPSQPPFVNAS  616



>ref|XP_006439855.1| hypothetical protein CICLE_v10023699mg, partial [Citrus clementina]
 gb|ESR53095.1| hypothetical protein CICLE_v10023699mg, partial [Citrus clementina]
Length=560

 Score =   506 bits (1303),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 270/544 (50%), Positives = 352/544 (65%), Gaps = 31/544 (6%)
 Frame = -2

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             VYA+ +C +DLSQTDC  CF+  K +  RCLP        R+F DGCF+RYD+Y FF E+
Sbjct  28    VYAYMQCHEDLSQTDCESCFSALKQKANRCLPSD----SARIFLDGCFLRYDNYDFFGEA  83

Query  2035  -SSLSDKTVCGAEDFGGNS--GLFRRNAAALVGELGRKAAANDGFFTAAVGRGN-STVYG  1868
                + DK  C A      S    F      ++  +      N G F    G+G  +TVY 
Sbjct  84    VDPIHDKFNCSARHLDDESLSKQFEEKVIEVITNVTIVTKRN-GRFGQVEGKGGIATVYA  142

Query  1867  LAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQ  1688
             LAQC +F+  K C  CL  A  ++  C    EGR + AGCY+R+ST++F++    P   +
Sbjct  143   LAQCLKFLDNKGCSQCLDEAALRLKGCSKSGEGRAMFAGCYVRFSTERFFN----PNYQK  198

Query  1687  SGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNF  1508
                          T   +F FL  +G  A I  KR+ + RK +  LG +L T   S LNF
Sbjct  199   K-----------ETRVCAFTFLSSIG--ACIGYKRLSEMRKGQVLLGTVLCT---SSLNF  242

Query  1507  SYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLI  1328
              YE LE+ATD+FD+S KLGQGG+G V++G LPDG+ +A+KRLFFN+ QW D FFNEVNLI
Sbjct  243   KYEILERATDFFDNSRKLGQGGAGSVFRGTLPDGRNIAVKRLFFNSRQWVDQFFNEVNLI  302

Query  1327  SGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAE  1148
             SGI HKN+V+LLGCSI GPESLLVYE+VPN+SL      +     LSW+QR+ II GTAE
Sbjct  303   SGIQHKNVVRLLGCSIEGPESLLVYEYVPNRSLDQILFVKNTIHILSWQQRFTIICGTAE  362

Query  1147  GLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYM  968
             GLA+LH  + + IIHRDIK SN+LLDE+ TPKIADFGL R    DK+H+ST +AGTLGYM
Sbjct  363   GLAHLHGGSGIKIIHRDIKTSNILLDEKLTPKIADFGLARHVAPDKTHVSTGIAGTLGYM  422

Query  967   APEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVD  788
             APEY+V+G+LTEKADVY+FGVLVIEV SG++NS F + S S+L   W  ++A ++ +++D
Sbjct  423   APEYLVRGQLTEKADVYAFGVLVIEVASGRRNSVFSEGSSSVLHTVWKHYKANRITQSMD  482

Query  787   GSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPFLTSNS  614
               L  R    EA+R LQIGL+C QA   LRPSM+ VV M++  D +IP P QPPFL ++ 
Sbjct  483   PGLTGRFPENEASRVLQIGLLCTQAPVALRPSMTEVVHMLNNIDYEIPPPKQPPFLNASV  542

Query  613   AASS  602
              + S
Sbjct  543   ISPS  546



>gb|KCW45360.1| hypothetical protein EUGRSUZ_L00962 [Eucalyptus grandis]
Length=678

 Score =   510 bits (1314),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 290/675 (43%), Positives = 397/675 (59%), Gaps = 66/675 (10%)
 Frame = -2

Query  2452  RKMASLSKWLFLFIFFLS--INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDA  2279
             R   ++S +  L +  LS   + + SDPR +EA  IC +     +++   + N++A +  
Sbjct  11    RSSTTISTYFALPLLALSSFFSLATSDPRITEAGFICGSSNGLLTEK--VIPNYIAIMRE  68

Query  2278  LTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRG  2099
             ++  V  +++G+  + +    +Y   +C  DL + DC LC A  ++++  C+P       
Sbjct  69    ISESVADQRWGKYSLASPPPALYGLAQCYGDLFENDCLLCHALSRSRLYGCVP-----NF  123

Query  2098  GRLFYDGCFVRYDDYVFFNES-SSLSDKTVCGAE-----DFGGNSGLFRRNAAALVGELG  1937
             GRL+ DGCF+RYD Y F+NE+     D   C +      D       F      ++  + 
Sbjct  124   GRLYLDGCFLRYDGYDFYNETVDPTHDMLKCSSNSTVPADQRERVAEFSDRVDRVLRNVS  183

Query  1936  RKAAANDGFFTAA---VGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGR  1766
               A  N+GF  A    VG G + VY LAQCW  V    C  CL  A SK  SC P EE R
Sbjct  184   ASAVQNEGFAVAGEDGVG-GVAGVYALAQCWSTVDAGGCSVCLENATSKARSCAPGEEAR  242

Query  1765  VLNAGCYMRYSTKKFYD---NSTIPATNQSGGRSNHLPVILATTFGSFAF----------  1625
              +NAGC++RYST KFY+   N     + Q+G +  H P +    FG              
Sbjct  243   AMNAGCFLRYSTTKFYNIPVNGASMTSPQAGLKRVH-PSLSLLGFGKLDLTQGSSRVRIT  301

Query  1624  ------------LLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKAT  1481
                         L+++G  A+I  K+  K+++    L  + +TV+K  L F YETLEKAT
Sbjct  302   IAIASSAAAVTSLVLIG--AYIGYKKYFKKKRVHHSLTQLPMTVSKFSLYFKYETLEKAT  359

Query  1480  DYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLV  1301
             ++FDDS KLGQGG G VYKG LP+GK VA+KRL FNT QW D+FFNEVNLI+GI HKNLV
Sbjct  360   NFFDDSRKLGQGGGGSVYKGNLPNGKVVAVKRLVFNTLQWVDNFFNEVNLINGIRHKNLV  419

Query  1300  KLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQ------------PLSWEQRYKIILG  1157
             KLLGCSI GPESLL+YE++PN SL      R   Q             L+WE R  II G
Sbjct  420   KLLGCSIEGPESLLIYEYLPNGSLDQVLFTRSYKQIESFVAGDNETHVLTWEARLHIITG  479

Query  1156  TAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTL  977
             +AEGLA+LH    + IIHRDIK SNVLLD+  T KIADFGL R    D+SH+ST +AGTL
Sbjct  480   SAEGLAHLHGGCGVKIIHRDIKASNVLLDKNLTAKIADFGLARCIAPDESHLSTVIAGTL  539

Query  976   GYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYE  797
             GYMAPEY+++G+LTEKADVY+FGVLV+E++SGKKNS++ Q S S+L   WN +++  L  
Sbjct  540   GYMAPEYLMRGQLTEKADVYAFGVLVLEILSGKKNSTYTQGSSSVLNSVWNHYKSNNLAA  599

Query  796   AVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPFLT  623
              +D +L  +  + EA+R LQI L+C QA  ELRP MS V++M+   D+ +PQP QPPF+ 
Sbjct  600   CIDLALRGKFPILEASRLLQISLLCTQACMELRPPMSEVIEMLHDKDRVVPQPNQPPFVN  659

Query  622   S-----NSAASSGSY  593
             +     NS++ S +Y
Sbjct  660   ASVLFDNSSSRSSTY  674



>ref|XP_009362983.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Pyrus 
x bretschneideri]
Length=586

 Score =   507 bits (1305),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 269/569 (47%), Positives = 358/569 (63%), Gaps = 25/569 (4%)
 Frame = -2

Query  2266  VDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLF  2087
             V++K++GE +I +    VYA  +C  DLS T+C+ CFA  +T++  CLP        R++
Sbjct  8     VNAKRWGEYIITSPAPEVYALAQCYDDLSPTECSACFAVSRTKLPLCLP----STSARIY  63

Query  2086  YDGCFVRYDDYVFFNESSSLSDKTV-CGAEDFGGNSGL---FRRNAAALVGELGRKAAAN  1919
              DGCF+ YDD+ F +++     K V CG+     +      F R    ++  +   A ++
Sbjct  64    LDGCFLGYDDHEFSHQAVDDEYKNVNCGSSRIDASKSRTKEFARKVEGVIRNVTELAVSH  123

Query  1918  DGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMR  1739
              GF      RG  +VY LAQCW+ +    C +CL  A + +  C+P  EGR + AGC++R
Sbjct  124   GGFGVFG-KRGAESVYALAQCWKTINASGCRECLEEAGASLVGCVPGVEGRAMFAGCFLR  182

Query  1738  YSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKER  1559
             YS + FY    I   +   G  N   V       + + L + G   F+  K+  K+ +  
Sbjct  183   YSNENFYG---IEDGSNDSGEPNWQTVATILIAMASSLLALFG--VFMAYKKFYKRTEVY  237

Query  1558  KRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLF  1379
                  + V+++K+ L+F YE LEKATD+FD S KLGQGG+G V+KGVLPDG+TVA+KRL+
Sbjct  238   NNPIGISVSIHKNNLSFKYEMLEKATDFFDASRKLGQGGAGSVFKGVLPDGRTVAVKRLY  297

Query  1378  FNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNH  1199
             FNT QW D FFNEVNLISGIHHKNLV+LLGCSI GPESLLVYE+V N+SL          
Sbjct  298   FNTRQWVDEFFNEVNLISGIHHKNLVRLLGCSIEGPESLLVYEYVANKSLDQVLFGNDTR  357

Query  1198  QPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFP  1019
             Q LSW+QR+ II G AEGL YLHE   + IIHRDIK SN+LLDE   PKIADFGL R   
Sbjct  358   QILSWQQRFDIICGIAEGLVYLHESCGVKIIHRDIKASNILLDENLIPKIADFGLARCVG  417

Query  1018  EDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLL  839
              DKSH+ST +AGTLGYMAPEY+V+G+LT+KADVY+FGV+V+E+V GKKN  F + S S+L
Sbjct  418   PDKSHLSTGIAGTLGYMAPEYLVRGQLTDKADVYAFGVMVLEIVCGKKNRVFVEGSSSVL  477

Query  838   QQHWNLFRAGKLYEAVD----GSLEERARVEATRQLQIGLVCVQASPELRPSMSAVVKMI  671
                W  ++   + E VD    G   ER   EA+  LQIGL+C QAS  +RPSM+ VV+M+
Sbjct  478   YSVWKHYKEKNITETVDPTLKGGFPER---EASDVLQIGLMCTQASLAVRPSMAEVVRML  534

Query  670   SGDQD-IPQPTQPPFLTS---NSAASSGS  596
             + ++  IP P QPPFL +   NS AS  S
Sbjct  535   TDEKHVIPSPKQPPFLNASILNSDASKAS  563



>gb|KCW83335.1| hypothetical protein EUGRSUZ_B00265 [Eucalyptus grandis]
Length=620

 Score =   508 bits (1308),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 286/619 (46%), Positives = 386/619 (62%), Gaps = 41/619 (7%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L L  FF S+  +VSD R ++A LIC N T   +     V+NF   +  ++  V ++++ 
Sbjct  15    LALSSFFFSL--AVSDSRIAQAGLICENSTGIMAGNS--VSNFNTVVREISKSVANQRWS  70

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
                +      VY   +C  DL + +C LCFA+ +   L C P       GRL+ DGCF+R
Sbjct  71    NYSVAKPPPAVYGLAQCHGDLIEAECFLCFAESRLWKLPCFP-----NFGRLYMDGCFLR  125

Query  2065  YDDYVFFNE-----------SSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAAN  1919
             YD Y F+NE           SS+L+      AE       + R  +A+ +   G   A  
Sbjct  126   YDVYDFYNETVDPTHDMLKCSSNLTVPAERVAELSDRVDRVLRNVSASALRNKGFAVAGE  185

Query  1918  DGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMR  1739
             DG     VG G + VY LAQCW  +    C  CL  A S   SC P EE R +NAGC++R
Sbjct  186   DG-----VG-GVAGVYALAQCWSTLDAGGCRVCLENATSMARSCAPGEEARAMNAGCFLR  239

Query  1738  YSTKKFYDNSTIPATNQSGGRSN-HLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKE  1562
             YST KFY+   +P    SGG S   + + + ++  +   L+++G  A+I  K+  K+++ 
Sbjct  240   YSTTKFYN---VPV---SGGSSRVRITIAITSSAAATTSLVLIG--AYIGYKKYSKKKQV  291

Query  1561  RKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRL  1382
             +  L  +  + +K  L F Y+TLEKAT++FDDS KLGQGG G VYKG+LPDGK VA+KRL
Sbjct  292   QNNLMQLRASKSKFSLYFKYKTLEKATNFFDDSRKLGQGGGGSVYKGILPDGKVVAVKRL  351

Query  1381  FFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKN  1202
              FNT QWAD FFNEVNLISGI HKNL++LLGCSI GPESLLVYE+ P +SL D      +
Sbjct  352   VFNTCQWADDFFNEVNLISGIRHKNLMRLLGCSIEGPESLLVYEYFPKRSL-DLVLFVND  410

Query  1201  HQP-LSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRL  1025
               P L+WE+R  II+GTAEGLAYLH    + IIHRDIK SN+LLDE  T KI+DFGL R 
Sbjct  411   ATPVLTWEERLHIIIGTAEGLAYLHGGCGVKIIHRDIKTSNILLDENLTAKISDFGLARC  470

Query  1024  FPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVS  845
                D SH+ST +AGTLGYMAPEY+++G+LTEKADVY+FGVLV+E++SG+KNS + + S S
Sbjct  471   IALDMSHLSTGIAGTLGYMAPEYLMRGQLTEKADVYAFGVLVLEILSGRKNSVYIRGSSS  530

Query  844   LLQQHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMIS  668
             +LQ  W  +++  L   +D +L+ +  + EA   LQI L+C QA  ELRP MS VVKM+ 
Sbjct  531   VLQSVWKHYKSNNLAACIDPALQGKFPILEALNVLQISLLCTQAYMELRPPMSGVVKMLH  590

Query  667   GDQD--IPQPTQPPFLTSN  617
              D++  +PQP+QPPF+ ++
Sbjct  591   -DKNYVVPQPSQPPFINAS  608



>ref|XP_010045533.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
Length=621

 Score =   508 bits (1308),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 286/606 (47%), Positives = 381/606 (63%), Gaps = 41/606 (7%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             +VSDPR +EA L C N T   +Q    V NFVA +  ++  V ++++G   + +    VY
Sbjct  25    AVSDPRTTEAGLYCENCTGIVAQN--IVPNFVAVMREISKSVANQRWGNYSLTSPPPAVY  82

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNE---  2039
                +C  DL+++DC LCF +  T    CLP       GRL+ DGCF+RY  Y F+NE   
Sbjct  83    GLAQCHGDLTESDCLLCFIKSWT----CLP-----NFGRLYLDGCFLRYGSYDFYNETVD  133

Query  2038  --------SSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGN  1883
                     SS+L+      AE       + R   A+ V   G   A  DG     VG G 
Sbjct  134   PTHGMLKCSSNLTVPAERVAELSDRVDRVLRNFLASAVQNKGFAVAGEDG-----VG-GV  187

Query  1882  STVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTI  1703
             + VY LAQCW  +    C  CL  A S   SC P EE R +NAGC++RYST KFY+   +
Sbjct  188   AGVYALAQCWSALDAGGCRFCLENATSMARSCAPGEEARAMNAGCFLRYSTTKFYN---V  244

Query  1702  PATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNK  1523
             P  +  G    H+P+ + ++  +   L+++G  A+I  K+  K+++ +  +  +  + +K
Sbjct  245   P--DSRGSSRVHIPIAITSSVAATTSLVLIG--AYIGYKKYSKKKQVQNNIMQLRASKSK  300

Query  1522  SKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFN  1343
               L F YETLEKAT++FDD  KLGQGG G VYKG LPDGK VA+KRL FN  QWAD FFN
Sbjct  301   FSLYFKYETLEKATNFFDDLRKLGQGGGGSVYKGNLPDGKVVAVKRLVFNMRQWADDFFN  360

Query  1342  EVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP-LSWEQRYKI  1166
             EVNLISGI HKNL++LLGCSI G ESLLVY+++PN SL D+     N  P L+WE+R  I
Sbjct  361   EVNLISGIQHKNLLRLLGCSIEGRESLLVYKYLPNGSL-DHVLFVNNATPVLTWEERLHI  419

Query  1165  ILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVA  986
             I+GTA+GLAYLH    + IIHRDIK SN+LLD+  T KI+DFGL R    DKSH+ST +A
Sbjct  420   IIGTAKGLAYLHGGCGVKIIHRDIKTSNILLDKNLTAKISDFGLARCIAVDKSHLSTGIA  479

Query  985   GTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGK  806
             GTLGYMAPEY+V+G+LTEKADVY+FGVLV+EV+SG+KNS + + S ++LQ  W   ++  
Sbjct  480   GTLGYMAPEYLVRGQLTEKADVYAFGVLVLEVLSGRKNSIYTRGSSTVLQSVWKHCKSNN  539

Query  805   LYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISGDQD--IPQPTQP  635
             L   +D +L+ +  V EA+  LQI L+C QAS ELRP MS V +M+  D+D  +PQP QP
Sbjct  540   LAACIDPALQGKFPVLEASNVLQISLLCTQASMELRPPMSGVFEMLR-DKDCVVPQPNQP  598

Query  634   PFLTSN  617
             PFL ++
Sbjct  599   PFLKAS  604



>gb|EYU28432.1| hypothetical protein MIMGU_mgv1a002644mg [Erythranthe guttata]
Length=651

 Score =   508 bits (1309),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 280/632 (44%), Positives = 379/632 (60%), Gaps = 40/632 (6%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQA--YVANFVAALDALTPLVDSKK  2252
             L   I  +  + + SDPR+    LIC      QS+  A  YV NFVA ++ ++  + +  
Sbjct  11    LMAVILMVLPDPTWSDPRSKTVKLIC----GEQSEHNATLYVPNFVATMENISAQIRNSG  66

Query  2251  YGETVIGAGNA-TVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGC  2075
             +G +V G GN  T Y   +C  DLS  DC LC+A+ +T + +C P      GGR+F DGC
Sbjct  67    FGLSVTGPGNIDTNYGLAQCYGDLSPLDCVLCYAEARTVLPQCFP----ANGGRIFLDGC  122

Query  2074  FVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV  1895
             F+R ++Y FF+E S  +D  VCG E   G +  FR +    + +    A   +G+  A V
Sbjct  123   FMRAENYSFFHEYSGPNDVAVCGNETRTGPA--FRESVRRALNDAVLTAPEKNGYGRAEV  180

Query  1894  ---GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKK  1724
                G GN + Y LA CW  +   +C  CL  A S +  CLP   GR LNAGC++RYS   
Sbjct  181   AVSGDGNGSAYVLADCWRTLNASACRSCLKKASSSVMKCLPLSNGRALNAGCFLRYSNTN  240

Query  1723  FYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSV--AFIVRKRIV-KQRKERKR  1553
             F +   IP    S  R     +++     S A +LI+G+V   +  ++RI+ ++RK    
Sbjct  241   FLN--PIPQNRNSKERI----IVIVMACVSAAAVLIIGAVIGVYTWKQRIIQRKRKGSDD  294

Query  1552  LGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFN  1373
                   T+N S LNF Y TLEKAT  FD++NKLG+GG G VYKGVLPDG+ +A+KRLFFN
Sbjct  295   TKKYAKTLNDSSLNFKYSTLEKATASFDEANKLGRGGFGTVYKGVLPDGREIAVKRLFFN  354

Query  1372  TTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP  1193
                 A  F+NEV +IS + HKNLV+LLGCS +GPESLLVYEF+PN SL  +       + 
Sbjct  355   NKHRASDFYNEVKIISSVEHKNLVRLLGCSCSGPESLLVYEFLPNTSLDRFIFDSSKGKG  414

Query  1192  LSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPED  1013
             L+WE+R++II+GTAEGL YLHE     IIHRDIK SN+LLD     KIADFGL R F ED
Sbjct  415   LNWEKRFEIIIGTAEGLVYLHENGNARIIHRDIKASNILLDSRLRAKIADFGLARSFQED  474

Query  1012  KSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKK----NSSFYQASVS  845
             KSHISTA+AGTLGYMAPEY+  G+LTEKADVYSFGVL++E+V+G++    N+S Y  + S
Sbjct  475   KSHISTAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIVTGRQNNRSNTSVY--AES  532

Query  844   LLQQHWNLFRAGKLYEAVDGSL--------EERARVEATRQLQIGLVCVQASPELRPSMS  689
             L+   W  F+   + E  D +L            R +  R + +GL+C Q    LRPSMS
Sbjct  533   LVTITWKRFQQRTVEEIFDSNLVTSHNYNYNIETRNDILRVVHVGLLCTQEIASLRPSMS  592

Query  688   AVVKM-ISGDQDIPQPTQPPFLTSNSAASSGS  596
               ++M +  D+D+P PT PPF+  N+   +G+
Sbjct  593   KALEMLVKKDEDLPAPTSPPFVDDNTMELNGT  624



>ref|XP_009772712.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Nicotiana 
sylvestris]
Length=675

 Score =   509 bits (1311),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 282/617 (46%), Positives = 369/617 (60%), Gaps = 23/617 (4%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L  FIF  S    + DPR S A + C  RT        +   ++  +  L   +   K  
Sbjct  16    LIFFIFLFS--PCLCDPRTSVANISCKPRTNVSINSDLF-PKYMEIMGTLNDFISENKSA  72

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
                + + +  +Y   +C  DLSQ +C LCF + K ++  C+P      GG ++ DGCF+R
Sbjct  73    TYSVSSTSPDIYGLAKCHNDLSQDECKLCFVEAKDKLNTCIP----APGGSVYLDGCFLR  128

Query  2065  YDDYVFFNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALV----GELGRKAAANDGFFTA  1901
             Y++Y FF+ES    S   VCG      N    +R+ AA V      +   +  N GF   
Sbjct  129   YENYDFFDESVQKNSSSFVCGVPTDITNDQYMKRDFAARVDRAIANVTSMSIVNKGFGAT  188

Query  1900  AVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKF  1721
              V  G   VY L QCW+ +  + C  CL  A   I  CLP  EG+ +NAGCY+RYS+ KF
Sbjct  189   IVKSGLLAVYALGQCWDSLDVEICTKCLNNAGDMIRKCLPAAEGKAMNAGCYLRYSSNKF  248

Query  1720  Y-DNSTIPATNQSGGRSNHL---PVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKR  1553
             + D + + A      R N      ++L T  G FA   ILG  AF+  +R  K++   KR
Sbjct  249   FGDGALVLADKGPTKRKNMWIIAAIVLLTILGIFA---ILG--AFLGYRRYSKEQGGTKR  303

Query  1552  LGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFN  1373
             +  +   +  SKLNF YE LEKAT  FD  NKLGQGGSG VYKG+LPDGKTVA+KRL +N
Sbjct  304   VHKIPRALETSKLNFKYEMLEKATGGFDPLNKLGQGGSGSVYKGILPDGKTVAVKRLLYN  363

Query  1372  TTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP  1193
             T QWA+ FFNEVNLISGI HKN+VKLLGCSI GPESLLV++FV N++L      +   Q 
Sbjct  364   TRQWAEEFFNEVNLISGIQHKNVVKLLGCSIEGPESLLVFDFVSNKNLDQVLFDKNKRQF  423

Query  1192  LSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPED  1013
             LSW +R+++ILG AEGLAYLHE  +  IIHRDIK SN+L+DE   PKIADFGL R F   
Sbjct  424   LSWTERFQVILGIAEGLAYLHEGNKAKIIHRDIKNSNILVDELLIPKIADFGLARRFAPH  483

Query  1012  KSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQ  833
             K+H+ST VAGTLGY+APEY++QG LTEKADVYSFGV+ IEV    KN+ F   S S+LQ 
Sbjct  484   KTHVSTGVAGTLGYLAPEYLLQGCLTEKADVYSFGVVAIEVACCIKNNVFVSDSGSVLQS  543

Query  832   HWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMI-SGDQ  659
              W  ++  K+ E++D  L  +    EA+R LQ+GL+C Q     RPSMS VV+++   + 
Sbjct  544   VWRNYKLNKITESIDSRLMSDFQEQEASRVLQLGLLCTQTRRFSRPSMSQVVRILRDKET  603

Query  658   DIPQPTQPPFLTSNSAA  608
             ++P P QPPF  S+  A
Sbjct  604   EVPVPMQPPFQNSSLLA  620



>ref|XP_010045529.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
Length=620

 Score =   506 bits (1303),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 278/605 (46%), Positives = 380/605 (63%), Gaps = 37/605 (6%)
 Frame = -2

Query  2386  VSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYA  2207
             ++DPR +E  L   N T   +     V+N +A +  ++  V ++++G   + +    VY 
Sbjct  26    IADPRITEVGLYRENCTGVVAGNG--VSNLIAVMREISKSVANQRWGNYSLTSPPPAVYG  83

Query  2206  FGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNE----  2039
               +C  DL++ +C LCF +  T+I RCLP       GRL+ DGCF RY  Y F+NE    
Sbjct  84    LAQCHGDLTEIECLLCFTESWTRIARCLP-----NFGRLYLDGCFFRYGSYDFYNETVDR  138

Query  2038  -------SSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNS  1880
                    SS+L+      AE       + R  +A+ V   G   A  DG     VG G +
Sbjct  139   TRDMLKCSSNLTVPAERVAELSDRVDRVLRNVSASAVRNKGFAVAGEDG-----VG-GVA  192

Query  1879  TVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIP  1700
              VY LAQCW  +    C  CL  A S   SC P EE R +NAGC++RYST KFYD   IP
Sbjct  193   GVYALAQCWSTLDAVGCRVCLENATSMARSCAPGEEARAMNAGCFLRYSTTKFYD---IP  249

Query  1699  ATNQSGGRSN-HLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNK  1523
                 SGG S   + +++ ++  +   L+++G  A+I  K+  K+++ +  L  +  + +K
Sbjct  250   ---DSGGSSRVRITIVITSSAAATTSLVLIG--AYIGYKKYSKKKQMQNNLIQLQASKSK  304

Query  1522  SKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFN  1343
               L F Y+TLEKAT++FDDS KLGQGG G VYKG+LPDGK VA+KRL FNT  WAD FFN
Sbjct  305   FSLYFKYKTLEKATNFFDDSRKLGQGGGGSVYKGILPDGKVVAVKRLVFNTCNWADDFFN  364

Query  1342  EVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP-LSWEQRYKI  1166
             EVNLI+GI HKNLV+LLGCSI GPESLLVYE++P +SL D      +  P L+WE+R  I
Sbjct  365   EVNLINGIRHKNLVRLLGCSIEGPESLLVYEYLPKRSL-DLVLFVNDASPILTWEERLHI  423

Query  1165  ILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVA  986
             I+GTA+GLAYLH    + IIHRDIK SN+LLDE  T KI+DFGL R    D SH+ST +A
Sbjct  424   IIGTAKGLAYLHGSCGVKIIHRDIKTSNILLDENLTAKISDFGLARCIALDTSHLSTGIA  483

Query  985   GTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGK  806
             GTLGYMAPEY+++G+LTEKADVY+FGVLV+E++SG+KN+ + + S S+LQ  W  +++  
Sbjct  484   GTLGYMAPEYIMRGQLTEKADVYAFGVLVLEILSGRKNNVYARGSSSVLQSVWKHYKSNN  543

Query  805   LYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI-SGDQDIPQPTQPP  632
             L   +D +L+ +  + EA+  LQI L+C QA  ELRP MS VV+M+   +  +PQP QPP
Sbjct  544   LAACIDPALQGKFPILEASNVLQISLLCTQACMELRPPMSEVVEMLHDKNHVVPQPNQPP  603

Query  631   FLTSN  617
             F+ ++
Sbjct  604   FVNTS  608



>emb|CAN64526.1| hypothetical protein VITISV_005913 [Vitis vinifera]
Length=654

 Score =   505 bits (1300),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 282/636 (44%), Positives = 383/636 (60%), Gaps = 41/636 (6%)
 Frame = -2

Query  2425  LFLFIFFLS-INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKY  2249
             LF FI  LS I  S  DPR+    ++C N+    S    +V NFVA ++ ++  + +  +
Sbjct  16    LFFFILTLSVIELSAGDPRSRTIQMMCGNQREHNST--IFVINFVAMMENISNQMRTSGF  73

Query  2248  GETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFV  2069
             G  V+G+     Y   +C  DLS  DC LC+A+ +T + +C PF      GR++ DGCF+
Sbjct  74    GVAVLGSAPDATYGLAQCYGDLSLLDCVLCYAEARTFLPQCFPFTT----GRIYLDGCFM  129

Query  2068  RYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--  1895
             R  +Y F  E +  SD  +CG E    ++  F+ +A   + +    A  N+G+  + V  
Sbjct  130   RAQNYSFIEEYTGPSDHALCGNETRKNST--FQESARQAIKQAVADAPNNNGYARSKVMV  187

Query  1894  -GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFY  1718
              G  N + Y LA CW  +   SC  CL  A S I  CLP  EGR LN GC+MRYS   F 
Sbjct  188   PGTANESAYVLANCWRTLNAISCRACLENASSSILGCLPWSEGRALNTGCFMRYSDTDFL  247

Query  1717  DNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRK-ERKRLGA-  1544
             +    P    S G      +I+ +   +   LL+ G++       I+KQRK ++KR G+ 
Sbjct  248   NKE--PDNGSSRGTII---IIVVSAVSAVIVLLVGGAIGVY----ILKQRKIQKKRRGSN  298

Query  1543  ----MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFF  1376
                 ++ T++ S LNF Y TLEKAT  FD++NKLGQGG G VYKGVL DG+ +A+KRLFF
Sbjct  299   DAIKLVKTLHDSSLNFKYATLEKATGSFDNANKLGQGGFGTVYKGVLADGREIAVKRLFF  358

Query  1375  NTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQ  1196
             N    A  F+NEVN+IS + HKNLV+LLGCS +GPESLL+YEF+PN+SL  +       +
Sbjct  359   NNRHRAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLIYEFLPNKSLDRFIFDTNRGK  418

Query  1195  PLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPE  1016
              L+WE+R +II GTAEGL YLHE +++ IIHRDIK SN+LLD +   KIADFGL R F E
Sbjct  419   ALNWEKRCEIITGTAEGLVYLHENSKIRIIHRDIKASNILLDSKMRAKIADFGLARSFQE  478

Query  1015  DKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSL  842
             DKSHISTA+AGTLGYMAPEY+  G+LTEKADVYSFGVL++E+ +G++N  S   + S SL
Sbjct  479   DKSHISTAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIXTGRQNNRSKTAEYSDSL  538

Query  841   LQQHWNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELRPSMSAVV  680
             +   W  F+ G L E  D +L          + E  R +QIGL+C Q  P LRPSMS  +
Sbjct  539   VTIAWKHFQLGTLEELFDPNLMLHNHDNGNIKNEVLRVMQIGLLCTQEVPSLRPSMSKAL  598

Query  679   KMIS-GDQDIPQPTQPPFLTS-----NSAASSGSYP  590
             +M++  D+ +P PT PPF+       N A  + SYP
Sbjct  599   QMLTKKDEHLPTPTSPPFIDERTMELNEACENPSYP  634



>ref|XP_002265910.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Vitis 
vinifera]
 emb|CBI28578.3| unnamed protein product [Vitis vinifera]
Length=654

 Score =   505 bits (1300),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 282/636 (44%), Positives = 383/636 (60%), Gaps = 41/636 (6%)
 Frame = -2

Query  2425  LFLFIFFLS-INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKY  2249
             LF FI  LS I  S  DPR+    ++C N+    S    +V NFVA ++ ++  + +  +
Sbjct  16    LFFFILTLSVIELSAGDPRSRTIQMMCGNQREHNST--IFVINFVAMMENISNQMRTSGF  73

Query  2248  GETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFV  2069
             G  V+G+     Y   +C  DLS  DC LC+A+ +T + +C PF      GR++ DGCF+
Sbjct  74    GVAVLGSAPDATYGLAQCYGDLSLLDCVLCYAEARTFLPQCFPFTT----GRIYLDGCFM  129

Query  2068  RYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--  1895
             R  +Y F  E +  SD  +CG E    ++  F+ +A   + +    A  N+G+  + V  
Sbjct  130   RAQNYSFIEEYTGPSDHALCGNETRKNST--FQESARQAIKQAVADAPNNNGYARSKVMV  187

Query  1894  -GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFY  1718
              G  N + Y LA CW  +   SC  CL  A S I  CLP  EGR LN GC+MRYS   F 
Sbjct  188   PGTANESAYVLANCWRTLNAISCRACLENASSSILGCLPWSEGRALNTGCFMRYSDTDFL  247

Query  1717  DNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRK-ERKRLGA-  1544
             +    P    S G      +I+ +   +   LL+ G++       I+KQRK ++KR G+ 
Sbjct  248   NKE--PDNGSSRGTII---IIVVSAVSAVIVLLVGGAIGVY----ILKQRKIQKKRRGSN  298

Query  1543  ----MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFF  1376
                 ++ T++ S LNF Y TLEKAT  FD++NKLGQGG G VYKGVL DG+ +A+KRLFF
Sbjct  299   DAIKLVKTLHDSSLNFKYATLEKATGSFDNANKLGQGGFGTVYKGVLADGREIAVKRLFF  358

Query  1375  NTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQ  1196
             N    A  F+NEVN+IS + HKNLV+LLGCS +GPESLL+YEF+PN+SL  +       +
Sbjct  359   NNRHRAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLIYEFLPNKSLDRFIFDTNRGK  418

Query  1195  PLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPE  1016
              L+WE+R +II GTAEGL YLHE +++ IIHRDIK SN+LLD +   KIADFGL R F E
Sbjct  419   ALNWEKRCEIITGTAEGLVYLHENSKIRIIHRDIKASNILLDSKMRAKIADFGLARSFQE  478

Query  1015  DKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSL  842
             DKSHISTA+AGTLGYMAPEY+  G+LTEKADVYSFGVL++E+ +G++N  S   + S SL
Sbjct  479   DKSHISTAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIATGRQNNRSKTAEYSDSL  538

Query  841   LQQHWNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELRPSMSAVV  680
             +   W  F+ G L E  D +L          + E  R +QIGL+C Q  P LRPSMS  +
Sbjct  539   VTIAWKHFQLGTLEELFDPNLMLHNHDNGNIKNEVLRVMQIGLLCTQEVPSLRPSMSKAL  598

Query  679   KMIS-GDQDIPQPTQPPFLTS-----NSAASSGSYP  590
             +M++  D+ +P PT PPF+       N A  + SYP
Sbjct  599   QMLTKKDEHLPTPTSPPFIDERTMELNEACENPSYP  634



>gb|KCW83344.1| hypothetical protein EUGRSUZ_B00278 [Eucalyptus grandis]
Length=611

 Score =   503 bits (1294),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 287/616 (47%), Positives = 377/616 (61%), Gaps = 44/616 (7%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L L  FF S+  +VSDPR +EA LIC N  +P       V+N +A L+ ++  + ++++G
Sbjct  15    LALSSFFFSL--AVSDPRITEAGLICEN--SPWIVTGNVVSNLIATLNEISDRIAAQRWG  70

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
             +  + +    VY   +C  DL +T+C LCF +   QI RCLP       GRL+ DGCF+R
Sbjct  71    KYSLASPPPAVYGLTQCHGDLIETECRLCFTESWIQIARCLP-----NFGRLYLDGCFLR  125

Query  2065  YDDYVFFNE-----------SSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAAN  1919
             Y  Y F+NE           SS+L+      AE       + R  +A+ V   G   A  
Sbjct  126   YGSYDFYNETVDPTHDMLKCSSNLTVPAERVAEFSDRVDRVLRNISASAVRNKGFAVAGE  185

Query  1918  DGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMR  1739
             DG       RG + VY  AQCW  +   SC  CL  A S   SC P EE R +NAGC++R
Sbjct  186   DGV------RGVAGVYAFAQCWSTLDAGSCRVCLENATSMARSCAPGEEARAMNAGCFLR  239

Query  1738  YSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKER  1559
             YST KFYD   +P    SGG S     I  T+  + A  L+L   A+I  K         
Sbjct  240   YSTTKFYD---VP---DSGGSSRVRITIAITSSAAAATSLVLIG-AYIGYK---------  283

Query  1558  KRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLF  1379
             K       +  K  L F Y+TLEKAT++FDDS KLGQGG G VYKG+LPDGK VA+KRL 
Sbjct  284   KYSKKKQTSKTKFSLYFKYKTLEKATNFFDDSRKLGQGGGGSVYKGILPDGKVVAVKRLV  343

Query  1378  FNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNH  1199
             FNT QWAD FFNEVNLISG+ HKNL+++LGCSI GPESL+VYE++P +SL          
Sbjct  344   FNTCQWADDFFNEVNLISGMRHKNLMRILGCSIEGPESLIVYEYLPKRSLDLVLFVNDTT  403

Query  1198  QPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFP  1019
               L+WE+R  II+G AEGLAYLH    + IIHRDIK SN+LLDE  T KI DFGL R   
Sbjct  404   PVLTWEERLHIIIGIAEGLAYLHGGCGVKIIHRDIKSSNILLDENLTAKILDFGLARCIA  463

Query  1018  EDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLL  839
              DKSH+ST +AGTLGYMAPEY+++G+LTEKADVY+FGVLV+E++SG+KNS + + S S+L
Sbjct  464   LDKSHLSTGIAGTLGYMAPEYIMRGQLTEKADVYAFGVLVLEILSGRKNSVYTRGSSSVL  523

Query  838   QQHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI-SG  665
             Q  W  +++  L    D +L+ +  + EA+  LQI L+C QA  ELRP MS VV+M+   
Sbjct  524   QSVWKHYKSNNLAACSDPALQGKFPILEASNVLQISLLCTQACMELRPPMSRVVEMLHDK  583

Query  664   DQDIPQPTQPPFLTSN  617
             ++ +PQP+QPPF+ ++
Sbjct  584   NRVVPQPSQPPFVNAS  599



>gb|KCW83333.1| hypothetical protein EUGRSUZ_B00261 [Eucalyptus grandis]
Length=621

 Score =   503 bits (1295),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 274/604 (45%), Positives = 374/604 (62%), Gaps = 37/604 (6%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             + SDPR +EA L+C N TA          NF+  +  +   +  +++G+  I +    VY
Sbjct  25    AASDPRIAEAGLLCGNSTATVD------VNFITVMKEIFDSIAERRWGKCSIPSPPPPVY  78

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES-S  2033
                +C+ DL+ TDC LCFA+   +I RC P+      GRL+ DGCF+RYD+Y F+NE+  
Sbjct  79    GLAQCLGDLTDTDCVLCFAKSGNRIPRCFPYV-----GRLYLDGCFLRYDNYNFYNETVD  133

Query  2032  SLSDKTVCGAEDFGGNSGLFRRNAAALVGELGR-------KAAANDGF--FTAAVGRGNS  1880
                D   C +     NS +     A     + R        A  + GF         G +
Sbjct  134   PTHDMLKCSS-----NSTVPAERVAEFSDRVDRVLRNVLASAVLSKGFAVAGEDGAGGVA  188

Query  1879  TVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIP  1700
               Y LAQCW  +    C  CL +A S   SC P EE R +NAGC++RYST KFY+   +P
Sbjct  189   GAYALAQCWSTLDAGGCRVCLESATSMARSCAPGEEARAMNAGCFLRYSTTKFYN---VP  245

Query  1699  ATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKS  1520
              +   G     + + +A+   +   L+++G  A+I  K+  K+++ +  L  +  +++K 
Sbjct  246   VSR--GSSRIRITIAIASLAAAVMSLILMG--AYIGCKKYSKEKRVQNSLMQLGGSMSKF  301

Query  1519  KLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNE  1340
              L F YETLEKAT++FDDS KLGQGG G VYKG LPDGK +A+KRL FN  QW D FFNE
Sbjct  302   SLYFKYETLEKATNFFDDSRKLGQGGGGSVYKGNLPDGKVIAVKRLVFNKLQWVDDFFNE  361

Query  1339  VNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP-LSWEQRYKII  1163
             VNLISGI HKNL++LLGCSI GPESLL+YE++PN SL D      N  P L+WE+R  II
Sbjct  362   VNLISGIQHKNLIRLLGCSIEGPESLLIYEYLPNGSL-DKVLFVNNATPVLTWEERLHII  420

Query  1162  LGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAG  983
             +G AEGLA+LH    + IIH DIK SN+LLDE   PKI+DFGL R    DKSH+ST +AG
Sbjct  421   IGIAEGLAFLHGGCGVKIIHWDIKTSNILLDENLMPKISDFGLARCIALDKSHLSTGIAG  480

Query  982   TLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKL  803
             TLGYMAPEY+V+G+LTEKADVY+FGVLV+E+++G+KNS + + S S+LQ  W  +++  L
Sbjct  481   TLGYMAPEYLVKGQLTEKADVYAFGVLVLEILTGRKNSVYTRGSSSVLQSVWKHYKSNNL  540

Query  802   YEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI-SGDQDIPQPTQPPF  629
                +D +L+ +  + EA+  LQI L+C Q S ELRP M  VV+M+   D+ +PQP QPPF
Sbjct  541   AACIDPTLQGKFPILEASNVLQISLLCTQTSMELRPPMPGVVEMLHDKDRVVPQPNQPPF  600

Query  628   LTSN  617
             L ++
Sbjct  601   LNAS  604



>gb|KCW83341.1| hypothetical protein EUGRSUZ_B00274 [Eucalyptus grandis]
Length=621

 Score =   502 bits (1293),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 281/606 (46%), Positives = 378/606 (62%), Gaps = 41/606 (7%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             + SDPR  EA L+C N TA          NF+  +  ++  +  +++G+  I +    VY
Sbjct  25    AASDPRIVEAGLLCGNSTATVD------FNFITVMREISDSIVDRRWGKYSIPSPPPPVY  78

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSS  2030
                +C+ DL+ TDC LCFA+ + +I RCLP     + GRL+ DGCF+RYD+Y F+NE+  
Sbjct  79    GLAQCLGDLTDTDCVLCFAKSRNRIPRCLP-----KVGRLYLDGCFLRYDNYNFYNETVD  133

Query  2029  -------LSDKTVCGAE---DFGGNSGLFRRNAAALVGELGRKAAANDGF--FTAAVGRG  1886
                     S  +   AE   +F        RN  A        A  + GF         G
Sbjct  134   PTHNMLKCSSNSTVPAERVAEFSDRVDRVLRNVLA-------SAVLSKGFAVAGEDGAGG  186

Query  1885  NSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNST  1706
              +  Y LAQCW  +    C  CL +A S   SC P EE R +NAGC++RYST KFY+   
Sbjct  187   VAGAYALAQCWSTLDAGGCRVCLESATSMARSCAPGEEARAMNAGCFLRYSTTKFYN---  243

Query  1705  IPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVN  1526
             +P +   G     + + +A++  +   L+++G  A+I  K+  K+++ +  L  +  + +
Sbjct  244   VPVSR--GSSRIRITIAIASSAAAVTSLVLMG--AYIGCKKYSKEKRVQNSLMQLGASKS  299

Query  1525  KSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFF  1346
             K  L F YETLEKAT++FD+S KLGQGG G VYKG LPDGK +A+KRL FNT QW D FF
Sbjct  300   KFSLYFKYETLEKATNFFDNSRKLGQGGGGSVYKGNLPDGKVIAVKRLVFNTLQWVDDFF  359

Query  1345  NEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP-LSWEQRYK  1169
             NEVNLISGI HKNLV+LLGCSI  PESLLVYE++PN SL D      N  P L+WE+R  
Sbjct  360   NEVNLISGIQHKNLVRLLGCSIESPESLLVYEYLPNGSL-DQVLFVSNATPVLTWEERLH  418

Query  1168  IILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAV  989
             II+G AEGLAYLH    + IIHRDIK SN+LLDE   PKI+DFGL+R    DKSH+ST +
Sbjct  419   IIIGIAEGLAYLHGGCGVKIIHRDIKTSNILLDENLKPKISDFGLIRCIALDKSHLSTGI  478

Query  988   AGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAG  809
             AGTLGYMAPEY+V+G+LTEKADVY+FGVLV+E+++G+KN+ + Q S  +LQ  W  +++ 
Sbjct  479   AGTLGYMAPEYLVRGQLTEKADVYAFGVLVLEILTGRKNNVYTQGSNLVLQLVWKHYKSN  538

Query  808   KLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI-SGDQDIPQPTQP  635
              L   +D +L+ +  V EA+  LQI L+C QAS ELRP M  VV+M+   D+ IPQP QP
Sbjct  539   NLAACIDPALQGKFSVLEASNVLQISLLCTQASMELRPPMPGVVEMLHDKDRIIPQPNQP  598

Query  634   PFLTSN  617
             PFL ++
Sbjct  599   PFLNAS  604



>ref|XP_006344422.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Solanum tuberosum]
Length=653

 Score =   503 bits (1295),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 268/608 (44%), Positives = 371/608 (61%), Gaps = 21/608 (3%)
 Frame = -2

Query  2398  INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNA  2219
             I+ S+ DPR S A + C  R A  +     +  F   ++ L   +   K     +     
Sbjct  2     ISPSLCDPRTSVANVSCKPR-ANVANNVDLIPKFTQVMETLHDFIMENKSATYEMNTNAP  60

Query  2218  TVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNE  2039
              +Y   +C  DLSQ DC LCF + K ++ +C+P      GG ++ DGCF+RY+DY FF+E
Sbjct  61    DIYGMAKCHNDLSQDDCKLCFEEAKIKLTKCIP----APGGSVYLDGCFLRYEDYNFFDE  116

Query  2038  SS-SLSDKTVCGAEDFGGNSGLFRRNAAALV----GELGRKAAANDGFFTAAVGRGNSTV  1874
             S    S   VCGA     N    +R+ AA V      +   +  N GF    V  G   +
Sbjct  117   SILKNSSIYVCGAPTDITNDQYMKRDFAARVDRAIANVTSMSIVNGGFGATIVKSGLLAI  176

Query  1873  YGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPAT  1694
             Y L QCW++++ + C  CL  A   +  CLP  EG+ +NAGCY+RYS+ KF+D+  +   
Sbjct  177   YALGQCWDYLQPEICTMCLNNAGDMLRKCLPAAEGKAMNAGCYLRYSSNKFFDDGALVLA  236

Query  1693  NQSGGRSNHL----PVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVN  1526
             ++   +  ++     ++L++  G FA   ILG  AF+  +R  + +    R+  + + + 
Sbjct  237   DKGPTKCKNVWIIAAIVLSSILGVFA---ILG--AFLGYRRYSQDKGGTNRIHKIPLALE  291

Query  1525  KSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFF  1346
              SKLNF YE LE+AT  FD  NKLGQGGSG VYKG+LPDGK +A+KRL +NT QWA+ FF
Sbjct  292   TSKLNFKYEMLEQATGGFDPLNKLGQGGSGSVYKGILPDGKKIAVKRLLYNTRQWAEEFF  351

Query  1345  NEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKI  1166
             NEVNLISGI HKN+VKLLGCSI GPESLLV++ V N++L      +   Q LSW++R+ I
Sbjct  352   NEVNLISGIQHKNVVKLLGCSIEGPESLLVFDHVSNRNLDQLLFDKNKRQFLSWKERFDI  411

Query  1165  ILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVA  986
             ILG AEG+ +LHE ++  IIHRDIK SN+L+D+E  PKIADFGL R F   K+H+ST VA
Sbjct  412   ILGIAEGITHLHEGSKAKIIHRDIKNSNILVDDELVPKIADFGLARRFAPHKTHVSTGVA  471

Query  985   GTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGK  806
             GTLGY+APEY++QG LTEKADVYSFGV+ IEV    K++ F   + S+LQ  W  ++  K
Sbjct  472   GTLGYLAPEYLLQGCLTEKADVYSFGVVAIEVACCIKSNVFVSDNGSVLQSVWRNYKLNK  531

Query  805   LYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ-DIPQPTQPP  632
             + E++D  L  +    EA+R LQ+GL+C Q     RPSMS VV ++  ++ +IP P QPP
Sbjct  532   ITESIDSRLMSDFQEEEASRVLQLGLLCTQTRRFSRPSMSQVVTILRNEEIEIPTPMQPP  591

Query  631   FLTSNSAA  608
             F  S+  A
Sbjct  592   FQNSSLLA  599



>ref|XP_002318677.2| hypothetical protein POPTR_0012s08890g, partial [Populus trichocarpa]
 gb|EEE96897.2| hypothetical protein POPTR_0012s08890g, partial [Populus trichocarpa]
Length=583

 Score =   499 bits (1286),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 272/598 (45%), Positives = 354/598 (59%), Gaps = 61/598 (10%)
 Frame = -2

Query  2368  SEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAFGECMK  2189
             SE +LIC    + +    +YV N V  +D+L   V S+ +G   I +    +Y   +C  
Sbjct  1     SETSLICG---SSKHIDNSYVPNIVKVMDSLQKQVGSRNWGCGFITSPLLQIYGLAQCHD  57

Query  2188  DLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES-SSLSDKTV  2012
             DLS  DC +CF Q + ++ RCLP        R++ +GCF+RYD+Y FF+E+   ++D  V
Sbjct  58    DLSSLDCKICFFQGRVKLPRCLP----ATSARIYLNGCFIRYDNYNFFHEAIDPMNDAVV  113

Query  2011  CGAEDFGGNSGL----FRRNAAALVGELGRKAAANDGFFTAAVGRGNS-TVYGLAQCWEF  1847
             CG              F++  AA +  +   A  N G F AA  +G   +VY LAQCW  
Sbjct  114   CGEPTNALTDSFLHMEFKQRLAAAIQNVTAMALGN-GTFAAAEAKGRVFSVYALAQCWNT  172

Query  1846  VRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNH  1667
             +    C  CLA A SK+  C P   G    AGCYM+YST+ F+  S      +S  R + 
Sbjct  173   LDKDECRKCLAKAGSKLSQCAPGSGGSAFFAGCYMKYSTRHFFKKSV-----ESKARYD-  226

Query  1666  LPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEK  1487
                                              K   RL         S LNF+YE LEK
Sbjct  227   ---------------------------------KTNLRLSP------NSSLNFTYEVLEK  247

Query  1486  ATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKN  1307
             +T+ FDDS KLGQGG+G V+KG LPDG+TVA+KRL ++T QW D FFNEVNLISGI HKN
Sbjct  248   STECFDDSRKLGQGGAGSVFKGTLPDGRTVAVKRLVYSTRQWVDQFFNEVNLISGIQHKN  307

Query  1306  LVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHE  1127
             LV LLGCSI GPESLLVYE+VPN+SL      +     L+W+QR+ IILGTA GLAYLH 
Sbjct  308   LVILLGCSIEGPESLLVYEYVPNRSLDQILFIKNTLHILNWQQRFNIILGTARGLAYLHG  367

Query  1126  ETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQ  947
                + IIHRDIK SN+LLDE+ TPKIADFGL R    D +HIST +AGTLGYMAPEY+V+
Sbjct  368   GCGVTIIHRDIKTSNILLDEKLTPKIADFGLARCVATDNTHISTGIAGTLGYMAPEYLVR  427

Query  946   GKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEER-  770
             G+LTEK DVY FGVL++E+ +GKKNS F Q S S+L   W  ++A  + + VD  L    
Sbjct  428   GQLTEKVDVYGFGVLLLEIATGKKNSVFSQGSSSILHSVWKHYKANTITDMVDPGLRGMF  487

Query  769   ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ-DIPQPTQPPFLTSNSAASSG  599
             ++ +A + LQIGL+C QAS  LRPSM+ VV+M++  Q +IP P QPPFL ++  +  G
Sbjct  488   SQKQAEKVLQIGLLCTQASSRLRPSMNEVVQMLTDAQCEIPSPKQPPFLNASVLSPDG  545



>ref|NP_001269003.1| uncharacterized protein LOC101255872 [Solanum lycopersicum]
 gb|AGN92795.1| CRK1 [Solanum lycopersicum]
Length=616

 Score =   501 bits (1289),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 257/544 (47%), Positives = 352/544 (65%), Gaps = 14/544 (3%)
 Frame = -2

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             +Y   +C  DLS  DC LCF + KT++ +C+P      GG +  DGCF+RY+DY FF+ES
Sbjct  25    IYGMVKCHNDLSHDDCKLCFEEAKTKLTKCIP----APGGSVHLDGCFLRYEDYTFFDES  80

Query  2035  -SSLSDKTVCGAEDFGGNSGLFRRNAAALVGE----LGRKAAANDGFFTAAVGRGNSTVY  1871
               + S   VCGA     N    +R+ AA V      +   +  N GF    V  G   +Y
Sbjct  81    IQNNSSVYVCGAPTDITNDQYMKRDFAAGVDRAIVNVTSTSIVNGGFGATIVKSGLLAIY  140

Query  1870  GLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATN  1691
              L QCW++++ + C  CL  A   +  CLP  +G+ +NAGCY+RYS+ KF+++  +   +
Sbjct  141   ALGQCWDYLQPEICTKCLNDAGDMLRKCLPAADGKAMNAGCYLRYSSNKFFEDGALVLAD  200

Query  1690  QSGGRSNHLPVILATTFGS-FAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKL  1514
             +   +S ++ VI A    S      ILG  AF+  +R  + +    R+  + + +  SKL
Sbjct  201   KGPTKSKNVWVIAAIVLSSILGIFAILG--AFLGYRRYSQDKGGANRIHKIPLALETSKL  258

Query  1513  NFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVN  1334
             NF YE LE+AT  FD SNKLGQGGSG VYKG+LPDGKT+A+K+L +NT QWA+ FFNEVN
Sbjct  259   NFKYEMLEEATGGFDPSNKLGQGGSGSVYKGILPDGKTIAVKKLLYNTRQWAEEFFNEVN  318

Query  1333  LISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGT  1154
             LISGI HKN+VKLLGCSI GPESLLV++ V N++L      +   Q LSW++R+ IILG 
Sbjct  319   LISGIQHKNVVKLLGCSIEGPESLLVFDHVSNRNLDQLLFDKNKRQFLSWKERFDIILGI  378

Query  1153  AEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLG  974
             AEG+A+LHE ++  IIHRDIK SN+L+D+E  PKIADFGL R F  +K+H+ST +AGTLG
Sbjct  379   AEGIAHLHEGSKATIIHRDIKNSNILVDDELVPKIADFGLARRFAPNKTHVSTGIAGTLG  438

Query  973   YMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEA  794
             Y+APEY++QG LTEKADVYSFGV+ IEV    K++ F   + S+LQ  W  ++  K+ E+
Sbjct  439   YLAPEYLLQGCLTEKADVYSFGVVAIEVACCIKSNVFVSDNGSVLQSVWRNYKLNKITES  498

Query  793   VDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ-DIPQPTQPPFLTS  620
             +D  L  +    EA+R LQIGL+C Q     RPSMS VV+++  ++ +IP PTQPPF  S
Sbjct  499   IDSRLMSDFQEQEASRVLQIGLLCTQTRRFSRPSMSQVVRILRNEEIEIPTPTQPPFQNS  558

Query  619   NSAA  608
             +  A
Sbjct  559   SLLA  562



>ref|XP_008390081.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Malus 
domestica]
Length=381

 Score =   491 bits (1265),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 236/327 (72%), Positives = 274/327 (84%), Gaps = 1/327 (0%)
 Frame = -2

Query  1564  ERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKR  1385
             E+K+ GA+  TVNKSKLNFSYE LEKAT+YF D+NKLGQGGSG VYKGVLP G  VAIKR
Sbjct  37    EKKQFGALFATVNKSKLNFSYEVLEKATNYFHDTNKLGQGGSGSVYKGVLPGGNVVAIKR  96

Query  1384  LFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARK  1205
             LFFNT QW DHFFNEVNLISGIHHKNL+KLLGCSITGPESLLVYE+VPNQSL+DY   + 
Sbjct  97    LFFNTRQWVDHFFNEVNLISGIHHKNLLKLLGCSITGPESLLVYEYVPNQSLHDYFIVKN  156

Query  1204  NHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRL  1025
             N +PL W+ RYKIILGTAEGLAYLHEE++L IIHRDIKLSN+LLDEEF  KIADFGL R+
Sbjct  157   NVEPLRWDLRYKIILGTAEGLAYLHEESKLRIIHRDIKLSNILLDEEFNAKIADFGLARM  216

Query  1024  FPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVS  845
             FPEDK+HISTA+AGTLGYMAPEY V+GKLTEKADVYSFGVLVIEV+ G++N+S   +S S
Sbjct  217   FPEDKTHISTAIAGTLGYMAPEYAVRGKLTEKADVYSFGVLVIEVICGRRNNSVLSSSTS  276

Query  844   LLQQHWNLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS  668
             +LQ  W+L+   +L EAVD  LE +    EA+R LQIGL+CVQAS ELRP+MS VVKM++
Sbjct  277   ILQMTWDLYGTCRLREAVDPLLEGKFENEEASRLLQIGLLCVQASAELRPAMSLVVKMLT  336

Query  667   GDQDIPQPTQPPFLTSNSAASSGSYPN  587
              + +IPQPTQPPFL S +A  +   P+
Sbjct  337   ENLEIPQPTQPPFLNSGTAKFNRRIPS  363



>ref|XP_009768898.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X2 [Nicotiana sylvestris]
Length=652

 Score =   501 bits (1291),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 273/635 (43%), Positives = 382/635 (60%), Gaps = 29/635 (5%)
 Frame = -2

Query  2425  LFLFIFFLSI-NRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKY  2249
             LF+ +  L + N S ++PR+    +IC N+   +     YV NFVA ++ ++  + ++ Y
Sbjct  12    LFVILSILLLPNVSEAEPRSQPVQIICGNQH--EHNTTIYVPNFVATMETISEQMRTRGY  69

Query  2248  GETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFV  2069
             G  V G G    Y   +C  DLS  DC LC+A+ +T + +C P+     GGR++ DGCF+
Sbjct  70    GVAVTGTGLDANYGLAQCYGDLSLLDCVLCYAEARTVLPQCFPYN----GGRIYLDGCFM  125

Query  2068  RYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--  1895
             R ++Y F+++     D+ VCG     G+  LF++ A   V +    A  ++G+  A V  
Sbjct  126   RAENYTFYDQYLGPEDRHVCGNRTRKGS--LFQQTARQAVQQAVANAPNSNGYARAEVAV  183

Query  1894  -GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFY  1718
              G  N T Y  A CW  +   SC  CL  A + +  CLP  EGR L  GC+MRYS   F 
Sbjct  184   PGATNETAYVQADCWRTLSANSCRACLQNASASMMGCLPWSEGRALYTGCFMRYSDVNFL  243

Query  1717  DNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVR-KRIVKQRKERKRLGAM  1541
             +   I  +  S    N + +++A        ++      ++ + K+I K+RK    +  +
Sbjct  244   N--AIATSGDSSSNGNVVVIVIAVVSAVVVLVVGAVIAFYMWKNKQIQKKRKGSNDVEKL  301

Query  1540  LVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQW  1361
             + T+N S LNF Y TLEKAT  FD++NKLGQGG G VYKGVL DG+ +A+KRLFFN    
Sbjct  302   VKTLNDSSLNFKYSTLEKATGSFDEANKLGQGGFGTVYKGVLQDGREIAVKRLFFNNKHR  361

Query  1360  ADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWE  1181
             A  F+NEVN+IS + HKNLV+LLGCS +GPESLLVYEF+PNQSL  +       + L+WE
Sbjct  362   AADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEFLPNQSLDRFIFDPSKGKTLNWE  421

Query  1180  QRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHI  1001
             +R++II+GTAEGL YLHE  +  IIHRDIK SN+LLD     KIADFGL R F EDKSHI
Sbjct  422   KRFEIIIGTAEGLVYLHENNKTRIIHRDIKASNILLDSRLRAKIADFGLARSFQEDKSHI  481

Query  1000  STAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHW  827
             STA+AGTLGYMAPEY+  G+LTEKADVYSFGVL++E+V+G++N  S   + S SL+   W
Sbjct  482   STAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIVTGRQNNRSKHTEYSDSLISIAW  541

Query  826   NLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELRPSMSAVVKM-IS  668
               F+ G++ E  D +L            E  R + +GL+C Q  P LRPSMS  ++M + 
Sbjct  542   QHFQHGRVEELFDPNLMLHNYHTINVENEVLRVVHVGLLCTQEVPGLRPSMSKALQMLVK  601

Query  667   GDQDIPQPTQPPFLTSNSAA-----SSGSYPNRGG  578
              ++++P PT PPF+   +        + SYP+R G
Sbjct  602   KEEELPAPTNPPFVDEKTMELHDPWDTPSYPHREG  636



>emb|CAN71641.1| hypothetical protein VITISV_031461 [Vitis vinifera]
Length=665

 Score =   502 bits (1292),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 279/643 (43%), Positives = 378/643 (59%), Gaps = 42/643 (7%)
 Frame = -2

Query  2425  LFLFIFFLS-INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKY  2249
             LFLFI  LS I  S  DPR+    + C N+  P+     +V NFVA ++ ++  V +  +
Sbjct  14    LFLFIITLSVIELSAGDPRSRMIQITCANQ--PEHNSTIFVPNFVAMMENISNQVRTSGF  71

Query  2248  GETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFV  2069
             G  + G+G    Y   +C  DLS  DC LC+A+ +T + +C P+     GGR++ DGCF+
Sbjct  72    GVAISGSGPDANYGLAQCYGDLSLLDCVLCYAEARTVLPQCFPYN----GGRIYLDGCFM  127

Query  2068  RYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--  1895
             R  +Y F  E +  SD  +CG E    ++  F+ +A   + +    A  N+G+  + V  
Sbjct  128   RAQNYSFIEEYTGPSDHALCGNETRKNST--FQESARQAIKQAVADAPNNNGYARSKVIV  185

Query  1894  -GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFY  1718
              G  N + Y LA CW  +   SC  CL  A S I  CLP  EGR LN GC+MRYS   F 
Sbjct  186   PGTANESAYVLADCWRTLNASSCRACLENASSSILGCLPWSEGRALNTGCFMRYSDTDFL  245

Query  1717  DNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLG---  1547
             +    P    S G    + V           L  +G V    +++I K+R+ +K L    
Sbjct  246   NKE--PDNGSSRGTVIIIVVPAVXAVIVLLVLGAIG-VYIWKQRKIQKKRRGKKILENKF  302

Query  1546  ----------AMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTV  1397
                        ++ T++ S LNF Y TLEKAT  FD+ NKLGQGG G VYKGVL DG+ +
Sbjct  303   LFENGSNDAIKLVKTLHDSSLNFKYATLEKATGSFDNENKLGQGGFGTVYKGVLTDGREI  362

Query  1396  AIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYT  1217
             A+KRLFFN    A  F+NEVN+IS + HKNLV+LLGCS +GPESLLVYE++PN+SL  + 
Sbjct  363   AVKRLFFNNRHRAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEYLPNKSLDRFI  422

Query  1216  SARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFG  1037
                   + L+WE+R +II+GTAEGLAYLHE +   IIHRDIK SN+LLD +   KIADFG
Sbjct  423   FDTNRGKALNWEKRCEIIIGTAEGLAYLHENSTNRIIHRDIKASNILLDSKMRAKIADFG  482

Query  1036  LVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSF  863
             L R F EDKSHI+TA+AGTLGYMAPEY+  G+LTEK DVYSFGVL++E+V+G++N  S  
Sbjct  483   LARSFQEDKSHITTAIAGTLGYMAPEYLAHGQLTEKXDVYSFGVLLLEIVTGRQNNRSKT  542

Query  862   YQASVSLLQQHWNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELR  701
              + S S +   W  F+ G L E  D +L          + E  R +QI L+C Q +P LR
Sbjct  543   XEYSDSJVTIAWKHFQLGTLEELFDPNLMLHNYHNGNIKNEVLRVMQIALLCTQEAPSLR  602

Query  700   PSMSAVVKMIS-GDQDIPQPTQPPFLTS-----NSAASSGSYP  590
             PSMS  ++M++  D+ +P PT PPF+       N A ++ SYP
Sbjct  603   PSMSKALQMLTKKDEHLPTPTNPPFIDERTMELNEACANPSYP  645



>gb|KCW83350.1| hypothetical protein EUGRSUZ_B00284, partial [Eucalyptus grandis]
Length=564

 Score =   498 bits (1281),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 269/554 (49%), Positives = 356/554 (64%), Gaps = 18/554 (3%)
 Frame = -2

Query  2308  VANFVAALDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILR  2129
             V+NF+  +  +   V   ++    + +    +YA  +C  DLS  DC LCFAQ +T + R
Sbjct  13    VSNFLNVMLKVLAKVTEDRWANDSVTSPLPEIYALAQCHGDLSYDDCLLCFAQSRTILPR  72

Query  2128  CLPFQRLVRGGRLFYDGCFVRYDDYVFFNES-SSLSDKTVCGAEDFGGNSGLFRRNAAAL  1952
             C     L   GRL+ DGCF+R D Y FFNE+     D   C  +         R+  A  
Sbjct  73    C---TILDTKGRLYLDGCFIRSDYYNFFNETIDPQHDMVKCANQSSVSADQQVRQQFATK  129

Query  1951  VGELGRKAAA----NDGF--FTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGS  1790
             V  +    +A    N GF  F  A   G + VY LAQCW  +  K C +CLA A+ +  +
Sbjct  130   VDRVLTNVSAVAPENKGFAVFGEARRGGVAGVYALAQCWNTLDKKGCRECLANAMIRARN  189

Query  1789  CLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILG  1610
             C P +EGR +NAGC+MRYST+ FY       T  + G S+ L + +A      A   ++ 
Sbjct  190   CTPGDEGRAMNAGCFMRYSTQSFY-------TVHTDGDSSKLGIKIAIASSVAAATSLVL  242

Query  1609  SVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCV  1430
               A++  +++ K+R+ +K+L  +   V K  LNF+YE+LEKATD+FD+S KLGQGG+G V
Sbjct  243   VGAYVGYRQLSKKREVQKKLFGVPAIVRKLNLNFNYESLEKATDFFDESRKLGQGGAGSV  302

Query  1429  YKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYE  1250
             +KG+LPDG+ VA+KRL FNT +W D  FNEVNLISGI HKNLV+LLGCSI GPESLLVYE
Sbjct  303   FKGILPDGRVVAVKRLVFNTREWVDDLFNEVNLISGIQHKNLVRLLGCSIEGPESLLVYE  362

Query  1249  FVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLD  1070
             +VPN+SL      +   + LSW++R  II GTAEGLA+LH    + IIHRDIK SNVLLD
Sbjct  363   YVPNRSLDQILFVKNATRILSWQERLNIISGTAEGLAFLHGPCGVKIIHRDIKSSNVLLD  422

Query  1069  EEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEV  890
             E+ T KIADFGL R    +KSH+ST +AGTLGYMAPEY+V+G+LTEKADVYSFGVLV+E+
Sbjct  423   EDLTAKIADFGLARCLDPEKSHLSTGIAGTLGYMAPEYLVKGQLTEKADVYSFGVLVLEI  482

Query  889   VSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQAS  713
             +SG+KN  F QAS S+LQ  W  +++  L E +D  L+ +  V EA   +QI L+C QAS
Sbjct  483   LSGRKNRIFGQASGSVLQSVWKQYKSNSLAECIDPVLKGKFPVSEALNVIQIALLCTQAS  542

Query  712   PELRPSMSAVVKMI  671
             P+LRPSMS VV+M+
Sbjct  543   PDLRPSMSEVVEML  556



>gb|KHG30441.1| Cysteine-rich receptor-like protein kinase 1 [Gossypium arboreum]
Length=633

 Score =   499 bits (1286),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 265/570 (46%), Positives = 364/570 (64%), Gaps = 16/570 (3%)
 Frame = -2

Query  2317  QAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQ  2138
             Q +V +    + AL+ L+ ++ +G         TV+  G+C + ++   C LCF   K +
Sbjct  48    QRFVRSVDKVMGALSKLIAAQGWGTFSDVDPPFTVFGLGQCYQHVNGKGCKLCFNTAKEE  107

Query  2137  ILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES-SSLSDKTVCGAEDFGGNSGLFRRNA  1961
             + RC+P       GR+F D CF R+D+Y+F+NE   +  D  +CG+   G     F+R  
Sbjct  108   LRRCVP----ATSGRIFLDWCFQRFDNYMFYNEGVDAKYDHLICGSPA-GVYQQEFQREL  162

Query  1960  AALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLP  1781
               ++ ++   A  N+G+   A   G +TVY LAQCW  +  ++C +CL  A S +  C P
Sbjct  163   DQVIRKVTNTALENNGYAAKAAKGGVTTVYALAQCWRAIDLETCSECLRHAASGLRKCPP  222

Query  1780  KEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVA  1601
               EG+ + +GCYMRYST +F+       T  + G S  + + LA+   + A L  +G+  
Sbjct  223   GAEGKAMFSGCYMRYSTHRFFGPEA--ETEDNKGFSPWVIIGLASAGVACAVLGAIGT--  278

Query  1600  FIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKG  1421
             +I  KR  K    +K L  +  T N + LN+ Y TLEKATD+FD+S KLGQGG+G V+KG
Sbjct  279   YISYKRFSK----KKGLDDIPATRNNTSLNYMYGTLEKATDHFDESRKLGQGGAGTVFKG  334

Query  1420  VLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVP  1241
             +LPDGK VA+KRLFFNT QW D FFNEVNLISGI HKNLV LLGCSI GPESLLVYE+VP
Sbjct  335   ILPDGKVVAVKRLFFNTRQWVDQFFNEVNLISGIQHKNLVSLLGCSIEGPESLLVYEYVP  394

Query  1240  NQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEF  1061
             N+SL      +     LSW  R+ II GTAEGLAYLH  + + IIHRDIK SN+LLDE  
Sbjct  395   NRSLDQILFVKNTINILSWSHRFNIICGTAEGLAYLHGGSGVKIIHRDIKSSNILLDENL  454

Query  1060  TPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSG  881
              PKIADFGL      DKSH+STA+AGTLGYMAPEY+V+G+LTEKADVY+FGVL++E+ +G
Sbjct  455   NPKIADFGLACCVASDKSHVSTAIAGTLGYMAPEYLVRGQLTEKADVYAFGVLMLEIATG  514

Query  880   KKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPEL  704
             +KN+ F + S S L   W  ++A  + +A+D +L+ R    EA+  L++GL+C Q+S  L
Sbjct  515   RKNNVFCERSSSTLYLVWKQYKAESITQAIDSTLKGRFDEREASIVLRVGLLCTQSSVAL  574

Query  703   RPSMSAVVKMISGDQ-DIPQPTQPPFLTSN  617
             RP+MS V +M++  +  IP P QPPFL ++
Sbjct  575   RPTMSEVAQMLTDRRCVIPSPKQPPFLNAS  604



>ref|XP_010023497.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Eucalyptus 
grandis]
 ref|XP_010023498.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Eucalyptus 
grandis]
 ref|XP_010023499.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Eucalyptus 
grandis]
 gb|KCW59789.1| hypothetical protein EUGRSUZ_H02538 [Eucalyptus grandis]
Length=651

 Score =   500 bits (1287),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 271/621 (44%), Positives = 368/621 (59%), Gaps = 36/621 (6%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             +V DPR     + C+     +     +V NFVA ++ ++  + +  +G  VIG+G    Y
Sbjct  26    AVGDPRTHNVRMTCS--VEREHNSTLFVPNFVATMENISEQMRTSGFGTAVIGSGPDANY  83

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSS  2030
                +C  DLS  DC LC+A+ ++ + +C PF     GGR++ DGCF+R  +Y FF E + 
Sbjct  84    GLSQCYGDLSLLDCVLCYAEARSLLPQCYPFN----GGRIYLDGCFMRAQNYSFFEEYTG  139

Query  2029  LSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTA---AVGRGNSTVYGLAQ  1859
               D  +CG  +       F+ +A   V     +A  N+G+  A     G  N + Y LA 
Sbjct  140   PQDGAMCG--NVTRKDTTFQDSARKAVASAVARAPNNNGYARAEEVVSGTANESAYVLAD  197

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGG  1679
             CW  +   SC  CL  A + I  CLP  EGR LN GC+MRYS   F +N       Q G 
Sbjct  198   CWRTLNATSCMACLRNASASILKCLPWSEGRALNTGCFMRYSDTNFLNN-------QPGN  250

Query  1678  RSNHLPVILATTFGSFAFLL--ILGSVAFIV--RKRIVKQRKERKRLGAMLVTVNKSKLN  1511
              SN   +I+ T       ++  +  ++A+ V   K I K+RK        +  ++ S LN
Sbjct  251   GSNKGTIIVITVSVVSGLVVLAVGITIAYFVWKHKYIQKKRKGSNHAEKFVKILHDSSLN  310

Query  1510  FSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNL  1331
             F Y TLEKAT  FD +NKLGQGG G VYKGVLPDG+ +A+KRLFFN    A  F+NEVN+
Sbjct  311   FKYSTLEKATGSFDSANKLGQGGFGTVYKGVLPDGREIAVKRLFFNNRHRAADFYNEVNI  370

Query  1330  ISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTA  1151
             IS + HKNLV+LLGCS +GPESLLVYEF+PN+SL  +       + L+WE+R  II+GTA
Sbjct  371   ISSVEHKNLVRLLGCSCSGPESLLVYEFLPNRSLDRFIFDANKGKALNWEKRVDIIVGTA  430

Query  1150  EGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGY  971
             EGL YLHE  +  IIHRDIK SN+LLD +   KIADFGL R F EDKSHISTA+AGTLGY
Sbjct  431   EGLVYLHENFKNKIIHRDIKASNILLDSKLRAKIADFGLARSFQEDKSHISTAIAGTLGY  490

Query  970   MAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHWNLFRAGKLYE  797
             MAPEY+  G+LTEKADVYS+GVL++E V+G++N  S   + S SL+   WN F+A ++ E
Sbjct  491   MAPEYLAHGQLTEKADVYSYGVLLLETVTGRQNNRSKNLEYSESLITIAWNHFQANRVEE  550

Query  796   AVDGSL------EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS-GDQDIPQPTQ  638
               D SL          + E  R + IGL+C Q +P LRP+MS  ++M++  ++++P PT 
Sbjct  551   LFDPSLMLHNHHNRNIKNEVLRVIHIGLLCTQEAPSLRPTMSEALQMLTKKNEELPPPTN  610

Query  637   PPFLTS-----NSAASSGSYP  590
             PPF+       N A    S+P
Sbjct  611   PPFIDERTMELNDACDDPSFP  631



>ref|XP_009768897.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X1 [Nicotiana sylvestris]
Length=653

 Score =   500 bits (1287),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 274/636 (43%), Positives = 384/636 (60%), Gaps = 30/636 (5%)
 Frame = -2

Query  2425  LFLFIFFLSI-NRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKY  2249
             LF+ +  L + N S ++PR+    +IC N+   +     YV NFVA ++ ++  + ++ Y
Sbjct  12    LFVILSILLLPNVSEAEPRSQPVQIICGNQH--EHNTTIYVPNFVATMETISEQMRTRGY  69

Query  2248  GETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFV  2069
             G  V G G    Y   +C  DLS  DC LC+A+ +T + +C P+     GGR++ DGCF+
Sbjct  70    GVAVTGTGLDANYGLAQCYGDLSLLDCVLCYAEARTVLPQCFPYN----GGRIYLDGCFM  125

Query  2068  RYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--  1895
             R ++Y F+++     D+ VCG     G+  LF++ A   V +    A  ++G+  A V  
Sbjct  126   RAENYTFYDQYLGPEDRHVCGNRTRKGS--LFQQTARQAVQQAVANAPNSNGYARAEVAV  183

Query  1894  -GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFY  1718
              G  N T Y  A CW  +   SC  CL  A + +  CLP  EGR L  GC+MRYS   F 
Sbjct  184   PGATNETAYVQADCWRTLSANSCRACLQNASASMMGCLPWSEGRALYTGCFMRYSDVNFL  243

Query  1717  DNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVR-KRIVKQRKERKRLGAM  1541
             +   I  +  S    N + +++A        ++      ++ + K+I K+RK    +  +
Sbjct  244   N--AIATSGDSSSNGNVVVIVIAVVSAVVVLVVGAVIAFYMWKNKQIQKKRKGSNDVEKL  301

Query  1540  LVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQW  1361
             + T+N S LNF Y TLEKAT  FD++NKLGQGG G VYKGVL DG+ +A+KRLFFN    
Sbjct  302   VKTLNDSSLNFKYSTLEKATGSFDEANKLGQGGFGTVYKGVLQDGREIAVKRLFFNNKHR  361

Query  1360  ADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNH-QPLSW  1184
             A  F+NEVN+IS + HKNLV+LLGCS +GPESLLVYEF+PNQSL  +  A  +  + L+W
Sbjct  362   AADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEFLPNQSLDRFIFADPSKGKTLNW  421

Query  1183  EQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSH  1004
             E+R++II+GTAEGL YLHE  +  IIHRDIK SN+LLD     KIADFGL R F EDKSH
Sbjct  422   EKRFEIIIGTAEGLVYLHENNKTRIIHRDIKASNILLDSRLRAKIADFGLARSFQEDKSH  481

Query  1003  ISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQH  830
             ISTA+AGTLGYMAPEY+  G+LTEKADVYSFGVL++E+V+G++N  S   + S SL+   
Sbjct  482   ISTAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIVTGRQNNRSKHTEYSDSLISIA  541

Query  829   WNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELRPSMSAVVKM-I  671
             W  F+ G++ E  D +L            E  R + +GL+C Q  P LRPSMS  ++M +
Sbjct  542   WQHFQHGRVEELFDPNLMLHNYHTINVENEVLRVVHVGLLCTQEVPGLRPSMSKALQMLV  601

Query  670   SGDQDIPQPTQPPFLTSNSAA-----SSGSYPNRGG  578
               ++++P PT PPF+   +        + SYP+R G
Sbjct  602   KKEEELPAPTNPPFVDEKTMELHDPWDTPSYPHREG  637



>ref|XP_010026658.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Eucalyptus 
grandis]
Length=648

 Score =   499 bits (1286),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 280/645 (43%), Positives = 385/645 (60%), Gaps = 47/645 (7%)
 Frame = -2

Query  2461  TMNRKMASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALD  2282
             T  R +A+LS      I  L +  +  DPRA      C++   P      +V NFVA ++
Sbjct  10    TQRRLLAALS------IVLLEL--AAGDPRAQIVNRTCSH--VPGHNTTVFVPNFVATME  59

Query  2281  ALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVR  2102
              ++  + +  +G   IG+G    YA  +C  DLS  DC LC+A+ ++ + +C P+     
Sbjct  60    NISNQMRTSGFGLATIGSGPDASYALSQCYGDLSLLDCVLCYAEARSALPQCYPYN----  115

Query  2101  GGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAA  1922
              GR+F DGCF+R ++Y FF E +   D  VCG  +    S  F  +    V +   +A  
Sbjct  116   SGRIFLDGCFMRGENYSFFQEYTGPQDARVCG--NVTRKSATFYDSVRQAVAKAVVRAPN  173

Query  1921  NDGFFTAAV--GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGC  1748
             NDG+  A V  G  N + Y LA CW  +   SC  CL  A   I  CLP+ EGR LN GC
Sbjct  174   NDGYARAEVVLGTANESAYLLANCWRTLNATSCRACLENASRSILGCLPRSEGRALNTGC  233

Query  1747  YMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLI----LGSVAFIVRKRI  1580
             +MRYS   F         N+  G+ +    I+A T    + L++    +  V F+ + + 
Sbjct  234   FMRYSDTNFL--------NKEPGKGSKKGTIIALTVPVVSALVVLAVGITIVYFVWKHKY  285

Query  1579  V-KQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGK  1403
             V K+RK        +  ++ S LNF Y TLEKAT+ FD +NKLGQGG G VYKGVLPDG+
Sbjct  286   VQKKRKGSDDAEKFVKILHDSSLNFKYSTLEKATESFDSANKLGQGGFGTVYKGVLPDGR  345

Query  1402  TVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYD  1223
              +A+KRLFFNT Q    F+NEVN+IS + HKNLV+LLGCS +GP+SLLVYEF+PN+SL +
Sbjct  346   EIAVKRLFFNTRQRVAEFYNEVNIISRVEHKNLVRLLGCSFSGPDSLLVYEFLPNKSLDN  405

Query  1222  YTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIAD  1043
             +       + LSWE+R  I++GTAEGL YLHE ++  IIHRDIK SN+LLD  F  KIAD
Sbjct  406   FIFDTNRGKALSWEKRVDIMVGTAEGLVYLHESSK--IIHRDIKASNILLDSRFRAKIAD  463

Query  1042  FGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--S  869
             FGL R F EDKSHISTA+AGTLGYMAPEY+ +G+LTEKADVYS+GVL++E V+G +N  S
Sbjct  464   FGLARSFQEDKSHISTAIAGTLGYMAPEYLARGQLTEKADVYSYGVLLLENVTGIQNNRS  523

Query  868   SFYQASVSLLQQHWNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPE  707
                + S SL+Q  WN F+A ++ E  D +L      +   + E +R + IGL+C+Q +P 
Sbjct  524   KTSEYSDSLVQIAWNHFQANRVEELFDPNLMLHNYPDSNIKNEVSRVVHIGLLCMQEAPS  583

Query  706   LRPSMSAVVKMIS-GDQDIPQPTQPPF-----LTSNSAASSGSYP  590
             LRP MS  ++M++  D+++P  T PPF     +T N      S+P
Sbjct  584   LRPKMSKALEMLTKKDEELPPTTNPPFIDERTMTLNDMCKEQSFP  628



>ref|XP_004489796.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X1 [Cicer arietinum]
 ref|XP_004489797.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X2 [Cicer arietinum]
 ref|XP_004489798.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X3 [Cicer arietinum]
 ref|XP_004489799.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X4 [Cicer arietinum]
Length=654

 Score =   499 bits (1286),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 272/622 (44%), Positives = 375/622 (60%), Gaps = 31/622 (5%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             +FL  F L     +++PRA    + C N    +     +V NFVA ++ ++  + +  +G
Sbjct  15    IFLIKFALLSETVMAEPRAKTVFITCGN--ILEHNTSIFVPNFVATMEKISEQMRTTGFG  72

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
               V G G  T Y   +C  DLS  DC LC+A+ +T + +C P+      GR++ DGCF+R
Sbjct  73    TAVTGTGLDTNYGLAQCYGDLSLLDCVLCYAEARTVLPQCFPYN----SGRIYLDGCFMR  128

Query  2065  YDDYVFFNESSSLSDKTVCGAEDFGGNSGL-FRRNAAALVGELGRKAAANDGFFTAAV--  1895
              ++Y FFNE +   D+ +CG      N  L FR  A   V    + A  N G+    V  
Sbjct  129   SENYSFFNEYTGQGDRALCGNRT---NKNLGFRAAAKEAVLRAVQGAPENKGYARGKVDV  185

Query  1894  -GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFY  1718
              G  N +VY LA CW  +  +SC  CL  A S I  CLP  EGR LN GC+MRYS   F 
Sbjct  186   SGTANESVYVLADCWRNLDSRSCKACLEKASSSILRCLPASEGRALNTGCFMRYSNNDFL  245

Query  1717  DNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKR-IVKQRKERKRLGAM  1541
             +       + SGG    + V + ++      ++ +G  A+I ++R I K+R+       +
Sbjct  246   NKEV--ENDSSGGNVLVIVVAVVSSVIVTVVVVTIG--AYICKQRYIQKKRRGSNDAEKL  301

Query  1540  LVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQW  1361
               T+    LNF Y TLEKAT  F+D NKLG GG G VYKGVLPDG+ +AIKRL+FN    
Sbjct  302   AKTLQHKSLNFKYSTLEKATGSFNDDNKLGHGGFGTVYKGVLPDGRQIAIKRLYFNNRHR  361

Query  1360  ADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWE  1181
             A  F+NEVN+ISG+ HKNLV+LLGCS +GPESLLVYE++PN+SL  +   +   + L+WE
Sbjct  362   AADFYNEVNIISGVEHKNLVRLLGCSCSGPESLLVYEYLPNRSLDRFIFDKNKGKELNWE  421

Query  1180  QRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHI  1001
             +RY+II+GTAEGL YLHE + + IIHRDIK SN+LLD +F  KIADFGL R F EDKSHI
Sbjct  422   KRYEIIIGTAEGLVYLHENSNVRIIHRDIKASNILLDAKFRAKIADFGLARSFQEDKSHI  481

Query  1000  STAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHW  827
             STA+AGTLGY+APEY+  G+LTEKADVYSFGVL++E+V+G+ N  S   + S SL+   W
Sbjct  482   STAIAGTLGYIAPEYLAHGQLTEKADVYSFGVLLLEIVTGRLNNRSKESEYSDSLIIVTW  541

Query  826   NLFRAGKLYEAVDGSLE--------ERARVEATRQLQIGLVCVQASPELRPSMSAVVKMI  671
               F+ G   +  D ++E        +  + E  R + IGL+C Q  P LRP+MS  ++M+
Sbjct  542   KHFQLGTAEQLFDPNIELHDNDNNSDVIKNEILRVIHIGLLCTQEVPSLRPTMSKALQML  601

Query  670   SGDQ---DIPQPTQPPFLTSNS  614
             S ++   D+  P+ PPFL  ++
Sbjct  602   SKNEEHLDLVAPSNPPFLDEST  623



>ref|XP_010040446.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Eucalyptus 
grandis]
Length=845

 Score =   506 bits (1303),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 279/597 (47%), Positives = 372/597 (62%), Gaps = 36/597 (6%)
 Frame = -2

Query  2362  AALICTNRTAPQSQRQAYVAN--FVAALDALTPLVDSKKYGE--TVIGAGNATVYAFGEC  2195
             A L C N T    +  A + N  F+  +  +T  V ++++G+    + +    VY   +C
Sbjct  253   AGLYCNNST----EIVAGIVNHDFITIMREITGSVANRRWGKANNSLASPPTVVYGLAQC  308

Query  2194  MKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLSDKT  2015
               DL +TDC LCFA+ +T+I RCLP       GRL+ DGCF+RYD Y F+NE+   +   
Sbjct  309   HGDLIETDCLLCFAESRTRIPRCLP-----NFGRLYLDGCFLRYDSYDFYNETVDPTHDM  363

Query  2014  VCGAEDFGGNSGLFRRNAAALVGELGR-------KAAANDGFFTAAV--GRGNSTVYGLA  1862
             +    +   NS +    AA     L R        A  N GF  A      G + VY LA
Sbjct  364   L----NCSSNSTVLVWTAAEFWDRLDRVLRNVLASALQNGGFAVAGEDGAEGAAGVYALA  419

Query  1861  QCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSG  1682
             QCW  +    C  CL  A SK  +C P  E R  NAGC++RYST KFY+   +P +    
Sbjct  420   QCWSTLDAGGCRVCLENAASKARNCTPAGEARATNAGCFLRYSTTKFYN---VPVS----  472

Query  1681  GRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSY  1502
             G S    + +A    + A  L+L S A+I  K+  K+++ +  L  +  +++K +L F Y
Sbjct  473   GVSYEFRMTVAIASSAVAISLVLIS-AYIGYKKYSKKKQVQNSLMQLRASMSKFRLYFKY  531

Query  1501  ETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISG  1322
             ETLEKAT++FDDS+KLGQGG G VYKG+LPD K +A+KRL FNT QWAD  FNEVNLISG
Sbjct  532   ETLEKATNFFDDSSKLGQGGGGSVYKGILPDKKVIAVKRLVFNTRQWADDLFNEVNLISG  591

Query  1321  IHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGL  1142
             I HKNLV+LLGCSI GP SLLVYE++ N+SL            LSWE+R  II+GTAEGL
Sbjct  592   IQHKNLVRLLGCSIEGPNSLLVYEYLSNKSLDQVLLVNNAILVLSWEERLHIIIGTAEGL  651

Query  1141  AYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAP  962
             AYLH    + IIHRDIK SN+LLDE  T KIA+FGL R    DKSH+ST +AGT+GYMAP
Sbjct  652   AYLHGGCGVKIIHRDIKASNILLDENLTAKIANFGLARCIALDKSHLSTGIAGTIGYMAP  711

Query  961   EYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGS  782
             EY+V+G+LTEKADVY+FGVLV+E+++G+KNS + + S S+LQ  W  +++  L   +D +
Sbjct  712   EYLVRGQLTEKADVYAFGVLVMEILTGRKNSVYTRGSSSILQSVWEHYKSNNLAVCIDPA  771

Query  781   LEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPFLTSN  617
             L+ +  V E +  LQI L+C QAS ELRP MS VV+M+   D+ +PQP QPPFL ++
Sbjct  772   LQGKFPVLEVSNVLQISLLCTQASMELRPPMSGVVEMLHDKDRVVPQPNQPPFLNAS  828


 Score =   136 bits (342),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 120/246 (49%), Gaps = 22/246 (9%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L L  FF S+  +VS+PR +EA   C   T   +   A   N VA +  ++  V    +G
Sbjct  15    LALSSFFFSL--AVSNPRITEAGRYCNYSTEIATGNVA--PNLVAVMTEISESVTDGGWG  70

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
             +  + +    +Y   +C  DL+  DC  CFA+ +T+I RC P       GRL+ DGCF+R
Sbjct  71    KYSLTSPPPGMYGLAQCHGDLNWPDCIYCFAESRTRIRRCQP-----NFGRLYLDGCFLR  125

Query  2065  YDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGR-------KAAANDGFF  1907
             YD Y F+NE+   +   +    +   NS +    AA   G + R        A  N GF 
Sbjct  126   YDSYDFYNETVDPTHDVL----NCSSNSAVPAERAAEFSGRVDRVLKNVSASAVQNGGFA  181

Query  1906  TAAV--GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYS  1733
              A      G   VY LAQCW  +    C  CL  A SK  +C P  E R +NAGC++RYS
Sbjct  182   VAEEDGAEGAPGVYALAQCWSTLDFGGCRVCLENAASKARNCTPGGEARAMNAGCFLRYS  241

Query  1732  TKKFYD  1715
             T KFY+
Sbjct  242   TTKFYN  247



>gb|KDO69587.1| hypothetical protein CISIN_1g042149mg [Citrus sinensis]
Length=625

 Score =   498 bits (1283),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 264/544 (49%), Positives = 345/544 (63%), Gaps = 46/544 (8%)
 Frame = -2

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
             VYA+ +C +DLSQTDC  CF+  K +  RCLP        R+F DGCF+RYD+Y FF E+
Sbjct  89    VYAYMQCHEDLSQTDCESCFSALKQKANRCLPSD----SARIFLDGCFLRYDNYDFFGEA  144

Query  2035  -SSLSDKTVCGAEDFGGNS--GLFRRNAAALVGELGRKAAANDGFFTAAVGRGN-STVYG  1868
                + DK  C A      S    F      ++  +     +N G F    G+G  +TVY 
Sbjct  145   VDPIHDKFNCSARHLDDESLSKQFEEKVIEVITNVTIVTKSN-GRFGQVEGKGGIATVYA  203

Query  1867  LAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQ  1688
             LAQC +F+  K C  CL  A  ++  C    EGR + AGCY+R+ST++F++    P   +
Sbjct  204   LAQCLKFLDNKGCSQCLDEAALRLKGCSKSGEGRAMFAGCYVRFSTERFFN----PNYQK  259

Query  1687  SGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNF  1508
                R                             KR+ + RK +  LG +L T   S LNF
Sbjct  260   KETR----------------------------YKRLSEMRKGQVLLGTVLCT---SSLNF  288

Query  1507  SYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLI  1328
              YE LE+ATD+FD+S KLGQGG+G V++G LPDG+ +A+KRLFFN+ QW D FFNEVNLI
Sbjct  289   KYEILERATDFFDNSRKLGQGGAGSVFRGTLPDGRNIAVKRLFFNSRQWVDQFFNEVNLI  348

Query  1327  SGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAE  1148
             SGI HKN+V+LLGCSI GPESLLVYE+VPN+SL      +     LSW+QR+ II GTAE
Sbjct  349   SGIQHKNVVRLLGCSIEGPESLLVYEYVPNRSLDQILFVKNTIHILSWQQRFTIICGTAE  408

Query  1147  GLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYM  968
             GLA+LH  + + IIHRDIK SN+LLDE+ TPKIADFGL R    DK+H+ST +AGTLGYM
Sbjct  409   GLAHLHGGSGIKIIHRDIKTSNILLDEKLTPKIADFGLARHVAPDKTHVSTGIAGTLGYM  468

Query  967   APEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVD  788
             APEY+V+G+LTEKADVY+FGVLVIEV SG++NS F + S S+L   W  ++A ++ +++D
Sbjct  469   APEYLVRGQLTEKADVYAFGVLVIEVASGRRNSVFSEGSSSVLHTVWKHYKANRITQSMD  528

Query  787   GSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVKMISG-DQDIPQPTQPPFLTSNS  614
               L  R    EA+R LQIGL+C QA   LRPSM+ VV M++  D +IP P QPPFL ++ 
Sbjct  529   PGLTGRFPENEASRVLQIGLLCTQAPVALRPSMAEVVHMLNNIDYEIPPPKQPPFLNASV  588

Query  613   AASS  602
              + S
Sbjct  589   ISPS  592


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 51/118 (43%), Gaps = 2/118 (2%)
 Frame = -2

Query  2011  CGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAA--VGRGNSTVYGLAQCWEFVRG  1838
             CG      ++  FR+N  A++G +  +   +  +  A   V      VY   QC E +  
Sbjct  42    CGPPAKVSDNRNFRQNFDAVMGNISEQIMDDHHYHFALHYVVSPAPQVYAYMQCHEDLSQ  101

Query  1837  KSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHL  1664
               C+ C +A   K   CLP +  R+   GC++RY    F+  +  P  ++    + HL
Sbjct  102   TDCESCFSALKQKANRCLPSDSARIFLDGCFLRYDNYDFFGEAVDPIHDKFNCSARHL  159



>ref|XP_009759216.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Nicotiana 
sylvestris]
Length=653

 Score =   499 bits (1285),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 265/600 (44%), Positives = 372/600 (62%), Gaps = 21/600 (4%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             SV +PR+    +IC N+  P+     +V NFVA ++ ++  + ++ YG  VIG G  T Y
Sbjct  25    SVGEPRSQPVQIICGNQ--PEENTTIFVPNFVATMETISQQMRTRGYGVAVIGTGPNTNY  82

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSS  2030
                +C  DLS  DC LC+A+ +T + +C P+     GGR++ DGCF+R ++Y F+++   
Sbjct  83    GLAQCYGDLSLLDCVLCYAEARTVLPQCFPYN----GGRIYLDGCFMRAENYTFYDQYLG  138

Query  2029  LSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV---GRGNSTVYGLAQ  1859
               D+ VCG     G+  LF++ A   V +    A +N+G+  A V   G  N T Y LA 
Sbjct  139   PEDRHVCGNTTTKGS--LFQQTARRAVQQAVANAPSNNGYARAEVPVPGPSNETAYVLAD  196

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGG  1679
             CW+ +   +C  CL  A + +  CLP  EGR L  GC+MRYS   F +  +    + SGG
Sbjct  197   CWKTLSANACTACLQNASASMLGCLPWSEGRALYTGCFMRYSDTNFLNAISTSGGSSSGG  256

Query  1678  RSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYE  1499
             +   + +++ ++    A   ++G +     K+I K+RK  K    ++  ++ S LNF Y 
Sbjct  257   KVVVIVIVVVSSVVVLAVGAVIG-IYIWKNKQIQKKRKGAKDAEKLVKILHDSSLNFKYS  315

Query  1498  TLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGI  1319
             TL+KAT  FD++NKLGQGG G VYKGVL DG+ +A+KRLFFN    A  F+NEVN+IS +
Sbjct  316   TLDKATGSFDEANKLGQGGFGTVYKGVLQDGREIAVKRLFFNNKHRAADFYNEVNIISSV  375

Query  1318  HHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLA  1139
              HKNLV+LLGCS +GPESLLVYEF+PNQSL  +       + L+WE+R++II+GTAEGL 
Sbjct  376   EHKNLVRLLGCSCSGPESLLVYEFLPNQSLDRFIFDSNKGKALNWEKRFEIIIGTAEGLV  435

Query  1138  YLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPE  959
             YLHE T+  IIHRDIK SN+LLD     KIADFGL R F EDKSHISTA+AGTLGYMAPE
Sbjct  436   YLHENTKNRIIHRDIKASNILLDSRLRAKIADFGLARSFQEDKSHISTAIAGTLGYMAPE  495

Query  958   YVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASV--SLLQQHWNLFRAGKLYEAVDG  785
             Y+  G+LTEK DVYSFGVL++E+V+G++N+    A    SL+   W  F+ G+  E  D 
Sbjct  496   YLAHGQLTEKVDVYSFGVLLLEIVTGRQNNRSKNAEYTDSLVSIAWEHFQRGRTEELFDP  555

Query  784   SL------EERARVEATRQLQIGLVCVQASPELRPSMSAVVKM-ISGDQDIPQPTQPPFL  626
             +L          + E  R L +GL+C Q    LRP MS  ++M +  ++++P PT PPF+
Sbjct  556   NLMLHNYHTINVKNEVLRVLHVGLLCTQEIATLRPYMSKALQMLVKKEEELPPPTNPPFI  615



>ref|XP_008791183.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Phoenix 
dactylifera]
Length=645

 Score =   499 bits (1284),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 280/617 (45%), Positives = 370/617 (60%), Gaps = 26/617 (4%)
 Frame = -2

Query  2440  SLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVD  2261
             SL   + + I  +    S++DPR + A   C N ++      A   NFV A+D L+ LVD
Sbjct  6     SLGTLIAVLIPIIIWKASLADPRTTVAGQFCNNISSVSGP--ALADNFVPAMDNLSSLVD  63

Query  2260  SKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYD  2081
                +G TV G G  +VYA G+C  DL   DC LCF++ ++ + +C P      GGR+F D
Sbjct  64    RNGFGTTVAGTGPNSVYALGQCFGDLGSVDCQLCFSEIRSLLPKCYPEP----GGRIFLD  119

Query  2080  GCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTA  1901
             GCF RY++Y FFNE    +D  VC       N   F +    +V  +  +A    GF   
Sbjct  120   GCFGRYENYSFFNEVVDSNDTHVCSYSKNSSNPRSFSKVVQVVVSNVTSEALKKQGFAVG  179

Query  1900  AVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKF  1721
             +    NS VY LAQCWE +    C  CL AA S I  C P  EGR L AGCY+RYST  F
Sbjct  180   SASDSNSQVYALAQCWENLDETLCGSCLDAAASSIVLCSPATEGRALYAGCYLRYSTVLF  239

Query  1720  YDNSTIPATNQSGGRSNH-LPVILATTFGSFAFLLILGSVAFIVRKR-------IVKQRK  1565
             + N    A+N SG  +N  + +IL    G   FL I+G VA+  RKR       ++  R 
Sbjct  240   W-NLNQTASNSSGNHTNKVIWIILGVLLG--GFLFIVGIVAW--RKRGYWSKSNVISMRD  294

Query  1564  ERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKR  1385
               K    +    ++S +NF YE L KAT+ F+ SNKLGQG  G VYK VL DGK VA+KR
Sbjct  295   MYKP--ELSAAFSQSNMNFRYEDLRKATNNFNLSNKLGQGSYGTVYKAVLSDGKGVAVKR  352

Query  1384  LFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARK  1205
             LF NT QW D FFNEV LI+ + HKNLVKLLGCS+ GPESLLVYE+  N+SL  +     
Sbjct  353   LFLNTRQWVDQFFNEVELINRVRHKNLVKLLGCSVDGPESLLVYEYYSNRSLDLFIFDEN  412

Query  1204  NHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRL  1025
             + + L W+QR  II G AEGL+YLHEE+E  IIHRDIK SN+LLDE+F PKI DFGL R 
Sbjct  413   HDKHLVWQQRLDIIQGVAEGLSYLHEESETRIIHRDIKASNILLDEKFMPKITDFGLARS  472

Query  1024  FPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFY--QAS  851
             F  DK+H+ST +AGTLGYMAPEYVV G LTEKADVYS+GVL++E+V+GK+ SS       
Sbjct  473   FAADKTHLSTGIAGTLGYMAPEYVVYGHLTEKADVYSYGVLILEIVTGKRCSSGIGTHGG  532

Query  850   VSLLQQHWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKM  674
                L + W+ ++ G   + ++  + +E  + +    + IGL CVQA+P  RP+M+ V+++
Sbjct  533   NLPLAKIWDHYKTGTAEKLIEECIYKESVKADILHIVWIGLFCVQANPHSRPTMAKVLEL  592

Query  673   I--SGDQDIPQPTQPPF  629
             +  S +++    T PPF
Sbjct  593   LRSSRNEEEVVLTDPPF  609



>gb|KCW83354.1| hypothetical protein EUGRSUZ_B00289, partial [Eucalyptus grandis]
Length=531

 Score =   494 bits (1272),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 270/541 (50%), Positives = 351/541 (65%), Gaps = 27/541 (5%)
 Frame = -2

Query  2266  VDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLF  2087
             V   ++    I +    +YA  +C  DLS+ DC LCFA+ +T + RC     L   GRL+
Sbjct  8     VAEDRWANDSITSPLPEIYALAQCHGDLSRDDCILCFARSRTSLSRC---TILDTKGRLY  64

Query  2086  YDGCFVRYDDYVFFNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAA----  1922
              DGCF+R D Y FFNE+     D   C  +         R+  AA V  +    +A    
Sbjct  65    LDGCFIRSDYYNFFNETVDPQHDMVKCANQSSVLADQQARQQFAAKVDRVLTNVSAVAPE  124

Query  1921  NDGF--FTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGC  1748
             N GF  F  A   G + VY LAQCW  +  K C +CLA A+ +  +C P EEGR +NAGC
Sbjct  125   NMGFAVFGEARRGGVAGVYALAQCWNTLDEKGCRECLANAMIRARNCTPGEEGRAMNAGC  184

Query  1747  YMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQR  1568
             +MRYST++FY   T+P    + G S  L +I+A +    A   +L   A++  +++ K+R
Sbjct  185   FMRYSTQRFY---TVP----TDGDSLKLGIIIAISLSVAAATSLLFVGAYVGYRKLSKKR  237

Query  1567  KERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIK  1388
             + +K+L  +   V KS LNF+YE+LEKAT++FD+S KLGQGG+G VYKG+LPDG+ VA+K
Sbjct  238   EVQKKLFGVPEIVRKSNLNFNYESLEKATNFFDESRKLGQGGAGSVYKGILPDGRVVAVK  297

Query  1387  RLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSAR  1208
             RL FNT QW D FFNEVNLI+GI HKNLV+LLGCSI GPESLLVYE+VPN+SL      +
Sbjct  298   RLVFNTRQWVDDFFNEVNLITGIQHKNLVRLLGCSIEGPESLLVYEYVPNRSLDQILFVK  357

Query  1207  KNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVR  1028
                  LSW++R  II GTAEGLA+LH    + IIHRDIK SNVLLDE+ T KIADFGL R
Sbjct  358   NATHVLSWQERVNIISGTAEGLAFLHGPCGVKIIHRDIKSSNVLLDEDLTAKIADFGLAR  417

Query  1027  LFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASV  848
                 +KSH+ST +AGTLGYMAPEY+V+G+LTEKADVYSFGVLV+E++S         AS 
Sbjct  418   CLDPEKSHLSTGIAGTLGYMAPEYLVKGQLTEKADVYSFGVLVLEILS---------ASG  468

Query  847   SLLQQHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMI  671
             S+LQ  W  ++A  L E +D  L+ +  V EA   LQI L+C QASP+LRPSMS VV+M+
Sbjct  469   SVLQSVWKQYKANSLAECIDPVLKGKFPVSEALNVLQIALLCTQASPDLRPSMSEVVEML  528

Query  670   S  668
             +
Sbjct  529   N  529



>ref|XP_007211016.1| hypothetical protein PRUPE_ppa020522mg [Prunus persica]
 gb|EMJ12215.1| hypothetical protein PRUPE_ppa020522mg [Prunus persica]
Length=633

 Score =   496 bits (1278),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 272/619 (44%), Positives = 374/619 (60%), Gaps = 40/619 (6%)
 Frame = -2

Query  2422  FLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGE  2243
             FL I+    + S+S+PR SEA   C +  A  +    ++ NF+  +D ++  V++K++GE
Sbjct  15    FLIIYAFLFSSSISEPRISEAGRFCGH--AKHNSSSNFIPNFITVMDFISNDVNAKRWGE  72

Query  2242  TVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRY  2063
               I +    VYAF +C  DLS  DC  CFA  +T++  CLP        R++ DGCF+ Y
Sbjct  73    YTIASPAPEVYAFAQCYDDLSPIDCAACFAVSRTKLPLCLP----STSARIYLDGCFLGY  128

Query  2062  DDYVFFNESSSLSDKTV-CGAEDFG---GNSGLFRRNAAALVGELGRKAAANDGFFTAAV  1895
             DD+ F ++S     K V C           +  F R    ++G +  KA +++GF     
Sbjct  129   DDHEFSHQSLDEEHKNVKCSGSAIDVSKSKTEEFARKVEDVIGNVTEKAVSHEGFGVFEQ  188

Query  1894  GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIG-SCLPKEEGRVLNAGCYMRYSTKKFY  1718
               G   VY LAQCW+ +    C +CL  A + +   C+P  EGR + AGCY+RYST++FY
Sbjct  189   RGGVENVYALAQCWKTINESGCRECLEEAGASLRRECVPGVEGRAMFAGCYLRYSTERFY  248

Query  1717  DNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAML  1538
                 I + ++   +  H   I+AT   +    L+    A +  KR+ K+ +       + 
Sbjct  249   G---IESDSEDCVKVEH---IVATILSAMVLCLLALFGAVMAYKRLSKRNEVYNGPIQIS  302

Query  1537  VTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWA  1358
             ++++K+ LNF YE LEKAT++FD S KLGQGG               A+KRL+FNT QW 
Sbjct  303   ISIHKNNLNFKYEMLEKATNFFDASRKLGQGG---------------AVKRLYFNTRQWV  347

Query  1357  DHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQ  1178
             D FFNEVNLISGI H+NLVKLLGCSI GPESLLVYE+VPN+SL      +     LSW+Q
Sbjct  348   DDFFNEVNLISGIQHQNLVKLLGCSIEGPESLLVYEYVPNKSLDQVLFDKDTLHILSWKQ  407

Query  1177  RYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHIS  998
             R+ II G AEGL YLH    + IIHRDIK SN+LLDE   PKIADFGL R    DKSH+S
Sbjct  408   RFDIICGIAEGLVYLHGSCGVKIIHRDIKASNILLDENLIPKIADFGLARCVGPDKSHLS  467

Query  997   TAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLF  818
             T +AGTLGYMAPEY+V+G+LT+KADVY+FGV+V+E+VSG+KN  F + S S+L   W  +
Sbjct  468   TGIAGTLGYMAPEYLVRGQLTDKADVYAFGVMVLEIVSGRKNRVFAEGSSSILYAVWKHY  527

Query  817   RAGKLYEAVD----GSLEERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ-DI  653
             +A  + EAVD    G   ER   EA+  L+IGL+C QAS  +RPSM+ VV+M++  +  I
Sbjct  528   KARNITEAVDPILKGGFPER---EASDVLRIGLLCTQASLAVRPSMTEVVQMLTDKECVI  584

Query  652   PQPTQPPFLTSNSAASSGS  596
             P P +PPFL ++  +S  S
Sbjct  585   PSPKRPPFLNASILSSDVS  603



>ref|XP_009600945.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Nicotiana 
tomentosiformis]
Length=653

 Score =   497 bits (1279),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 262/600 (44%), Positives = 368/600 (61%), Gaps = 21/600 (4%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             SV +PR     +IC N+   +     +V NFVA ++ ++  + ++ YG  +IG G  T Y
Sbjct  25    SVGEPRTRTVQIICGNQH--EENTMIFVPNFVATMETISQQMRTRGYGVAIIGTGPNTNY  82

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSS  2030
                +C  DLS  DC LC+A+ +T + +C P+     GGR++ DGCF+R ++Y F+++   
Sbjct  83    GLAQCYGDLSLLDCVLCYAEARTVLPQCFPYN----GGRIYLDGCFMRAENYTFYDQYLG  138

Query  2029  LSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV---GRGNSTVYGLAQ  1859
               D+ VCG     G+  LF++ A   V +    A +N+G+  A V   G  N T Y LA 
Sbjct  139   PEDRHVCGNRTTKGS--LFQQTARQAVQQAVANAPSNNGYARAEVPVPGPSNETAYVLAD  196

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGG  1679
             CW+ +   +C  CL  A + +  CLP  EGR L  GC+MRYS   F +       + SGG
Sbjct  197   CWKTLSANACTACLRNASASMLGCLPWSEGRALYTGCFMRYSDTNFLNAILTSGDSSSGG  256

Query  1678  RSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYE  1499
             +   + +++ ++    A   ++G +     K+I K+RK       ++  ++ S LNF Y 
Sbjct  257   KVVAIVIVVVSSVVVLAVGAVIG-IYIWKNKQIQKKRKGANDAEKLVKILHDSSLNFKYS  315

Query  1498  TLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGI  1319
             TL+KAT  FD++NKLGQGG G VYKGVL DG+ +A+KRLFFN    A  F+NEVN+IS +
Sbjct  316   TLDKATGSFDEANKLGQGGFGTVYKGVLQDGREIAVKRLFFNNKHRAADFYNEVNIISSV  375

Query  1318  HHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLA  1139
              HKNLV+LLGCS +GPESLLVYEF+PNQSL  +       + L+WE+R++II+GTAEGL 
Sbjct  376   EHKNLVRLLGCSCSGPESLLVYEFLPNQSLDRFIFDSNKGKALNWEKRFEIIIGTAEGLV  435

Query  1138  YLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPE  959
             YLHE T+  IIHRDIK SN+LLD     KIADFGL R F EDKSHISTA+AGTLGYMAPE
Sbjct  436   YLHENTKNRIIHRDIKASNILLDSRLRAKIADFGLARTFQEDKSHISTAIAGTLGYMAPE  495

Query  958   YVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASV--SLLQQHWNLFRAGKLYEAVDG  785
             Y+  G+LTEK DVYSFGVL++E+V+G++N+    A    SL+   W  F+ G+  E  D 
Sbjct  496   YLAHGQLTEKVDVYSFGVLLLEIVTGRQNNRSKNAEYTDSLVSIAWEHFQRGRTEELFDP  555

Query  784   SL------EERARVEATRQLQIGLVCVQASPELRPSMSAVVKM-ISGDQDIPQPTQPPFL  626
             +L          + E  R L +GL+C Q    LRP MS  ++M +  ++++P PT PPF+
Sbjct  556   NLMLHNYHTINVKNEVLRVLHVGLLCTQEIAMLRPYMSKALQMLVKKEEELPPPTNPPFI  615



>ref|XP_004238642.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X1 [Solanum lycopersicum]
Length=641

 Score =   496 bits (1276),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 271/621 (44%), Positives = 373/621 (60%), Gaps = 31/621 (5%)
 Frame = -2

Query  2422  FLFIFFLSI----NRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSK  2255
             F    FLSI    N S ++PR+    +IC+  T P+    A+V NFVA ++ ++  + ++
Sbjct  10    FRLCVFLSILLVPNVSEAEPRSQTVQIICS--TQPEHNATAFVPNFVATMETISDQMRTQ  67

Query  2254  KYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGC  2075
              YG  + G+G    Y   +C  DLS  DC LC+A+ +T + +C PF     GGR++ DGC
Sbjct  68    GYGIALTGSGPDANYGIAQCYGDLSLLDCVLCYAEARTVLPQCFPFN----GGRIYLDGC  123

Query  2074  FVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV  1895
             F+R ++Y F ++     D  VCG  +    + LF++ A   V +    A  N+G+  A +
Sbjct  124   FMRAENYTFDHQYLGPEDTHVCG--NRTRKNSLFQQTARQAVQQAVANAPKNNGYARAEL  181

Query  1894  ---GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKK  1724
                G  N T Y L  CW  +   SC  CL  A + +  CLP  EGR L  GC++RYS   
Sbjct  182   AVPGATNETAYVLVDCWRTLSANSCRACLQNASASMMGCLPWSEGRALYTGCFLRYSDVN  241

Query  1723  FYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIV--RKRIVKQRKERKRL  1550
             F +     A   S   S ++ VI+     +    ++   +AF +   K+I K+RK    +
Sbjct  242   FLN-----AIATSEDSSPNVVVIVIAVVSAVVVFVLGAIIAFYMWKNKQIEKKRKGSNDV  296

Query  1549  GAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNT  1370
               ++ T+N S LNF Y TLEKAT  FD++NKLGQGG G VYKGVL DG+ +A+KRLFFN 
Sbjct  297   EKLVKTLNDSSLNFKYSTLEKATASFDEANKLGQGGFGTVYKGVLQDGREIAVKRLFFNN  356

Query  1369  TQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPL  1190
                A  F+NEVN+IS + HKNLV+LLGCS +GPESLLVYEF+PNQSL  +       + L
Sbjct  357   KHRAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEFLPNQSLDRFIFDSTKGKTL  416

Query  1189  SWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDK  1010
             +WE+R+ II+GTAEGL YLHE     IIHRDIK SN+LLD     KIADFGL R F EDK
Sbjct  417   NWEKRFDIIIGTAEGLVYLHENNRTRIIHRDIKASNILLDSRLRAKIADFGLARSFQEDK  476

Query  1009  SHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQ  836
             SHISTA+AGTLGYMAPEY+  G+LTEKADVYSFGVL++E+V+G++N  S   +   SL+ 
Sbjct  477   SHISTAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIVTGRQNNRSKNTEYCDSLIS  536

Query  835   QHWNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELRPSMSAVVKM  674
               W  F+  ++ E  D +L          + E  R + +GL+C Q    LRPSMS  ++M
Sbjct  537   ITWQHFQHARVEELFDPNLMLHNYHTSNVKKEVVRVVHVGLLCTQEVAGLRPSMSKALQM  596

Query  673   -ISGDQDIPQPTQPPFLTSNS  614
              +  ++++P PT PPF+  NS
Sbjct  597   LVKKEEELPAPTNPPFIDENS  617



>ref|XP_006356405.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006356406.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X2 [Solanum tuberosum]
Length=649

 Score =   496 bits (1277),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 274/644 (43%), Positives = 387/644 (60%), Gaps = 33/644 (5%)
 Frame = -2

Query  2458  MNRKMASLSKWLFLFIFFLSI-NRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALD  2282
             M + +  ++  LF+ +  L + N S ++PR+    +IC+  T P+    A+V NFVA ++
Sbjct  1     MEKAVTLVAFRLFVVLSILLLPNVSEAEPRSQMIQIICS--TQPEHNTTAFVPNFVATME  58

Query  2281  ALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVR  2102
              ++  + ++ YG  + G+G    Y   +C  DLS  DC LC+A+ +T + +C PF     
Sbjct  59    KISDQMRTQGYGIALTGSGPDANYGLAQCYGDLSLLDCVLCYAEARTVLPQCFPFN----  114

Query  2101  GGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAA  1922
             GGR++ DGCF+R ++Y F ++     D+ VC  E+      LF++ A   V +    A  
Sbjct  115   GGRIYLDGCFMRAENYTFDHQYLGPEDRHVC--ENRTRKDSLFQQTARRAVQQAVASAPN  172

Query  1921  NDGFFTAAV---GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAG  1751
             N+G+  A +   G  N T Y LA CW+ +   SC  CL  A + +  CLP  EGR L  G
Sbjct  173   NNGYSRAELAVPGAMNETAYVLADCWKTLSANSCRACLENASASMMGCLPWSEGRALYTG  232

Query  1750  CYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIV--RKRIV  1577
             C++RYS   F +     A   S   S ++ VI+     +    ++   +AF +   K+I 
Sbjct  233   CFLRYSDVNFLN-----AIASSEDSSPNVVVIVIAVVSAVVVFVLGAIIAFYMWKNKQIQ  287

Query  1576  KQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTV  1397
             K+RK    +  ++ T+N S LNF Y TLEKAT  FD++NKLGQGG G VYKGVL DG+ +
Sbjct  288   KKRKGSNDVEKLVKTLNDSSLNFKYSTLEKATASFDEANKLGQGGFGTVYKGVLQDGREI  347

Query  1396  AIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYT  1217
             A+KRLFFN    A  F+NEVN+IS + HKNLV+LLGCS +GPESLLVYEF+PNQSL  + 
Sbjct  348   AVKRLFFNNKHRAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEFLPNQSLDRFI  407

Query  1216  SARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFG  1037
                   + L+WE+R+ II+GTAEGL YLHE     IIHRDIK SN+LLD     KIADFG
Sbjct  408   FDSTKGKTLNWEKRFDIIIGTAEGLVYLHENNRTRIIHRDIKASNILLDSRLRAKIADFG  467

Query  1036  LVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSF  863
             L R F EDKSHISTA+AGTLGYMAPEY+  G+LTEKADVYSFGVL++E+V+G++N  S  
Sbjct  468   LARSFQEDKSHISTAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIVTGRQNNRSKN  527

Query  862   YQASVSLLQQHWNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELR  701
              + S SL+   W  F+  ++ E  D +L          + E  R + +GL+C Q  P LR
Sbjct  528   TEYSDSLISITWQHFQHARVEELFDPNLMLHNYHTSNVKKEVLRVVHVGLLCTQEIPGLR  587

Query  700   PSMSAVVKM-ISGDQDIPQPTQPPFLTSNSAA-----SSGSYPN  587
             PSMS  ++M +  ++++P PT PPF+   +        + SYP+
Sbjct  588   PSMSKALQMLVKKEEELPAPTNPPFVDEKTMELHDPWDTPSYPH  631



>ref|XP_006841050.1| hypothetical protein AMTR_s00085p00158310 [Amborella trichopoda]
 gb|ERN02725.1| hypothetical protein AMTR_s00085p00158310 [Amborella trichopoda]
Length=635

 Score =   495 bits (1274),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 273/625 (44%), Positives = 369/625 (59%), Gaps = 35/625 (6%)
 Frame = -2

Query  2440  SLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVD  2261
             S  ++L L +  + I  ++S+PR +  A+ CT   A       Y+ANFV A  ALT  + 
Sbjct  6     SHGRFLLLVVIMVHIGVALSNPRTNVVAVYCTKSRA--HNMTTYLANFVQATRALTAQLT  63

Query  2260  SKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYD  2081
             +  +G    G  +   Y   +CM DLS  DC  CFAQ K     C P      GGR++ D
Sbjct  64    TTGFGLAAAGTTDDKFYTLSQCMGDLSMQDCATCFAQLKAIQSGCFPST----GGRVYLD  119

Query  2080  GCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTA  1901
             GCF+R ++Y FF+E+ S  D  VCG+    G   + R     LV  L   A  N G+  A
Sbjct  120   GCFLRSENYSFFSEAVSNIDMKVCGSTTRDGYEAVAR----GLVSNLVEWAPGNGGYGRA  175

Query  1900  A-VGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKK  1724
             +  G G   VYGLA CW  +  +SC  CL  A + + SCLP  EGR +NAGC++RYS + 
Sbjct  176   SSTGEGGDRVYGLANCWRILDEESCSACLKKAAAAVFSCLPTTEGRAMNAGCFLRYSDQN  235

Query  1723  FYDNS-TIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERK---  1556
             F +    +P    + G        +  +FG+ A  + + +VA IV   + K  +ER+   
Sbjct  236   FLNEGHDMPIEINNMGE-------MVQSFGTLAAGIFVLAVAIIVGVILAKSIQERRTAI  288

Query  1555  -----RLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAI  1391
                  +   M  ++ K  LNF Y TL+KAT  F +SNKLGQGG G VYKG L DG+ +A+
Sbjct  289   KNTGMQHDEMDASLFKRSLNFKYSTLQKATGSFRESNKLGQGGFGEVYKGTLLDGREIAV  348

Query  1390  KRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSL--YDYT  1217
             KRLF N        +NE+N+IS   HKNLV+ LGC ++G +SLLVYE++PN+SL  + + 
Sbjct  349   KRLFMNPKNRGSDIYNEMNVISRAQHKNLVRFLGCCLSGTDSLLVYEYLPNKSLDRFLFD  408

Query  1216  SARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFG  1037
             S RK  + + W++R +II+GTAEGL YLH E E+ IIHRDIK SN+LLD    PKIADFG
Sbjct  409   SIRK--KEIDWKKRLEIIVGTAEGLKYLHTECEVRIIHRDIKASNILLDVRLRPKIADFG  466

Query  1036  LVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQ  857
             L R F  DK+HISTA+AGTLGYMAPEYV  G+LTEKADVYSFGVLV+E++SGK+N+   +
Sbjct  467   LARFFSGDKTHISTAIAGTLGYMAPEYVAHGQLTEKADVYSFGVLVLEIISGKQNN---R  523

Query  856   ASVSLLQQHWNLFRAGKLYEAVDGSLEERARVEATRQLQIGLVCVQASPELRPSMSAVVK  677
             +  +L+   W LF +  +   VD S+      E TR + IGL+C Q SP LRP M+ VV 
Sbjct  524   SVDTLVPTSWKLFMSDAIMRIVDPSMSIMDLAEVTRVIHIGLLCTQESPSLRPCMAEVVD  583

Query  676   MISGDQ-DIPQPTQPPFLTSNSAAS  605
              +S     +P PT+PPF+    A S
Sbjct  584   YLSKQTVQLPSPTKPPFMDELGAGS  608



>ref|XP_007153757.1| hypothetical protein PHAVU_003G062600g [Phaseolus vulgaris]
 gb|ESW25751.1| hypothetical protein PHAVU_003G062600g [Phaseolus vulgaris]
Length=651

 Score =   495 bits (1275),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 267/622 (43%), Positives = 380/622 (61%), Gaps = 31/622 (5%)
 Frame = -2

Query  2428  WLFLFIFFLSINRSV-SDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKK  2252
             ++FL +  + ++++V ++PRA    + C+ +   +     +V NFVA ++ ++  + S  
Sbjct  13    FIFLLMKAVLLSKTVVAEPRAKTVNITCSQKL--EHNYTIFVPNFVATMEKISEQMSSTG  70

Query  2251  YGETVIGAGNA-TVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGC  2075
             YG  V G G   T Y   +C  DLS  DC LC+A+ +T + +C P      GGR++ DGC
Sbjct  71    YGTAVEGTGGPDTNYGLAQCYGDLSPLDCVLCYAEARTVLPQCFPHN----GGRIYLDGC  126

Query  2074  FVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV  1895
             F+R ++Y F++E +   DK VCG       S  F+  A   V    + A  N G+  A V
Sbjct  127   FMRAENYSFYDEYTGPGDKAVCGNTTKKNTS--FQAAAKKAVMTAVQTAPNNKGYARAEV  184

Query  1894  ---GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKK  1724
                G  N + Y LA CW  +  KSC  CL  A S +  CLP   GR LN GC+MRYS   
Sbjct  185   AVEGTANDSAYVLANCWRSLDAKSCRACLENASSSVLGCLPWSGGRALNTGCFMRYSDSD  244

Query  1723  FYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILG-SVAFIVRKRIVKQRKERKRLG  1547
             F +        +  GRS    +++  T  S A +L++G ++   +RK    Q K R    
Sbjct  245   FLNKE------EKKGRSGDNVLVIVITVVSSAIVLVVGIAIVVYIRKHRYVQMKRRGSND  298

Query  1546  A--MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFN  1373
             A  +  +++ + LNF Y TLEKAT+ FD+ NKLGQGG G VYKGVLPDG+ +AIKRL+FN
Sbjct  299   AEKLAKSLHHNSLNFKYSTLEKATNSFDEDNKLGQGGFGAVYKGVLPDGREIAIKRLYFN  358

Query  1372  TTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP  1193
                 A  F+NEVN+IS + HKNLV+LLGCS +GPESLL+YEF+ N+SL  +   +   + 
Sbjct  359   NRHRAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLIYEFLANRSLDRFIFDKNKGRE  418

Query  1192  LSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPED  1013
             L+W +RY II+GTAEGL YLHE + + IIHRDIK SN+LLD +   KIADFGL R F +D
Sbjct  419   LNWTKRYDIIVGTAEGLVYLHENSNIRIIHRDIKASNILLDAKLRAKIADFGLARSFQDD  478

Query  1012  KSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLL  839
             KSHI+TA+AGTLGYMAPEY+  G+LTEKADVYSFGVL++E+++G++N  S   + S SL+
Sbjct  479   KSHITTAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIITGRQNNRSKASEYSDSLI  538

Query  838   QQHWNLFRAGKLYEAVDGSL----EERARV--EATRQLQIGLVCVQASPELRPSMSAVVK  677
                W  F++G   + +D  L      R++V  +  R +QIGL+C Q    LRPSMS  +K
Sbjct  539   IMTWKHFQSGTAEQIIDPYLLLDDNHRSKVKNDILRVVQIGLLCTQEISSLRPSMSKALK  598

Query  676   MIS-GDQDIPQPTQPPFLTSNS  614
             M++  ++ +  P+ PPF+  ++
Sbjct  599   MLTKKEEHVEAPSNPPFIDEST  620



>ref|XP_007155445.1| hypothetical protein PHAVU_003G202000g [Phaseolus vulgaris]
 gb|ESW27439.1| hypothetical protein PHAVU_003G202000g [Phaseolus vulgaris]
Length=656

 Score =   494 bits (1273),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 264/584 (45%), Positives = 354/584 (61%), Gaps = 21/584 (4%)
 Frame = -2

Query  2365  EAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG-ETVIGAGNATVYAFGECMK  2189
             E    C     P S      + F+A +D L+  V  + +G +T++G+G   +YA G+C +
Sbjct  21    ETGFTCGGSENPGSS----ASRFMALMDTLSFQVKERGWGAQTLLGSG-PPMYALGQCRR  75

Query  2188  DLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES-SSLSDKTV  2012
             DL  TDC  CF+Q +  + RC+P       G ++ DGCF+RYD+Y F  ES     D  +
Sbjct  76    DLRSTDCYKCFSQARQVLSRCVP----KTAGTIYLDGCFLRYDNYSFIRESVDPTRDIGI  131

Query  2011  CGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKS  1832
             C     G + G   +  A +V  +  K AA  GF       G   V+ LAQCW  +    
Sbjct  132   CMTPTLGDDGG---KRVAEMVSNV-TKEAAERGFAV----DGEEGVFALAQCWSTLNKGR  183

Query  1831  CDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVIL  1652
             C  CL  A  K+  C+P  EGR L  GC +RYST+KFY++  +P  N S      + +I+
Sbjct  184   CKICLTEAAKKVQECVPNVEGRGLFTGCILRYSTRKFYNDVALPNINNSTEERPGVWMIV  243

Query  1651  ATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYF  1472
             A    +   +L++   AFI  +++  +RK R   G      + +  +F Y+ LEKATD+F
Sbjct  244   ACVLSAIVGILLIAFAAFICCQKMSSRRKVRDSGGVSPDFSSVAGFSFRYDLLEKATDHF  303

Query  1471  DDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLL  1292
             D +NKLGQG +  V+KG LP G TVA+KRLFFN  QW + FFNEVNLI+GI HKN+VKLL
Sbjct  304   DPANKLGQGEAASVFKGTLPSGGTVAVKRLFFNKRQWTEGFFNEVNLINGIQHKNVVKLL  363

Query  1291  GCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELC  1112
             GCSI GPESLLVYEFVP+ SL     ++ +   L+WEQR++II G AEGLAYLHE +   
Sbjct  364   GCSIEGPESLLVYEFVPSGSLDQVLFSKDSEDALNWEQRFQIICGLAEGLAYLHEGSGTK  423

Query  1111  IIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTE  932
             IIHRDIK SN+L DE   PKIADFGL R    +KSH+ST  + TLGYMAPEYV +G+LTE
Sbjct  424   IIHRDIKSSNILFDENMNPKIADFGLARSVTGNKSHLSTGNSRTLGYMAPEYVSKGQLTE  483

Query  931   KADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEERARV-EA  755
             K D+Y+FGVL++E+V GKKNS     S SLL   W  ++   +  +VD +L  +  V EA
Sbjct  484   KVDIYAFGVLIVEIVCGKKNSDHIPGSTSLLHSVWKNYKTNNITASVDPALHGKLTVEEA  543

Query  754   TRQLQIGLVCVQASPELRPSMSAVVKMIS-GDQDIPQPTQPPFL  626
             +  LQ GL+C Q++  LRPSMS VV+M++  D  IP P Q PFL
Sbjct  544   SNTLQTGLLCTQSTVTLRPSMSEVVQMLTKKDYAIPSPKQKPFL  587



>ref|XP_010415736.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Camelina 
sativa]
Length=649

 Score =   494 bits (1272),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 271/619 (44%), Positives = 375/619 (61%), Gaps = 38/619 (6%)
 Frame = -2

Query  2419  LFIFFLSINRSVS-DPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGE  2243
             LFIF LS+ R ++ D RA    + C+ +   +    AYV NFV  ++ ++  V +  +G 
Sbjct  16    LFIFLLSLLRPITGDARARAVKVTCSPQL--EHNETAYVPNFVTTMEKISTKVQTAGFGV  73

Query  2242  TVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRY  2063
              + G G    Y   +C  DL   DC LC+A+ +T + +C P      GGR+F DGCF+R 
Sbjct  74    ALTGTGPDANYGLAQCYGDLPLNDCVLCYAEARTMLPQCYP----QNGGRIFLDGCFMRA  129

Query  2062  DDYVFFNESSSLSDKTVCG-----AEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAA  1898
             ++Y F+NE     D  VCG     +E FG        NA A       +A+   G+  A+
Sbjct  130   ENYSFYNEYRGPEDTVVCGNKTRKSETFGDAVRQGLSNAVA-------EASGTGGYARAS  182

Query  1897  VGRGNS---TVYGLAQCWEFVRGKSCDDCLA-AAVSKIGSCLPKEEGRVLNAGCYMRYST  1730
                G S   + + LA CW  +   SC  CL  A+VS +  CLP  EGR L+ GC++RYS 
Sbjct  183   AKAGESESESAFVLANCWRTLSPGSCKKCLENASVSVVKGCLPWSEGRALHTGCFLRYSD  242

Query  1729  KKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKR-IVKQRKERKR  1553
             + F +   IP   +S G    + V + ++   F   + +G   +I + R I K+R+    
Sbjct  243   QDFLNK--IPRNGRSRGSVVVIVVSVLSSVVVFMIGIAIG--VYICKLRTIQKKRRGSND  298

Query  1552  LGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFN  1373
             +  M  T+  S LNF Y TLEKAT  FD++NKLGQGG G VYKGVLPDG+ +A+KRLFFN
Sbjct  299   VEKMAKTLKDSNLNFKYSTLEKATGSFDEANKLGQGGFGTVYKGVLPDGRDIAVKRLFFN  358

Query  1372  TTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP  1193
                 A  F+NEVN+IS + HKNLV+LLGCS +GPESLLVYE++ N+SL  +       + 
Sbjct  359   NRHRAADFYNEVNMISTVEHKNLVRLLGCSCSGPESLLVYEYLQNKSLDRFIFDVNRGKT  418

Query  1192  LSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPED  1013
             L W++RY II+GTAEGL YLHE++ + IIHRDIK SN+LLD +   KIADFGL R F +D
Sbjct  419   LDWQKRYAIIVGTAEGLVYLHEQSSVKIIHRDIKASNILLDSKLQAKIADFGLARSFQDD  478

Query  1012  KSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLL  839
             KSHISTA+AGTLGYMAPEY+  G+LTE  DVYSFGVLV+E+ +GK+N  S     S SL+
Sbjct  479   KSHISTAIAGTLGYMAPEYLAHGQLTEMVDVYSFGVLVLEIATGKQNTKSKMSDYSDSLI  538

Query  838   QQHWNLFRAGKLYEAVDGSLEERARVEA-------TRQLQIGLVCVQASPELRPSMSAVV  680
              + W  F++G+L E  D +L  + ++++        R +QIGL+C Q  P LRPSMS ++
Sbjct  539   TEAWKHFQSGELEEIYDPNLNWKNQIDSHIIIKDIARVIQIGLLCTQEIPSLRPSMSKLL  598

Query  679   KMISGDQDI-PQPTQPPFL  626
              M+   ++I P P+ PPF+
Sbjct  599   HMLKNKEEILPLPSNPPFM  617



>ref|XP_006300838.1| hypothetical protein CARUB_v10019929mg [Capsella rubella]
 gb|EOA33736.1| hypothetical protein CARUB_v10019929mg [Capsella rubella]
Length=649

 Score =   494 bits (1272),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 271/616 (44%), Positives = 373/616 (61%), Gaps = 32/616 (5%)
 Frame = -2

Query  2419  LFIFFLSINRSVS-DPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGE  2243
             LF+F LS+ R ++ D RA    + C+     +    AYV NFVA ++ ++  V +  +G 
Sbjct  16    LFMFLLSLLRPITGDARARAVQVTCSPHL--EHNETAYVPNFVATMEKISTQVQTAGFGV  73

Query  2242  TVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRY  2063
              + G G    Y   +C  DL   DC LC+A+ +T + +C P      GGR+F DGCF+R 
Sbjct  74    ALTGTGPDANYGLAQCYGDLPLNDCVLCYAEARTMLPQCYP----KNGGRIFLDGCFMRA  129

Query  2062  DDYVFFNESSSLSDKTVCG-----AEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAA  1898
             ++Y F+NE     D  VCG     +E FG       RNA A+    G  A A     ++ 
Sbjct  130   ENYSFYNEYRGPEDNVVCGNKTRKSETFGDAVRQGLRNAVAVASGTGGYARA-----SSK  184

Query  1897  VGRGNS-TVYGLAQCWEFVRGKSCDDCLA-AAVSKIGSCLPKEEGRVLNAGCYMRYSTKK  1724
             V    S + + LA CW  +   SC  CL  A+ S +  CLP  EGR L+ GC++RYS + 
Sbjct  185   VAESESESAFVLANCWRTLSPDSCKQCLENASASVVKGCLPWSEGRALHTGCFLRYSDQD  244

Query  1723  FYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGA  1544
             F +   IP   +S G    + V + ++   F   + +G V    R+ I K+R+    +  
Sbjct  245   FLNK--IPRNGRSRGSVVVIVVSVLSSVVVFMIGVAIG-VYICKRRTIQKKRRGSNDVEK  301

Query  1543  MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQ  1364
             M  T+  S LNF Y TLEKAT  FD++NKLGQGG G VYKGVL DG+ +A+KRLFFN   
Sbjct  302   MAKTLKDSSLNFKYSTLEKATGSFDEANKLGQGGFGTVYKGVLQDGRDIAVKRLFFNNRH  361

Query  1363  WADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSW  1184
              A  F+NEVN+IS + HKNLV+LLGCS +GPESLLVYE++ N+SL  +       + L W
Sbjct  362   RASDFYNEVNMISTVEHKNLVRLLGCSCSGPESLLVYEYLQNKSLDRFIFDVNRGKTLDW  421

Query  1183  EQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSH  1004
             ++RY II+GTAEGL YLHE++ + IIHRDIK SN+LLD +   KIADFGL R F +DKSH
Sbjct  422   QRRYAIIVGTAEGLVYLHEQSAVKIIHRDIKASNILLDSKLQAKIADFGLARSFQDDKSH  481

Query  1003  ISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQA--SVSLLQQH  830
             ISTA+AGTLGYMAPEY+  G+LTE  DVYSFGVLV+E+V+GK+N+    +  S SL+ + 
Sbjct  482   ISTAIAGTLGYMAPEYLAHGQLTEMVDVYSFGVLVLEIVTGKQNTKTKMSDYSDSLITEA  541

Query  829   WNLFRAGKLYEAVDGSLEERARV-------EATRQLQIGLVCVQASPELRPSMSAVVKMI  671
             W  F++G+L E  D +L  + ++       E  R +QIGL+C Q  P LRPSMS ++ M+
Sbjct  542   WKHFQSGELEEIYDPNLNWKNQIDSHIIKKEIGRVVQIGLLCTQEIPSLRPSMSKLLHML  601

Query  670   SGDQDI-PQPTQPPFL  626
                ++I P P+ PPF+
Sbjct  602   KNKEEILPLPSNPPFM  617



>emb|CDP01560.1| unnamed protein product [Coffea canephora]
Length=564

 Score =   491 bits (1263),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 270/582 (46%), Positives = 372/582 (64%), Gaps = 33/582 (6%)
 Frame = -2

Query  2287  LDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRL  2108
             +D +  LV    +G       N + YA  +C +DL+  DC  C+   +   +R     R 
Sbjct  1     MDEIESLVIKNGWGLYAGNKTNISFYALAQCYQDLAPVDCYFCYLTSRG--IRHEACGR-  57

Query  2107  VRGGRLFYDGCFVRYDDYVFFNES-------SSLSDKT--VCGAEDFGGNSGLFRRNAAA  1955
                GR++ DGCF+R+D+Y FF+ES       S+ S ++  V   ED       F +N   
Sbjct  58    AASGRVYMDGCFLRFDNYNFFDESVDTTKGISNCSSRSAGVLSVEDVEN----FGKNVVK  113

Query  1954  LVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKE  1775
             L+ ++   A  N GF      +G + V+GLAQCW+ +  + C +CL  A      CLP  
Sbjct  114   LIDKVTSVALKNGGFAV----KGLNGVFGLAQCWKTLSEQGCKECLTKASRNAIGCLPSR  169

Query  1774  EGRVLNAGCYMRYSTKKFYDN--STIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVA  1601
             EGR ++AGCY+RYST KFY++   TI   +  G R     V + ++  +F+ L +  + A
Sbjct  170   EGRGMDAGCYLRYSTVKFYNDPPKTIAGPSTWGKR-----VAIGSSVVAFSMLSLFAAYA  224

Query  1600  FIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKG  1421
             F  R +  K  +E+++L  +    NKS L F YE LEKAT+YFD   K+GQGG+G VY G
Sbjct  225   FYARFK--KSIQEQRKLARISHAYNKSYLYFKYEILEKATNYFDPRMKIGQGGAGSVYIG  282

Query  1420  VLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVP  1241
              LPDGK +A+KRLFF+T++W + FFNEV+LI+GI HKNLVK LGCSI GPESLLVYEFVP
Sbjct  283   TLPDGKVIAVKRLFFSTSRWVEEFFNEVDLINGIQHKNLVKFLGCSIEGPESLLVYEFVP  342

Query  1240  NQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEF  1061
             N+SL  Y       + LSW++R++II+GTAEG+A+LH    + I+HRDIK SNVLLDE+F
Sbjct  343   NKSLDHYLFDENRIKILSWKERFQIIIGTAEGIAFLHGGAGIRIVHRDIKSSNVLLDEDF  402

Query  1060  TPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSG  881
             +PK+ADFGL R F ED++H+ST +AGTLGYMAPEY+V+G+LTEKADVYSFG+LV+E+V G
Sbjct  403   SPKVADFGLARHFAEDRTHLSTELAGTLGYMAPEYLVKGQLTEKADVYSFGILVLEIVCG  462

Query  880   KK-NSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPE  707
             +K N +  + S SLLQ  W  ++  KL E VD  L+     +EA   L+IGL+C QAS  
Sbjct  463   RKHNYASKEDSGSLLQTVWTFYQTDKLEELVDPCLKGNFPALEAWNVLKIGLLCGQASAT  522

Query  706   LRPSMSAVVKMIS-GDQDIPQPTQPPFLTSNSAASSGSYPNR  584
              RPSM  VV+M++  +  IP+P QPPFL SNS+  + + P+R
Sbjct  523   SRPSMVEVVQMLTVPNCAIPEPNQPPFLNSNSSFPAAN-PSR  563



>ref|XP_006390875.1| hypothetical protein EUTSA_v10018252mg [Eutrema salsugineum]
 gb|ESQ28161.1| hypothetical protein EUTSA_v10018252mg [Eutrema salsugineum]
Length=648

 Score =   493 bits (1270),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 274/618 (44%), Positives = 373/618 (60%), Gaps = 37/618 (6%)
 Frame = -2

Query  2419  LFIFFLSINRSVS-DPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGE  2243
             L +F LS  R ++ D RA    + C+    P+     YV NFVA ++ ++  V +  +G 
Sbjct  16    LLMFLLSSLRPITGDARARTVKVNCS--PLPEHNETVYVPNFVATMEKISQQVQTSGFGV  73

Query  2242  TVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRY  2063
              + G+G    Y   +C  DL   DC LC+A+ +T + +C P      GGR+F DGCF+R 
Sbjct  74    ALTGSGPDANYGLAQCYGDLPLNDCVLCYAEARTILPQCYP----QNGGRIFLDGCFMRA  129

Query  2062  DDYVFFNESSSLSDKTVCG-----AEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAA  1898
             ++Y F+NE     D  VCG        FG       R A   VGE    A  N G+  A+
Sbjct  130   ENYSFYNEFKGPEDSVVCGNTTRKKSTFGDAVRQVLRKA---VGE----APGNGGYARAS  182

Query  1897  VGRGNS--TVYGLAQCWEFVRGKSCDDCLA-AAVSKIGSCLPKEEGRVLNAGCYMRYSTK  1727
                G S  + + LA CW  +  +SC  CL  A+ S +  CLP  EGR L+ GC++RYS +
Sbjct  183   ANAGESEESAFVLANCWRNLSPESCKQCLENASASVVNECLPWSEGRALHTGCFLRYSDQ  242

Query  1726  KFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKR-IVKQRKERKRL  1550
              F +   IP   +S G    + V + ++   F   + +G   +I + R I K+R+    +
Sbjct  243   DFLNK--IPRNGRSRGSVVVIVVSVLSSVVVFMVGIAIG--VYICKHRTIQKKRRGPNDV  298

Query  1549  GAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNT  1370
               M  T+  S LNF Y TLEKAT  FD +NKLGQGG G VYKGVLPDG+ +A+KRLFFN 
Sbjct  299   EKMAKTLTDSSLNFKYSTLEKATGSFDSANKLGQGGFGTVYKGVLPDGRDIAVKRLFFNN  358

Query  1369  TQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPL  1190
                A  F+NEVN+IS + HKNLV+LLGC+ +GPESLLVYE++ N+SL  +       + L
Sbjct  359   RHRAADFYNEVNIISSVEHKNLVRLLGCNCSGPESLLVYEYLQNKSLDRFIFDVNRGKTL  418

Query  1189  SWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDK  1010
              W++RY II+GTAEGL YLHE++ + IIHRDIK SN+LLD +   KIADFGL R F EDK
Sbjct  419   DWQRRYVIIVGTAEGLVYLHEQSTVRIIHRDIKASNILLDSKLQAKIADFGLARSFQEDK  478

Query  1009  SHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQ  836
             SHISTA+AGTLGYMAPEY+  G+LTEK DVYSFGVLV+E+V+GK+N  S     S SL+ 
Sbjct  479   SHISTAIAGTLGYMAPEYLAHGQLTEKVDVYSFGVLVLEIVTGKQNTKSKMSDYSDSLIT  538

Query  835   QHWNLFRAGKLYEAVDGSLEER-------ARVEATRQLQIGLVCVQASPELRPSMSAVVK  677
             + W  F++G+L E  D +L  +        + E  R +QIGL+C Q    LRPSMS V++
Sbjct  539   EAWKHFQSGELEEIYDPNLNWKNQNDSISIKKEIVRVVQIGLLCTQEIASLRPSMSKVLR  598

Query  676   MISG-DQDIPQPTQPPFL  626
             M+   D+++P P+ PPF+
Sbjct  599   MLKNKDENLPLPSNPPFM  616



>ref|XP_010471047.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Camelina 
sativa]
Length=648

 Score =   493 bits (1270),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 268/619 (43%), Positives = 377/619 (61%), Gaps = 38/619 (6%)
 Frame = -2

Query  2419  LFIFFLSINRSVS-DPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGE  2243
             LFIF LS+ R ++ D RA    + C+ +   +    AYV NFV  ++ ++  V +  +G 
Sbjct  15    LFIFLLSLLRPITGDARARAVKVTCSPQL--EHNETAYVPNFVTTMEKISTQVQTAGFGV  72

Query  2242  TVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRY  2063
              + G G    Y   +C  DL   DC LC+A+ +T + +C P      GGR+F DGCF+R 
Sbjct  73    ALTGTGPDANYGLAQCYGDLPLNDCVLCYAEARTMLPQCYP----QNGGRIFLDGCFMRA  128

Query  2062  DDYVFFNESSSLSDKTVCG-----AEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAA  1898
             ++Y F+NE     D  VCG     ++ FG      R+  +  V E    A+   G+  A+
Sbjct  129   ENYSFYNEYRGPEDTVVCGNKTRKSQTFGD---AVRQGLSYAVAE----ASGTGGYARAS  181

Query  1897  VGRGNS---TVYGLAQCWEFVRGKSCDDCLA-AAVSKIGSCLPKEEGRVLNAGCYMRYST  1730
                G S   + + LA CW  +   SC  CL  A+ S +  CLP  EGR L+ GC++RYS 
Sbjct  182   AKAGESESESAFVLANCWRTLSPGSCKQCLENASASVVKGCLPWSEGRALHTGCFLRYSD  241

Query  1729  KKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIV-KQRKERKR  1553
             + F +   IP   +S G    + V + ++   F   + +G   +I ++RI+ K+R+    
Sbjct  242   QDFLNK--IPRNGRSKGSVVVIVVSVLSSVVVFMIGVAIG--VYICKRRIIQKKRRGSND  297

Query  1552  LGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFN  1373
             +  M  T+  S LNF Y TLEKAT  FD++NKLGQGG G VYKGVLPDG+ +A+KRLFFN
Sbjct  298   VEKMAKTLKDSNLNFKYSTLEKATGSFDEANKLGQGGFGTVYKGVLPDGRDIAVKRLFFN  357

Query  1372  TTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP  1193
                 A  F+NEVN+IS + HKNLV+LLGCS +GPESLLVYE++ N+SL  +       + 
Sbjct  358   NRHRAADFYNEVNMISTVEHKNLVRLLGCSCSGPESLLVYEYLQNKSLDRFIFDVNRGKT  417

Query  1192  LSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPED  1013
             L W++RY II+GTAEGL YLHE++ + IIHRDIK SN+LLD +   KIADFGL R F +D
Sbjct  418   LDWQKRYAIIVGTAEGLVYLHEQSSVKIIHRDIKASNILLDSKLHAKIADFGLARSFQDD  477

Query  1012  KSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLL  839
             KSHISTA+AGTLGYMAPEY+  G+LTE  DVYSFGVLV+E+ +GK+N  S     S SL+
Sbjct  478   KSHISTAIAGTLGYMAPEYLAHGQLTEMVDVYSFGVLVLEIATGKQNTKSKMSDYSDSLI  537

Query  838   QQHWNLFRAGKLYEAVDGSLEERARVEA-------TRQLQIGLVCVQASPELRPSMSAVV  680
              + W  F++G+L E  D +L  + ++++        + +QIGL+C Q  P LRPSMS ++
Sbjct  538   TEAWKHFQSGELEEIYDPNLNWKNQIDSHIIKKDIAKVVQIGLLCTQEIPSLRPSMSKLL  597

Query  679   KMISGDQDI-PQPTQPPFL  626
              M+   ++I P P+ PPF+
Sbjct  598   HMLKNKEEILPLPSNPPFM  616



>emb|CBI28576.3| unnamed protein product [Vitis vinifera]
Length=696

 Score =   494 bits (1271),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 272/627 (43%), Positives = 374/627 (60%), Gaps = 37/627 (6%)
 Frame = -2

Query  2425  LFLFIFFLS-INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKY  2249
             LFLFI  LS I  S  DPR+    + C N+  P+     +V NFVA ++ ++  V +  +
Sbjct  84    LFLFIITLSVIELSAGDPRSRMIQITCANQ--PEHNSTIFVPNFVAMMENISNQVRTSGF  141

Query  2248  GETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFV  2069
             G  + G+G    Y   +C  DLS  DC LC+A+ +T + +C P+     GGR++ DGCF+
Sbjct  142   GVAISGSGPDANYGLAQCYGDLSLLDCVLCYAEARTVLPQCFPYN----GGRIYLDGCFM  197

Query  2068  RYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--  1895
             R  +Y F  E +  SD  +CG E    ++  F+ +A   + +    A  N+G+  + V  
Sbjct  198   RAQNYSFIEEYTGPSDHALCGNETRKNST--FQESARQAIKQAVADAPNNNGYARSKVIV  255

Query  1894  -GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFY  1718
              G  N + Y LA CW  +   SC  CL  A S I  CLP  EGR LN GC+MRYS   F 
Sbjct  256   PGTANESAYVLADCWRTLNASSCRACLENASSSILGCLPWSEGRALNTGCFMRYSDTDFL  315

Query  1717  DNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIV--RKRIVKQRKERKRLGA  1544
             +    P    S G    + +I+     +   LL+LG++   +  +++I K+R+       
Sbjct  316   NKE--PDNGSSRGT---VIIIVVPAVSAVIVLLVLGAIGVYIWKQRKIQKKRRGSNDAIK  370

Query  1543  MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQ  1364
             ++ T++ S LNF Y TLEKAT  FD+ NKLGQGG G VYKGVL DG+ +A+KRLFFN   
Sbjct  371   LVKTLHDSSLNFKYATLEKATGSFDNENKLGQGGFGTVYKGVLTDGREIAVKRLFFNNRH  430

Query  1363  WADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSW  1184
              A  F+NEVN+IS + HKNLV+LLGCS +GPESLLVYE++PN+SL  +       + L+W
Sbjct  431   RAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEYLPNKSLDRFIFDTNRGKALNW  490

Query  1183  EQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSH  1004
             E+R +II+GTAEGLAYLHE +   IIHRDIK SN+LLD +   KIADFGL R F EDKSH
Sbjct  491   EKRCEIIIGTAEGLAYLHENSTNRIIHRDIKASNILLDSKMRAKIADFGLARSFQEDKSH  550

Query  1003  ISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQH  830
             I+TA+AGTLGYMAPEY+  G+LTEK DVYSFGVL++E+V+G++N  S   + S S++   
Sbjct  551   ITTAIAGTLGYMAPEYLAHGQLTEKVDVYSFGVLLLEIVTGRQNNRSKTSEYSDSIVTIA  610

Query  829   WNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS  668
             W  F+ G L E  D +L          + E  R +QI L+C Q +P LRPSM+  +    
Sbjct  611   WKHFQLGTLEELFDPNLMLHNYHNGNIKNEVLRVMQIALLCTQEAPSLRPSMTMEL----  666

Query  667   GDQDIPQPTQPPFLTSNSAASSGSYPN  587
              ++    P+ P      +AA SGS  N
Sbjct  667   -NEACANPSYPL-----NAAISGSVAN  687



>ref|XP_007044714.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 2 isoform 1 
[Theobroma cacao]
 gb|EOY00546.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 2 isoform 1 
[Theobroma cacao]
Length=652

 Score =   492 bits (1266),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 269/641 (42%), Positives = 372/641 (58%), Gaps = 29/641 (5%)
 Frame = -2

Query  2452  RKMASLSKWLFLFIFFLS----INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAAL  2285
              K   L + L+ F   +     + R   DPRA    + C N+   +     +V NFVA +
Sbjct  2     HKTVQLVRSLYTFFVLIGSLALLTRVGGDPRAQTLNITCGNQM--EHNTTIFVPNFVATM  59

Query  2284  DALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLV  2105
             + ++  +    +G  V G+G    +   +C  DLS  DC LC+A+ +T + +C P     
Sbjct  60    EKISEQMRDSGFGTAVTGSGPDANHGLAQCYGDLSLLDCVLCYAEARTVLPQCYPHN---  116

Query  2104  RGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAA  1925
              GGR+F DGCF+R ++Y FF E +   D+ VCG     G++  F+ +A   V      A 
Sbjct  117   -GGRIFLDGCFMRSENYTFFEEYTGPDDRAVCGNTSRKGSN--FQDSARQAVNHAVAAAL  173

Query  1924  ANDGFFTA--AVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAG  1751
               +G+  A  AV   N + Y L  CW  +   SC  CL  A + I  CLP  EGR LN G
Sbjct  174   EKEGYAKAQVAVPGTNESAYVLVNCWRTLNKSSCKACLENASASILGCLPWSEGRALNTG  233

Query  1750  CYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQ  1571
             C++RYS   F +    P    S G    + V + ++    A  + +G   +I + R +++
Sbjct  234   CFVRYSDTNFLNKE--PGNGISKGTIIIIVVSVVSSLVVLAIGVAIG--VYIRKHRYIQK  289

Query  1570  RKERKRLGAMLVTV-NKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVA  1394
             ++        LV + + S LNF Y TLE+AT  F+D NKLGQGG G VYKG+LPDG+ +A
Sbjct  290   KRRGSNDAEKLVKLLHDSNLNFKYSTLERATGSFNDVNKLGQGGFGTVYKGILPDGREIA  349

Query  1393  IKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTS  1214
             +KRLFFN    A  F+NEVN+IS + HKNLV+LLGCS  GPESLLVYEF+PN+SL  +  
Sbjct  350   VKRLFFNNRHRAADFYNEVNIISSVEHKNLVRLLGCSCAGPESLLVYEFLPNKSLDRFIF  409

Query  1213  ARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGL  1034
                  + L+WE+RY++I+GT EGL YLHE +   IIHRDIK SN+LLD     KIADFGL
Sbjct  410   DPSRGKVLNWEKRYEVIIGTVEGLVYLHENSRNKIIHRDIKASNILLDSRLRAKIADFGL  469

Query  1033  VRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFY  860
              R F ED+SHISTA+AGTLGYMAPEY+  G+LTEK DVYSFGVL++E+V+GK+N  S   
Sbjct  470   ARAFQEDQSHISTAIAGTLGYMAPEYLAHGQLTEKVDVYSFGVLLLEIVTGKQNNRSKAA  529

Query  859   QASVSLLQQHWNLFRAGKLYEAVDGSL-------EERARVEATRQLQIGLVCVQASPELR  701
             + S SL+   W  F+ G + E  D +L           + E  R + IGL+C Q  P LR
Sbjct  530   EYSDSLVTIAWKHFQLGTVEEIYDPNLMLHNNNHSSNVKNEIFRVVHIGLLCAQEIPSLR  589

Query  700   PSMSAVVKMIS-GDQDIPQPTQPPFLTSNSAASSGSYPNRG  581
             PSMS V++M++  D+D+P PT PPF+   +   + +  N G
Sbjct  590   PSMSKVLQMLTKKDEDLPAPTNPPFMDEKTMEFNDTSENPG  630



>ref|XP_004299001.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Fragaria vesca subsp. vesca]
Length=646

 Score =   492 bits (1266),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 267/613 (44%), Positives = 371/613 (61%), Gaps = 27/613 (4%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             +++DPR     + C N+   +     +V NF+A +  ++  + +  +G  V G+G    Y
Sbjct  21    ALADPRTQTIQVTCANQL--EHNASIFVPNFIATMANISEQMAASGFGVAVTGSGPDISY  78

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSS  2030
                +C  DLS  DC LC+AQ +T + +C P+     GGR+F DGCF+R  +Y F+ +   
Sbjct  79    GLAQCYGDLSLQDCVLCYAQARTVLPKCYPYN----GGRIFLDGCFMRSQNYSFYEDFRE  134

Query  2029  LSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRG---NSTVYGLAQ  1859
              +D  VCG  +    S LF  +A   V  + + A +N G+  A VG     N TVY L+ 
Sbjct  135   PNDTAVCG--NTTRKSSLFEASARQAVLNIVQSAPSNRGYARAQVGVSGSVNETVYVLSD  192

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGG  1679
             CW  +   SC  CL  A   I  CLP  EGR LN GC+MRYS   F +         SG 
Sbjct  193   CWRSLNESSCRQCLENASDTILGCLPWSEGRALNTGCFMRYSDTDFLNKEL-----GSGS  247

Query  1678  RSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGA--MLVTVNKSKLNFS  1505
                 + VI+ +   S   L++ G++ F + KR   Q+K R    A  M  T+N S LNF 
Sbjct  248   SRGTIIVIVVSVVSSLVVLVVGGAIGFYIWKRRYIQKKRRGSNDAEKMAKTLNDSSLNFK  307

Query  1504  YETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLIS  1325
             Y T+EKAT+ F   NKLGQGG G VYKGVLPDG+ +A+KRLFFN    A  F+NE+N+IS
Sbjct  308   YSTIEKATESFAIDNKLGQGGFGTVYKGVLPDGREIAVKRLFFNNRHRAADFYNEINIIS  367

Query  1324  GIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEG  1145
              + HKNLV+LLGCS +GPESLLVYE++ N+SL  +    +  + L+WE+RY+II GTAEG
Sbjct  368   SVEHKNLVRLLGCSCSGPESLLVYEYLANKSLDCFIFDEQRGKTLNWEKRYEIITGTAEG  427

Query  1144  LAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMA  965
             L YLH+ ++  IIHRDIK SN+LLD     KIADFGL R F EDKSHISTA+AGTLGYMA
Sbjct  428   LVYLHDNSKTRIIHRDIKASNILLDSRLRAKIADFGLARSFEEDKSHISTAIAGTLGYMA  487

Query  964   PEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASV--SLLQQHWNLFRAGKLYEAV  791
             PEY+  G+LTEKADVYSFGVL++E+++G++N+    A    SL+   W  F+AG + E  
Sbjct  488   PEYLAHGQLTEKADVYSFGVLMMEIITGRQNNRSKSAEYLDSLVIITWRHFQAGTVEELY  547

Query  790   DGSL------EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS-GDQDIPQPTQPP  632
             D +L       +  + E  R +QIGL+C Q  P LRP+MS  ++M++  ++++P P+ PP
Sbjct  548   DPNLMLQNDNNDNVKDEILRVVQIGLLCTQEIPTLRPTMSKALQMLTKKEENLPAPSNPP  607

Query  631   FLTSNSAASSGSY  593
             F+   +   + +Y
Sbjct  608   FMDEKTMELNDTY  620



>gb|KCW83353.1| hypothetical protein EUGRSUZ_B00288 [Eucalyptus grandis]
Length=629

 Score =   491 bits (1264),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 279/612 (46%), Positives = 370/612 (60%), Gaps = 40/612 (7%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             +FL +F  S +  + DPR SEA ++C       S     ++N +  +  +T  V    + 
Sbjct  11    VFLVLFSSSFSPLLGDPRISEAGILCLRSNV--SSTANVLSNVLEVMLKITAEVTENCWA  68

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
                + +    +YA  +C  DLS +DC LCF Q +  + RC       + GRL+ DGCF+R
Sbjct  69    NDSVTSPLPEIYALAQCHGDLSHSDCVLCFVQSRNILPRCNVLD--AKPGRLYLDGCFIR  126

Query  2065  YDDYVFFNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAA----NDGF--F  1907
              D Y F+NE+     D   C  +         R+     V  + R  +A    N GF  F
Sbjct  127   SDYYNFYNETIDPQHDMVKCANQSNDSAHQQARQQFVDKVDRVLRNVSAVAPENKGFAVF  186

Query  1906  TAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTK  1727
               A   G + VY LAQCW  +  K C +CLA A+    +C P +EGR +NAGC+MRYST+
Sbjct  187   EEARRGGVAGVYALAQCWNTLDRKGCRECLANAMIMARNCTPGDEGRAMNAGCFMRYSTQ  246

Query  1726  KFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLG  1547
             +FY   T+P    + G S+ L +I+A      A   ++   A++  +++ K+R+      
Sbjct  247   RFY---TVP----TDGDSSKLGIIIAIASSVAAATSLVFIGAYVGYRKLSKKRE------  293

Query  1546  AMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTT  1367
                  V KS LNF+YE+LEKATD+FDDS KLGQGG+G VYKG+LPD + VA+KRL FNT 
Sbjct  294   ---AIVRKSNLNFNYESLEKATDFFDDSRKLGQGGAGSVYKGILPDRRVVAVKRLVFNTC  350

Query  1366  QWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLS  1187
             QW D+ FNEVNLI GI HKNLV LL           VYE+VPN+SL      +     LS
Sbjct  351   QWVDYLFNEVNLICGIQHKNLVHLL-----------VYEYVPNRSLDQILFVKNATHILS  399

Query  1186  WEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKS  1007
             W++R  II GTAEGLA+LH    + IIHRDIK SNVLLDE+ T KIADFGL R    +KS
Sbjct  400   WQERLNIISGTAEGLAFLHGPCGVKIIHRDIKSSNVLLDEDLTAKIADFGLARCLDPEKS  459

Query  1006  HISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHW  827
             H+ST +AGTLGYMAPEYVV+G+LTEKADVYSFGVLV+E++SG+KNS F Q S S+LQ  W
Sbjct  460   HLSTGIAGTLGYMAPEYVVRGQLTEKADVYSFGVLVLEILSGRKNSVFGQVSGSVLQSVW  519

Query  826   NLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISGDQD-I  653
               +++  L E +D  L+    V EA   LQI L+C QASP+LRPSMS VV+M++  +  +
Sbjct  520   KQYKSNGLAECIDPVLKGTFPVSEALNVLQIALLCTQASPDLRPSMSEVVEMLNNQERMV  579

Query  652   PQPTQPPFLTSN  617
             P PTQPPFL +N
Sbjct  580   PVPTQPPFLNNN  591



>dbj|BAF95169.1| putative protein kinase [Ipomoea nil]
Length=645

 Score =   491 bits (1264),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 269/631 (43%), Positives = 379/631 (60%), Gaps = 26/631 (4%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
               L +  L  + S   PRA +  LIC   T  +    A+V NFV  ++ ++  + ++ +G
Sbjct  8     FILSLILLFPDLSYGAPRAQQVKLIC--ETELEHNTTAFVPNFVGVMEKISDKMRTQGWG  65

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
              +V+G+G    +   +C  DLS  DC LC+A+ +T + +C PF     GGR++ DGCF+R
Sbjct  66    TSVLGSGPDENFGLAQCYGDLSLLDCVLCYAEARTVLPQCFPFN----GGRIYLDGCFMR  121

Query  2065  YDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV---  1895
              ++Y FF+E     D  VCG       S  F++ A   V +    A  N+G   + +   
Sbjct  122   AENYTFFDEYLGPGDTRVCGNSTRKDPS--FQQTARRAVMQAVSTAVNNNGSSRSQLSVP  179

Query  1894  GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYD  1715
             GR N + Y LA CW  +   +C  CL  A + +  CLP  EGR L  GC+MRYS   F +
Sbjct  180   GRQNESAYVLADCWNTLNDSACRACLQNASASMLGCLPWSEGRALYTGCFMRYSDTNFLN  239

Query  1714  NSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLV  1535
                IP+ + S   S  + V+ A +      + ++ ++ F+ ++RI K+RK       ++ 
Sbjct  240   --PIPSNDSSSRVSVAVIVVAAVSSVIVLIVGVVIALYFLKQRRIEKKRKGPNDAEKLVK  297

Query  1534  TVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWAD  1355
              ++ S LNF Y TLEKAT  FD++NKLGQGG G VYKGVLPDG+ +A+KRLFFN    A 
Sbjct  298   ILHDSSLNFKYSTLEKATGCFDEANKLGQGGFGTVYKGVLPDGREIAVKRLFFNNKHRAA  357

Query  1354  HFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQR  1175
              F+NEVN+IS + HKNLV+LLGCS +GPESLLVYE++ NQSL  +       + L+WE+R
Sbjct  358   DFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEYMHNQSLDQFIFDPNKGKALNWERR  417

Query  1174  YKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHIST  995
             ++II+GTAEGL YLHE +   IIHRDIK SN+LLD     KIADFGL R F EDKSHIST
Sbjct  418   FEIIIGTAEGLVYLHENSRNRIIHRDIKASNILLDSRLRAKIADFGLARSFQEDKSHIST  477

Query  994   AVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHWNL  821
             A+AGTLGYMAPEY+  G+L+EKADVYSFGV+++E+VSG++N  S   + + SL+   W  
Sbjct  478   AIAGTLGYMAPEYLAHGQLSEKADVYSFGVVLLEIVSGRQNNRSKATEYTDSLVNIAWMH  537

Query  820   FRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ  659
             F+ G + E  D +L          + E  R + IGL+C Q +  LRPSMS  ++M+   +
Sbjct  538   FQQGTVNELFDPNLMLHNYHNINVKNEVLRVVHIGLLCTQEASSLRPSMSKALQMLVKKE  597

Query  658   DIPQPTQPPFLTS-----NSAASSGSYPNRG  581
             ++P PT PPF+       N    + S+P RG
Sbjct  598   ELPAPTNPPFVDEKTMELNDGWDNQSFPLRG  628



>ref|XP_008781331.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Phoenix 
dactylifera]
Length=648

 Score =   491 bits (1263),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 260/586 (44%), Positives = 355/586 (61%), Gaps = 21/586 (4%)
 Frame = -2

Query  2317  QAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQ  2138
             +A+  NFV  ++ +   V    +G  V G  N  V+  G+C   LS T C LC+A+ + +
Sbjct  49    EAFDVNFVNTMEMVFQNVTRAGFGTAVSGTSN-IVHGLGQCFNYLSPTACQLCYAESRVK  107

Query  2137  ILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAA  1958
             +  CLP        R++ DGCF+RY DY   +++    D  VCG      NS  F   A 
Sbjct  108   LPHCLP----ATTARIYLDGCFLRYADYNVSSDAVDEFDAFVCGNSS-ASNSTEFEDTAI  162

Query  1957  ALVGELGRKAAANDGFFTAAVGRGNS--TVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCL  1784
              LV  L  +A ++  ++ A    G+S  TVYG+AQCW  +    C DCL +A   +  CL
Sbjct  163   RLVRSLASEAYSSKEYYKAGSSAGSSGVTVYGMAQCWRSLNVSGCRDCLKSAKDSVARCL  222

Query  1783  PKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSV  1604
             P  +G+ LNAGCY+RYST+ FY    +  T +SGG S+    ++       A L ++G  
Sbjct  223   PAADGKALNAGCYLRYSTEPFY----LAKTVESGGSSSARRRLIVALGSIIAALAVIGIA  278

Query  1603  AFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYK  1424
                ++ R      +      ++ +++ S L+F YE L +ATD F   NKLGQGG G VYK
Sbjct  279   ILWMKLRPTDSNDDIDGSQEIIRSISSSNLSFKYEDLRRATDNFSQMNKLGQGGFGSVYK  338

Query  1423  GVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFV  1244
             GVLPDG  +A+KRLF +  QW D F NEV+LI+ + HKNL KLLGCS+ GPESLLVYE++
Sbjct  339   GVLPDGTEIAVKRLFSDARQWIDQFVNEVSLINRVQHKNLAKLLGCSVEGPESLLVYEYL  398

Query  1243  PNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEE  1064
              N SL  +     N   L WE+R+ II+GTAEGLAYLH   E+ IIHRDIK SN+LLDE 
Sbjct  399   CNTSLDHFLFDSFNKNALDWERRFDIIIGTAEGLAYLHTSCEVRIIHRDIKASNILLDES  458

Query  1063  FTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVS  884
             F PKI+DFGL R F  D+SH+ST +AGT GYMAPEY+V G+LTEKAD+YS+GVLV+E+V+
Sbjct  459   FKPKISDFGLARCFAGDQSHLSTGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLVLEIVT  518

Query  883   GKKNSSFYQASV---SLLQQHWNLFRAGKLYEAVDGSLEERARVE-ATRQLQIGLVCVQA  716
             G+KN S    S    SL+   W  F + +L E +D +L+++   E A +   +GL+C QA
Sbjct  519   GRKNHSSIAESAEGHSLVSLIWQNFNSERLTELLDPNLQDQCSEEQAIKVFHVGLLCTQA  578

Query  715   SPELRPSMSAVVKMI-SGDQDIPQPTQPPFLTSNSAASSGSYPNRG  581
             SP LRP M  VV+M+ S  +D+P PT+PPF+    A    S+ N G
Sbjct  579   SPSLRPPMWKVVEMLRSNSKDLPLPTRPPFIGIKGA----SFKNEG  620



>ref|XP_006841051.1| hypothetical protein AMTR_s00085p00159370 [Amborella trichopoda]
 gb|ERN02726.1| hypothetical protein AMTR_s00085p00159370 [Amborella trichopoda]
Length=647

 Score =   490 bits (1262),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 267/595 (45%), Positives = 362/595 (61%), Gaps = 20/595 (3%)
 Frame = -2

Query  2380  DPRASEAALICTNRTAPQSQRQAYVANFVAALDALTP--LVDSKKYGETVIGAGNATVYA  2207
             D R+    LIC  +  P+     YV NFV+ ++ ++    V+   +G  + G+G  T +A
Sbjct  30    DSRSHSIRLICGLK--PEHNASLYVPNFVSTMEKISDQIRVNRSNFGLAITGSGPDTSFA  87

Query  2206  FGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSL  2027
               +C  DL+  DC LC+A+ +T + +C P    V GGR+F DGCF+R ++Y FF E S  
Sbjct  88    MAQCYGDLTPNDCILCYAEARTLLPQCFP----VNGGRIFLDGCFMRGENYSFFGEFSGP  143

Query  2026  SDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEF  1847
             +D  +CG     G+   FR  A  +V  +  +A  N GF   + G  N++VY L  CW  
Sbjct  144   NDTHICGNLSKPGSE--FRSAAQRVVQRVVLEAPGNMGFGRGSEGVNNASVYVLGNCWRT  201

Query  1846  VRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNH  1667
             +   +C  CL +A   +  CLP  EGR L  GC++RYS   F +N T     QS G    
Sbjct  202   LNESACRACLGSAARAVLGCLPMSEGRALYTGCFLRYSDFDFLNNVTAATGGQSRGNMVA  261

Query  1666  LPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLV-TVNKSKLNFSYETLE  1490
             + V + +   + A  ++L    FI ++R +++++     G  L  ++  S LNF Y TLE
Sbjct  262   MVVGIVSAVAALALGVVLA--LFIFKRRKIQKKRRGSNYGTKLTPSLYNSSLNFKYSTLE  319

Query  1489  KATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHK  1310
             KAT  FD +NKLGQGG G VYKGVL DG+ VA+KRLFFN    A  F+NE+N+IS + HK
Sbjct  320   KATGSFDPANKLGQGGFGSVYKGVLGDGREVAVKRLFFNNRHRAADFYNEINIISSVQHK  379

Query  1309  NLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLH  1130
             NLVKLLGCS +GPESLLVYEFVPN+SL  +    +  + L WE+R +II GTAEGLAYLH
Sbjct  380   NLVKLLGCSCSGPESLLVYEFVPNRSLDRFLFEPEVAKELDWEKRMEIITGTAEGLAYLH  439

Query  1129  EETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVV  950
             EE E+ IIHRDIK SN+LLD    PKIADFGL R F E+ SHISTA+AGTLGYMAPEY+ 
Sbjct  440   EECEIKIIHRDIKASNILLDSRLRPKIADFGLARSFQENLSHISTAIAGTLGYMAPEYIA  499

Query  949   QGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHWNLFRAGKLYEAVDGSL-  779
              G LTEKADVYSFGVL++E+VSGK+N  S   +   SLL   W  F++  +   +D  + 
Sbjct  500   HGHLTEKADVYSFGVLLLEIVSGKQNNRSKSVEYMDSLLTAAWKHFQSNTVEGLIDPIIY  559

Query  778   ---EERARVEATRQLQIGLVCVQASPELRPSM-SAVVKMISGDQDIPQPTQPPFL  626
                 E  + E  R + + L+C Q  P LRPSM  A+  ++  +Q++  PT PPF+
Sbjct  560   SNNNENVKAEILRVVHVALLCTQEVPTLRPSMLKALQLLVKKEQNLALPTSPPFI  614



>ref|XP_006348519.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Solanum tuberosum]
Length=650

 Score =   490 bits (1261),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 263/602 (44%), Positives = 370/602 (61%), Gaps = 21/602 (3%)
 Frame = -2

Query  2395  NRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNAT  2216
             + SV +PR+    + C+  T  +    A+V NFVA ++ ++  + ++ YG  V G G  T
Sbjct  23    DTSVCEPRSQTVQITCS--TQLEHNTTAFVPNFVAVMETISQQMRTRGYGVAVSGTGPDT  80

Query  2215  VYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES  2036
              +   +C  DLS  DC LC+A+ +T + +C P+     GGR++ DGCF+R ++Y F+++ 
Sbjct  81    NFGLAQCYGDLSLLDCVLCYAEARTVLPQCFPYN----GGRIYLDGCFMRAENYTFYDQY  136

Query  2035  SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV---GRGNSTVYGL  1865
                 D+ VCG     G   LF++NA   + +    A  N+G   A V   G  N T Y L
Sbjct  137   LGPEDRHVCGNRTTKGT--LFQQNARLAIQQAVVDAPTNNGTARAQVSVPGPSNETAYVL  194

Query  1864  AQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQS  1685
             A CW+ +   SC  CL  A   +  CLP  EGR L  GC+MRYS   F +  ++   + S
Sbjct  195   ADCWKTLSVNSCAACLQNASESMLGCLPWSEGRALYTGCFMRYSDTNFLNAISVSEGSSS  254

Query  1684  GGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFS  1505
             GG    + +I+ ++        ++G +     K+I K+RK       ++  ++ + LNF 
Sbjct  255   GGSVVVIVIIVVSSMVVLGVGAVIG-IYVWKNKQIQKKRKGANDAEKLVKILHDNSLNFK  313

Query  1504  YETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLIS  1325
             Y TL+KAT  FD++NKLGQGG G VYKGVL DG+ +A+KRLFFN    A  F+NEVN+IS
Sbjct  314   YSTLDKATGSFDEANKLGQGGFGTVYKGVLADGREIAVKRLFFNNKHRAADFYNEVNIIS  373

Query  1324  GIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEG  1145
              + HKNLV+LLGCS +GPESLLVYEF+PNQSL  +       + L+WE+R++II+GT EG
Sbjct  374   SVEHKNLVRLLGCSCSGPESLLVYEFLPNQSLDRFIFDSIKGKALNWEKRFEIIIGTTEG  433

Query  1144  LAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMA  965
             L YLHE T+  IIHRDIK SN+LLD  F  KIADFGL R F EDKSHISTA+AGTLGYMA
Sbjct  434   LVYLHENTKTRIIHRDIKASNILLDSRFRAKIADFGLARSFQEDKSHISTAIAGTLGYMA  493

Query  964   PEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHWNLFRAGKLYEAV  791
             PEY+  G+LTEKADVYSFG+L++E+V+G++N  S   + + SL+   W  F+ G + +  
Sbjct  494   PEYIAHGQLTEKADVYSFGILLLEIVTGRQNNRSKHVEYTDSLVSIAWEHFQRGIVEKLF  553

Query  790   DGSL------EERARVEATRQLQIGLVCVQASPELRPSMSAVVKM-ISGDQDIPQPTQPP  632
             D +L          + E  R L +GL+C Q  P LRPSMS  ++M +  D+++P PT PP
Sbjct  554   DPNLMLNNNHTINVKNEVARVLHVGLLCTQEIPTLRPSMSKALQMFVKKDEELPPPTNPP  613

Query  631   FL  626
             F+
Sbjct  614   FV  615



>ref|XP_008444357.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Cucumis 
melo]
Length=646

 Score =   490 bits (1261),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 268/601 (45%), Positives = 374/601 (62%), Gaps = 27/601 (4%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             +V+DPR+  A ++C+  T  +    A+V NFVA +  ++  + +  +G  V+G G    Y
Sbjct  23    TVADPRSRTAKILCS--TVLEHNTTAFVPNFVATMQIISDQMRTGGFGVAVVGKGPDANY  80

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSS  2030
                +C  DLS  DC LC+A+ +T + +C P+     GGR+F DGCF+R ++Y F++E + 
Sbjct  81    GLAQCYGDLSLMDCVLCYAEARTVLPQCFPYN----GGRIFLDGCFMRAENYSFYDEFAG  136

Query  2029  LSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFF---TAAVGRGNSTVYGLAQ  1859
               D+ VCG       + +FR++A          A  N G+     A  G  N++VY LAQ
Sbjct  137   PLDRAVCGNNSI--TNSIFRQSARQAAARAIETAPNNGGYARIQVAPPGTSNASVYLLAQ  194

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGG  1679
             CW  +   SC  CL  A + I  CLP+ E R LN GC+MRYS   F +     + ++S G
Sbjct  195   CWRNLNRTSCTSCLQNASASILKCLPRSEARALNTGCFMRYSNVDFLNAEA--SASRSRG  252

Query  1678  RSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQ-RKERKRLGAMLVTVNKSKLNFSY  1502
                 + V L ++       +++G   ++   R VK+ R+       M  T+N S LNF Y
Sbjct  253   TIIEIVVSLVSSVAVLVVGVLIG--IYVWNNRYVKKKRRGSNDANKMAKTLNNSSLNFKY  310

Query  1501  ETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISG  1322
              TLEKAT  F ++NKLGQGG G VYKGVL DG+ +A+KRLFFN    A  F+NEVN+IS 
Sbjct  311   STLEKATGSFAEANKLGQGGFGTVYKGVLSDGREIAVKRLFFNNKHRAADFYNEVNIISS  370

Query  1321  IHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGL  1142
             + HKNLV+LLGCS +GPESLLVYE++ N+SL  +   R   + L+WE+RY II+GT EGL
Sbjct  371   VEHKNLVRLLGCSCSGPESLLVYEYLANKSLDRFIFDRDRGKVLNWEKRYDIIVGTVEGL  430

Query  1141  AYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAP  962
             AYLHE ++  IIHRDIK SN+LLD +   KIADFGL R F ED+SHISTA+AGTLGYMAP
Sbjct  431   AYLHENSKTKIIHRDIKASNILLDSKLRAKIADFGLARSFEEDESHISTAIAGTLGYMAP  490

Query  961   EYVVQGKLTEKADVYSFGVLVIEVVSGKKNS----SFYQASVSLLQQHWNLFRAGKLYEA  794
             EY+  G+LTEKADVYSFGV+++E V+G +NS    S Y  S+ L+   W  F++G     
Sbjct  491   EYLAHGQLTEKADVYSFGVVLLETVTGIQNSRSKTSDYLESIVLIA--WKHFQSGTTERI  548

Query  793   VDGSL---EERA-RVEATRQLQIGLVCVQASPELRPSMSAVVKMI-SGDQDIPQPTQPPF  629
             +D +L   E+R+ + E  R +QIGL+C Q S  LRP+MS V++M+   ++ +P PT PPF
Sbjct  549   LDPNLMVEEDRSTKEEILRVVQIGLLCTQESASLRPTMSKVLQMLMKKEEKLPTPTNPPF  608

Query  628   L  626
             +
Sbjct  609   M  609



>gb|KGN62311.1| hypothetical protein Csa_2G348970 [Cucumis sativus]
Length=646

 Score =   490 bits (1261),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 261/601 (43%), Positives = 370/601 (62%), Gaps = 27/601 (4%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             +++DPR+    ++C+  T  +    A+V NFV  +  ++  + +  +G  V G G    Y
Sbjct  23    TLADPRSRTVKILCS--TVLEHNTTAFVPNFVRTMQLISDQMRTGGFGVAVAGKGPDANY  80

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSS  2030
                +C  DLS  DC LC+A+ +T + +C P+     GGR+F DGCF+R ++Y F+ E + 
Sbjct  81    GLAQCYGDLSLMDCVLCYAEARTVLPQCFPYN----GGRIFLDGCFMRAENYSFYEEFAG  136

Query  2029  LSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFF---TAAVGRGNSTVYGLAQ  1859
               D+  CG       + +FR++A   V      A +N G+     A  G  N++VY LAQ
Sbjct  137   PLDRAECGNNSI--TNSIFRQSARQAVARAIETAPSNGGYARIQVAPPGTSNASVYLLAQ  194

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGG  1679
             CW  +   SC  CL  A + I  CLP+ E R LN GC+MRYS   F +       + S  
Sbjct  195   CWRNLNRTSCTSCLQNASASILKCLPRSEARALNTGCFMRYSNLDFLN----AEASASRS  250

Query  1678  RSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQ-RKERKRLGAMLVTVNKSKLNFSY  1502
             R   + ++++        ++ +    ++   R VK+ R+       M  T+N S LNF Y
Sbjct  251   RGTIIEIVVSLVSSVAVLVVGVLIGIYVWNNRYVKKKRRGSNDANKMAKTLNNSSLNFKY  310

Query  1501  ETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISG  1322
              TLEKAT  F ++NKLGQGG G VYKGVL DG+ +A+KRLFFN    A  F+NEVN+IS 
Sbjct  311   STLEKATGSFAEANKLGQGGFGTVYKGVLSDGREIAVKRLFFNNKHRAADFYNEVNIISS  370

Query  1321  IHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGL  1142
             + HKNLV+LLGCS +GPESLLVYE++ N+SL  +   R   + L+WE+RY II+GT EGL
Sbjct  371   VEHKNLVRLLGCSCSGPESLLVYEYLANKSLDRFIFDRDRGKALNWEKRYDIIVGTVEGL  430

Query  1141  AYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAP  962
             AYLHE ++  IIHRDIK SN+LLD +   KIADFGL R F ED+SHISTA+AGTLGYMAP
Sbjct  431   AYLHENSKNKIIHRDIKASNILLDSKLRAKIADFGLARSFEEDESHISTAIAGTLGYMAP  490

Query  961   EYVVQGKLTEKADVYSFGVLVIEVVSGKKNS----SFYQASVSLLQQHWNLFRAGKLYEA  794
             EY+  G+LT+KADVYSFGV+++E V+G +NS    S Y  S+ L+   W  F++G +   
Sbjct  491   EYLAHGQLTDKADVYSFGVVLLETVTGIQNSRSKTSDYLESIVLIV--WRHFQSGTIESI  548

Query  793   VDGSL---EERA-RVEATRQLQIGLVCVQASPELRPSMSAVVKMI-SGDQDIPQPTQPPF  629
             +D +L   E+R+ + E  R +QIGL+C Q S  LRP+MS V++M+   ++++P PT PPF
Sbjct  549   LDANLMVEEDRSTKEEILRVVQIGLLCTQESASLRPAMSKVLQMLMKKEEELPTPTNPPF  608

Query  628   L  626
             +
Sbjct  609   M  609



>gb|KCW59793.1| hypothetical protein EUGRSUZ_H02541 [Eucalyptus grandis]
Length=622

 Score =   488 bits (1257),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 276/634 (44%), Positives = 377/634 (59%), Gaps = 45/634 (7%)
 Frame = -2

Query  2461  TMNRKMASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALD  2282
             T  R +A+LS      I  L +  +  DPRA      C++   P      +V NFVA ++
Sbjct  10    TQRRLLAALS------IVLLEL--AAGDPRAQIVNRTCSH--VPGHNTTVFVPNFVATME  59

Query  2281  ALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVR  2102
              ++  + +  +G   IG+G    YA  +C  DLS  DC LC+A+ ++ + +C P+     
Sbjct  60    NISNQMRTSGFGLATIGSGPDASYALSQCYGDLSLLDCVLCYAEARSALPQCYPYN----  115

Query  2101  GGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAA  1922
              GR+F DGCF+R ++Y FF E +   D  VCG  +    S  F  +    V +   +A  
Sbjct  116   SGRIFLDGCFMRGENYSFFQEYTGPQDARVCG--NVTRKSATFYDSVRQAVAKAVVRAPN  173

Query  1921  NDGFFTAAV--GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGC  1748
             NDG+  A V  G  N + Y LA CW  +   SC  CL  A   I  CLP+ EGR LN GC
Sbjct  174   NDGYARAEVVLGTANESAYLLANCWRTLNATSCRACLENASRSILGCLPRSEGRALNTGC  233

Query  1747  YMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLI----LGSVAFIVRKRI  1580
             +MRYS   F         N+  G+ +    I+A T    + L++    +  V F+ + + 
Sbjct  234   FMRYSDTNFL--------NKEPGKGSKKGTIIALTVPVVSALVVLAVGITIVYFVWKHKY  285

Query  1579  V-KQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGK  1403
             V K+RK        +  ++ S LNF Y TLEKAT+ FD +NKLGQGG G VYKGVLPDG+
Sbjct  286   VQKKRKGSDDAEKFVKILHDSSLNFKYSTLEKATESFDSANKLGQGGFGTVYKGVLPDGR  345

Query  1402  TVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYD  1223
              +A+KRLFFNT Q    F+NEVN+IS + HKNLV+LLGCS +GP+SLLVYEF+PN+SL +
Sbjct  346   EIAVKRLFFNTRQRVAEFYNEVNIISRVEHKNLVRLLGCSFSGPDSLLVYEFLPNKSLDN  405

Query  1222  YTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIAD  1043
             +       + LSWE+R  I++GTAEGL YLHE ++  IIHRDIK SN+LLD  F  KIAD
Sbjct  406   FIFDTNRGKALSWEKRVDIMVGTAEGLVYLHESSK--IIHRDIKASNILLDSRFRAKIAD  463

Query  1042  FGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--S  869
             FGL R F EDKSHISTA+AGTLGYMAPEY+ +G+LTEKADVYS+GVL++E V+G +N  S
Sbjct  464   FGLARSFQEDKSHISTAIAGTLGYMAPEYLARGQLTEKADVYSYGVLLLENVTGIQNNRS  523

Query  868   SFYQASVSLLQQHWNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPE  707
                + S SL+Q  WN F+A ++ E  D +L      +   + E +R + IGL+C+Q +P 
Sbjct  524   KTSEYSDSLVQIAWNHFQANRVEELFDPNLMLHNYPDSNIKNEVSRVVHIGLLCMQEAPS  583

Query  706   LRPSMSAVVKMISGDQDIPQPTQPPFLTSNSAAS  605
             LRP M+  +  +  +Q  P    P   TSNS A+
Sbjct  584   LRPKMTMTLNDMCKEQSFP----PTPKTSNSVAT  613



>ref|XP_010663140.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Vitis 
vinifera]
Length=642

 Score =   489 bits (1258),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 263/619 (42%), Positives = 377/619 (61%), Gaps = 25/619 (4%)
 Frame = -2

Query  2446  MASLSKWLFLFIFFLS---INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDAL  2276
             M  + +   +F+F ++   ++  ++DPR + A   C +  A  S   A   NFV A+  L
Sbjct  1     MGIVGRMRVVFLFLMASGFVSNLMADPRTTVAGFQCNSTEAVSSVLLA--QNFVPAMANL  58

Query  2275  TPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGG  2096
             +  V+   +G +++G     V+   +C KDLS  DC LCF++ ++ + +C P      GG
Sbjct  59    STQVNEDGFGTSIVGEAPNAVFGLAQCFKDLSSIDCQLCFSEIRSILPKCYP----DTGG  114

Query  2095  RLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAAND  1916
             R+F+DGCF RY+++ FF++         C +       G+F+     ++  +  KA  N 
Sbjct  115   RIFFDGCFGRYENFSFFDQGMDSVQLKNCSSSKNSSQPGIFKEALERVIESVSLKAQKNQ  174

Query  1915  GFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRY  1736
             GF  A+    N T++ LAQCWE +  K+C+ CL A+ S I SC P  +GR LNAGCYMRY
Sbjct  175   GFAVASHSVSNLTLHALAQCWESLDKKTCNSCLQASASSIMSCYPGVDGRSLNAGCYMRY  234

Query  1735  STKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFI----VRKRIVKQR  1568
             S + F++ S    T  S GR   L +IL    G F   LIL  +       +R+   K  
Sbjct  235   SNEVFWNLSR--HTGLSAGRKA-LYIILGLAVGGF---LILAGIGLWKKGHLRQSFGKSL  288

Query  1567  KERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIK  1388
             K+    G +   +  S+LNF Y+ L +AT+ FD SNKLGQG  G VYKG+L DG+ VA+K
Sbjct  289   KDIYGSG-LSSALAHSQLNFRYQELRQATNNFDSSNKLGQGSYGSVYKGILLDGREVAVK  347

Query  1387  RLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSAR  1208
             RLF NT QW D FFNEV+LI+ + HKNLVKLLG S+ G ESLLVY++ PN+SL  +    
Sbjct  348   RLFLNTRQWIDQFFNEVHLINQVRHKNLVKLLGYSVDGQESLLVYDYYPNKSLDHFIFDE  407

Query  1207  KNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVR  1028
                Q L W++R  II G AEGL+YLHEE+E+ IIHRDIK SN+LLD++  PKI DFGL R
Sbjct  408   NQAQILDWKKRIDIIQGVAEGLSYLHEESEIRIIHRDIKASNILLDDKLKPKITDFGLAR  467

Query  1027  LFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKK--NSSFYQA  854
              F ED++H+ST +AGTLGYMAPEYVV G LTEKADVYSFGVL++E+++G++  N +  + 
Sbjct  468   SFAEDQTHLSTGIAGTLGYMAPEYVVHGHLTEKADVYSFGVLLLEILTGQRCSNGTGAKP  527

Query  853   SVSLLQQHWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVK  677
                 L + W+ ++A  + E +D    +E  + E    + +GL+C QA+P  RP+M+ VV+
Sbjct  528   GQFFLAKIWSHYKAETVDEIMDRHFYDEEVKDEILHAVHVGLLCTQATPSYRPTMAKVVE  587

Query  676   MI--SGDQDIPQPTQPPFL  626
             ++  + +Q+   PT PPFL
Sbjct  588   LLRSTKNQENVFPTDPPFL  606



>emb|CBI14998.3| unnamed protein product [Vitis vinifera]
Length=636

 Score =   488 bits (1257),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 262/610 (43%), Positives = 374/610 (61%), Gaps = 25/610 (4%)
 Frame = -2

Query  2419  LFIFFLS---INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKY  2249
             +F+F ++   ++  ++DPR + A   C +  A  S   A   NFV A+  L+  V+   +
Sbjct  4     VFLFLMASGFVSNLMADPRTTVAGFQCNSTEAVSSVLLA--QNFVPAMANLSTQVNEDGF  61

Query  2248  GETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFV  2069
             G +++G     V+   +C KDLS  DC LCF++ ++ + +C P      GGR+F+DGCF 
Sbjct  62    GTSIVGEAPNAVFGLAQCFKDLSSIDCQLCFSEIRSILPKCYP----DTGGRIFFDGCFG  117

Query  2068  RYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGR  1889
             RY+++ FF++         C +       G+F+     ++  +  KA  N GF  A+   
Sbjct  118   RYENFSFFDQGMDSVQLKNCSSSKNSSQPGIFKEALERVIESVSLKAQKNQGFAVASHSV  177

Query  1888  GNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNS  1709
              N T++ LAQCWE +  K+C+ CL A+ S I SC P  +GR LNAGCYMRYS + F++ S
Sbjct  178   SNLTLHALAQCWESLDKKTCNSCLQASASSIMSCYPGVDGRSLNAGCYMRYSNEVFWNLS  237

Query  1708  TIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFI----VRKRIVKQRKERKRLGAM  1541
                 T  S GR   L +IL    G F   LIL  +       +R+   K  K+    G +
Sbjct  238   R--HTGLSAGRKA-LYIILGLAVGGF---LILAGIGLWKKGHLRQSFGKSLKDIYGSG-L  290

Query  1540  LVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQW  1361
                +  S+LNF Y+ L +AT+ FD SNKLGQG  G VYKG+L DG+ VA+KRLF NT QW
Sbjct  291   SSALAHSQLNFRYQELRQATNNFDSSNKLGQGSYGSVYKGILLDGREVAVKRLFLNTRQW  350

Query  1360  ADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWE  1181
              D FFNEV+LI+ + HKNLVKLLG S+ G ESLLVY++ PN+SL  +       Q L W+
Sbjct  351   IDQFFNEVHLINQVRHKNLVKLLGYSVDGQESLLVYDYYPNKSLDHFIFDENQAQILDWK  410

Query  1180  QRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHI  1001
             +R  II G AEGL+YLHEE+E+ IIHRDIK SN+LLD++  PKI DFGL R F ED++H+
Sbjct  411   KRIDIIQGVAEGLSYLHEESEIRIIHRDIKASNILLDDKLKPKITDFGLARSFAEDQTHL  470

Query  1000  STAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKK--NSSFYQASVSLLQQHW  827
             ST +AGTLGYMAPEYVV G LTEKADVYSFGVL++E+++G++  N +  +     L + W
Sbjct  471   STGIAGTLGYMAPEYVVHGHLTEKADVYSFGVLLLEILTGQRCSNGTGAKPGQFFLAKIW  530

Query  826   NLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMI--SGDQD  656
             + ++A  + E +D    +E  + E    + +GL+C QA+P  RP+M+ VV+++  + +Q+
Sbjct  531   SHYKAETVDEIMDRHFYDEEVKDEILHAVHVGLLCTQATPSYRPTMAKVVELLRSTKNQE  590

Query  655   IPQPTQPPFL  626
                PT PPFL
Sbjct  591   NVFPTDPPFL  600



>gb|KHN08615.1| Cysteine-rich receptor-like protein kinase 2 [Glycine soja]
Length=649

 Score =   489 bits (1258),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 266/603 (44%), Positives = 366/603 (61%), Gaps = 28/603 (5%)
 Frame = -2

Query  2386  VSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNA-TVY  2210
             +++PRA    + C N+   +     +V NFVA ++ ++  + +  YG  V+G G   T Y
Sbjct  24    MAEPRARTVNITCNNKL--EHNTTIFVPNFVATMEKISEQMRNTGYGTAVVGTGGPDTNY  81

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSS  2030
                +C  DLS  DC LC+A+ +T + +C P+     GGR++ DGCF+R ++Y F++E   
Sbjct  82    GLAQCYGDLSLLDCVLCYAEARTVLPQCFPYN----GGRIYLDGCFMRAENYSFYDEYIG  137

Query  2029  LSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV---GRGNSTVYGLAQ  1859
               DK VCG       S  F+  A   V    + AA N G+    V   G  N   Y LA 
Sbjct  138   PGDKAVCGNTTRKSTS--FQAAAKKAVLSAVQAAANNKGYARKEVFVAGTTNDAAYVLAN  195

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGG  1679
             CW  +  +SC  CL  A S I  CLP  EGR LN GC+MRYS   F +         SGG
Sbjct  196   CWRSLDTRSCRACLENASSSILGCLPWSEGRALNTGCFMRYSDTDFLNKEQ--ENGSSGG  253

Query  1678  RSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLV-TVNKSKLNFSY  1502
               N L +++A        ++ +  V +I + R ++ ++        L  +++ + LNF Y
Sbjct  254   --NVLVIVVAVVSSVIVLVVGIAIVVYIRKHRYIQMKRRGSNDAEKLAKSLHHNSLNFKY  311

Query  1501  ETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISG  1322
              TLEKAT+ FD++NKLGQGG G VYKGVL DG+ +AIKRL+FN    A  FFNEVN+IS 
Sbjct  312   STLEKATNSFDEANKLGQGGFGTVYKGVLADGREIAIKRLYFNNRHRAADFFNEVNIISS  371

Query  1321  IHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGL  1142
             + HKNLV+LLGCS +GPESLL+YE++PN+SL  +   +   + L+W++RY II+GTAEGL
Sbjct  372   VEHKNLVRLLGCSCSGPESLLIYEYLPNRSLDRFIFDKNKGRELNWDKRYDIIIGTAEGL  431

Query  1141  AYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAP  962
              YLHE + + IIHRDIK SN+LLD +   KIADFGL R F EDKSHISTA+AGTLGYMAP
Sbjct  432   VYLHENSNIRIIHRDIKASNILLDAKLRAKIADFGLARSFQEDKSHISTAIAGTLGYMAP  491

Query  961   EYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHWNLFRAGKLYEAVD  788
             EY+  G+LTEKADVYSFGVL++E+++G+ N  S   + S SL+   W  F++G   + +D
Sbjct  492   EYLAHGQLTEKADVYSFGVLLLEIITGRLNNRSKASEYSDSLVTMTWKHFQSGTAEQLID  551

Query  787   GSL----EERARV--EATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ---DIPQPTQP  635
               L      R+ V  E  R L IGL+C Q  P LRPSMS  +KM++  +   D+  P+ P
Sbjct  552   PCLVVNDNHRSNVKNEILRVLHIGLLCTQEIPSLRPSMSKALKMLTKKEEHLDLEAPSNP  611

Query  634   PFL  626
             PF+
Sbjct  612   PFI  614



>ref|XP_010100422.1| Cysteine-rich receptor-like protein kinase 2 [Morus notabilis]
 gb|EXB82556.1| Cysteine-rich receptor-like protein kinase 2 [Morus notabilis]
Length=650

 Score =   489 bits (1258),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 272/620 (44%), Positives = 366/620 (59%), Gaps = 30/620 (5%)
 Frame = -2

Query  2383  SDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAF  2204
             +DPRA    + C   T  +     +V NFVA ++ ++  + +  +G+ ++G G    Y  
Sbjct  25    ADPRAQTVNITCG--TVREHNTTIFVQNFVAVMEKISEQMRTHGFGQALVGTGPDANYGL  82

Query  2203  GECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLS  2024
              +C  DLS  DC LC+A+ +T + +C P+      GR+F DGCF+R  +Y F+ E     
Sbjct  83    AQCYGDLSLLDCVLCYAEARTVLPQCFPYN----SGRIFLDGCFMRAGNYSFYEEYKGPE  138

Query  2023  DKTVCG-AEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEF  1847
             D TVCG A   G   G   R A A         +   G+  A V   N T Y LA CW  
Sbjct  139   DMTVCGNATRKGSVFGESARQAVAQAVAAAGAPSITRGYAKAKVAVRNETAYVLADCWRS  198

Query  1846  VRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNH  1667
             +   SC  CL  A   I  CLP  EGR LN GC+MRYS + F +         SG     
Sbjct  199   LNQSSCSKCLDNASRSIVKCLPWSEGRALNTGCFMRYSDRDFLNKEA-----GSGSSRAS  253

Query  1666  LPVILATTFGSFAFLLILGSVAFIVRKR--IVKQRKERKRLGAMLVTVNKSKLNFSYETL  1493
               VI+ +   S   L++  ++   + KR  I K+R+       M+ T+N S LNF Y TL
Sbjct  254   WVVIVVSVVSSVVVLVVGVAIGHHIWKRRYIQKKRRGSDVAKKMVKTLNDSSLNFKYATL  313

Query  1492  EKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHH  1313
             EKAT  FDDSNKLGQGG G VYKGVLPDG+ +A+KRLFFN       F+NEVN+IS + H
Sbjct  314   EKATGSFDDSNKLGQGGFGSVYKGVLPDGREIAVKRLFFNNKHRVADFYNEVNIISSVEH  373

Query  1312  KNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYL  1133
             KNLV+LLGCS +GPESLLVYE++PN+SL  +   +   + L+WE+RY+II+GTAEGL YL
Sbjct  374   KNLVRLLGCSCSGPESLLVYEYLPNKSLDRFIFDQTRGKGLNWEKRYEIIIGTAEGLVYL  433

Query  1132  HEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYV  953
             HE +++ IIHRDIK SN+LLD     KIADFGL R F EDKSHISTA+AGTLGYMAPEY+
Sbjct  434   HENSKIRIIHRDIKTSNILLDSRLRAKIADFGLARSFEEDKSHISTAIAGTLGYMAPEYL  493

Query  952   VQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHWNLFRAGKLYEAVDGSL  779
               G+LTEK DVYSFGVL++E+V+G++N  S   + + SL+   W  F++GK  E  D +L
Sbjct  494   AHGQLTEKVDVYSFGVLLLEIVTGRQNNRSKTSEYTDSLVTLTWKHFQSGKAEELYDPNL  553

Query  778   --------EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS-GDQDIPQPTQPPFL  626
                     + + + + +R + IGL+C Q    LRP+MS  ++M++  +Q +P PT PPF+
Sbjct  554   MLHNYRDSQNQIKNQISRVVHIGLLCTQEIGSLRPTMSKALQMLTKKEQQLPAPTSPPFI  613

Query  625   TS-----NSAASSGSYPNRG  581
                    N      SYP  G
Sbjct  614   DEKTMEFNDTCEDPSYPLNG  633



>ref|XP_009392899.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009392900.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=657

 Score =   488 bits (1257),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 270/637 (42%), Positives = 369/637 (58%), Gaps = 41/637 (6%)
 Frame = -2

Query  2473  R*SDTMNRKMASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFV  2294
             R SDT       L     +F+F     R   DPR+    ++C  +   +    AYV NF+
Sbjct  5     RSSDTHPMSTVGLIVHPLVFMFLYGFTRG--DPRSETVEVMCGRQL--EHNTTAYVPNFL  60

Query  2293  AALDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQ  2114
             A +D +   + +  +G++ +G+G    Y  G+C  DLS  DC LC+A+ +T + +C P+ 
Sbjct  61    AVMDNVGNQIRAGGFGKSTVGSGPDGNYGLGQCYGDLSSLDCALCYAEARTVLPKCFPYN  120

Query  2113  RLVRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGR  1934
                  GR+F DGCF+R  +Y FF E +   D   CG  +    S +F + A   + E   
Sbjct  121   ----SGRIFLDGCFMRSANYSFFTEYTGPEDNIKCG--NATRKSRVFEQMAQQALQEATD  174

Query  1933  KAAANDGFFTAAVGRG---NSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRV  1763
             KA  N G+  A+  R    N + Y L  CW  +   SC  CL  A + +  CLP  EGR 
Sbjct  175   KAPGNGGYAKASALRSGVLNESAYVLVNCWRTLNESSCRACLKNASASVVGCLPWSEGRA  234

Query  1762  LNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKR  1583
             LN GC++RYS   F +       +QS G      + +    GS   L+++G V   V   
Sbjct  235   LNTGCFLRYSDTNFLN------ADQSSGLGRRSIIAMVAAIGSA--LMVIG-VGLTVGVF  285

Query  1582  IVKQRKERKRLGAMLVT-----VNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGV  1418
             + KQRK +K+ GA   T     +  S LNF Y TLEKAT  F  SNKLGQGG G VYKG 
Sbjct  286   MWKQRKLKKKRGANNATRLASALYDSSLNFKYSTLEKATGGFSISNKLGQGGFGTVYKGT  345

Query  1417  LPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPN  1238
             L DG+ +A+KRLFFN       F+NEVN+IS + HKNLV+LLGCS +GPESLLVYEF+PN
Sbjct  346   LSDGREIAVKRLFFNNKHRVSDFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEFLPN  405

Query  1237  QSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFT  1058
             +SL  +   R+N + L W +R+ II  TAEGL+YLHE  ++ IIHRDIK SN+LLD +F 
Sbjct  406   KSLDRFLFDRENGKALDWRKRFNIITDTAEGLSYLHENPKVKIIHRDIKASNILLDLKFR  465

Query  1057  PKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGK  878
              KIADFGL R F  DKSHISTA+AGTLGYMAPEY+  G+LTEKADVYSFGVL+IE+V+G 
Sbjct  466   AKIADFGLARSFQGDKSHISTAIAGTLGYMAPEYIAHGQLTEKADVYSFGVLMIEIVTGI  525

Query  877   KNSSFY------QASVSLLQQHWNLFRAGKLYEAVDGSLE-------ERARVEATRQLQI  737
              N+         ++S SLL Q W  F++G + + +D ++        +  + E  +   +
Sbjct  526   SNNRSKICEYDSESSESLLTQAWKHFQSGTVEQLMDPNITLDRYADGDAVKEEVMKMFHV  585

Query  736   GLVCVQASPELRPSMSAVVKM-ISGDQDIPQPTQPPF  629
             GL+C Q  P  RPS+S  ++M +  ++  P PT+PPF
Sbjct  586   GLLCTQEIPTFRPSVSCALQMLLDREKQPPAPTKPPF  622



>ref|XP_010040238.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Eucalyptus 
grandis]
Length=646

 Score =   488 bits (1255),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 275/618 (44%), Positives = 371/618 (60%), Gaps = 42/618 (7%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L L  FF ++  +VS P+ +EA L C N T   +       +F A +  ++  V  ++ G
Sbjct  15    LALSSFFFAL--AVSVPQITEAGLHCNNSTEIVTSNNF---SFRAVMREISESVADQRRG  69

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
                + +    VY   +C   L + DC LCFA+ +T+I RCLP       G+L+ DGCF+R
Sbjct  70    NYSVTSPPPVVYGLAQCEGGLIEMDCPLCFAEIRTRIPRCLP-----NFGQLYRDGCFLR  124

Query  2065  YDDYVFFNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGR-------KAAANDGF  1910
             YD Y F+NE+     D   C +     NS +    A      + R       KA  N GF
Sbjct  125   YDGYDFYNETVDPTHDMLNCSS-----NSTVPAERATEFSERVDRVLRYVLAKALQNGGF  179

Query  1909  FTAA--VGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRY  1736
               A      G   VY  AQCW  +    C  CL  A S   SC P EE R +NAGC++RY
Sbjct  180   AVAGEDAPEGAVGVYAWAQCWSTLDAGGCRVCLENATSMARSCAPGEEARAMNAGCFLRY  239

Query  1735  STKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERK  1556
             ST KFYD  +  ++  S  ++  +P+++A    +   + ++   A+I  K   K+++ + 
Sbjct  240   STTKFYDLDSRGSSEVSITKA-VVPIVVAIAPSAAVVISLVLIGAWIGYKEYSKKKRVQN  298

Query  1555  RLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFF  1376
              L  +  +++K +L F YETLEKAT++F DS KLGQGG+G VYKG+LPD K VAIKRL  
Sbjct  299   SLMQLRASMSKFRLYFKYETLEKATNFFHDSRKLGQGGAGSVYKGILPDKKVVAIKRLVI  358

Query  1375  NTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFV--------------PN  1238
             NT QWAD  FNEVNLISGI HKNLVKLLGCSI GPESLLVYE++              PN
Sbjct  359   NTQQWADDLFNEVNLISGIQHKNLVKLLGCSIEGPESLLVYEYLSNKSLDQVLLVQGNPN  418

Query  1237  QSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFT  1058
             + +  + +     + L+WE+R  II+G AEGLAYLH    + IIHRDIK SN+LLDE  T
Sbjct  419   KQIESFVAVNNATRILTWEERLHIIIGIAEGLAYLHGGYGVKIIHRDIKASNILLDENLT  478

Query  1057  PKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGK  878
              KIADFGL R    DKSH+ T +AGT+GYMAPEY+V+G+LTEKADVY+FGVLV+E+++G+
Sbjct  479   AKIADFGLARCISPDKSHLCTGIAGTIGYMAPEYLVRGQLTEKADVYAFGVLVLEILTGR  538

Query  877   KNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELR  701
             KNS + Q S S+LQ  W  +++  L   +D +L+ +  V EA+  LQIGL+C QAS ELR
Sbjct  539   KNSVYTQGSSSILQSVWKHYKSTNLAACIDPTLQGKFLVLEASNVLQIGLLCTQASMELR  598

Query  700   PSMSAVVKMISGDQDIPQ  647
             P MS VV+M+  D+D  Q
Sbjct  599   PPMSRVVEMLH-DKDQQQ  615



>ref|XP_009392895.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392896.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392897.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392898.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=675

 Score =   488 bits (1257),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 270/637 (42%), Positives = 369/637 (58%), Gaps = 41/637 (6%)
 Frame = -2

Query  2473  R*SDTMNRKMASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFV  2294
             R SDT       L     +F+F     R   DPR+    ++C  +   +    AYV NF+
Sbjct  23    RSSDTHPMSTVGLIVHPLVFMFLYGFTRG--DPRSETVEVMCGRQL--EHNTTAYVPNFL  78

Query  2293  AALDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQ  2114
             A +D +   + +  +G++ +G+G    Y  G+C  DLS  DC LC+A+ +T + +C P+ 
Sbjct  79    AVMDNVGNQIRAGGFGKSTVGSGPDGNYGLGQCYGDLSSLDCALCYAEARTVLPKCFPYN  138

Query  2113  RLVRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGR  1934
                  GR+F DGCF+R  +Y FF E +   D   CG  +    S +F + A   + E   
Sbjct  139   ----SGRIFLDGCFMRSANYSFFTEYTGPEDNIKCG--NATRKSRVFEQMAQQALQEATD  192

Query  1933  KAAANDGFFTAAVGRG---NSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRV  1763
             KA  N G+  A+  R    N + Y L  CW  +   SC  CL  A + +  CLP  EGR 
Sbjct  193   KAPGNGGYAKASALRSGVLNESAYVLVNCWRTLNESSCRACLKNASASVVGCLPWSEGRA  252

Query  1762  LNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKR  1583
             LN GC++RYS   F +       +QS G      + +    GS   L+++G V   V   
Sbjct  253   LNTGCFLRYSDTNFLN------ADQSSGLGRRSIIAMVAAIGSA--LMVIG-VGLTVGVF  303

Query  1582  IVKQRKERKRLGAMLVT-----VNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGV  1418
             + KQRK +K+ GA   T     +  S LNF Y TLEKAT  F  SNKLGQGG G VYKG 
Sbjct  304   MWKQRKLKKKRGANNATRLASALYDSSLNFKYSTLEKATGGFSISNKLGQGGFGTVYKGT  363

Query  1417  LPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPN  1238
             L DG+ +A+KRLFFN       F+NEVN+IS + HKNLV+LLGCS +GPESLLVYEF+PN
Sbjct  364   LSDGREIAVKRLFFNNKHRVSDFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEFLPN  423

Query  1237  QSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFT  1058
             +SL  +   R+N + L W +R+ II  TAEGL+YLHE  ++ IIHRDIK SN+LLD +F 
Sbjct  424   KSLDRFLFDRENGKALDWRKRFNIITDTAEGLSYLHENPKVKIIHRDIKASNILLDLKFR  483

Query  1057  PKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGK  878
              KIADFGL R F  DKSHISTA+AGTLGYMAPEY+  G+LTEKADVYSFGVL+IE+V+G 
Sbjct  484   AKIADFGLARSFQGDKSHISTAIAGTLGYMAPEYIAHGQLTEKADVYSFGVLMIEIVTGI  543

Query  877   KNSSFY------QASVSLLQQHWNLFRAGKLYEAVDGSLE-------ERARVEATRQLQI  737
              N+         ++S SLL Q W  F++G + + +D ++        +  + E  +   +
Sbjct  544   SNNRSKICEYDSESSESLLTQAWKHFQSGTVEQLMDPNITLDRYADGDAVKEEVMKMFHV  603

Query  736   GLVCVQASPELRPSMSAVVKM-ISGDQDIPQPTQPPF  629
             GL+C Q  P  RPS+S  ++M +  ++  P PT+PPF
Sbjct  604   GLLCTQEIPTFRPSVSCALQMLLDREKQPPAPTKPPF  640



>emb|CAN66423.1| hypothetical protein VITISV_007983 [Vitis vinifera]
Length=642

 Score =   487 bits (1253),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 262/619 (42%), Positives = 376/619 (61%), Gaps = 25/619 (4%)
 Frame = -2

Query  2446  MASLSKWLFLFIFFLS---INRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDAL  2276
             M  + +   +F+F ++   ++  ++DPR + A   C +  A  S   A   NFV A+  L
Sbjct  1     MGIVGRMRVVFLFLMASGFVSNLMADPRTTVAGFQCNSTEAVSSVLLA--QNFVPAMANL  58

Query  2275  TPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGG  2096
             +  V+   +G +++G     V+   +C KDLS  DC LCF++ ++ + +C P      GG
Sbjct  59    STQVNEDGFGTSIVGEAPNAVFGLAQCFKDLSSIDCQLCFSEIRSILPKCYP----DTGG  114

Query  2095  RLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAAND  1916
             R+F+DGCF RY+++ FF++         C +       G+F+     ++  +  KA  N 
Sbjct  115   RIFFDGCFGRYENFSFFDQGXDSVQLKNCSSSKNSSQPGIFKEALERVIESVSLKAQKNQ  174

Query  1915  GFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRY  1736
             GF  A+    N T++ LAQCWE +  K+C+ CL A+ S I SC P  +GR LNAGCYMRY
Sbjct  175   GFAVASHSVSNLTLHALAQCWESLDKKTCNSCLQASASSIMSCYPGVDGRSLNAGCYMRY  234

Query  1735  STKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFI----VRKRIVKQR  1568
             S + F++ S    T  S GR   L +IL    G F   LIL  +       +R+   K  
Sbjct  235   SNEVFWNLSR--HTGLSAGRKA-LYIILGLAVGGF---LILAGIGLWKKGHLRQSFGKSL  288

Query  1567  KERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIK  1388
             K+    G +   +  S+LNF Y+ L +AT+ FD SNKLGQG  G VYKG+L DG+ VA+K
Sbjct  289   KDIYGSG-LSSALAHSQLNFRYQELRQATNNFDSSNKLGQGSYGSVYKGILLDGREVAVK  347

Query  1387  RLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSAR  1208
             RLF NT QW D FFNEV+LI+ + HKNLVKLLG S+ G ES LVY++ PN+SL  +    
Sbjct  348   RLFLNTRQWIDQFFNEVHLINQVRHKNLVKLLGYSVDGQESXLVYDYYPNKSLDHFIFDE  407

Query  1207  KNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVR  1028
                Q L W++R  II G AEGL+YLHEE+E+ IIHRDIK SN+LLD++  PKI DFGL R
Sbjct  408   NQAQILDWKKRIDIIQGVAEGLSYLHEESEIRIIHRDIKASNILLDDKLKPKITDFGLAR  467

Query  1027  LFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKK--NSSFYQA  854
              F ED++H+ST +AGTLGYMAPEYVV G LTEKADVYSFGVL++E+++G++  N +  + 
Sbjct  468   SFAEDQTHLSTGIAGTLGYMAPEYVVHGHLTEKADVYSFGVLLLEILTGQRCSNGTGAKP  527

Query  853   SVSLLQQHWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAVVK  677
                 L + W+ ++A  + E +D    +E  + E    + +GL+C QA+P  RP+M+ VV+
Sbjct  528   GQFFLAKIWSHYKAETVDEIMDRHFYDEXVKDEILHAVHVGLLCTQATPSYRPTMAKVVE  587

Query  676   MI--SGDQDIPQPTQPPFL  626
             ++  + +Q+   PT PPFL
Sbjct  588   LLRSTKNQENVFPTDPPFL  606



>ref|XP_010921575.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Elaeis 
guineensis]
Length=649

 Score =   487 bits (1253),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 265/590 (45%), Positives = 360/590 (61%), Gaps = 19/590 (3%)
 Frame = -2

Query  2359  ALICTNRTAPQSQR-QAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAFGECMKDL  2183
             A+I T     QS + +A+  NFV  ++ +   V    +G  V G  N  VY  G+C   L
Sbjct  28    AIILTICGQNQSTKPEAFDVNFVNTMEMVYQNVTRTGFGTAVSGTSN-IVYGLGQCFNYL  86

Query  2182  SQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGA  2003
             S T C LC+A+ + ++  CLP       GR++ DGCF+RY DY   +E+    D  VCG 
Sbjct  87    SPTGCQLCYAESRVKLPYCLPNTT----GRIYLDGCFLRYADYNISSEAVDKLDTYVCGN  142

Query  2002  EDFGGNSGL-FRRNAAALVGELGRKAAANDGFFTA---AVGRGNSTVYGLAQCWEFVRGK  1835
                  ++   F   A  LV  L  +A ++  ++ A   +VG    TVYG+AQCW  +   
Sbjct  143   SSTSASNSTDFDDTAMKLVRNLTSEAYSSKEYYKAGSLSVGSSGVTVYGMAQCWRSLNES  202

Query  1834  SCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVI  1655
              C DCL +A   +  CLP  +G+ LNAGCY+RYST+ FY   T+ +   S  R   +  +
Sbjct  203   GCRDCLESARGSVARCLPASDGKALNAGCYLRYSTEPFYVAQTVESGGSSSARRRLIVAL  262

Query  1654  LATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETLEKATDY  1475
              +         + +  +     +R +    +      ++ +++ S LNF YE L  ATD 
Sbjct  263   GSVIAALAVIAIAILWMKLRPNRRSIDSNDDIDGSQEIIRSISSSNLNFKYEDLRIATDN  322

Query  1474  FDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKL  1295
             F   NKLGQGG G VYKGVLPDG+ +A+KRLF  T QW D FFNEV+LI+ I HKNLVKL
Sbjct  323   FSQMNKLGQGGFGSVYKGVLPDGREIAVKRLFSTTRQWLDQFFNEVSLINRIQHKNLVKL  382

Query  1294  LGCSITGPESLLVYEFVPNQSL--YDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEET  1121
             LGCS+ GPESL+VYE++ N SL  + + S +KN   L W++R+ II GTAEGLAYLH   
Sbjct  383   LGCSVEGPESLVVYEYLCNTSLDHFLFDSFKKN--ALDWKRRFNIITGTAEGLAYLHTSC  440

Query  1120  ELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGK  941
             E+ IIHRDIK SN+LLDE F PKI+DFGLVR F  D+SH+ST +AGT GYMAPEY+V G+
Sbjct  441   EVRIIHRDIKASNILLDESFKPKISDFGLVRYFAGDQSHLSTGLAGTFGYMAPEYIVHGQ  500

Query  940   LTEKADVYSFGVLVIEVVSGKKNSSFYQASV---SLLQQHWNLFRAGKLYEAVDGSLEER  770
             LTEKAD+YS+GVLV+E+V+G+KN+S    S    SL+   W  F + +L E +D  L+++
Sbjct  501   LTEKADIYSYGVLVLEIVTGRKNNSSIAESAEGHSLVSLIWQKFNSERLLELLDPYLQDQ  560

Query  769   ARVE-ATRQLQIGLVCVQASPELRPSMSAVVKMI-SGDQDIPQPTQPPFL  626
                E A +   IGL+C QASP LRP M  VV+M+ S  +D+P PTQPPF+
Sbjct  561   CSEEQALKVFHIGLLCAQASPNLRPPMWKVVEMLTSNSKDLPLPTQPPFI  610



>ref|XP_003551216.2| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X1 [Glycine max]
 ref|XP_006602389.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X2 [Glycine max]
 ref|XP_006602390.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X3 [Glycine max]
Length=649

 Score =   487 bits (1253),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 264/607 (43%), Positives = 366/607 (60%), Gaps = 28/607 (5%)
 Frame = -2

Query  2386  VSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNA-TVY  2210
             +++PRA    + C N+   +     +V NFVA ++ ++  + +  YG  V+G G   T Y
Sbjct  24    MAEPRARTVNITCNNKL--EHNTTIFVPNFVATMEKISEQMRNTGYGTAVVGTGGPDTNY  81

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSS  2030
                +C  DLS  DC LC+A+ +T + +C P+     GGR++ DGCF+R ++Y F++E   
Sbjct  82    GLAQCYGDLSLLDCVLCYAEARTVLPQCFPYN----GGRIYLDGCFMRAENYSFYDEYIG  137

Query  2029  LSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV---GRGNSTVYGLAQ  1859
               DK VCG       S  F+  A   V    + AA N G+    V   G  N   Y LA 
Sbjct  138   PGDKAVCGNTTRKSTS--FQAAAKKAVLSAVQAAANNKGYARKEVFVAGTTNDAAYVLAN  195

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGG  1679
             CW  +  +SC  CL  A S I  CLP  EGR LN GC+MRYS   F +         SGG
Sbjct  196   CWRSLDTRSCRACLENASSSILGCLPWSEGRALNTGCFMRYSDTDFLNKEQ--ENGSSGG  253

Query  1678  RSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLV-TVNKSKLNFSY  1502
               N L +++A        ++ +  V +I + R ++ ++        L  +++ + LNF Y
Sbjct  254   --NVLVIVVAVVSSVIVLVVGIAIVVYIRKHRYIQMKRRGSNDAEKLAKSLHHNSLNFKY  311

Query  1501  ETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISG  1322
              TLEKAT+ FD++NKLGQGG G VYKGVL DG+ +AIKRL+FN    A  FFNEVN+IS 
Sbjct  312   STLEKATNSFDEANKLGQGGFGTVYKGVLADGREIAIKRLYFNNRHRAADFFNEVNIISS  371

Query  1321  IHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGL  1142
             + HKNLV+LLGCS +GPESLL+YE++PN+SL  +   +   + L+W++RY II+GTAEGL
Sbjct  372   VEHKNLVRLLGCSCSGPESLLIYEYLPNRSLDRFIFDKNKGRELNWDKRYDIIIGTAEGL  431

Query  1141  AYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAP  962
              YLHE + + IIHRDIK SN+LLD +   KIADFGL R F EDKSHISTA+AGTLGYMAP
Sbjct  432   VYLHENSNIRIIHRDIKASNILLDAKLRAKIADFGLARSFQEDKSHISTAIAGTLGYMAP  491

Query  961   EYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHWNLFRAGKLYEAVD  788
             EY+  G+LTEKADVYSFGVL++E+++G+ N  S   + S SL+   W  F++G   + +D
Sbjct  492   EYLAHGQLTEKADVYSFGVLLLEIITGRLNNRSKASEYSDSLVTMTWKHFQSGTAEQLID  551

Query  787   GSL------EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQ---DIPQPTQP  635
               L          + E  R L IGL+C Q  P LRPSMS  +KM++  +   D+  P+ P
Sbjct  552   PCLVVDDNHRSNFKNEILRVLHIGLLCTQEIPSLRPSMSKALKMLTKKEEHLDLEAPSNP  611

Query  634   PFLTSNS  614
             PF+  ++
Sbjct  612   PFIDEST  618



>ref|XP_004228552.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Solanum 
lycopersicum]
Length=645

 Score =   486 bits (1252),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 268/636 (42%), Positives = 383/636 (60%), Gaps = 29/636 (5%)
 Frame = -2

Query  2458  MNRKMASL--SKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAAL  2285
             M R   S+  S ++ + I  L  + SV++PR+    LIC N T         V+NFV  +
Sbjct  1     MERATPSMLCSHFVVVLILLLP-DTSVAEPRSQIVQLICENGTT------VSVSNFVNTM  53

Query  2284  DALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLV  2105
             + ++  + ++  G    G G    Y  G+C  DLS +DC LCF++ +T   +C P  +  
Sbjct  54    ETISEQMRTRGNGVAATGTGPNASYGLGQCYGDLSLSDCVLCFSEARTVFPQCFPSNK--  111

Query  2104  RGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAA  1925
                R++ DGCF+R D+Y F+++     D+ VCG     G+  LF++N    + +    A 
Sbjct  112   --ARIYLDGCFMRADNYNFYDQYFGPEDRHVCGNRTTKGS--LFQQNVRRAIQQAVANAP  167

Query  1924  ANDGFFTAAV---GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNA  1754
             +N+G+  A V   G  + T Y LA CW+ +   SC  CL  A + +  CLP  EGR L  
Sbjct  168   SNNGYARAQVSVPGSSSMTAYVLADCWKTLSANSCAACLQNASASMLGCLPWSEGRALYT  227

Query  1753  GCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVK  1574
             GC++RYS   F  N+   +   S G+   + +++ ++F  F     +G +     K+I +
Sbjct  228   GCFIRYSDTNFL-NAISTSRGSSRGKVAVIVIVVVSSFVVFGVGAFIG-IGVWKNKQIQR  285

Query  1573  QRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVA  1394
             +RK       ++  ++   LNF Y TL+KAT  FD+SNKLGQGG G VYKGVL DG+ +A
Sbjct  286   KRKGANDAEKLVKILHDISLNFKYSTLDKATGSFDESNKLGQGGFGTVYKGVLADGREIA  345

Query  1393  IKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTS  1214
             +KRLFFN    A  F+NEVN+IS + HKNL++LLGCS +GPESLLVYEF+PNQSL  +  
Sbjct  346   VKRLFFNNKHRAADFYNEVNIISSVEHKNLIRLLGCSCSGPESLLVYEFLPNQSLDRFIF  405

Query  1213  ARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGL  1034
                  + L+WE+R+KII+GTAEGLAYLHE T+  IIHRDIK SN+LLD +   KIADFGL
Sbjct  406   DPMKGKDLNWEKRFKIIIGTAEGLAYLHENTKTRIIHRDIKASNILLDSKLRAKIADFGL  465

Query  1033  VRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFY--  860
              R F EDKSHISTA+AGTLGYMAPEY+  G+LTEKADVYSFGVL++E+V+G++N+     
Sbjct  466   ARSFQEDKSHISTAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLMEIVTGRQNNRSIND  525

Query  859   QASVSLLQQHWNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELRP  698
             + + SL+   W+ ++ G + E  D SL          + E  R L +GL+C Q    +RP
Sbjct  526   ENTESLVSIVWDYYQRGIVEELFDPSLMLHNYNTINVKNEIARVLHVGLLCTQEIQTVRP  585

Query  697   SMSAVVKMI-SGDQDIPQPTQPPFLTSNSAASSGSY  593
             SMS  ++MI   ++++P PT PPF+  N+    G +
Sbjct  586   SMSKALRMILEKEEELPAPTNPPFVDENTMELHGPW  621



>ref|XP_007157363.1| hypothetical protein PHAVU_002G063900g [Phaseolus vulgaris]
 gb|ESW29357.1| hypothetical protein PHAVU_002G063900g [Phaseolus vulgaris]
Length=649

 Score =   486 bits (1252),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 260/604 (43%), Positives = 364/604 (60%), Gaps = 25/604 (4%)
 Frame = -2

Query  2386  VSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYA  2207
             +++PRA    + C +    +     +V NFVA +D ++  +    +G  V+G G  T Y 
Sbjct  27    IAEPRAKTVLITCGH--VREHNTTIFVPNFVATMDKISDEMRKTGFGTAVVGTGPDTNYG  84

Query  2206  FGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSL  2027
               +C  DLS  DC LC+A+ +T + +C P+      GR+F DGCF+R ++Y FFNE +  
Sbjct  85    LAQCYGDLSLLDCVLCYAEARTVLPQCYPYN----SGRIFLDGCFMRAENYSFFNEYTGP  140

Query  2026  SDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV---GRGNSTVYGLAQC  1856
              DK VCG  +    +  F+  A   V    + A  N G+    V   G  N +VY LA C
Sbjct  141   GDKAVCG--NMTKKNSSFQAAAKEAVSRAVQDAPNNKGYARGNVAVEGATNQSVYVLADC  198

Query  1855  WEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGR  1676
             W  +  +SC  CL  A   +  CLP  EGR LN GC+MRYS K F +      ++    R
Sbjct  199   WRTLDKRSCKACLENAFFSLLGCLPWSEGRALNTGCFMRYSDKDFLNKEQETGSS----R  254

Query  1675  SNHLPVILATTFGSFAFLLILGSVAFIVRKR-IVKQRKERKRLGAMLVTVNKSKLNFSYE  1499
              N   +++         ++ +    +I ++R I K+R+       +  ++    LNF Y 
Sbjct  255   GNVAVIVVVVVSSVIVSVVGVTIGVYIWKQRYIQKKRRGSNDAEKLAKSLQNKSLNFKYS  314

Query  1498  TLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGI  1319
             TL+KAT  F ++NKLGQGG G VYKGVL DG+ +AIKRL+FN  Q A  F+NEVN+IS +
Sbjct  315   TLDKATGSFHENNKLGQGGFGTVYKGVLADGREIAIKRLYFNNRQRAADFYNEVNIISSL  374

Query  1318  HHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLA  1139
              HKNLV+LLGCS +GPESLLVYEF+PN+SL  +   +   + L+WE+R++II+GT EGL 
Sbjct  375   EHKNLVRLLGCSCSGPESLLVYEFLPNKSLDRFIFDKNKGKELNWEKRFEIIIGTTEGLV  434

Query  1138  YLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPE  959
             YLHE ++  IIHRDIK SN+LLD +F  KIADFGL R F EDKSHISTA+AGTLGYMAPE
Sbjct  435   YLHENSKTRIIHRDIKASNILLDAKFRAKIADFGLARSFQEDKSHISTAIAGTLGYMAPE  494

Query  958   YVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHWNLFRAGKLYEAVDG  785
             Y+  G+LTEKADVYSFGVL++E+V+G++N  S   + S SL+   W  F+AG   +  D 
Sbjct  495   YLAHGQLTEKADVYSFGVLLLEMVTGRQNNRSKVSEYSDSLVTVAWKHFQAGTAEQLFDP  554

Query  784   SL------EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS-GDQDIPQPTQPPFL  626
             +L          + E  R + IGL+C Q  P LRP MS  ++M++  ++++  P+ PPFL
Sbjct  555   NLVLQEDHNSEVKDEILRVVHIGLLCTQEVPSLRPIMSKTLQMLTKKEENLIAPSNPPFL  614

Query  625   TSNS  614
               N+
Sbjct  615   DENT  618



>gb|KDP26625.1| hypothetical protein JCGZ_17783 [Jatropha curcas]
Length=615

 Score =   484 bits (1247),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 258/598 (43%), Positives = 363/598 (61%), Gaps = 31/598 (5%)
 Frame = -2

Query  2386  VSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYA  2207
             + DPRA +  + C  +   +     +V NFVA ++ ++  + +  +G  V G+G    Y 
Sbjct  1     MGDPRAQQVKVTCGRQL--EHNASIFVPNFVATMENISEQMRTSGFGVAVTGSGPDINYG  58

Query  2206  FGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSL  2027
               +C  DLS  DC LC+A+ +T + +C P      GGR+F DGCF+R ++Y FF E    
Sbjct  59    LAQCYGDLSLLDCVLCYAEARTVLPQCYPHN----GGRVFLDGCFMRSENYSFFEEYRGP  114

Query  2026  SDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTA--AVGRGNSTVYGLAQCW  1853
              D+ +CG +    ++  F  +A   +      A  + G+  A  AV   N + Y LA CW
Sbjct  115   LDEVICGNQTRKNST--FEESAKVALSTAVSSAMNSRGYARAQVAVQGTNESAYVLADCW  172

Query  1852  EFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGRS  1673
               +   +C  CL  A + I  CLP  EGR L  GC++RYS + F +       + S G  
Sbjct  173   RTLNASACRACLENASASILKCLPGSEGRALYTGCFIRYSDRDFLNELR---NDSSRGSI  229

Query  1672  NHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLV-TVNKSKLNFSYET  1496
               + V + ++       +I+G   +I + R V+ ++        LV T+N S LNF Y T
Sbjct  230   IVIVVSIVSSLVVLGVGIIIG--VYIWKHRYVQMKRRGSNDARKLVKTLNDSSLNFKYST  287

Query  1495  LEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIH  1316
             LEKAT  FDD+NKLGQGG G VYKGVLPDG+ +A+KRLFFN    A  F+NEVN+IS + 
Sbjct  288   LEKATGSFDDANKLGQGGFGSVYKGVLPDGREIAVKRLFFNNRHRAADFYNEVNIISTVE  347

Query  1315  HKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAY  1136
             HKNLV+LLGCS +GPESLLVYEF+PN++       +   + L+WE+RY II+GTAEGL Y
Sbjct  348   HKNLVRLLGCSCSGPESLLVYEFLPNKN-------QNKGKVLTWEKRYDIIIGTAEGLVY  400

Query  1135  LHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEY  956
             LHE +++ IIHRDIK SN+LLD  F  KIADFGL R F EDKSHISTA+AGTLGYMAPEY
Sbjct  401   LHENSKIRIIHRDIKASNILLDSRFRAKIADFGLARSFQEDKSHISTAIAGTLGYMAPEY  460

Query  955   VVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHWNLFRAGKLYEAVDGS  782
             +  G+LTEKADVYSFGVL++E+V+G++N  S   + + SL+   W  F+ G + E  D +
Sbjct  461   LAHGQLTEKADVYSFGVLLLEIVTGRQNNRSKTSEYTDSLVTLTWKKFQTGTVEEFYDPN  520

Query  781   L------EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDIPQPTQPPFL  626
             L          + +  R +QIGL+C Q  P LRP+M+  ++M++ + ++P P+ PPF+
Sbjct  521   LMLHNHHNSNIKNDVYRVVQIGLLCTQEMPSLRPTMAKTLQMLTTEDNLPAPSNPPFI  578



>gb|KFK41462.1| hypothetical protein AALP_AA2G134000 [Arabis alpina]
Length=648

 Score =   485 bits (1248),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 266/607 (44%), Positives = 369/607 (61%), Gaps = 41/607 (7%)
 Frame = -2

Query  2380  DPRASEAALICTNRTAPQSQRQA--YVANFVAALDALTPLVDSKKYGETVIGAGNATVYA  2207
             D RA    + C+    P  +  A  YV NFVA ++ ++  V    +G  + G+G    Y 
Sbjct  29    DARARNVQVTCS----PLLEHNATVYVPNFVATMEKISQQVQVSGFGVALTGSGPDANYG  84

Query  2206  FGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSL  2027
               +C  DL   DC LC+A+ +  + +C P      GGR+F DGCF+R ++Y F+NE    
Sbjct  85    LAQCYGDLPLNDCVLCYAEARMILPKCYP----KNGGRIFLDGCFMRAENYSFYNEFKGP  140

Query  2026  SDKTVCGAE------DFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNS--TVY  1871
              D  VCG         FG       RNA +       +A  N G+  AA   G S  + +
Sbjct  141   EDNVVCGNTTRRKEGSFGDTVRRVLRNAVS-------EAPGNGGYARAAANAGESGESAF  193

Query  1870  GLAQCWEFVRGKSCDDCLA-AAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPAT  1694
              LA CW  +  +SC +CL  A+ S +  CLP  EGR L+ GC++RYS K F +   IP  
Sbjct  194   VLANCWRNLSRESCKECLENASASMVKQCLPWSEGRALHTGCFLRYSDKDFLNK--IPRN  251

Query  1693  NQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIV-KQRKERKRLGAMLVTVNKSK  1517
              +S  R + + ++++       F++ +  V +I ++R + K+R+    +  M  T+N S 
Sbjct  252   GRS--RGSVVVIVVSVLSSVVVFMIGIAIVVYICKRRTIQKKRRGSNDVEKMAKTLNDSS  309

Query  1516  LNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEV  1337
             LNF Y TLEKAT  FD++NKLGQGG G VYKGVL DG+ +A+KRLFFN    A  F+NEV
Sbjct  310   LNFKYSTLEKATGSFDNANKLGQGGFGTVYKGVLHDGRDIAVKRLFFNNRHRATDFYNEV  369

Query  1336  NLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILG  1157
             N+IS   HKNLV+LLGCS +GPESLLVYE++ N+SL  +       + L W++RY II+G
Sbjct  370   NIISTCEHKNLVRLLGCSCSGPESLLVYEYLQNKSLDRFIFDVNRGKTLDWQRRYVIIVG  429

Query  1156  TAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTL  977
             TAEGL YLHE++ + IIHRDIK SN+LLD +   KIADFGL R F EDKSHISTA+AGTL
Sbjct  430   TAEGLVYLHEQSTVKIIHRDIKASNILLDSKLQAKIADFGLARSFQEDKSHISTAIAGTL  489

Query  976   GYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHWNLFRAGKL  803
             GYMAPEY+  G+LTEK DVYSFGVLV+E+V+G++N  S     S SL+ + W  F++G+L
Sbjct  490   GYMAPEYLANGQLTEKVDVYSFGVLVLEIVTGRQNTKSKMSDYSDSLITEAWKHFQSGEL  549

Query  802   YEAVDGSLEERARVEAT-------RQLQIGLVCVQASPELRPSMSAVVKMISGDQDI-PQ  647
              E +D +L+ + + ++T       R +QIGL+C Q    LRPSMS ++ M+   ++I P 
Sbjct  550   EEIIDPNLDWKDQNDSTIIKKEIVRVVQIGLLCTQEIAALRPSMSKLLHMLRNKEEILPL  609

Query  646   PTQPPFL  626
             P  PPF+
Sbjct  610   PGNPPFM  616



>ref|XP_004508879.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Cicer arietinum]
Length=682

 Score =   486 bits (1251),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 264/593 (45%), Positives = 360/593 (61%), Gaps = 27/593 (5%)
 Frame = -2

Query  2365  EAALICTNRTAP-QSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAFGECMK  2189
             EA L C +   P  +     + N++ A+D ++  V    +G   +      +YA G+C +
Sbjct  28    EAGLTCGSYQYPGDNGGNKLMQNWMIAMDGVSFQVKEHGWGAQTLVGNWHPMYALGQCHR  87

Query  2188  DLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES-SSLSDKTV  2012
             DL+ T C  CF Q +  + RC+P       GR++ DGCF+RYD+Y FF+ES  S  D  +
Sbjct  88    DLNPTQCYDCFTQARQLLSRCVP----KVAGRIYLDGCFLRYDNYTFFDESVDSNRDTNM  143

Query  2011  CGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKS  1832
             CG  + G  +    +  A+L+  + + A    G    AV  G   VY LAQCWE V   S
Sbjct  144   CGTTEKGETT---LKRVASLISNVSKSA----GEHRFAV-EGEGGVYALAQCWETVDKWS  195

Query  1831  CDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFY-------DNSTIPATNQSGGRS  1673
             C  CL  A  K+  C+P  EGR L  GC+MRYST+KFY       D  T P   +   R 
Sbjct  196   CQRCLREAGKKVQGCVPAPEGRSLFTGCFMRYSTRKFYKDVVAQNDAQTTPPPPRD--RH  253

Query  1672  NHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYETL  1493
              ++ +I+A    + A +L++  +AF+ R+++V   K     G        +  +F Y+ L
Sbjct  254   INVWIIIACVISAIAVILLIVPIAFLSRRKMVSHEKSNNHFGGSPSFAYVAGFSFRYDVL  313

Query  1492  EKATDYFDDSNKLGQGGS--GCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGI  1319
             EKAT+YFD +NKL   G   G ++K  LP G+TVA+KRL F+T QW D  FNEVNLI+GI
Sbjct  314   EKATNYFDVTNKLAPKGEEDGSMFKATLPTGRTVAVKRLSFDTRQWTDVLFNEVNLINGI  373

Query  1318  HHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLA  1139
              HKN+VKLLGCSI GPESLLVYEF+PN+SL      + +   +SWEQR++II G AEGLA
Sbjct  374   QHKNVVKLLGCSIDGPESLLVYEFLPNKSLDQILFDKDSKNVVSWEQRFQIICGIAEGLA  433

Query  1138  YLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPE  959
             YLHE +   IIHRDIK SN+LLDE   PKI DFGL     ++KS+++T  AGTL YMAPE
Sbjct  434   YLHEGSGTKIIHRDIKSSNILLDEALNPKIVDFGLALCVAKNKSNLNTGTAGTLRYMAPE  493

Query  958   YVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSL  779
              + QG++TEK+D+Y+FGV+V E+V GKKNS++ Q S S+L   W  F+   +  +VD SL
Sbjct  494   CLSQGQMTEKSDIYAFGVMVTEIVCGKKNSAYPQGSNSVLHSVWKSFKENNITTSVDPSL  553

Query  778   EERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMIS-GDQDIPQPTQPPFL  626
             + +  V EA+  LQIGL+C Q+S  LRPSMS VV+M++  D  IP P Q PFL
Sbjct  554   QGKCVVEEASSALQIGLLCTQSSATLRPSMSEVVQMLTKKDYIIPSPKQQPFL  606



>ref|XP_002455789.1| hypothetical protein SORBIDRAFT_03g025280 [Sorghum bicolor]
 gb|EES00909.1| hypothetical protein SORBIDRAFT_03g025280 [Sorghum bicolor]
Length=676

 Score =   485 bits (1249),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 280/632 (44%), Positives = 381/632 (60%), Gaps = 54/632 (9%)
 Frame = -2

Query  2383  SDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAF  2204
             +DPR S A   C   TA      A   NFV A+D L   V +  +G + +G+G  TV+  
Sbjct  25    ADPRTSVAGQTCAPGTAVSGSTLA--DNFVPAMDELNTNVSAHGFGTSAVGSGPNTVFGL  82

Query  2203  GECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNES-SSL  2027
             G+C++DLS  DC LCFA+ ++ + +C P  R+  GGRL+ DGCF RY +Y FF E+  + 
Sbjct  83    GQCLRDLSSVDCKLCFAEVRSLLPKCYP--RV--GGRLYLDGCFGRYGNYSFFGEALDAA  138

Query  2026  SDKTVCGAE-------DFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVYG  1868
             +D  VCG E       D        R   A +      +A  + GF   +   G +T + 
Sbjct  139   TDARVCGTEGNYTGPADPRAFEDAVRAVLANVTAAAAAEAPGSQGFGAGSAAVGAATAFA  198

Query  1867  LAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQ  1688
             +AQCWE +   +C  CL AA   +  C P  E R L AGCY+RYST++F+ N    A + 
Sbjct  199   IAQCWESLNATACAQCLRAASDAVAPCAPATEARALFAGCYLRYSTRQFW-NVNATAGSD  257

Query  1687  SGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAML-----VTVNK  1523
             S G S  L ++L +  G+FA +L++  +A+  +KRI+ +RK       M      V + +
Sbjct  258   SSGHSGILWILLGSFLGAFAIVLVIAFLAW--KKRILSRRKGCNSFIDMYGDGLSVRIAQ  315

Query  1522  SKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFN  1343
             S L+F YE L K T+YFD SNKLGQG  G VYK VLPDGK VA+KRLF NT QWAD FFN
Sbjct  316   SSLSFKYEELRKTTNYFDPSNKLGQGSYGAVYKAVLPDGKEVAVKRLFLNTRQWADQFFN  375

Query  1342  EVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQS----LYDY---------------  1220
             EV+LIS + HKNLVKLLGCS+ GPESLLVYE+  N+S    L+ Y               
Sbjct  376   EVDLISQVRHKNLVKLLGCSMNGPESLLVYEYYFNKSLDLFLFAYGCQPATCLLSYLWVR  435

Query  1219  -----TSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTP  1055
                  TS R+N   L+W+ R  II G AEGL+YLH E+E+ IIHRDIK SN+LLD++  P
Sbjct  436   MFKKNTSRRRN---LTWDLRVDIIQGIAEGLSYLHGESEIRIIHRDIKASNILLDDKLKP  492

Query  1054  KIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKK  875
             KI DFGL R F E+ +H++T VAGTLGYMAPEY+V G LTEKADV+S+GVLV+E+V+GK+
Sbjct  493   KITDFGLARAFGEEVTHLTTGVAGTLGYMAPEYIVHGHLTEKADVFSYGVLVLEIVTGKR  552

Query  874   --NSSFYQASVSLLQQHWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPEL  704
               NS+       LL + W  ++  ++   VD S+ E+  R EA   LQIGL+C QA+P+ 
Sbjct  553   CSNSNGSHGGQVLLTKVWKHYKDNRVEMIVDRSIYEDSIRDEAMHILQIGLLCTQANPDD  612

Query  703   RPSMSAVVKMISGDQDIPQP--TQPPFLTSNS  614
             RP+M  VV+++   ++  +   + PPFL  ++
Sbjct  613   RPTMGKVVELLRNHRNALEIVLSDPPFLNVDA  644



>ref|XP_003550730.2| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Glycine max]
Length=619

 Score =   483 bits (1244),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 268/573 (47%), Positives = 359/573 (63%), Gaps = 31/573 (5%)
 Frame = -2

Query  2296  VAALDALTPLVDSKKYG-ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLP  2120
             +A +D ++  V  + +G +T++G+G   +YA G+C +DL  T+C  CF Q +  + RC+P
Sbjct  1     MAIMDTVSFQVKERGWGAQTLLGSG-PPMYALGQCRRDLRPTECYTCFTQARQVLSRCVP  59

Query  2119  FQRLVRGGRLFYDGCFVRYDDYVFFNES-SSLSDKTVCGAEDFGGNSGLFR----RNAAA  1955
                    GR++ DGCF+RYD+Y FF ES     D +VC +     + GL +    R AAA
Sbjct  60    ----KTAGRIYLDGCFLRYDNYSFFRESVDPTRDISVCQS-----SPGLRKDGEGRVAAA  110

Query  1954  LVGELGRKAAANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKE  1775
             +      K AA  GF  A V      V+ LAQCW  +   +C+ CL AA +++  C+P  
Sbjct  111   VAN--ATKGAAECGFAVAGV----EGVFALAQCWGTLDKGTCERCLNAAGTRVQECVPNA  164

Query  1774  EGRVLNAGCYMRYSTKKFYDNSTI----PATNQSGGRSNHLPVILATTFGSFAFLLILGS  1607
             +GR L  GC++RYST+KFY++  +     +TN   G S  + +++A    +   LL++  
Sbjct  165   QGRSLFTGCFLRYSTRKFYNDVALHGIKDSTNSREGPST-VWLMVACVLLAIVGLLLVVL  223

Query  1606  VAFIVRKRIVKQRKER--KRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGC  1433
              AFI RKRI   R+ +     GA       +  +F Y+ LEKAT+YFD +NKLG+GG+G 
Sbjct  224   AAFICRKRIASSRRNKISDSCGASPGFAYVTGFSFRYDLLEKATNYFDPANKLGEGGAGS  283

Query  1432  VYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVY  1253
             V+KG LP G TVA+KRLFFN  QW + FFNE+NLI+ I HKN+VKLLGCSI GPESLLVY
Sbjct  284   VFKGTLPSGGTVAVKRLFFNARQWTEGFFNELNLINEIQHKNVVKLLGCSIDGPESLLVY  343

Query  1252  EFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLL  1073
             EFVP  +L      + +   L+WEQR++II G AEGLAYLH      IIHRDIK SN+L 
Sbjct  344   EFVPRGNLDQVLFGKNSENALNWEQRFRIICGIAEGLAYLHGGPGKKIIHRDIKSSNILF  403

Query  1072  DEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIE  893
             DE   PKIADFGL R   E+KS +S   A TLGYMAPEYV+ G+LTEKAD+Y+FGVLVIE
Sbjct  404   DENLNPKIADFGLARSVAENKSLLSIGNAETLGYMAPEYVINGQLTEKADIYAFGVLVIE  463

Query  892   VVSGKKNSSFYQASVSLLQQHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQA  716
             +VSGKKNS +   S S+L   W  + A  +  +VD +L  +    EA+  LQ GL+C Q+
Sbjct  464   IVSGKKNSDYIPESTSVLHSVWKNYNANIITSSVDPTLHGKFTAEEASNALQAGLLCTQS  523

Query  715   SPELRPSMSAVVKMIS-GDQDIPQPTQPPFLTS  620
             S  LRPSMS VV+M++  D  IP P Q PFL S
Sbjct  524   SDTLRPSMSEVVQMLTKKDYVIPSPNQQPFLNS  556



>ref|XP_009105717.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Brassica 
rapa]
 emb|CDY47145.1| BnaA08g05380D [Brassica napus]
Length=644

 Score =   484 bits (1245),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 264/607 (43%), Positives = 362/607 (60%), Gaps = 40/607 (7%)
 Frame = -2

Query  2386  VSDPRASEAALICTNRTAPQSQRQ--AYVANFVAALDALTPLVDSKKYGETVIGAGNATV  2213
              SDPRA    + C+    PQ +     +V NFVA+++ ++ +V +  +G    G+G    
Sbjct  26    TSDPRARSVKITCS----PQLEHNETVFVPNFVASMEKISQVVQTTGFGTAQTGSGPDGN  81

Query  2212  YAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESS  2033
             YA  +C  DL   DC LC+A+ +T + +C P      GGR+F DGCF+R ++Y F+ E  
Sbjct  82    YALAQCYGDLPLNDCVLCYAEARTILPKCYP----QNGGRIFLDGCFMRAENYSFYKEFK  137

Query  2032  SLSDKTVCGAED------FGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNSTVY  1871
                D  +CG         FG       RNA A        AA   G +         + +
Sbjct  138   GPEDTVICGNTTKRNNATFGDAVRQVVRNAVA--------AAPGSGGYARGASENGESAF  189

Query  1870  GLAQCWEFVRGKSCDDCLA-AAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPAT  1694
              L  CW  +  +SC  CL  A+ S +  CLP  EGR L+ GC++RYS + F +   IP  
Sbjct  190   ALVNCWRNLSPESCKQCLEDASASMVDKCLPWSEGRALHTGCFLRYSDQDFLNK--IPRN  247

Query  1693  NQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKR-IVKQRKERKRLGAMLVTVNKSK  1517
              +S G    + V + ++   F   + +G   +I + R I K+R+    +  M  T+  S 
Sbjct  248   GRSRGSVVVIVVSVLSSVIVFMVGIAIG--VYICKHRTIQKKRRGSNDVEKMAKTLTDSS  305

Query  1516  LNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEV  1337
             LNF Y TLEKAT  FD++NKLGQGG G VYKGVL DG+ +A+KRLFFN    A  F+NEV
Sbjct  306   LNFKYSTLEKATGSFDNANKLGQGGFGTVYKGVLADGRDIAVKRLFFNNRHRAADFYNEV  365

Query  1336  NLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILG  1157
             N+IS + HKNLV+LLGCS +GPESLLVYE++ N+SL  +       + L W++R+ II+G
Sbjct  366   NIISSVEHKNLVRLLGCSCSGPESLLVYEYLQNKSLDRFIFDVNRGKTLDWQRRFVIIVG  425

Query  1156  TAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTL  977
             TAEGL YLHE++ + IIHRDIK SN+LLD +   KIADFGL R F EDKSHISTA+AGTL
Sbjct  426   TAEGLVYLHEQSSVKIIHRDIKASNILLDCKLQAKIADFGLARSFQEDKSHISTAIAGTL  485

Query  976   GYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHWNLFRAGKL  803
             GYMAPEY+  G+LTEK DVYSFGVLV+E+V+GK+N  S     S SL+ + W  F++G+L
Sbjct  486   GYMAPEYLAHGQLTEKVDVYSFGVLVLEIVTGKQNTKSKMSDYSDSLITEAWKHFQSGEL  545

Query  802   YEAVDGSLEERAR-------VEATRQLQIGLVCVQASPELRPSMSAVVKMISGDQDI-PQ  647
              E  D +L+ + R        E  R +QIGL+C Q    LRPSMS V+ M+   +++ P 
Sbjct  546   EEIYDPNLDWKNRNDSIIIKKEIVRVVQIGLLCTQEMASLRPSMSKVLHMLKNKEEVLPL  605

Query  646   PTQPPFL  626
             P+ PPF+
Sbjct  606   PSNPPFM  612



>gb|KHG05033.1| Cysteine-rich receptor-like protein kinase 2 [Gossypium arboreum]
 gb|KHG18968.1| Cysteine-rich receptor-like protein kinase 2 [Gossypium arboreum]
 gb|KHG19685.1| Cysteine-rich receptor-like protein kinase 2 [Gossypium arboreum]
Length=648

 Score =   483 bits (1244),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 274/634 (43%), Positives = 372/634 (59%), Gaps = 34/634 (5%)
 Frame = -2

Query  2434  SKWLFLFIF-FLSINRSVS-DPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVD  2261
             S ++FL +  FL++   V  DPRA    + C ++   +     YV+NFVA ++ +   + 
Sbjct  10    SGYIFLVLMGFLALLEGVKGDPRAKTVNVSCGHQL--EHYGTIYVSNFVATMENINEQIR  67

Query  2260  SKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYD  2081
                +G    G+G    Y   +C  DLS  DC LCFA+ +  + +C PF     GGR+F D
Sbjct  68    DSGFGTAAAGSGLDRNYGLAQCYGDLSSLDCVLCFAEARAVLPQCYPFN----GGRIFLD  123

Query  2080  GCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTA  1901
             GCF+R ++Y FF E +   D+ VCG     G +  F+ +A   V      A  N+G+  A
Sbjct  124   GCFMRAENYSFFEEHTGPDDRAVCGNTSRKGLN--FQESARQAVRHAVAAALGNEGYAKA  181

Query  1900  --AVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTK  1727
               AV   N + Y LA CW  +   SC  CL  A + +  CLP  EGR LN GC++RYS  
Sbjct  182   QVAVSGTNESAYVLANCWRTLNNTSCKTCLENASASVLGCLPWSEGRALNTGCFIRYSDT  241

Query  1726  KFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKR-IVKQRKERKRL  1550
              F +    P    S G    + V + ++    A  + +G   +I + R I K+R+     
Sbjct  242   DFLNKE--PGNGISRGTVIIIVVSIVSSLIVLAIGVAIG--VYIWKYRYIQKKRRGSNDS  297

Query  1549  GAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNT  1370
                +  ++ S LNF Y TL++AT  F+D+NKLGQGG G    GVLPDG+ +A+KRLFFN 
Sbjct  298   EKFVKLLHDSNLNFKYSTLDRATGSFNDANKLGQGGFG---TGVLPDGREIAVKRLFFNN  354

Query  1369  TQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPL  1190
                A  F+NEV LIS + HKNLV+LLGCS +GPESLLVYEF+PN+SL  +       + L
Sbjct  355   RHRAADFYNEVKLISSVEHKNLVRLLGCSCSGPESLLVYEFLPNKSLDRFIFDPSRGKLL  414

Query  1189  SWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDK  1010
              WE+RY +I+GT EGL YLHE +E  IIHRDIK SN+LLD +   KIADFGL R F ED+
Sbjct  415   DWEKRYVVIIGTVEGLVYLHENSETKIIHRDIKASNILLDSKLRAKIADFGLARSFQEDQ  474

Query  1009  SHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQ  836
             SHISTA+AGTLGYMAPEY+  G+LTEKADVYSFGVL++E+V+GK+N  S   + S S++ 
Sbjct  475   SHISTAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIVTGKQNNKSKATEYSDSIVT  534

Query  835   QHWNLFRAGKLYEAVDGSLE-------ERARVEATRQLQIGLVCVQASPELRPSMSAVVK  677
               W  F+ G + E  D +L           R E  R +QIGL+C Q  P LRPSMS V+ 
Sbjct  535   VTWRHFQLGTVEEIYDPNLMLHNDNNGSNVRNEIFRMVQIGLLCTQEIPSLRPSMSKVLH  594

Query  676   MIS-GDQDIPQPTQPPFLTS----NSAASSGSYP  590
             +++  D+D+P PT PPFL      N  + +  YP
Sbjct  595   LLTKKDEDLPAPTNPPFLDEKMEFNETSDNECYP  628



>ref|XP_010427830.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Camelina 
sativa]
Length=650

 Score =   483 bits (1243),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 266/606 (44%), Positives = 364/606 (60%), Gaps = 39/606 (6%)
 Frame = -2

Query  2380  DPRASEAALICTNRTAPQSQRQ--AYVANFVAALDALTPLVDSKKYGETVIGAGNATVYA  2207
             D RA    + C+    PQ +    AYV NFV  ++ ++  V +  +G  + G G    Y 
Sbjct  31    DARARAVKVTCS----PQLEHNETAYVPNFVTTMEKISTKVQTAGFGVALTGTGPDANYG  86

Query  2206  FGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSL  2027
               +C  DL   DC LC+A+ +T + +C P      GGR+F DGCF+R ++Y F+NE    
Sbjct  87    LAQCYGDLPLNDCVLCYAEARTMLPQCYP----QNGGRIFLDGCFMRAENYSFYNEYRGP  142

Query  2026  SDKTVCG-----AEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGNS---TVY  1871
              D  VCG     +E FG        NA A       +A+   G+  A+   G S   + +
Sbjct  143   EDTVVCGNKTRKSETFGDAVRQGLSNAVA-------EASGTGGYARASAKAGESESESAF  195

Query  1870  GLAQCWEFVRGKSCDDCLA-AAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPAT  1694
              LA CW  +   +C  CL  A+VS +  CLP  EGR L+ GC++RYS   F +   IP  
Sbjct  196   VLANCWRTLSPGNCKKCLENASVSVVKGCLPWSEGRALHTGCFLRYSDHDFLNK--IPRN  253

Query  1693  NQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKL  1514
              +S G    + V + ++   F   + +G V    R+ I K+R+    +  M  T+  S L
Sbjct  254   GRSKGSVVVIVVSVLSSVVVFMIGVAVG-VYICKRRTIQKKRRGSNDVEKMAKTLKDSNL  312

Query  1513  NFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVN  1334
             NF Y TLEKAT  FD++NKLGQGG G VYKGVLPDG+ +A+KRLFFN    A  F+NEVN
Sbjct  313   NFKYSTLEKATGSFDEANKLGQGGFGTVYKGVLPDGRDIAVKRLFFNNRHRAADFYNEVN  372

Query  1333  LISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGT  1154
             +IS + HKNLV+LLGCS +GPESLLVYE++ N+SL  +       + L W++RY II+GT
Sbjct  373   MISTVEHKNLVRLLGCSCSGPESLLVYEYLQNKSLDRFIFDVNRGKTLDWQRRYAIIVGT  432

Query  1153  AEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLG  974
             AEGL YLHE++ + IIHRDIK SN+LLD +   KIADFGL R F +DKSHISTA+AGTLG
Sbjct  433   AEGLVYLHEQSSVKIIHRDIKASNILLDSKLHAKIADFGLARSFQDDKSHISTAIAGTLG  492

Query  973   YMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHWNLFRAGKLY  800
             YMAPEY+  G+LTE  DVYSFGVLV+E+ +GK+N  S     S SL+ + W  F++G+L 
Sbjct  493   YMAPEYLAHGQLTEMVDVYSFGVLVLEIATGKQNTKSKMSDYSDSLITEAWKNFQSGELE  552

Query  799   EAVDGSLEERARVEA-------TRQLQIGLVCVQASPELRPSMSAVVKMISGDQDI-PQP  644
             E  D +L  + + ++       TR +QIGL+C Q  P LRPSMS ++ M+   ++I P P
Sbjct  553   EIYDPNLNWKNQNDSHIIKKDITRVVQIGLLCTQEIPSLRPSMSKLLHMLKNKEEILPLP  612

Query  643   TQPPFL  626
             + PPF+
Sbjct  613   SNPPFM  618



>gb|EYU22513.1| hypothetical protein MIMGU_mgv1a002715mg [Erythranthe guttata]
Length=644

 Score =   483 bits (1242),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 258/598 (43%), Positives = 360/598 (60%), Gaps = 25/598 (4%)
 Frame = -2

Query  2383  SDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYAF  2204
             +DPR       C ++   +     YV NF+A ++ ++  + +  +G+   G G    Y  
Sbjct  23    ADPRTHTVKFTCGSQL--EHNASIYVPNFIATMENVSIQIRASGFGKARTGTGPDANYGL  80

Query  2203  GECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSLS  2024
              +C  DLS  DC LC+AQ +T   +C P    V G +LF DGCF+R ++Y F++E S  +
Sbjct  81    AQCYGDLSLVDCVLCYAQARTITPQCYP----VNGAKLFLDGCFMRTENYSFYHEYSGPT  136

Query  2023  DKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGF----FTAAVGRGNSTVYGLAQC  1856
             D+ +CG  +    +  F+ +A   +      A  N+G+       A GRGN +VY LA C
Sbjct  137   DQAICG--NITRQNPEFQVSAKRALSRAVLTAPDNNGYGRVEMAVAGGRGNGSVYVLADC  194

Query  1855  WEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGR  1676
             W  +   +C  CLA A   +G CLP  EGR +N GC++RYS   F +    P T     R
Sbjct  195   WRTINATACRACLAKAFDYLGRCLPMSEGRAVNTGCFVRYSDVNFLN----PITRNPSRR  250

Query  1675  SNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYET  1496
                + +++A    + A ++       + + RI+ Q K +     ++ T+N   LNF Y  
Sbjct  251   GRVIVIVVAAVSAAAALIIGAIIAVHMWKNRII-QNKRKGDAEKLVKTLNDCSLNFKYSA  309

Query  1495  LEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGIH  1316
             LEKATD F+++NKLGQGG G VYKGVL DG+ +A+KRLFFNT   A  FFNEVN+IS + 
Sbjct  310   LEKATDSFNEANKLGQGGFGTVYKGVLADGREIAVKRLFFNTKHRAADFFNEVNIISSVE  369

Query  1315  HKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLAY  1136
             HKNLV+LLGCS  GPESLLVYE++PN+SL  +       + L+WE+R++II+GTAEGL Y
Sbjct  370   HKNLVRLLGCSCLGPESLLVYEYLPNKSLDRFIFDSSKGKELNWEKRFEIIIGTAEGLVY  429

Query  1135  LHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPEY  956
             LHE  +  IIHRDIK SN+LLD     KIADFGL R F EDKSHISTA+AGTLGYMAPEY
Sbjct  430   LHENKKTRIIHRDIKASNILLDSRLRAKIADFGLARSFQEDKSHISTAIAGTLGYMAPEY  489

Query  955   VVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQAS---VSLLQQHWNLFRAGKLYEAVDG  785
             +  G+LTEK DVYSFGVL++E+V+G++N+   + S    SL+   W  F+   + E  D 
Sbjct  490   LALGQLTEKVDVYSFGVLLLEIVTGRQNNMSNKTSDYGDSLVTVAWKNFQQKTVEELFDP  549

Query  784   SLEERARV----EATRQLQIGLVCVQASPELRPSMSAVVKMIS-GDQDIPQPTQPPFL  626
             +L     V    E  R + +GL+C Q    LRP+MS  + M++  D+++PQPT PPF+
Sbjct  550   NLVFHNYVNLKNEVLRVVHVGLLCTQEIASLRPTMSKALLMLAKKDEELPQPTNPPFM  607



>ref|XP_004228898.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X1 [Solanum lycopersicum]
Length=651

 Score =   483 bits (1242),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 260/600 (43%), Positives = 370/600 (62%), Gaps = 21/600 (4%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             SV +PR+    + C   T  +     +V NFVA ++ ++  + ++ YG  V G G  T +
Sbjct  26    SVCEPRSQTVQITCN--TQLEHNTTVFVPNFVAVMETISQQMRTRGYGVAVSGTGPDTNF  83

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSS  2030
                +C  DLS  DC LC+A+ +T + +C P+     GGR++ DGCF+R ++Y F+++   
Sbjct  84    GLAQCYGDLSLLDCILCYAEARTVLPQCFPYN----GGRIYLDGCFMRAENYTFYDQYLG  139

Query  2029  LSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV---GRGNSTVYGLAQ  1859
               D+  C  E+      LF++NA   + +    A  N+G   A V   G  N T Y LA 
Sbjct  140   PEDRHAC--ENRTTKGTLFQQNARRAIQQAVVNAPTNNGTARAQVSVPGPSNETAYVLAD  197

Query  1858  CWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGG  1679
             CW+ +   SC  CL  A + +  CLP  EGR L  GC+MRYS   F +  ++   + SGG
Sbjct  198   CWKTLSANSCAACLQNASASMLGCLPWSEGRALYTGCFMRYSDTNFLNAISVSEGSSSGG  257

Query  1678  RSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNKSKLNFSYE  1499
             +S  + V++ ++        ++G +     K+I K+RK       ++  ++ + LNF Y 
Sbjct  258   KSVVIVVVVVSSVVVLGVGAVIG-IYVWKNKQIQKKRKGANDAEKLVNILHDNSLNFKYS  316

Query  1498  TLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGI  1319
             TL+KAT  FD++NKLGQGG G VYKGVL DG+ +A+KRLFFN       F+NEVN+I+ +
Sbjct  317   TLDKATGSFDEANKLGQGGFGTVYKGVLADGREIAVKRLFFNNKHRVADFYNEVNIINSV  376

Query  1318  HHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLA  1139
              HKNLV+LLGCS +GPESLLVYEF+PNQSL  +       + L+WE+R+ II+GTAEGL 
Sbjct  377   EHKNLVRLLGCSCSGPESLLVYEFLPNQSLDRFIFDSIKGKALNWEKRFDIIIGTAEGLV  436

Query  1138  YLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPE  959
             YLHE T+  IIHRDIK SN+LLD  + PKIADFGL R F EDKSHISTA+AGTLGYMAPE
Sbjct  437   YLHENTKTRIIHRDIKASNILLDARYRPKIADFGLARSFQEDKSHISTAIAGTLGYMAPE  496

Query  958   YVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHWNLFRAG---KLYEA  794
             Y+  G+LTEKADVYSFG+L++E+V+G++N  S   + + SL+   W  F+ G   KL++ 
Sbjct  497   YIAHGQLTEKADVYSFGILLLEIVTGRQNNRSKHVEYTDSLVSIAWEHFQRGIVEKLFDP  556

Query  793   ---VDGSLEERARVEATRQLQIGLVCVQASPELRPSMSAVVKMI-SGDQDIPQPTQPPFL  626
                ++ +     + E  R L +GL+C Q  P LRP MS  +KMI   D+++P P+ PPF+
Sbjct  557   NFMLNNNHTINVKSEVARVLHVGLLCTQEIPTLRPFMSKALKMIVKKDEELPPPSNPPFV  616



>ref|XP_006378229.1| kinase family protein [Populus trichocarpa]
 gb|ERP56026.1| kinase family protein [Populus trichocarpa]
Length=651

 Score =   483 bits (1242),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 260/627 (41%), Positives = 368/627 (59%), Gaps = 29/627 (5%)
 Frame = -2

Query  2458  MNRKMASLSKWLFLFIFF----LSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVA  2291
             M + + S+      F FF    L     V  PR+    ++C  +    +    +V NFVA
Sbjct  1     MTKAIQSIPYQRIFFCFFGYVLLRERVVVGHPRSQTVQVMCGRQLDHNAT--IFVPNFVA  58

Query  2290  ALDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQR  2111
              ++ ++  + +  +G  V G+G    Y   +C  DLS  DC LC+A+ +T + +C P+  
Sbjct  59    TMENISEQMSASGFGVAVSGSGPDINYGLAQCYGDLSLLDCVLCYAEARTVLPQCYPYN-  117

Query  2110  LVRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRK  1931
                GGR+  DGCF+R ++Y F+ E     DK VCG  +    +  F  +    V +    
Sbjct  118   ---GGRIHLDGCFIRAENYSFYEEYLGPGDKAVCG--NTTRKNSTFAESTRQAVSQAVTS  172

Query  1930  AAANDGF--FTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLN  1757
             A+ N G+      V   N + Y LA CW+ +   SC  CL  A + I  CLP  EGR L 
Sbjct  173   ASNNQGYARVQLTVPGTNESAYVLANCWKTLNASSCRACLENATASILGCLPWSEGRALY  232

Query  1756  AGCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIV  1577
              GC+MRYS   F ++        S G    + V + ++       + +G V    R+ I+
Sbjct  233   TGCFMRYSDIDFLNDEL--GNGGSRGSIVIIVVSVISSLVVLGLGVSIG-VHIWKRRYIM  289

Query  1576  KQRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTV  1397
             K+R+       +  T+N S LNF Y TLEKAT  FDD+NKLGQGG G VYKG LPDG+ +
Sbjct  290   KKRRGSNEAQKVARTLNDSSLNFKYSTLEKATGSFDDTNKLGQGGFGSVYKGALPDGREI  349

Query  1396  AIKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYT  1217
             A+KRLFFN    A  F+NE+N+IS + HKNLV+LLGCS +GPESLLVYEF+PN+SL  + 
Sbjct  350   AVKRLFFNNRHRAKDFYNELNMISSVEHKNLVRLLGCSCSGPESLLVYEFLPNRSLDRFI  409

Query  1216  SARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFG  1037
               +   + L+WE+RY+II GTAEGLAYLH  + + IIHRDIK SN+LLD     KIADFG
Sbjct  410   FDQNKGKELTWEKRYEIITGTAEGLAYLHMNSSIRIIHRDIKASNILLDSRLRAKIADFG  469

Query  1036  LVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN----S  869
             L R F +DKSHISTA+AGTLGYMAPEY+  G+LTEK DVY FGVL++E+V+G++N    +
Sbjct  470   LARSFQDDKSHISTAIAGTLGYMAPEYLAHGQLTEKVDVYGFGVLLLEIVTGRQNNRSKN  529

Query  868   SFYQASVSLLQQHWNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPE  707
             S Y  S+ +L   W  F+AG + E  D +L      +   + +  R + +GL+C Q  P 
Sbjct  530   SEYTESLVILT--WKKFQAGTVEELYDPNLMLHNHHDNNVKNDVKRAVHVGLLCTQKIPS  587

Query  706   LRPSMSAVVKMISGDQDIPQPTQPPFL  626
             LRP+MS  ++M++ ++ +P+P+ PPF+
Sbjct  588   LRPTMSKALQMLTTEEHLPRPSNPPFI  614



>ref|XP_006348510.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006348511.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X2 [Solanum tuberosum]
Length=645

 Score =   482 bits (1240),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 266/636 (42%), Positives = 377/636 (59%), Gaps = 29/636 (5%)
 Frame = -2

Query  2458  MNRKMASL--SKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAAL  2285
             M R   S+  S ++ L I  L  + SV++PR+    LIC N T         V+NFV  +
Sbjct  1     MERATPSMLCSHFVILLILLLP-DTSVAEPRSQIVQLICENGTT------VSVSNFVNTM  53

Query  2284  DALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLV  2105
             + ++  + ++  G    G G    Y  G+C  DLS  DC LCF++ +T    C P  +  
Sbjct  54    ETISEQMRTRGNGVAATGTGPNASYGLGQCYGDLSLPDCVLCFSEARTVFPNCFPSNK--  111

Query  2104  RGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAA  1925
                R++ DGCF+R D+Y F+++     D+ VCG     G+  LF++NA   + +    A 
Sbjct  112   --ARIYLDGCFMRADNYNFYDQYFGPEDRHVCGNRTTKGS--LFQQNARRAIQQAVANAP  167

Query  1924  ANDGFFTAAV---GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNA  1754
             +N+G+  A V   G    T Y LA CW+ V   SC  CL  A + +  CLP  EGR L  
Sbjct  168   SNNGYARAQVSVPGSSTMTAYVLADCWKTVSANSCAACLQNASASMLGCLPWSEGRALYT  227

Query  1753  GCYMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVK  1574
             GC++RYS   F  N+   +   S G+   + +++ ++F        +G +     K+I K
Sbjct  228   GCFIRYSDTNFL-NAISTSRGSSRGKVAVIVIVVVSSFVVLGVGAFIG-IGVWKNKQIQK  285

Query  1573  QRKERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVA  1394
             +RK       ++  ++   LNF Y TL+KAT  FD++NK+GQGG G VYKGVL DG+ +A
Sbjct  286   KRKGANDAEKLVKILHDISLNFKYSTLDKATGSFDEANKIGQGGFGTVYKGVLADGREIA  345

Query  1393  IKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTS  1214
             +KRLFFN    A  F+NEVN+IS + HKNL++LLGCS +GPES LVYEF+PNQSL  +  
Sbjct  346   VKRLFFNNKHRAADFYNEVNIISSVEHKNLIRLLGCSCSGPESFLVYEFLPNQSLDRFIF  405

Query  1213  ARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGL  1034
                  + L+WE+R+KII+GTAEGL YLHE T   IIHRDIK SN+LLD +   KIADFGL
Sbjct  406   DPTKGKDLNWEKRFKIIIGTAEGLVYLHENTRTRIIHRDIKASNILLDSKLRAKIADFGL  465

Query  1033  VRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFY--  860
              R F ED SHISTA+AGTLGYMAPEY+  G+LTEKADVYSFGVL++E+V+G++N+     
Sbjct  466   ARSFQEDISHISTAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLMEIVTGRQNNRSIND  525

Query  859   QASVSLLQQHWNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELRP  698
             + + SL+   W+ ++ G + E  D +L          + E  R L +GL+C Q    LRP
Sbjct  526   ENTKSLVSIVWDYYQRGIVEELFDPNLMLHNYNTINVKNEVARVLHVGLLCTQEIQTLRP  585

Query  697   SMSAVVKMI-SGDQDIPQPTQPPFLTSNSAASSGSY  593
             SMS  ++MI   ++++P PT PPF+  N+    G++
Sbjct  586   SMSMALQMILEKEEELPAPTNPPFVDENTMELHGAW  621



>ref|XP_003517719.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X1 [Glycine max]
 ref|XP_006573026.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X2 [Glycine max]
 ref|XP_006573027.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X3 [Glycine max]
 ref|XP_006573028.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X4 [Glycine max]
Length=652

 Score =   482 bits (1241),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 259/602 (43%), Positives = 361/602 (60%), Gaps = 27/602 (4%)
 Frame = -2

Query  2386  VSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYA  2207
             +++PRA    + C +    +     +V NFVA ++ ++  +    +G  ++G G  T Y 
Sbjct  28    IAEPRAKTVLITCGHEL--EHNTTIFVPNFVATMEKISDEMRKTGFGTAIVGTGPDTNYG  85

Query  2206  FGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSL  2027
               +C  DLS  DC LC+A+ +T + +C P+      GR+F DGCF+R ++Y FFNE +  
Sbjct  86    LAQCYGDLSLLDCVLCYAEARTVLPQCFPYN----SGRIFLDGCFMRAENYSFFNEYTGP  141

Query  2026  SDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFF---TAAVGRGNSTVYGLAQC  1856
              D+ VCG      +S  F   A   V    + A  N G+     A  G  N + Y LA C
Sbjct  142   GDRAVCGNTTRKNSS--FHAAAMQAVLRAVQDAPNNKGYAKGNVAVAGTTNQSAYVLADC  199

Query  1855  WEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGR  1676
             W  +   SC  CL  A S I  CLP +EGR LN GC+MRYS   F +            R
Sbjct  200   WRTLDKSSCKACLENASSSILGCLPWQEGRALNTGCFMRYSDTDFLNKEQ----ENGSSR  255

Query  1675  SNHLPVILATTFGSFAFLLILGSVAFIVRKR-IVKQRKERKRLGAMLVTVNKSKLNFSYE  1499
              N + +++A        ++ +    +I ++R I K+R+       +  T+  + LNF Y 
Sbjct  256   GNVVVIVIAVVSSVTVLVVGVTIGVYIWKQRYIQKKRRGSNDAKKLAKTLQNNNLNFKYS  315

Query  1498  TLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGI  1319
             TL+KAT+ F ++NKLGQGG G VYKGVL DG+ +A+KRLFFN    A  F+NEVN+IS +
Sbjct  316   TLDKATESFHENNKLGQGGFGTVYKGVLADGREIAVKRLFFNNRHRAADFYNEVNIISSV  375

Query  1318  HHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLA  1139
              HKNLV+LLGCS +GPESLLVYEF+PN+SL  Y   +   + L+WE RY+II+GTAEGL 
Sbjct  376   EHKNLVRLLGCSCSGPESLLVYEFLPNRSLDRYIFDKNKGKELNWENRYEIIIGTAEGLV  435

Query  1138  YLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPE  959
             YLHE ++  IIHRDIK SN+LLD +   KIADFGL R F ED+SHISTA+AGTLGYMAPE
Sbjct  436   YLHENSKTRIIHRDIKASNILLDAKLRAKIADFGLARSFQEDQSHISTAIAGTLGYMAPE  495

Query  958   YVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHWNLFRAGKLYEAVDG  785
             Y+  G+LTEKADVYSFGVL++E+V+ ++N  S   + S SL+   W  F+AG   +  D 
Sbjct  496   YLAHGQLTEKADVYSFGVLLLEIVTARQNNRSKASEYSDSLVTVAWKHFQAGTSEQLFDP  555

Query  784   SLEER--------ARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS-GDQDIPQPTQPP  632
             +L+ +         + E  R + IGL+C Q  P LRPSMS  ++M++  ++ +  P+ PP
Sbjct  556   NLDLQEDHNSNVNVKDEIIRVVHIGLLCTQEVPSLRPSMSKALQMLTKKEEHLDAPSNPP  615

Query  631   FL  626
             FL
Sbjct  616   FL  617



>gb|KCW83336.1| hypothetical protein EUGRSUZ_B00268 [Eucalyptus grandis]
Length=611

 Score =   481 bits (1237),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 278/606 (46%), Positives = 371/606 (61%), Gaps = 51/606 (8%)
 Frame = -2

Query  2389  SVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVY  2210
             +VSDPR +EA L C N T   +Q    V NFVA +  ++  V ++++G   + +    VY
Sbjct  25    AVSDPRTTEAGLYCENCTGIVAQN--IVPNFVAVMREISKSVANQRWGNYSLTSPPPAVY  82

Query  2209  AFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNE---  2039
                +C  DL+++DC LCF +  T    CLP       GRL+ DGCF+RY  Y F+NE   
Sbjct  83    GLAQCHGDLTESDCLLCFIKSWT----CLP-----NFGRLYLDGCFLRYGSYDFYNETVD  133

Query  2038  --------SSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGRGN  1883
                     SS+L+      AE       + R   A+ V   G   A  DG     VG G 
Sbjct  134   PTHGMLKCSSNLTVPAERVAELSDRVDRVLRNFLASAVQNKGFAVAGEDG-----VG-GV  187

Query  1882  STVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTI  1703
             + VY LAQCW  +    C  CL  A S   SC P EE R +NAGC++RYST KFY+   +
Sbjct  188   AGVYALAQCWSALDAGGCRFCLENATSMARSCAPGEEARAMNAGCFLRYSTTKFYN---V  244

Query  1702  PATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGAMLVTVNK  1523
             P  +  G    H+P+ + ++  +   L+++G  A+I  K+  K+++ +  +  +  + +K
Sbjct  245   P--DSRGSSRVHIPIAITSSVAATTSLVLIG--AYIGYKKYSKKKQVQNNIMQLRASKSK  300

Query  1522  SKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFN  1343
               L F YETLEKAT++FDD  KLGQGG G VYKG LPDGK VA+KRL FN  QWAD FFN
Sbjct  301   FSLYFKYETLEKATNFFDDLRKLGQGGGGSVYKGNLPDGKVVAVKRLVFNMRQWADDFFN  360

Query  1342  EVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP-LSWEQRYKI  1166
             EVNLISGI HKNL++LLGCSI G ESLLVY+++PN SL D+     N  P L+WE+R  I
Sbjct  361   EVNLISGIQHKNLLRLLGCSIEGRESLLVYKYLPNGSL-DHVLFVNNATPVLTWEERLHI  419

Query  1165  ILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVA  986
             I+GTA+GLAYLH    + IIHRDIK SN+LLD+  T KI+DFGL R    DKSH+ST +A
Sbjct  420   IIGTAKGLAYLHGGCGVKIIHRDIKTSNILLDKNLTAKISDFGLARCIAVDKSHLSTGIA  479

Query  985   GTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASVSLLQQHWNLFRAGK  806
             GTL          G+LTEKADVY+FGVLV+EV+SG+KNS + + S ++LQ  W   ++  
Sbjct  480   GTL----------GQLTEKADVYAFGVLVLEVLSGRKNSIYTRGSSTVLQSVWKHCKSNN  529

Query  805   LYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVVKMISGDQD--IPQPTQP  635
             L   +D +L+ +  V EA+  LQI L+C QAS ELRP MS V +M+  D+D  +PQP QP
Sbjct  530   LAACIDPALQGKFPVLEASNVLQISLLCTQASMELRPPMSGVFEMLR-DKDCVVPQPNQP  588

Query  634   PFLTSN  617
             PFL ++
Sbjct  589   PFLKAS  594



>gb|KCW86685.1| hypothetical protein EUGRSUZ_B03305 [Eucalyptus grandis]
Length=417

 Score =   473 bits (1218),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 239/408 (59%), Positives = 294/408 (72%), Gaps = 5/408 (1%)
 Frame = -2

Query  2443  ASLSKWLFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLV  2264
             AS+   +F  +FF ++   + DPRA+EAALIC+NRT P   R+A+ ++   A+DA++P +
Sbjct  7     ASVPLVVFSVLFFAAL--CLCDPRANEAALICSNRTTPLPDRRAFASSVAEAMDAVSPQI  64

Query  2263  DSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFY  2084
             ++++Y   V GAGN TVYAF ECM+DL + DC+LC A+ K QILRCLPFQ   RGGRLFY
Sbjct  65    NARQYASAVGGAGNNTVYAFAECMEDLDRIDCDLCVARAKVQILRCLPFQWGTRGGRLFY  124

Query  2083  DGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFT  1904
             DGC++RYDDY FFNES S  D TVCG  DFGGN  +F  N   L   L  +A  N GF  
Sbjct  125   DGCYLRYDDYNFFNESLSPQDTTVCGTGDFGGNQAMFMNNVVELGRNLSLQAPINGGFSV  184

Query  1903  AAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKK  1724
              +V RGN +VYGLAQCW+ V G  C +CL     +I SC PKEEGR LNAGCY  YST+K
Sbjct  185   GSVIRGNVSVYGLAQCWKLVNGSECQNCLNNTAVRIDSCPPKEEGRGLNAGCYFMYSTEK  244

Query  1723  FYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRLGA  1544
             FY NST P     G R     +ILA    + A LLI+   AF++R+++V++ +E+K+LG 
Sbjct  245   FYYNSTEPFRRDEGERR---LIILAAVSSTLALLLIIALAAFLIRRKLVRKTREKKQLGL  301

Query  1543  MLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQ  1364
             ++  VN SK NFSYE LEKAT YF  S+KLGQGGSG VYKG+LPDGK VAIKRL FNTTQ
Sbjct  302   LVDVVNNSKRNFSYELLEKATSYFHQSSKLGQGGSGSVYKGILPDGKPVAIKRLVFNTTQ  361

Query  1363  WADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDY  1220
             W DHFFNEVNLIS I HKNLVKLLGCSITGPESLLVYE++PN SL+D+
Sbjct  362   WVDHFFNEVNLISDIDHKNLVKLLGCSITGPESLLVYEYIPNLSLHDH  409



>ref|XP_006348514.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006348515.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006348516.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X3 [Solanum tuberosum]
 ref|XP_006348517.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X4 [Solanum tuberosum]
 ref|XP_006348518.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X5 [Solanum tuberosum]
Length=654

 Score =   482 bits (1240),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 269/618 (44%), Positives = 374/618 (61%), Gaps = 37/618 (6%)
 Frame = -2

Query  2425  LFLFIFFLSI-NRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKY  2249
             LF+ +  L +   SV++PR+    LI  NR        A V NFV  ++ L+  V ++ Y
Sbjct  12    LFVVMLILLLPATSVAEPRSQIIQLIRGNRLT------ASVPNFVGTMETLSEQVRARGY  65

Query  2248  GETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFV  2069
             G  V G      Y   +C  DLS  DC LCF++ +T + +C P+      GR++ DGCF+
Sbjct  66    GVAVTGTRPGATYGISQCYGDLSLLDCVLCFSEARTVLPQCFPYN-----GRIYLDGCFM  120

Query  2068  RYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAV--  1895
             R ++Y+F+++     D  VCG     G   LF++NA   + +    A  N+G   A V  
Sbjct  121   RVENYMFYDQYLGPEDMHVCGNRTTKGT--LFQQNARQAIQQAVVNAPTNNGTARAQVSV  178

Query  1894  -GRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFY  1718
              G  N T Y LA CW+ +   SC  CL  A + +  CLP  EGR L  GC+MRYS   F 
Sbjct  179   PGPSNETAYVLADCWKTLSANSCAACLQNASASMLGCLPWSEGRALYTGCFMRYSDTNFL  238

Query  1717  DNSTIPATNQSGGRSNHLPVILATTF---GSFAFLLILGSVAFIV--RKRIVKQRKERKR  1553
             +  +    + S G+   + +++ ++    G+ AF      V F V   K+I K+RK    
Sbjct  239   NAISASGGSSSTGKVVVIVIVVVSSVVVSGAAAF------VGFSVWKNKQIQKKRKGAND  292

Query  1552  LGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFN  1373
             +  ++  ++++ LNF Y TL+KAT  FD++NKLGQGG G VYKGVL DG+ +A+KRLFFN
Sbjct  293   VKKLVKILDQNNLNFKYSTLDKATGSFDEANKLGQGGFGTVYKGVLADGREIAVKRLFFN  352

Query  1372  TTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQP  1193
                 A  F+NEVN+IS + HKNL +LLGCS +G E+LLVYE +PNQSL  Y       + 
Sbjct  353   NKHTAADFYNEVNIISSVQHKNLTRLLGCSCSGTENLLVYELLPNQSLDRYIFDPIKGKT  412

Query  1192  LSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPED  1013
             L+W++R++II+GTAEGL YLHE TE  IIHRDIK SN+LLD     KIADFGL R F ED
Sbjct  413   LNWKKRFEIIIGTAEGLVYLHENTETRIIHRDIKASNILLDLRLRAKIADFGLARSFQED  472

Query  1012  KSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFY--QASVSLL  839
             KSHISTA+AGTLGYMAPEY+ +G+LTEKADVYSFGVL++E+V+G++N+     + +VSL+
Sbjct  473   KSHISTAIAGTLGYMAPEYLARGQLTEKADVYSFGVLLLEIVTGRQNNKRKNDEDTVSLV  532

Query  838   QQHWNLFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELRPSMSAVVK  677
                W  F+ G + E  D +L          + E  R L +GL+C Q  P LRPSMS  ++
Sbjct  533   SNVWEHFQRGIVEELFDPNLMLHNYHTINVKNEVARVLHVGLLCTQEIPSLRPSMSKALQ  592

Query  676   M-ISGDQDIPQPTQPPFL  626
             M +  D+++P PT PPF+
Sbjct  593   MFVKKDEELPPPTNPPFV  610



>ref|XP_006574321.1| PREDICTED: protein kinase family protein isoform X1 [Glycine 
max]
 ref|XP_006574322.1| PREDICTED: protein kinase family protein isoform X2 [Glycine 
max]
Length=652

 Score =   482 bits (1240),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 260/602 (43%), Positives = 361/602 (60%), Gaps = 27/602 (4%)
 Frame = -2

Query  2386  VSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGETVIGAGNATVYA  2207
             +++PRA      C +    +     +V NFVA ++ ++  +    +G  ++G G  T Y 
Sbjct  28    IAEPRAKTVLTTCGHEL--EHNTTIFVPNFVATMEKISDEMRKTGFGTAIVGTGPDTNYG  85

Query  2206  FGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRYDDYVFFNESSSL  2027
               +C  DLS  DC LC+A+ +T + +C P+      GR+F DGCF+R ++Y FFNE    
Sbjct  86    LAQCYGDLSLLDCVLCYAEARTVLPQCFPYN----SGRIFLDGCFMRAENYSFFNEYLGP  141

Query  2026  SDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFF---TAAVGRGNSTVYGLAQC  1856
              D+ VCG      +S  F+  A   V    + A  N G+     A  G  N + Y LA C
Sbjct  142   GDRAVCGNTTRKNSS--FQAAARQAVLRAVQDAPNNKGYAKGNVAVAGTTNQSAYVLADC  199

Query  1855  WEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNSTIPATNQSGGR  1676
             W  +  +SC  CL  A S I  CLP  EGR LN GC+MRYS   F +         S G 
Sbjct  200   WRTLDKRSCKACLENASSSILGCLPWSEGRALNTGCFMRYSDTDFLNKEQ--ENGSSSGN  257

Query  1675  SNHLPVILATTFGSFAFLLILGSVAFIVRKR-IVKQRKERKRLGAMLVTVNKSKLNFSYE  1499
                + + + ++       + +G   +I ++R I K+R+       +  T+  + LNF Y 
Sbjct  258   VVVIVIAVVSSVIVSVVGVTIG--VYIWKQRNIQKKRRGSNDAEKLAKTLQNNNLNFKYS  315

Query  1498  TLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADHFFNEVNLISGI  1319
             TL+KAT+ F ++NKLGQGG G VYKGVL DG+ +A+KRLFFN    A  F+NEVN+IS +
Sbjct  316   TLDKATESFHENNKLGQGGFGTVYKGVLADGREIAVKRLFFNNRHRAADFYNEVNIISSV  375

Query  1318  HHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRYKIILGTAEGLA  1139
              HKNLV+LLGCS +GPESLLVYEF+PN+SL  Y   +   + L+WE+RY+II+GTAEGL 
Sbjct  376   EHKNLVRLLGCSCSGPESLLVYEFLPNRSLDRYIFDKNKGKELNWEKRYEIIIGTAEGLV  435

Query  1138  YLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTAVAGTLGYMAPE  959
             YLHE ++  IIHRDIK SN+LLD +   KIADFGL R F EDKSHISTA+AGTLGYMAPE
Sbjct  436   YLHENSKTRIIHRDIKASNILLDAKLRAKIADFGLARSFQEDKSHISTAIAGTLGYMAPE  495

Query  958   YVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQQHWNLFRAGKLYEAVDG  785
             Y+  G+LTEKADVYSFGVL++E+V+ ++N  S   + S SL+   W  F+AG   +  D 
Sbjct  496   YLAHGQLTEKADVYSFGVLLLEIVTARQNNRSKASEYSDSLVTVAWKHFQAGTAEQLFDP  555

Query  784   SLEER--------ARVEATRQLQIGLVCVQASPELRPSMSAVVKMIS-GDQDIPQPTQPP  632
             +L+ +         + E  R + IGL+C Q    LRPSMS  ++M++  ++D+  P+ PP
Sbjct  556   NLDLQEDHNSNVNVKDEILRVVHIGLLCTQEVSSLRPSMSKALQMLTKKEEDLVAPSNPP  615

Query  631   FL  626
             FL
Sbjct  616   FL  617



>ref|XP_008676391.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Zea 
mays]
Length=655

 Score =   481 bits (1239),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 282/625 (45%), Positives = 380/625 (61%), Gaps = 34/625 (5%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L L I     + + +DPR S A   C   TA      A   NFV A+D L   V +  +G
Sbjct  12    LALTILLALCSATSADPRTSVAGQTCAPGTAVSGS--ALADNFVPAMDELNTNVSAHGFG  69

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
              + +G+G  TV+  G+C +DLS  DC LCFA+ ++ + +C P  R+  GGRL+ DGCF R
Sbjct  70    TSAVGSGPNTVFGLGQCFRDLSSVDCKLCFAEVRSLLPKCYP--RV--GGRLYLDGCFGR  125

Query  2065  YDDYVFFNES-SSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAAVGR  1889
             Y +Y FF E+  + SD  VCG    G  +G   R      G+  R   AN      A G 
Sbjct  126   YGNYSFFGEALDAASDARVCGTAAEGNYTGADPRA----FGDAVRAVLANVTAAAEAPGS  181

Query  1888  ----------GNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMR  1739
                       G +T + +AQCWE + G +C  CL AA + +  C P  EGR L AGCY+R
Sbjct  182   QGFGAGSAAVGGATAFAIAQCWETLNGTACAQCLRAASAAVAPCAPAAEGRALFAGCYLR  241

Query  1738  YSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKER  1559
             YST++F+ N    A + S G S  L + L +  G+ A +L++  +A+  +KRI+ + K  
Sbjct  242   YSTRQFW-NVNATAGSSSSGNSGILWIWLGSFLGALAIVLVIAFLAW--KKRILSRDKGC  298

Query  1558  KRLGAML-----VTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVA  1394
                  M      + + +S LNF YE L KAT+YFD SNKLGQG  G VYK VL DGK VA
Sbjct  299   NSFIDMYGDGLSIRIAQSSLNFKYEELRKATNYFDPSNKLGQGSYGAVYKAVLMDGKEVA  358

Query  1393  IKRLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTS  1214
             +KRLF NT QWAD FFNEV+LIS + HKNLVKLLGCS+ GPESLLVYE+  N+SL  +  
Sbjct  359   VKRLFLNTRQWADQFFNEVDLISQVRHKNLVKLLGCSMNGPESLLVYEYYFNKSLDLFLF  418

Query  1213  ARKNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGL  1034
                +   L+W+ R  II G AEGL+YLHEE+E+ IIHRDIK SN+LLD++  PKI DFGL
Sbjct  419   GTSHRGNLTWDLRVDIIQGIAEGLSYLHEESEIRIIHRDIKASNILLDDKLKPKITDFGL  478

Query  1033  VRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKK--NSSFY  860
              R F ED +H++T VAGTLGYMAPEY+V G LTEKADV+S+GVLV+E+V+GK+  NS+  
Sbjct  479   ARAFGEDVTHLTTGVAGTLGYMAPEYIVHGHLTEKADVFSYGVLVLEIVTGKRCSNSNGS  538

Query  859   QASVSLLQQHWNLFRAGKLYEAVDGSL-EERARVEATRQLQIGLVCVQASPELRPSMSAV  683
                  LL + W  ++  ++   VD S+ E+  R E    LQIGL+C QA+P+ RP+M  V
Sbjct  539   HGGQVLLTKVWKQYKDNRVEMIVDRSIYEDSIRDEIMHILQIGLLCTQANPDDRPTMGKV  598

Query  682   VKMISGDQDIPQP--TQPPFLTSNS  614
             V+++   ++  +   + PPFL  ++
Sbjct  599   VELLRNHRNALEIVLSDPPFLNVDA  623



>ref|XP_011045281.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Populus 
euphratica]
Length=651

 Score =   481 bits (1239),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 257/612 (42%), Positives = 366/612 (60%), Gaps = 28/612 (5%)
 Frame = -2

Query  2419  LFIFFLSINRSV-SDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGE  2243
             LF + L   R+V  DPR+    ++C  +   +     +V NFVA ++ ++  +    +G 
Sbjct  17    LFGYVLLRERAVVGDPRSHTIQVMCGRQL--EHNATIFVPNFVATMENISEQMRVSGFGV  74

Query  2242  TVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRY  2063
              V G+G    Y   +C  DLS  DC LC+A+ +T + +C P+     GGR++ DGCF+R 
Sbjct  75    AVSGSGPDINYGLAQCYGDLSLLDCVLCYAEARTILPQCYPYN----GGRIYLDGCFMRA  130

Query  2062  DDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAANDGF--FTAAVGR  1889
             ++Y F+ E     DK  CG  +    +  F  +    V +    A+ N G+      V  
Sbjct  131   ENYSFYEEYLGPGDKAACG--NTTRKNSTFAESTRQAVSQAVTSASNNQGYARVQLPVPG  188

Query  1888  GNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMRYSTKKFYDNS  1709
              N + Y LA CW+ +   SC +CL  A + I  CLP  EGR L  GC+MRYS   F +  
Sbjct  189   TNESAYVLANCWKTLNASSCRECLENATASILGCLPWSEGRALYTGCFMRYSDIDFLNEE  248

Query  1708  TIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKR-IVKQRKERKRLGAMLVT  1532
                     G R + + ++++         L +    ++ ++R I+K+R+       +  T
Sbjct  249   L----GNGGSRGSIVIIVVSVISSLVVLGLGVSIGVYVWKRRYIMKKRRGCNEARKLART  304

Query  1531  VNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNTTQWADH  1352
             +N S LNF Y TLEKAT  FDD+NKLGQGG G VYKG LPDG+ +A+KRLFFN    A  
Sbjct  305   LNDSSLNFKYSTLEKATGSFDDTNKLGQGGFGSVYKGALPDGREIAVKRLFFNNRHRAAD  364

Query  1351  FFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPLSWEQRY  1172
             F+NEVN+IS + HKNLV+LLGCS +GPESLLVYEF+PN+SL  +   +   + L+WE+RY
Sbjct  365   FYNEVNMISSVEHKNLVRLLGCSCSGPESLLVYEFLPNRSLDRFIFDQNKGKELTWEKRY  424

Query  1171  KIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDKSHISTA  992
             +II GTAEGLAYLH  + + IIHRDIK SN+LLD     KIADFGL R F +DKSHISTA
Sbjct  425   EIITGTAEGLAYLHMNSSIRIIHRDIKASNILLDSRLRAKIADFGLARSFQDDKSHISTA  484

Query  991   VAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN----SSFYQASVSLLQQHWN  824
             +AGTLGYMAPEY+  G+LTEK DVY FGVL++E+V+G++N    +S Y  S+ +L   W 
Sbjct  485   IAGTLGYMAPEYLAHGQLTEKVDVYGFGVLLLEIVTGRQNNRSKNSEYTESLVILT--WK  542

Query  823   LFRAGKLYEAVDGSL------EERARVEATRQLQIGLVCVQASPELRPSMSAVVKMISGD  662
              F AG + E  D +L      +   + +  R + +GL+C Q  P LRP+MS  ++M++ +
Sbjct  543   KFHAGTVEELYDPNLMLHNHHDNNVKNDVKRAVHVGLLCTQEIPSLRPTMSKALQMLTTE  602

Query  661   QDIPQPTQPPFL  626
             + +P+P+ PPF+
Sbjct  603   EHLPRPSNPPFI  614



>gb|KCW83347.1| hypothetical protein EUGRSUZ_B00281 [Eucalyptus grandis]
Length=614

 Score =   480 bits (1235),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 273/622 (44%), Positives = 386/622 (62%), Gaps = 53/622 (9%)
 Frame = -2

Query  2425  LFLFIFFLSINRSVSDPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYG  2246
             L L  FF S+  +VSDPR +EA  IC N T   +     V++ +A ++ L+  V ++++ 
Sbjct  15    LALSSFFFSL--AVSDPRITEAGRICENSTWIVAGN--IVSDLIAIMNELSDGVAAQRWW  70

Query  2245  ETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVR  2066
             +  + +    VY   +C  DL++T+C LCF +   +I RCLP       GR++ DGCF+R
Sbjct  71    KYSLASPTLAVYGLIQCHGDLTETECRLCFTESWIRIARCLP-----NFGRIYLDGCFLR  125

Query  2065  YDDYVFFNE-----------SSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKAAAN  1919
             Y  Y F+NE           SS+L+      AE       + R  +A+ V   G   A  
Sbjct  126   YGTYDFYNETVDPTQDMLKCSSNLTVPAERVAELSDRVDRVLRNVSASAVQNKGFAVAEE  185

Query  1918  DGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGCYMR  1739
             DG     VG G + VY LAQCW  +   SC  CL  A+S   SC P E  R +NAGC++R
Sbjct  186   DG-----VG-GVAGVYALAQCWSTLDAGSCRFCLENAMSMARSCAPGE-ARAMNAGCFLR  238

Query  1738  YSTKKFYDNSTIPATNQSGGRSN-HLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKE  1562
             YST KFYD   +P    SGG S   + +++ ++  +   L+++G  A+I  K+  K+++ 
Sbjct  239   YSTTKFYD---VP---DSGGSSRVRITIVITSSAAAATSLVLIG--AYIGYKKYSKKKQM  290

Query  1561  RKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRL  1382
             +  L  +  + +K  L F Y+TLEKAT++FDDS KLGQGG G VYKG+LPD K VA+KRL
Sbjct  291   QNNLMQLRASKSKFSLYFKYKTLEKATNFFDDSRKLGQGGGGFVYKGILPDRKVVAVKRL  350

Query  1381  FFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSL----YDYTS  1214
              FNT QWAD FFNE          NL+++LGCSI GPESLLVYE++P +SL    ++Y  
Sbjct  351   VFNTCQWADDFFNE----------NLMRILGCSIEGPESLLVYEYLPKRSLDLVLFEYVV  400

Query  1213  ARKNHQP-LSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFG  1037
             A  +  P L+WE+R  II+G AEGLAYLH    + IIHRDIK SN+LLDE  T KI+DFG
Sbjct  401   AINDATPVLTWEERLHIIIGIAEGLAYLHGGCGVKIIHRDIKSSNILLDENLTAKISDFG  460

Query  1036  LVRLFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQ  857
             L R    D+SH+ST +AGT+GYMAPEY+++G+LTEK DVY+ GVLV+E++SG+KNS + +
Sbjct  461   LARCIALDESHLSTGIAGTVGYMAPEYIMRGQLTEKVDVYAIGVLVLEILSGRKNSVYTR  520

Query  856   ASVSLLQQHWNLFRAGKLYEAVDGSLEERARV-EATRQLQIGLVCVQASPELRPSMSAVV  680
              S S+LQ  W  +++  L   +D +L+ +  + EA+  LQI L+C QAS ELRP M  VV
Sbjct  521   GSSSVLQSVWKHYKSNNLATCIDLALQGKFPILEASNVLQISLLCTQASMELRPPMYGVV  580

Query  679   KMI-SGDQDIPQPTQPPFLTSN  617
             +M+ + +  +PQP+QPPF+ ++
Sbjct  581   EMLHNKNHLVPQPSQPPFVNAS  602



>ref|XP_002888785.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65044.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=649

 Score =   480 bits (1236),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 275/635 (43%), Positives = 374/635 (59%), Gaps = 37/635 (6%)
 Frame = -2

Query  2419  LFIFFLSINRSVS-DPRASEAALICTNRTAPQSQRQAYVANFVAALDALTPLVDSKKYGE  2243
             L +F LS  R ++ D RA    + C+     +    AYV NFVA ++ ++  V +  +G 
Sbjct  16    LLMFLLSSLRQITGDARARAVQVTCS--PLLEHNETAYVPNFVATMEKISTQVQTSGFGV  73

Query  2242  TVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRLVRGGRLFYDGCFVRY  2063
              + G G    Y   +C  DL   DC LC+A+ +T + +C P      GGR+F DGCF+R 
Sbjct  74    ALTGTGPDANYGLAQCYGDLPLNDCVLCYAEARTMLPQCYP----QNGGRIFLDGCFMRA  129

Query  2062  DDYVFFNESSSLSDKTVCG-----AEDFGGNSGLFRRNAAALVGELGRKAAANDGFFTAA  1898
             ++Y F+NE     D  VCG     +E FG       RNA A       +A+ + G+  A+
Sbjct  130   ENYSFYNEFKGREDNVVCGNTTRKSETFGDAVRQGLRNAVA-------EASGSGGYARAS  182

Query  1897  VGRGNS---TVYGLAQCWEFVRGKSCDDCLA-AAVSKIGSCLPKEEGRVLNAGCYMRYST  1730
                G S   + + LA CW  +   SC  CL  A+ S +  CLP  EGR L+ GC++RYS 
Sbjct  183   AKAGESESESAFVLANCWRTLSPDSCKQCLENASASVVKGCLPWSEGRALHTGCFLRYSD  242

Query  1729  KKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQRKERKRL  1550
             + F +   I    +S G    + V + ++   F  + I  SV    R+ I ++R+    +
Sbjct  243   QDFLNK--ISRNGRSRGSVVVIVVSVLSSVVVF-MIGIAVSVYICKRRTIKRKRRGSNDV  299

Query  1549  GAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIKRLFFNT  1370
               M  T+  S LNF Y TLEKAT  FD++NKLGQGG G VYKGVLPDG+ +A+KRLFFN 
Sbjct  300   EKMAKTLKDSSLNFKYSTLEKATGSFDEANKLGQGGFGTVYKGVLPDGRDIAVKRLFFNN  359

Query  1369  TQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSARKNHQPL  1190
                A  F+NEVN+IS + HKNLV+LLGCS +GPESLLVYE++ N+SL  +       + L
Sbjct  360   RHRATDFYNEVNMISTVEHKNLVRLLGCSCSGPESLLVYEYLQNKSLDRFIFDVNRGKTL  419

Query  1189  SWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVRLFPEDK  1010
              W++RY II+GTAEGL YLHE++ + IIHRDIK SN+LLD +   KIADFGL R F +DK
Sbjct  420   DWQRRYTIIIGTAEGLVYLHEQSTVKIIHRDIKASNILLDSKLQAKIADFGLARSFQDDK  479

Query  1009  SHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKN--SSFYQASVSLLQ  836
             SHISTA+AGTLGYMAPEY+  G+LTE  DVYSFGVLV+E+V+GK+N  S     S SL+ 
Sbjct  480   SHISTAIAGTLGYMAPEYLAHGQLTEMVDVYSFGVLVLEIVTGKQNTKSKMSDYSDSLMT  539

Query  835   QHWNLFRAGKLYEAVDGSLEER-------ARVEATRQLQIGLVCVQASPELRPSMSAVVK  677
             + W  F+ G L E  D +L  +        + E  R +QIGL+C Q  P LRPSMS ++ 
Sbjct  540   EAWKHFQTGDLEEVYDPNLNWKNQNDSIIIKKEIARVVQIGLLCTQEIPSLRPSMSKLLH  599

Query  676   MISGDQDI-PQPTQPPFLTSNSAA-SSGSYPNRGG  578
             M+   ++I P P+ PPF+         GSY +  G
Sbjct  600   MLKNKEEILPLPSNPPFMDERVMELRDGSYGDSAG  634



>ref|XP_006841052.1| hypothetical protein AMTR_s00085p00161150 [Amborella trichopoda]
 gb|ERN02727.1| hypothetical protein AMTR_s00085p00161150 [Amborella trichopoda]
Length=763

 Score =   483 bits (1244),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 247/542 (46%), Positives = 334/542 (62%), Gaps = 11/542 (2%)
 Frame = -2

Query  2287  LDALTPLVDSKKYGETVIGAGNATVYAFGECMKDLSQTDCNLCFAQCKTQILRCLPFQRL  2108
             +D+L   +  K +G  V G  +  +Y   +CM DLS+TDC LCFA  +  I  C P    
Sbjct  14    MDSLNDQIADKGFGSAVSGNESWKLYGLAQCMGDLSETDCRLCFASSRLSIPSCHPSVE-  72

Query  2107  VRGGRLFYDGCFVRYDDYVFFNESSSLSDKTVCGAEDFGGNSGLFRRNAAALVGELGRKA  1928
                GR++ DGCF+RY ++ FFNE+    D  +C       +   F +    L   +   A
Sbjct  73    ---GRVYMDGCFLRYAEHDFFNETMDFMDPKICNYSTNISDEMGFLQAIGNLTRNIAVDA  129

Query  1927  AANDGFFTAAVGRGNSTVYGLAQCWEFVRGKSCDDCLAAAVSKIGSCLPKEEGRVLNAGC  1748
               N GF   ++     TVYGL QCW  +  + C DCL  A S + SC P  E R LN GC
Sbjct  130   VKNGGFKVGSISLSRYTVYGLGQCWNSLDMELCRDCLVKASSSVLSCAPASEARALNTGC  189

Query  1747  YMRYSTKKFYDNSTIPATNQSGGRSNHLPVILATTFGSFAFLLILGSVAFIVRKRIVKQR  1568
             YMRYS  KFY++   P+ +  G +S  L ++L+ T  S   +L L    FI R R ++ +
Sbjct  190   YMRYSLTKFYND---PSASYKGNKSK-LRIVLSATLPSLFLVLGLVFGFFIHRSRFLEAK  245

Query  1567  KERKRLGAMLVTVNKSKLNFSYETLEKATDYFDDSNKLGQGGSGCVYKGVLPDGKTVAIK  1388
             ++R +L  +  T   SKLNF YETL +AT  F  S KLG+GG G VYKG  PDG+ +A+K
Sbjct  246   RDRSKLPELPETFFNSKLNFKYETLRQATGSFRLSRKLGEGGFGSVYKGTFPDGREIAVK  305

Query  1387  RLFFNTTQWADHFFNEVNLISGIHHKNLVKLLGCSITGPESLLVYEFVPNQSLYDYTSAR  1208
             RL  N TQ    FFNEVN++S + H NLV+LLGCSI   ESLLVYE++PN+SL  Y    
Sbjct  306   RLLVNRTQSMKEFFNEVNVVSRVQHPNLVRLLGCSIECSESLLVYEYLPNKSLDLYLFDS  365

Query  1207  KNHQPLSWEQRYKIILGTAEGLAYLHEETELCIIHRDIKLSNVLLDEEFTPKIADFGLVR  1028
                  L W++RYKI+LG AEGLAYLHEE E+ IIHRDIK SN+LLD +  PKIADFGL R
Sbjct  366   DKCMELDWDKRYKIMLGAAEGLAYLHEECEVRIIHRDIKASNILLDHKLRPKIADFGLAR  425

Query  1027  LFPEDKSHISTAVAGTLGYMAPEYVVQGKLTEKADVYSFGVLVIEVVSGKKNSSFYQASV  848
              F  D++H+ T +AGT+GY+APEY + G+LTEKADVYSFGVL++E++SGK+N+  + +  
Sbjct  426   FFGVDRTHLDTGIAGTMGYIAPEYAIHGQLTEKADVYSFGVLLLELLSGKRNNEAHNSEN  485

Query  847   --SLLQQHWNLFRAGKLYEAVDGSLEER-ARVEATRQLQIGLVCVQASPELRPSMSAVVK  677
               +LL   WN +   +  E +D  LE   ++ E +  LQ+GL+C+Q SP LRP+MS VV+
Sbjct  486   CDTLLNMMWNQYEKNEALEILDPVLESNCSKEEVSWALQVGLLCIQESPSLRPTMSMVVQ  545

Query  676   MI  671
              +
Sbjct  546   FL  547



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8645834145756