BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15931_g1_i1 len=794 path=[1:0-793]

Length=794
                                                                      Score     E

ref|XP_009607055.1|  PREDICTED: L-ascorbate peroxidase 2, cytosolic     404   4e-139   
gb|AGT80152.1|  ascorbate peroxidase                                    403   6e-139   
dbj|BAA12918.1|  cytosolic ascorbate peroxidase                         402   1e-138   Nicotiana tabacum [American tobacco]
ref|XP_010321697.1|  PREDICTED: cytosolic ascorbate peroxidase 2 ...    401   3e-138   
gb|AAP42501.1|  ascorbate peroxidase                                    401   4e-138   Ipomoea batatas [batate]
ref|XP_009771267.1|  PREDICTED: L-ascorbate peroxidase 2, cytosolic     401   5e-138   
ref|XP_010922498.1|  PREDICTED: L-ascorbate peroxidase, cytosolic...    400   8e-138   
gb|AGZ89631.1|  cytosolic ascorbate peroxidase                          400   2e-137   
gb|AAY21068.1|  cytosolic ascorbate peroxidase                          399   3e-137   Capsicum annuum
ref|NP_001234788.1|  cytosolic ascorbate peroxidase 2                   398   6e-137   
dbj|BAM15481.1|  ascorbate peroxydase                                   397   1e-136   
emb|CDP08948.1|  unnamed protein product                                397   1e-136   
gb|AAL83708.1|  putative ascorbate peroxidase                           396   4e-136   Capsicum annuum
emb|CAA57140.1|  L-ascorbate peroxidase                                 394   2e-135   Capsicum annuum
ref|NP_001275066.1|  L-ascorbate peroxidase 1, cytosolic-like           394   3e-135   
gb|ABD97259.1|  ascorbate peroxidase                                    394   3e-135   Camellia sinensis [black tea]
dbj|BAN58213.1|  ascorbate peroxidase                                   394   3e-135   
ref|XP_006366125.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    393   7e-135   
ref|XP_008783664.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    392   1e-134   
ref|XP_009597491.1|  PREDICTED: L-ascorbate peroxidase 1, cytosolic     391   4e-134   
gb|ACF93235.1|  ascorbate peroxidase                                    390   1e-133   Picrorhiza kurrooa
ref|XP_010689420.1|  PREDICTED: L-ascorbate peroxidase, cytosolic       389   2e-133   
ref|XP_009784425.1|  PREDICTED: L-ascorbate peroxidase 1, cytosolic     389   2e-133   
ref|XP_010691257.1|  PREDICTED: L-ascorbate peroxidase, cytosolic...    389   2e-133   
ref|XP_003606510.1|  Cytosolic ascorbate peroxidase                     388   6e-133   
ref|XP_010557305.1|  PREDICTED: L-ascorbate peroxidase 1, cytosolic     388   6e-133   
gb|AAZ79357.1|  ascorbate peroxidase                                    388   6e-133   Vitis pseudoreticulata
gb|ACJ84589.1|  unknown                                                 388   7e-133   Medicago truncatula
gb|KEH30074.1|  L-ascorbate peroxidase                                  387   8e-133   
gb|AAF22246.1|  ascorbate peroxidase                                    387   8e-133   Spuriopimpinella brachycarpa
gb|AAS19934.1|  ascorbate peroxidase                                    387   1e-132   Rehmannia glutinosa [Chinese foxglove]
ref|NP_001234782.1|  cytosolic ascorbate peroxidase 1                   387   2e-132   
gb|ABP65326.1|  asorbate peroxidase                                     386   3e-132   Cenchrus americanus [bulrush millet]
gb|ACN60159.1|  cytosolic ascorbate peroxidase                          385   1e-131   Tamarix hispida
emb|CAB58361.1|  ascorbate peroxidase                                   385   1e-131   Solanum lycopersicum
gb|EYU18888.1|  hypothetical protein MIMGU_mgv1a012445mg                385   1e-131   
ref|XP_011089855.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    384   1e-131   
gb|AFC01206.1|  ascorbate peroxidase                                    384   2e-131   
gb|AHI54569.1|  ascorbate peroxidase                                    384   2e-131   
ref|XP_004505943.1|  PREDICTED: L-ascorbate peroxidase, cytosolic...    384   2e-131   
ref|XP_004984819.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    384   2e-131   
ref|XP_004505944.1|  PREDICTED: L-ascorbate peroxidase, cytosolic...    384   3e-131   
gb|ABM45856.1|  cytosolic ascorbate peroxidase                          384   3e-131   Arachis hypogaea [goober]
ref|XP_010542605.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    384   3e-131   
ref|XP_010521780.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    384   4e-131   
ref|XP_002463451.1|  hypothetical protein SORBIDRAFT_02g044060          383   5e-131   Sorghum bicolor [broomcorn]
ref|XP_010253495.1|  PREDICTED: L-ascorbate peroxidase 2, cytosolic     383   5e-131   
ref|XP_008224940.1|  PREDICTED: L-ascorbate peroxidase, cytosolic       383   6e-131   
ref|XP_011008849.1|  PREDICTED: L-ascorbate peroxidase, cytosolic       383   7e-131   
gb|ACB45429.3|  ascorbate peroxidase                                    383   8e-131   Camellia sinensis [black tea]
gb|AAB03844.1|  cytosolic ascorbate peroxidase                          382   1e-130   Vigna unguiculata
gb|AGG14280.1|  cytosolic ascorbate peroxidase                          382   2e-130   
ref|XP_009352414.1|  PREDICTED: L-ascorbate peroxidase, cytosolic...    381   2e-130   
gb|ACL78796.1|  cytosolic ascorbate peroxidase 2                        380   3e-130   Solanum lycopersicum
gb|AIG92779.1|  ascorbate peroxidase                                    380   4e-130   
ref|XP_010043678.1|  PREDICTED: L-ascorbate peroxidase, cytosolic       380   4e-130   
ref|XP_007205774.1|  hypothetical protein PRUPE_ppa010431mg             380   6e-130   
gb|KCW85676.1|  hypothetical protein EUGRSUZ_B02456                     380   7e-130   
gb|AAD41404.1|AF159629_1  cytosolic ascorbate peroxidase                380   8e-130   Fragaria x ananassa
ref|XP_007205775.1|  hypothetical protein PRUPE_ppa010431mg             380   9e-130   
gb|AAB95222.1|  cytosolic ascorbate peroxidase                          380   1e-129   Fragaria x ananassa
ref|XP_006658179.1|  PREDICTED: L-ascorbate peroxidase 2, cytosol...    380   1e-129   
gb|EMT09178.1|  L-ascorbate peroxidase 2, cytosolic                     380   1e-129   
ref|XP_003558178.1|  PREDICTED: L-ascorbate peroxidase 1, cytosolic     380   1e-129   
sp|P48534.2|APX1_PEA  RecName: Full=L-ascorbate peroxidase, cytos...    380   1e-129   Pisum sativum [garden pea]
tpg|DAA41857.1|  TPA: APx2-Cytosolic Ascorbate Peroxidase               381   1e-129   
tpg|DAA41856.1|  TPA: hypothetical protein ZEAMMB73_314819              380   1e-129   
ref|NP_001152249.1|  APx1 - Cytosolic Ascorbate Peroxidase              379   1e-129   Zea mays [maize]
ref|XP_004294686.1|  PREDICTED: L-ascorbate peroxidase, cytosolic...    379   2e-129   
emb|CBI32625.3|  unnamed protein product                                379   2e-129   
gb|AAD41402.1|AF159627_1  cytosolic ascorbate peroxidase                379   2e-129   Fragaria x ananassa
ref|NP_001267988.1|  cytosolic ascorbate peroxidase                     379   2e-129   
gb|ABP87792.1|  ascorbate peroxidase                                    379   2e-129   Malus domestica [apple tree]
gb|AAD41407.1|AF159632_1  cytosolic ascorbate peroxidase                379   2e-129   Fragaria x ananassa
gb|ACF87724.1|  unknown                                                 379   2e-129   Zea mays [maize]
ref|XP_010653439.1|  PREDICTED: cytosolic ascorbate peroxidase is...    379   3e-129   
gb|AAL08496.1|  ascorbate peroxidase                                    379   3e-129   Hordeum vulgare [barley]
gb|EYU36225.1|  hypothetical protein MIMGU_mgv1a012399mg                379   3e-129   
gb|AFW88739.1|  hypothetical protein ZEAMMB73_022439                    380   3e-129   
ref|XP_008385256.1|  PREDICTED: L-ascorbate peroxidase, cytosolic...    379   3e-129   
ref|NP_001235587.1|  L-ascorbate peroxidase 2                           378   4e-129   
gb|EYU36222.1|  hypothetical protein MIMGU_mgv1a012399mg                379   4e-129   
ref|NP_001152746.1|  ascorbate peroxidase                               378   5e-129   Zea mays [maize]
gb|ADC95633.1|  L-ascorbate peroxidase                                  378   5e-129   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_004958803.1|  PREDICTED: L-ascorbate peroxidase 2, cytosol...    377   5e-129   
ref|NP_001150192.1|  APx1 - Cytosolic Ascorbate Peroxidase              378   5e-129   Zea mays [maize]
ref|XP_002313506.1|  cytosolic ascorbate peroxidase family protein      378   5e-129   Populus trichocarpa [western balsam poplar]
ref|XP_004958804.1|  PREDICTED: L-ascorbate peroxidase 2, cytosol...    378   5e-129   
gb|AEC11053.1|  ascorbate peroxidase                                    377   6e-129   
gb|AAO14118.1|AF457210_1  ascorbate peroxidase                          378   6e-129   Hevea brasiliensis [jebe]
gb|AHG54007.1|  cytosolic ascorbate peroxidase                          378   7e-129   
emb|CAA06996.1|  ascorbate peroxidase                                   377   8e-129   Hordeum vulgare [barley]
dbj|BAM28755.1|  ascorbate peroxidase                                   377   8e-129   
pdb|1APX|A  Chain A, Crystal Structure Of Recombinant Ascorbate P...    377   9e-129   
ref|NP_001237785.1|  ascorbate peroxidase 1, cytosolic                  377   9e-129   
gb|AAB01221.1|  ascorbate peroxidase 2                                  377   9e-129   Glycine max [soybeans]
gb|AEZ00894.1|  putative cytosolic ascorbate peroxidase protein         377   1e-128   
gb|ACO57439.1|  cytosolic ascorbate peroxidase                          377   1e-128   Elaeis oleifera
ref|XP_009409550.1|  PREDICTED: L-ascorbate peroxidase, cytosolic...    377   1e-128   
gb|ABK32072.1|  ascorbate peroxidase                                    377   1e-128   Acanthus ebracteatus
gb|AEI98602.1|  ascorbate peroxidase                                    377   1e-128   
ref|XP_010920944.1|  PREDICTED: L-ascorbate peroxidase, cytosolic       377   2e-128   
ref|XP_009399887.1|  PREDICTED: L-ascorbate peroxidase, cytosolic       377   2e-128   
gb|AEG80145.1|  cytosolic ascorbate peroxidase                          377   2e-128   
ref|XP_002468053.1|  hypothetical protein SORBIDRAFT_01g038760          376   2e-128   Sorghum bicolor [broomcorn]
gb|AIP90104.1|  ascorbate peroxidase                                    376   2e-128   
gb|ACG41151.1|  APx2 - Cytosolic Ascorbate Peroxidase                   376   3e-128   Zea mays [maize]
ref|XP_006488195.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    376   3e-128   
emb|CAN59923.1|  hypothetical protein VITISV_005618                     376   3e-128   Vitis vinifera
gb|AAC08576.1|  ascorbate peroxidase                                    375   4e-128   Zantedeschia aethiopica [arum-lily]
gb|ACN25039.1|  ascorbate peroxidase                                    375   5e-128   
ref|XP_006424675.1|  hypothetical protein CICLE_v10030198mg             377   5e-128   
gb|KHN05706.1|  L-ascorbate peroxidase, cytosolic                       375   7e-128   
gb|KHN22028.1|  L-ascorbate peroxidase, cytosolic                       375   7e-128   
ref|NP_001105500.1|  ascorbate peroxidase2                              375   8e-128   Zea mays [maize]
gb|AAA99518.1|  ascorbate peroxidase                                    375   8e-128   Spinacia oleracea
gb|ACO90193.1|  ascorbate peroxidase                                    375   9e-128   Cucumis sativus [cucumbers]
ref|XP_010907515.1|  PREDICTED: L-ascorbate peroxidase, cytosolic...    375   9e-128   
ref|XP_002889670.1|  hypothetical protein ARALYDRAFT_470824             375   1e-127   
gb|ACU15299.1|  unknown                                                 375   1e-127   Glycine max [soybeans]
pdb|2XIF|A  Chain A, The Structure Of Ascorbate Peroxidase Compou...    375   1e-127   
gb|ACU19647.1|  unknown                                                 374   1e-127   Glycine max [soybeans]
gb|EMS61931.1|  L-ascorbate peroxidase 1, cytosolic                     374   1e-127   
ref|XP_009358268.1|  PREDICTED: L-ascorbate peroxidase, cytosolic...    374   2e-127   
ref|XP_006361765.1|  PREDICTED: L-ascorbate peroxidase 2, cytosol...    374   2e-127   
pdb|2Y6B|A  Chain A, Ascorbate Peroxidase R38k Mutant                   374   2e-127   
gb|AFN21427.1|  ascorbate peroxidase                                    374   2e-127   
gb|AFN21424.1|  ascorbate peroxidase                                    374   2e-127   
gb|ACO90196.1|  ascorbate peroxidase                                    374   2e-127   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006361766.1|  PREDICTED: L-ascorbate peroxidase 2, cytosol...    374   2e-127   
ref|NP_001267635.1|  L-ascorbate peroxidase, cytosolic-like             374   3e-127   
ref|NP_172267.1|  L-ascorbate peroxidase 1                              374   3e-127   Arabidopsis thaliana [mouse-ear cress]
gb|AAK57005.1|AF378131_1  ascorbate peroxidase                          374   3e-127   Zantedeschia aethiopica [arum-lily]
gb|ACJ38537.1|  ascorbate peroxidase                                    374   3e-127   
gb|AAN60070.1|  cytosolic ascorbate peroxidase                          372   3e-127   Retama raetam [retem]
gb|ACV50426.1|  cytosolic ascorbate peroxidase-1                        374   3e-127   Jatropha curcas
dbj|BAC92738.1|  cytosolic ascorbate peroxidase 1                       374   3e-127   Glycine max [soybeans]
gb|KDO73089.1|  hypothetical protein CISIN_1g024615mg                   374   3e-127   
ref|XP_008344846.1|  PREDICTED: L-ascorbate peroxidase, cytosolic...    373   4e-127   
pdb|2Y6A|A  Chain A, Ascorbate Peroxidase R38a Mutant                   373   4e-127   
ref|NP_001077481.1|  L-ascorbate peroxidase 1                           373   5e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417755.1|  hypothetical protein EUTSA_v10008402mg             373   5e-127   
ref|NP_001060741.1|  Os07g0694700                                       373   5e-127   Oryza sativa Japonica Group [Japonica rice]
gb|KHG13785.1|  L-ascorbate peroxidase 1, cytosolic                     373   6e-127   
ref|XP_006305338.1|  hypothetical protein CARUB_v10009719mg             375   6e-127   
pdb|1OAF|A  Chain A, Ascobate Peroxidase From Soybean Cytosol In ...    373   6e-127   
ref|XP_011004154.1|  PREDICTED: L-ascorbate peroxidase, cytosolic       372   7e-127   
gb|AFL70595.1|  ascorbate peroxidase                                    372   7e-127   
gb|ABR18607.1|  cytosolic ascorbate peroxidase 1                        372   7e-127   Gossypium hirsutum [American cotton]
gb|AGJ72850.1|  ascorbate peroxidase                                    372   8e-127   
pdb|2VCF|X  Chain X, Structure Of Isoniazid (Inh) Bound To Cytoso...    373   8e-127   
ref|XP_006381500.1|  ascorbate peroxidase family protein                372   1e-126   
gb|AAN60795.1|  ascorbate peroxidase                                    372   1e-126   Brassica juncea [brown mustard]
gb|AAN60794.1|  ascorbate peroxidase                                    372   1e-126   Brassica juncea [brown mustard]
gb|ADT80721.1|  ascorbate peroxidase                                    372   1e-126   
gb|AAK58449.1|  cytosolic ascorbate peroxidase                          372   1e-126   Suaeda salsa
ref|XP_006649890.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    372   2e-126   
ref|XP_004246700.1|  PREDICTED: L-ascorbate peroxidase 2, cytosolic     372   2e-126   
ref|XP_006417756.1|  hypothetical protein EUTSA_v10008402mg             372   2e-126   
emb|CDY06284.1|  BnaA09g49190D                                          371   3e-126   
ref|XP_002284767.1|  PREDICTED: L-ascorbate peroxidase 2, cytosolic     371   3e-126   Vitis vinifera
gb|AAD20022.1|  ascorbate peroxidase                                    371   3e-126   Glycine max [soybeans]
ref|XP_009118402.1|  PREDICTED: L-ascorbate peroxidase 1, cytosolic     371   3e-126   
gb|ACJ11731.1|  ascorbate peroxidase                                    371   3e-126   Gossypium hirsutum [American cotton]
gb|AGG14281.1|  cytosolic ascorbate peroxidase                          371   4e-126   
gb|AGO97076.1|  ascorbate peroxidase                                    371   4e-126   
ref|XP_007016653.1|  Ascorbate peroxidase 1                             371   4e-126   
gb|AAQ88015.1|  ascorbate peroxidase                                    370   4e-126   Cucumis sativus [cucumbers]
ref|NP_001049769.1|  Os03g0285700                                       370   5e-126   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008792380.1|  PREDICTED: L-ascorbate peroxidase, cytosolic...    370   5e-126   
emb|CDY22715.1|  BnaC08g43490D                                          370   5e-126   
ref|XP_011048406.1|  PREDICTED: L-ascorbate peroxidase 2, cytosolic     370   6e-126   
ref|XP_010475564.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    370   6e-126   
dbj|BAB84009.1|  ascorbate peroxidase                                   370   6e-126   Brassica oleracea
gb|ACV92696.1|  APX                                                     370   6e-126   Brassica rapa subsp. pekinensis [bai cai]
gb|AGJ72851.1|  ascorbate peroxidase                                    370   7e-126   
pdb|2CL4|X  Chain X, Ascorbate Peroxidase R172a Mutant                  370   7e-126   
ref|XP_010233519.1|  PREDICTED: L-ascorbate peroxidase 2, cytosol...    370   7e-126   
gb|AGY78306.1|  ascorbate peroxidase                                    370   8e-126   
ref|XP_010475565.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    370   8e-126   
ref|XP_002322851.1|  ascorbate peroxidase family protein                370   8e-126   Populus trichocarpa [western balsam poplar]
pdb|2VCS|A  Chain A, Structure Of Isoniazid (Inh) Bound To Cytoso...    370   1e-125   
ref|NP_001170482.1|  ascorbate peroxidase                               369   1e-125   Zea mays [maize]
gb|AGS10094.1|  ascorbate peroxidase                                    369   2e-125   
ref|XP_003562395.1|  PREDICTED: L-ascorbate peroxidase 2, cytosol...    369   2e-125   
ref|XP_009148036.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    369   2e-125   
ref|XP_009620318.1|  PREDICTED: L-ascorbate peroxidase 2, cytosol...    369   2e-125   
ref|XP_009620319.1|  PREDICTED: L-ascorbate peroxidase 2, cytosol...    369   2e-125   
ref|XP_009148034.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    369   2e-125   
pdb|3ZCY|A  Chain A, Ascorbate Peroxidase W41a-h42y Mutant              369   2e-125   
gb|AFR23351.1|  ascorbate peroxidase                                    369   2e-125   
emb|CDX93610.1|  BnaA06g04380D                                          370   3e-125   
gb|AGG14282.1|  cytosolic ascorbate peroxidase                          369   3e-125   
pdb|2GGN|X  Chain X, Conformational Mobility In The Active Site O...    369   3e-125   
gb|AIE12238.1|  ascorbate peroxidase 2                                  368   4e-125   
ref|XP_009406949.1|  PREDICTED: L-ascorbate peroxidase, cytosolic...    368   4e-125   
dbj|BAB84008.1|  ascorbate peroxidase                                   368   5e-125   Brassica oleracea
ref|XP_002534421.1|  L-ascorbate peroxidase, cytosolic, putative        367   5e-125   Ricinus communis
ref|XP_006828348.1|  hypothetical protein AMTR_s00023p00249630          368   5e-125   
gb|KDO73088.1|  hypothetical protein CISIN_1g024615mg                   368   5e-125   
emb|CCC55736.1|  ascorbate peroxidase 2                                 368   5e-125   
ref|XP_009342360.1|  PREDICTED: L-ascorbate peroxidase 2, cytosolic     368   6e-125   
gb|KFK43104.1|  l-ascorbate peroxidase                                  368   6e-125   
gb|AEK05507.1|  ascorbate peroxidase                                    367   7e-125   
gb|AAR32786.1|  ascorbate peroxidase                                    367   7e-125   Pinus pinaster [cluster pine]
ref|XP_004302839.1|  PREDICTED: L-ascorbate peroxidase 2, cytosol...    367   8e-125   
gb|ABS01350.1|  ascorbate peroxidase                                    367   8e-125   Carica papaya [mamon]
ref|XP_010488092.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    367   9e-125   
ref|XP_006428887.1|  hypothetical protein CICLE_v10012554mg             367   1e-124   
ref|XP_010458002.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    367   1e-124   
ref|XP_010488105.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    367   1e-124   
sp|A2XFC7.1|APX1_ORYSI  RecName: Full=L-ascorbate peroxidase 1, c...    367   2e-124   Oryza sativa Indica Group [Indian rice]
ref|XP_009798830.1|  PREDICTED: L-ascorbate peroxidase 2, cytosolic     367   2e-124   
gb|AHF27426.1|  ascorbate peroxidase                                    366   2e-124   
gb|KHG05754.1|  L-ascorbate peroxidase 2, cytosolic                     366   3e-124   
ref|XP_006381499.1|  hypothetical protein POPTR_0006s13440g             365   3e-124   
dbj|BAO42878.1|  ascorbate peroxidase                                   365   4e-124   
emb|CAA55209.1|  L-ascorbate peroxidase                                 365   4e-124   Raphanus sativus
gb|AHF27424.1|  ascorbate peroxidase                                    365   5e-124   
gb|AAX84679.1|  ascorbate peroxidase APX2                               365   5e-124   Manihot esculenta [manioc]
ref|XP_010089357.1|  L-ascorbate peroxidase 2                           368   5e-124   
gb|KDO73087.1|  hypothetical protein CISIN_1g024615mg                   365   7e-124   
gb|AII01419.1|  ascorbate peroxidase                                    365   8e-124   
pdb|3ZCH|A  Chain A, Ascorbate Peroxidase W41a-h42m Mutant              365   8e-124   
gb|KDP29067.1|  hypothetical protein JCGZ_16456                         364   2e-123   
gb|KDO55249.1|  hypothetical protein CISIN_1g025588mg                   364   2e-123   
ref|XP_008350397.1|  PREDICTED: L-ascorbate peroxidase 2, cytosolic     364   2e-123   
ref|XP_002960880.1|  hypothetical protein SELMODRAFT_270176             364   2e-123   
pdb|3ZCG|A  Chain A, Ascorbate Peroxidase W41a-h42c Mutant              364   2e-123   
ref|XP_007027230.1|  Ascorbate peroxidase 2 isoform 1                   363   3e-123   
ref|XP_007027231.1|  Ascorbate peroxidase 2 isoform 2                   363   5e-123   
ref|XP_007205773.1|  hypothetical protein PRUPE_ppa010426mg             363   5e-123   
gb|ACM17463.1|  ascorbate peroxidase                                    362   6e-123   Citrus maxima [buntan]
gb|ABK23188.1|  unknown                                                 362   7e-123   Picea sitchensis
ref|XP_002967132.1|  hypothetical protein SELMODRAFT_144791             362   8e-123   
gb|AIP90105.1|  ascorbate peroxidase                                    362   9e-123   
dbj|BAE48791.1|  cytosolic ascorbate peroxidase                         362   2e-122   Codonopsis lanceolata
emb|CAA72247.1|  L-ascorbate peroxidase                                 361   2e-122   Brassica napus [oilseed rape]
gb|ABK26677.1|  unknown                                                 361   2e-122   Picea sitchensis
dbj|BAE92285.1|  putative ascorbate peroxidase                          361   3e-122   Cryptomeria japonica
ref|XP_010046851.1|  PREDICTED: L-ascorbate peroxidase 2, cytosolic     360   5e-122   
gb|KCW51442.1|  hypothetical protein EUGRSUZ_J00965                     360   5e-122   
gb|ABK23077.1|  unknown                                                 360   8e-122   Picea sitchensis
ref|XP_010032055.1|  PREDICTED: L-ascorbate peroxidase, cytosolic...    359   1e-121   
ref|XP_008239139.1|  PREDICTED: L-ascorbate peroxidase 2, cytosolic     359   1e-121   
ref|XP_006407656.1|  hypothetical protein EUTSA_v10021381mg             358   2e-121   
ref|XP_008359525.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    358   3e-121   
ref|XP_011094725.1|  PREDICTED: L-ascorbate peroxidase 2, cytosolic     357   8e-121   
ref|XP_007132164.1|  hypothetical protein PHAVU_011G071300g             357   1e-120   
gb|ADK38619.1|  ascorbate peroxidase                                    355   5e-120   
ref|XP_002882631.1|  hypothetical protein ARALYDRAFT_478284             355   8e-120   
ref|NP_001284378.1|  L-ascorbate peroxidase, cytosolic                  354   9e-120   
gb|ABS50864.1|  cytosolic ascorbate peroxidase                          354   1e-119   Dimocarpus longan [longan]
gb|EPS68866.1|  hypothetical protein M569_05901                         354   2e-119   
gb|ABB46514.2|  putative ascorbate peroxidase                           353   2e-119   Litchi chinensis [litchi]
gb|ACL81497.1|  ascorbate peroxidase                                    353   4e-119   Ginkgo biloba [ginkgo]
gb|KFK38355.1|  hypothetical protein AALP_AA3G103200                    353   4e-119   
gb|ABZ79406.1|  ascorbate peroxidase                                    352   6e-119   Litchi chinensis [litchi]
ref|XP_009123280.1|  PREDICTED: L-ascorbate peroxidase 2, cytosolic     352   6e-119   
ref|XP_010543364.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    352   7e-119   
ref|XP_010112332.1|  L-ascorbate peroxidase                             352   1e-118   
ref|XP_009110916.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    351   2e-118   
ref|XP_010464615.1|  PREDICTED: L-ascorbate peroxidase 2, cytosol...    351   2e-118   
emb|CDY58829.1|  BnaAnng15470D                                          350   4e-118   
ref|XP_010486535.1|  PREDICTED: L-ascorbate peroxidase 2, cytosolic     349   1e-117   
ref|XP_010474920.1|  PREDICTED: L-ascorbate peroxidase 2, cytosol...    349   1e-117   
emb|CDY32812.1|  BnaC08g02340D                                          349   2e-117   
emb|CAA56340.1|  ascorbate peroxidase                                   347   5e-117   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187575.2|  L-ascorbate peroxidase 2                              347   6e-117   Arabidopsis thaliana [mouse-ear cress]
gb|KGN47326.1|  hypothetical protein Csa_6G298480                       347   7e-117   
gb|AAF23294.1|AC016661_19  putative ascorbate peroxidase                347   8e-117   Arabidopsis thaliana [mouse-ear cress]
gb|KHG29674.1|  L-ascorbate peroxidase 1, cytosolic -like protein       347   9e-117   
gb|ABK28551.1|  unknown                                                 347   1e-116   Arabidopsis thaliana [mouse-ear cress]
gb|ABE65932.1|  L-ascorbate peroxidase 1b                               346   2e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006298395.1|  hypothetical protein CARUB_v10014466mg             346   3e-116   
ref|XP_008463870.1|  PREDICTED: L-ascorbate peroxidase, cytosolic...    345   4e-116   
gb|ACY30626.1|  cytosolic ascorbate peroxidase                          344   1e-115   Ginkgo biloba [ginkgo]
emb|CDP06698.1|  unnamed protein product                                343   2e-115   
gb|ACD44386.1|  ascorbate peroxidase                                    339   4e-114   Vigna luteola
ref|XP_010696372.1|  PREDICTED: L-ascorbate peroxidase 2, cytosol...    340   7e-114   
emb|CDY41303.1|  BnaA01g32160D                                          339   1e-113   
gb|ABH10015.1|  ascorbate peroxidase                                    337   2e-113   
dbj|BAG30911.1|  ascorbate peroxidase                                   334   8e-113   
gb|AAZ20282.1|  cytosolic ascorbate peroxidase                          336   2e-112   
gb|AAB94927.1|  ascorbate peroxidase                                    335   4e-112   
gb|AGO64468.1|  ascorbate peroxidase                                    333   4e-112   
gb|KCW85677.1|  hypothetical protein EUGRSUZ_B02456                     332   1e-111   
gb|AEX20395.1|  putative cytosolic ascorbate peroxidase                 329   2e-110   
emb|CDY41302.1|  BnaA01g32170D                                          331   3e-110   
ref|XP_011090051.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    332   4e-110   
gb|AFW88742.1|  hypothetical protein ZEAMMB73_022439                    325   3e-109   
gb|AAV88597.1|  ascorbate peroxidase                                    325   5e-109   
ref|XP_006488199.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    325   5e-109   
gb|KDO73095.1|  hypothetical protein CISIN_1g024615mg                   325   5e-109   
gb|KDO73101.1|  hypothetical protein CISIN_1g024615mg                   326   7e-109   
emb|CBY92008.1|  ascorbate peroxidase                                   323   3e-108   
gb|ACF84911.1|  unknown                                                 323   5e-108   
gb|ABL74866.1|  ascorbate peroxidase                                    319   7e-107   
ref|XP_001772538.1|  predicted protein                                  321   1e-106   
gb|AAY60679.1|  APX1                                                    318   2e-106   
gb|ACE00229.1|  ascorbate peroxidase                                    319   2e-106   
ref|XP_006488197.1|  PREDICTED: L-ascorbate peroxidase 1, cytosol...    319   3e-106   
gb|AAL15164.1|  ascorbate peroxidase                                    317   9e-106   
gb|KEH30073.1|  L-ascorbate peroxidase                                  317   2e-105   
tpg|DAA44796.1|  TPA: hypothetical protein ZEAMMB73_611255              317   2e-105   
gb|ADF56044.1|  ascorbate peroxidase                                    315   3e-104   
gb|ABK26904.1|  unknown                                                 313   5e-104   
emb|CAD33265.1|  ascorbate peroxidase                                   311   7e-104   
gb|ACD44387.1|  ascorbate peroxidase                                    311   2e-103   
gb|AIP90109.1|  ascorbate peroxidase                                    313   7e-103   
ref|XP_009401906.1|  PREDICTED: probable L-ascorbate peroxidase 4       312   2e-102   
gb|AFV96161.1|  ascorbate peroxidase                                    308   2e-102   
gb|KCW85675.1|  hypothetical protein EUGRSUZ_B02456                     306   2e-101   
ref|XP_008788436.1|  PREDICTED: LOW QUALITY PROTEIN: probable L-a...    309   2e-101   
gb|KDO73085.1|  hypothetical protein CISIN_1g024615mg                   308   3e-101   
gb|AFW88740.1|  hypothetical protein ZEAMMB73_022439                    304   1e-100   
gb|AIU34462.1|  putative ascorbate peroxidase                           305   7e-100   
gb|KDO73086.1|  hypothetical protein CISIN_1g024615mg                   301   4e-99    
gb|ACQ99774.1|  ascorbate peroxidase                                    299   1e-98    
gb|ABP57220.1|  ascorbate peroxidase                                    298   5e-98    
ref|XP_010920129.1|  PREDICTED: probable L-ascorbate peroxidase 4       300   6e-98    
gb|ADK25940.1|  ascorbate peroxidase                                    297   7e-98    
ref|XP_008808406.1|  PREDICTED: probable L-ascorbate peroxidase 4       300   9e-98    
ref|XP_004975086.1|  PREDICTED: probable L-ascorbate peroxidase 3...    300   1e-97    
dbj|BAK53858.1|  ascorbate peroxidase                                   296   1e-97    
ref|XP_006422614.1|  hypothetical protein CICLE_v10028990mg             297   1e-97    
ref|XP_004974146.1|  PREDICTED: probable L-ascorbate peroxidase 4...    299   2e-97    
ref|NP_001062439.1|  Os08g0549100                                       299   3e-97    
ref|XP_002983995.1|  hypothetical protein SELMODRAFT_271672             299   3e-97    
gb|AAG45937.1|AF326783_1  ascorbate peroxidase                          295   4e-97    
gb|KDO68044.1|  hypothetical protein CISIN_1g023103mg                   296   4e-97    
ref|XP_006422615.1|  hypothetical protein CICLE_v10028990mg             298   4e-97    
ref|XP_002960144.1|  hypothetical protein SELMODRAFT_139337             298   4e-97    
gb|KDO68043.1|  hypothetical protein CISIN_1g023103mg                   296   6e-97    
gb|AEH76922.1|  peroxisomal ascorbate peroxidase                        298   7e-97    
gb|ACQ99775.1|  ascorbate peroxidase                                    294   8e-97    
ref|XP_006486751.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    297   1e-96    
gb|KFK30138.1|  hypothetical protein AALP_AA7G221800                    297   1e-96    
ref|XP_002867096.1|  hypothetical protein ARALYDRAFT_491157             296   2e-96    
emb|CDY40651.1|  BnaA03g53120D                                          296   2e-96    
ref|XP_002278281.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    296   2e-96    
ref|XP_003574893.1|  PREDICTED: probable L-ascorbate peroxidase 4       296   2e-96    
ref|XP_010935103.1|  PREDICTED: probable L-ascorbate peroxidase 4       296   2e-96    
ref|XP_007041862.1|  Ascorbate peroxidase                               296   2e-96    
ref|XP_009138334.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    296   3e-96    
gb|AIP90110.1|  ascorbate peroxidase                                    296   3e-96    
ref|XP_002444620.1|  hypothetical protein SORBIDRAFT_07g024880          296   4e-96    
ref|NP_195226.1|  L-ascorbate peroxidase                                296   4e-96    
gb|ADW66154.1|  L-ascorbate peroxidase 1                                292   4e-96    
gb|AEO78932.1|  ascorbate peroxidase                                    295   5e-96    
ref|XP_006856766.1|  hypothetical protein AMTR_s00055p00061980          295   5e-96    
ref|NP_001132505.1|  uncharacterized protein LOC100193965               295   6e-96    
ref|XP_004287795.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    295   6e-96    
emb|CDX72511.1|  BnaC07g45330D                                          295   6e-96    
ref|XP_010265979.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    295   6e-96    
ref|XP_009363474.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    295   7e-96    
gb|AAD43334.1|AF159254_1  ascorbate peroxidase                          295   7e-96    
ref|XP_006425414.1|  hypothetical protein CICLE_v10026205mg             295   7e-96    
ref|XP_010028719.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    295   8e-96    
gb|ACF84871.1|  unknown                                                 295   8e-96    
ref|XP_009409974.1|  PREDICTED: probable L-ascorbate peroxidase 4       295   1e-95    
gb|KDP29642.1|  hypothetical protein JCGZ_18804                         294   1e-95    
gb|AGW23429.1|  ascorbate peroxidase                                    294   2e-95    
ref|XP_008352432.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    294   2e-95    
ref|XP_006412164.1|  hypothetical protein EUTSA_v10025911mg             294   2e-95    
gb|KDO71275.1|  hypothetical protein CISIN_1g0244891mg                  293   2e-95    
ref|XP_001756183.1|  predicted protein                                  294   2e-95    
gb|AAB52954.1|  ascorbate peroxidase                                    293   3e-95    
ref|XP_006659666.1|  PREDICTED: probable L-ascorbate peroxidase 4...    293   3e-95    
dbj|BAB64351.1|  peroxisomal ascorbate peroxidase                       293   3e-95    
emb|CAG27618.1|  putative ascorbate peroxidase                          290   3e-95    
dbj|BAB62533.1|  peroxisome type ascorbate peroxidase                   293   5e-95    
ref|XP_004232505.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    293   6e-95    
gb|ABK21917.1|  unknown                                                 293   6e-95    
gb|ACT87980.1|  ascorbate peroxidase                                    293   7e-95    
gb|KHG01334.1|  L-ascorbate peroxidase 3, peroxisomal -like protein     292   7e-95    
ref|XP_010526895.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    292   8e-95    
ref|XP_009796807.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    292   1e-94    
gb|AFI98389.1|  peroxisomal ascorbate peroxidase                        292   1e-94    
ref|XP_008661929.1|  PREDICTED: APx3 - Peroxisomal Ascorbate Pero...    290   2e-94    
ref|XP_011088597.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    291   2e-94    
emb|CAA06823.1|  ascorbate peroxidase                                   291   3e-94    
ref|NP_001148710.1|  APx3 - Peroxisomal Ascorbate Peroxidase            291   3e-94    
ref|XP_006340759.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    291   4e-94    
emb|CDO96922.1|  unnamed protein product                                290   5e-94    
ref|XP_010239709.1|  PREDICTED: probable L-ascorbate peroxidase 3...    289   5e-94    
gb|ABK22483.1|  unknown                                                 290   5e-94    
ref|XP_002530823.1|  L-ascorbate peroxidase 1, cytosolic, putative      290   6e-94    
ref|XP_010113325.1|  L-ascorbate peroxidase 3                           290   7e-94    
gb|AHZ94972.1|  ascorbate peroxidase                                    290   8e-94    
ref|XP_010090333.1|  L-ascorbate peroxidase 3                           290   1e-93    
gb|AEQ39059.1|  putative peroxisome-type ascorbate peroxidase           288   1e-93    
ref|XP_006652120.1|  PREDICTED: probable L-ascorbate peroxidase 3...    289   1e-93    
ref|XP_002983622.1|  hypothetical protein SELMODRAFT_119039             289   2e-93    
ref|XP_010437542.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    289   2e-93    
ref|XP_011046698.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    289   2e-93    
ref|XP_003581262.1|  PREDICTED: probable L-ascorbate peroxidase 3...    289   2e-93    
ref|XP_006284251.1|  hypothetical protein CARUB_v10005417mg             289   2e-93    
ref|XP_009618135.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    288   2e-93    
gb|AAV58827.1|  ascorbate peroxidase                                    288   3e-93    
ref|XP_010679905.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    288   3e-93    
ref|XP_009804433.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    288   4e-93    
ref|XP_001772540.1|  predicted protein                                  285   5e-93    
ref|XP_011046304.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    288   5e-93    
ref|XP_011043177.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    288   6e-93    
ref|XP_002312965.1|  L-ascorbate peroxidase family protein              287   8e-93    
ref|XP_004231035.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    287   9e-93    
gb|ABA10744.1|  cytosolic ascorbate peroxidase isoform 4                287   9e-93    
emb|CDP01872.1|  unnamed protein product                                287   9e-93    
ref|XP_010113326.1|  L-ascorbate peroxidase 3                           287   1e-92    
ref|XP_010432358.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    287   1e-92    
ref|XP_006383088.1|  hypothetical protein POPTR_0005s11430g             286   1e-92    
gb|AFS49700.1|  ascorbate peroxidase                                    286   1e-92    
ref|XP_006359692.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    286   2e-92    
ref|NP_001052271.1|  Os04g0223300                                       286   2e-92    
gb|KDP24002.1|  hypothetical protein JCGZ_25390                         286   2e-92    
sp|Q01MI9.1|APX3_ORYSI  RecName: Full=Probable L-ascorbate peroxi...    286   2e-92    
gb|AGI65626.1|  mitochondrial ascorbate peroxidase                      286   2e-92    
gb|AAL38027.1|AF443182_1  ascorbate peroxidase                          281   3e-92    
ref|XP_002446119.1|  hypothetical protein SORBIDRAFT_06g001970          286   4e-92    
ref|XP_009612589.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    285   4e-92    
ref|XP_008447964.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    285   4e-92    
ref|XP_010447012.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    285   5e-92    
ref|XP_002990588.1|  hypothetical protein SELMODRAFT_131845             285   6e-92    
gb|AFW03967.1|  ascorbate peroxidase                                    285   6e-92    
ref|XP_004289865.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    285   6e-92    
ref|XP_007202405.1|  hypothetical protein PRUPE_ppa009582mg             285   6e-92    
ref|XP_008242053.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    285   9e-92    
gb|ACF86504.1|  unknown                                                 281   1e-91    
gb|AGA20371.1|  peroxisomal ascorbate peroxidase                        284   1e-91    
gb|AAL35365.1|AF442387_1  ascorbate peroxidase                          284   1e-91    
ref|XP_010690378.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    284   2e-91    
ref|XP_004162907.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    286   2e-91    
gb|EMT10887.1|  Putative L-ascorbate peroxidase 4                       284   2e-91    
ref|XP_002306181.2|  hypothetical protein POPTR_0004s18030g             286   3e-91    
gb|AES95163.2|  L-ascorbate peroxidase                                  283   3e-91    
ref|XP_004144841.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    285   3e-91    
gb|ACI15209.1|  peroxisomal ascorbate peroxidase                        283   3e-91    
ref|XP_003537644.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    283   4e-91    
ref|XP_002886070.1|  hypothetical protein ARALYDRAFT_899989             282   7e-91    
gb|AFD04566.1|  cytosolic ascorbate peroxidase                          278   8e-91    
ref|XP_007200545.1|  hypothetical protein PRUPE_ppa009538mg             281   1e-90    
ref|XP_006409405.1|  hypothetical protein EUTSA_v10022797mg             281   1e-90    
gb|EYU37947.1|  hypothetical protein MIMGU_mgv1a011241mg                281   2e-90    
ref|XP_007131704.1|  hypothetical protein PHAVU_011G035000g             281   2e-90    
ref|NP_001238361.1|  peroxisomal ascorbate peroxidase                   281   2e-90    
gb|EYU37948.1|  hypothetical protein MIMGU_mgv1a011241mg                280   2e-90    
ref|XP_007157897.1|  hypothetical protein PHAVU_002G107000g             280   3e-90    
gb|AAD30294.1|AF139190_1  cytosolic ascorbate peroxidase                280   4e-90    
ref|XP_002886069.1|  hypothetical protein ARALYDRAFT_899988             280   8e-90    
ref|XP_003612205.1|  Ascorbate peroxidase                               281   1e-89    
ref|XP_010516362.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    279   2e-89    
ref|XP_008236006.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    278   2e-89    
ref|XP_003537806.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    278   3e-89    
ref|XP_010033512.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    277   3e-89    
emb|CDX89743.1|  BnaC03g46570D                                          278   3e-89    
gb|KFK36757.1|  hypothetical protein AALP_AA4G165900                    278   3e-89    
ref|XP_008394024.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    278   4e-89    
gb|ABS70719.1|  peroxisomal ascorbate peroxidase                        277   5e-89    
ref|XP_009136325.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    277   6e-89    
dbj|BAH56905.1|  AT1G07890                                              273   8e-89    
ref|XP_008661928.1|  PREDICTED: APx3 - Peroxisomal Ascorbate Pero...    277   9e-89    
ref|XP_006298235.1|  hypothetical protein CARUB_v10014296mg             277   1e-88    
ref|XP_007046647.1|  MORC family CW-type zinc finger protein 3 is...    274   2e-88    
gb|AFK46265.1|  unknown                                                 276   3e-88    
gb|ABK93153.1|  unknown                                                 271   3e-88    
ref|XP_007046646.1|  Ascorbate peroxidase isoform 1                     275   3e-88    
gb|AAS46016.1|  peroxisomal ascorbate peroxidase                        275   4e-88    
gb|EMS52219.1|  putative L-ascorbate peroxidase 3                       275   5e-88    
ref|XP_008347519.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    275   5e-88    
ref|XP_010467402.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    275   7e-88    
gb|EPS74288.1|  peroxisomal ascorbate peroxidase                        274   8e-88    
ref|XP_009379368.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    274   9e-88    
ref|XP_010489251.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    274   1e-87    
ref|XP_006300187.1|  hypothetical protein CARUB_v10016423mg             274   1e-87    
ref|XP_008352433.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    274   1e-87    
gb|KDO73105.1|  hypothetical protein CISIN_1g024615mg                   270   1e-87    
gb|EMT31421.1|  Putative L-ascorbate peroxidase 3                       274   1e-87    
ref|XP_008242055.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    273   2e-87    
gb|AGG14283.1|  peroxisome ascorbate peroxidase                         273   2e-87    
ref|XP_010467403.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    273   3e-87    
ref|XP_010516350.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    273   4e-87    
ref|XP_004512151.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    271   2e-86    
ref|XP_010446847.1|  PREDICTED: L-ascorbate peroxidase 5, peroxis...    270   3e-86    
gb|KDO73096.1|  hypothetical protein CISIN_1g024615mg                   266   4e-86    
ref|XP_003607199.1|  Ascorbate peroxidase                               270   5e-86    
ref|XP_004289080.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    270   7e-86    
ref|XP_002869048.1|  hypothetical protein ARALYDRAFT_491040             269   7e-86    
gb|KDO73103.1|  hypothetical protein CISIN_1g024615mg                   265   8e-86    
emb|CBL87996.1|  ascorbate peroxidase                                   265   9e-86    
gb|KDO73099.1|  hypothetical protein CISIN_1g024615mg                   265   1e-85    
gb|KDO73098.1|  hypothetical protein CISIN_1g024615mg                   265   1e-85    
dbj|BAA76419.1|  ascorbate peroxidase                                   265   2e-85    
ref|XP_010526808.1|  PREDICTED: L-ascorbate peroxidase 5, peroxis...    268   2e-85    
gb|AFF18840.1|  cytosolic ascorbate peroxidase                          265   2e-85    
emb|CDX75542.1|  BnaA01g01600D                                          268   3e-85    
ref|XP_010432206.1|  PREDICTED: L-ascorbate peroxidase 5, peroxis...    267   3e-85    
ref|XP_008440842.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    268   3e-85    
gb|KDO73102.1|  hypothetical protein CISIN_1g024615mg                   265   5e-85    
ref|XP_004505790.1|  PREDICTED: L-ascorbate peroxidase 3, peroxis...    267   6e-85    



>ref|XP_009607055.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic [Nicotiana tomentosiformis]
 gb|AAA86689.1| ascorbate peroxidase [Nicotiana tabacum]
Length=250

 Score =   404 bits (1037),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 187/220 (85%), Positives = 206/220 (94%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EYLKA++KC+RKLRG IAEK CAPLMLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKCYPTVSEEYLKAVDKCKRKLRGLIAEKNCAPLMLRLAWHSAGTYDVCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            RLKAEQGHGAN G+DIA++LLEP KEQFPI+S+ D YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RLKAEQGHGANNGIDIAIRLLEPIKEQFPILSYGDFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP+EGRLP+A KG+DHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKTEPPVEGRLPDATKGSDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDP FRPL
Sbjct  181  TNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPAFRPL  220



>gb|AGT80152.1| ascorbate peroxidase [Ipomoea trifida]
Length=250

 Score =   403 bits (1036),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 189/220 (86%), Positives = 204/220 (93%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY KAI+K RRKLRGFIAEK CAPLMLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKCYPTVSEEYQKAIDKLRRKLRGFIAEKNCAPLMLRLAWHSAGTYDVSSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            RLKAEQ HGAN GLDIAV+LLEPFKEQFPI+S+ADLYQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   RLKAEQAHGANNGLDIAVRLLEPFKEQFPIVSYADLYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP+EGRLP+A +GNDHLRDVFVK MGLSDKDIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKTEPPVEGRLPDATQGNDHLRDVFVKHMGLSDKDIVALSGGHTLGRCHKERSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLP+DKALL DPVFRPL
Sbjct  181  TNPLIFDNSYFKELLSGEKEGLLQLPTDKALLEDPVFRPL  220



>dbj|BAA12918.1| cytosolic ascorbate peroxidase [Nicotiana tabacum]
Length=250

 Score =   402 bits (1033),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 186/220 (85%), Positives = 205/220 (93%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EYLKA++KC+RKLRG IAEK CAPLMLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKCYPTVSEEYLKAVDKCKRKLRGLIAEKNCAPLMLRLAWHSAGTYDVCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAEQGHGAN G+DIA++LLEP KEQFPI+S+ D YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFKAEQGHGANNGIDIAIRLLEPIKEQFPILSYGDFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP+EGRLP+A KG+DHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKTEPPVEGRLPDATKGSDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDP FRPL
Sbjct  181  TNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPAFRPL  220



>ref|XP_010321697.1| PREDICTED: cytosolic ascorbate peroxidase 2 isoform X1 [Solanum 
lycopersicum]
 gb|AAX84654.1| ascorbate peroxidase [Solanum lycopersicum]
Length=250

 Score =   401 bits (1031),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 185/220 (84%), Positives = 204/220 (93%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSAEYLKA++KC+RKLR  IAEK CAP+MLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKSYPTVSAEYLKAVDKCKRKLRALIAEKNCAPIMLRLAWHSAGTYDVCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAEQ HGAN GLDIA++LLEP +EQFP +SHAD +QLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFKAEQAHGANNGLDIALRLLEPIREQFPTLSHADFHQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG DHLRDVFVKQMGLSDKDIVALSG HTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPVEGRLPDATKGCDHLRDVFVKQMGLSDKDIVALSGAHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDP FRPL
Sbjct  181  ANPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPAFRPL  220



>gb|AAP42501.1| ascorbate peroxidase [Ipomoea batatas]
Length=250

 Score =   401 bits (1031),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 189/220 (86%), Positives = 205/220 (93%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY KAIEK RRKLRGFIA+K CAPLML +AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKCYPTVSEEYKKAIEKLRRKLRGFIADKNCAPLMLPLAWHSAGTYDVSSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            RLKAEQ HGAN GLDIAV+LLEPFKEQFPI+S+AD YQLAGVVAVEITGGP+VPFHPGR+
Sbjct  61   RLKAEQAHGANNGLDIAVRLLEPFKEQFPIVSYADFYQLAGVVAVEITGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP+EGRLP+A +GNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKTEPPVEGRLPDATQGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELLSGEKEGLLQLP+DKALL+D VFRPL
Sbjct  181  TNPLIFDNSYFTELLSGEKEGLLQLPTDKALLNDSVFRPL  220



>ref|XP_009771267.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic [Nicotiana sylvestris]
Length=250

 Score =   401 bits (1030),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 185/220 (84%), Positives = 205/220 (93%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EYLKA++KC+RKLRG IAEK CAPLMLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKCYPTVSEEYLKAVDKCKRKLRGLIAEKNCAPLMLRLAWHSAGTYDVCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAEQGHGAN G+DIA++LLEP KEQFPI+S+ D YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFKAEQGHGANNGIDIAIRLLEPIKEQFPILSYGDFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP+EGRLP+A KG+DHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKTEPPVEGRLPDATKGSDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF+ELLSGEKEGLLQLPSDKALLSDP FRPL
Sbjct  181  TNPLIFDNSYFSELLSGEKEGLLQLPSDKALLSDPAFRPL  220



>ref|XP_010922498.1| PREDICTED: L-ascorbate peroxidase, cytosolic-like [Elaeis guineensis]
Length=250

 Score =   400 bits (1028),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 188/220 (85%), Positives = 202/220 (92%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSAEY KA+EKCRRKLRGFIAEK CAPLMLR+AWHSAGT+DV TK+GGP+GTM
Sbjct  1    MGKSYPTVSAEYQKAVEKCRRKLRGFIAEKNCAPLMLRLAWHSAGTYDVSTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAEQGHGAN GL+IAV+LLEP KEQFPI+S+AD YQLAGVVAVEITGGPEVPFHPGR+
Sbjct  61   RYKAEQGHGANNGLEIAVRLLEPIKEQFPILSYADFYQLAGVVAVEITGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLRDVFV  MGL+DKDIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKPEPPKEGRLPDATKGCDHLRDVFVTHMGLTDKDIVALSGGHTLGRCHKERSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEK+ LLQLPSDKALL+DP FRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKDDLLQLPSDKALLTDPAFRPL  220



>gb|AGZ89631.1| cytosolic ascorbate peroxidase [Lycium chinense]
Length=250

 Score =   400 bits (1027),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 184/220 (84%), Positives = 203/220 (92%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EYLKA++KC+RKLRG IAEK CAP+MLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKCYPTVSEEYLKAVDKCKRKLRGLIAEKNCAPIMLRLAWHSAGTYDVCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAEQGHGAN GLDIA++LLEP +EQFPI+SHAD YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFKAEQGHGANNGLDIALRLLEPIREQFPILSHADFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG DHLRDVFVKQMGLSDKDIVALSG HTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPVEGRLPDATKGCDHLRDVFVKQMGLSDKDIVALSGAHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPL+FDNSYF ELLSGEKEGLLQLPSDKALL DP FRPL
Sbjct  181  ANPLVFDNSYFKELLSGEKEGLLQLPSDKALLCDPAFRPL  220



>gb|AAY21068.1| cytosolic ascorbate peroxidase [Capsicum annuum]
Length=250

 Score =   399 bits (1025),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 182/220 (83%), Positives = 205/220 (93%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSAEYLKA++KC+RKLR  IAEK CAP+MLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKSYPTVSAEYLKAVDKCKRKLRALIAEKNCAPIMLRLAWHSAGTYDVCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R +AEQ HGAN G+DIA++LLEP +EQFP +S+AD +QLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFRAEQAHGANNGIDIAIRLLEPIREQFPTLSYADFHQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG+DHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPVEGRLPDATKGSDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDP FRPL
Sbjct  181  TNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPAFRPL  220



>ref|NP_001234788.1| cytosolic ascorbate peroxidase 2 [Solanum lycopersicum]
 gb|AAZ77771.1| cytosolic ascorbate peroxidase 2 [Solanum lycopersicum]
 gb|AAZ83364.1| cytosolic ascorbate peroxidase 2 [Solanum lycopersicum]
Length=250

 Score =   398 bits (1023),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 184/220 (84%), Positives = 203/220 (92%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSAEYLKA++KC+RKLR  IAEK CAP+MLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKSYPTVSAEYLKAVDKCKRKLRALIAEKNCAPIMLRLAWHSAGTYDVCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAEQ HGAN GLDIA++LLEP +EQFP +SHAD +QLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFKAEQAHGANNGLDIALRLLEPIREQFPTLSHADFHQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG DHLRDVFVKQMGLSDKDIVALSG HTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPVEGRLPDATKGCDHLRDVFVKQMGLSDKDIVALSGAHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELLSGEKEGLLQLPS KALLSDP FRPL
Sbjct  181  ANPLIFDNSYFTELLSGEKEGLLQLPSGKALLSDPAFRPL  220



>dbj|BAM15481.1| ascorbate peroxydase, partial [Solanum tuberosum]
Length=250

 Score =   397 bits (1021),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 183/220 (83%), Positives = 202/220 (92%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS EYLKA++KC+RKLR  IAEK CAP+MLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKSYPTVSEEYLKAVDKCKRKLRALIAEKNCAPIMLRLAWHSAGTYDVCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAEQ HGAN GLDIA++LLEP +EQFP +SHAD +QLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFKAEQAHGANNGLDIALRLLEPIREQFPTLSHADFHQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG DHLRDVFVKQMGLSDKDIVALSG HTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPVEGRLPDATKGCDHLRDVFVKQMGLSDKDIVALSGAHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELLSGEKEGLLQLPSDKALL DP FRPL
Sbjct  181  ANPLIFDNSYFTELLSGEKEGLLQLPSDKALLCDPAFRPL  220



>emb|CDP08948.1| unnamed protein product [Coffea canephora]
Length=250

 Score =   397 bits (1021),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 185/220 (84%), Positives = 204/220 (93%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSAEYLKA++K +RKLRG IAEK CAPLMLR+AWHSAGTFD  +K+GGP+GTM
Sbjct  1    MGKSYPTVSAEYLKALDKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDQGSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            RLKAEQGH AN G+DIA++LLEP KEQFP +S+AD YQLAGVVAVE+TGGP++PFHPGRQ
Sbjct  61   RLKAEQGHEANNGIDIAIRLLEPIKEQFPTLSYADFYQLAGVVAVEVTGGPDIPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP+EGRLP+A KG DHLRDVFVKQMGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKTEPPVEGRLPDATKGCDHLRDVFVKQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELLSG+KEGLLQLPSDKALLSDP FRPL
Sbjct  181  ANPLIFDNSYFTELLSGDKEGLLQLPSDKALLSDPAFRPL  220



>gb|AAL83708.1| putative ascorbate peroxidase [Capsicum annuum]
Length=250

 Score =   396 bits (1017),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 182/220 (83%), Positives = 203/220 (92%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EYLKA++KC+RKLRG IAEK CAPLMLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKCYPTVSEEYLKAVDKCKRKLRGLIAEKNCAPLMLRLAWHSAGTYDVCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R K EQ HGAN G+DIA++LLEP +EQFPI+S+AD YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFKTEQSHGANNGIDIALRLLEPIREQFPILSYADFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG+DHLRDVFVKQMGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPVEGRLPDATKGSDHLRDVFVKQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL GEKEGLLQLPSDKALLSDP FRPL
Sbjct  181  ANPLIFDNSYFKELLGGEKEGLLQLPSDKALLSDPAFRPL  220



>emb|CAA57140.1| L-ascorbate peroxidase [Capsicum annuum]
Length=250

 Score =   394 bits (1013),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 182/220 (83%), Positives = 202/220 (92%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EYLKA++KC+RKLRG IAEK CAPLMLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKCYPTVSEEYLKAVDKCKRKLRGLIAEKNCAPLMLRLAWHSAGTYDVCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R K EQ HGAN G+DIA++LLEP  EQFPI+S+AD YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFKTEQSHGANNGIDIALRLLEPLGEQFPILSYADFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG+DHLRDVFVKQMGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPVEGRLPDATKGSDHLRDVFVKQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL GEKEGLLQLPSDKALLSDP FRPL
Sbjct  181  ANPLIFDNSYFKELLGGEKEGLLQLPSDKALLSDPAFRPL  220



>ref|NP_001275066.1| L-ascorbate peroxidase 1, cytosolic-like [Solanum tuberosum]
 dbj|BAC22953.1| ascorbate peroxidase [Solanum tuberosum]
 gb|ABB02650.1| ascorbate peroxidase-like [Solanum tuberosum]
Length=250

 Score =   394 bits (1012),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 182/220 (83%), Positives = 201/220 (91%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS EYLKA++KC+RKLR  IAEK CAP+MLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKSYPTVSEEYLKAVDKCKRKLRALIAEKNCAPIMLRLAWHSAGTYDVCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAEQ HGAN GLDIA++LLEP +EQFP +SHAD +QLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFKAEQAHGANNGLDIALRLLEPIREQFPTLSHADFHQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG DHLRDVFVKQMGLSDKDIVALSG HTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPVEGRLPDATKGCDHLRDVFVKQMGLSDKDIVALSGAHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELLSGEKEGLLQLPSDKALL DP FR L
Sbjct  181  ANPLIFDNSYFTELLSGEKEGLLQLPSDKALLCDPAFRLL  220



>gb|ABD97259.1| ascorbate peroxidase [Camellia sinensis]
Length=250

 Score =   394 bits (1012),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 185/220 (84%), Positives = 202/220 (92%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY KAI+K +RKLRG IAEK CAP+MLR+AWHSAGT+DV TK+GGP+GTM
Sbjct  1    MGKCYPTVSEEYKKAIDKAKRKLRGLIAEKNCAPIMLRLAWHSAGTYDVTTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R K EQGHGAN GL+IAV+LLEP KEQFPIIS+AD YQLAGVVAVEITGGP+VPFHPGR+
Sbjct  61   RHKLEQGHGANNGLEIAVRLLEPIKEQFPIISYADFYQLAGVVAVEITGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG DHLRDVFVK MGL+DKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPVEGRLPDATKGTDHLRDVFVKHMGLTDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELL+GEKEGLLQLPS KALL+DPVFRPL
Sbjct  181  ANPLIFDNSYFTELLTGEKEGLLQLPSGKALLNDPVFRPL  220



>dbj|BAN58213.1| ascorbate peroxidase [Solanum melongena]
Length=250

 Score =   394 bits (1012),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 201/218 (92%), Gaps = 0/218 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS +YLKA++KC+RKLR  IAEK CAP+MLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKSYPTVSEDYLKAVDKCKRKLRALIAEKNCAPIMLRLAWHSAGTYDVSSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAEQ HGAN GLDIA++LLEP +EQFPI+SHAD +QL GVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFKAEQAHGANNGLDIALRLLEPIREQFPILSHADFHQLTGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG+DHLRDVFVKQMGLSD+DIVALSG HTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPVEGRLPDATKGSDHLRDVFVKQMGLSDQDIVALSGAHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFR  786
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDP FR
Sbjct  181  TNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPAFR  218



>ref|XP_006366125.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic-like [Solanum 
tuberosum]
Length=250

 Score =   393 bits (1009),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 183/220 (83%), Positives = 200/220 (91%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EYLKA++KC+RKLRG IAEK CAPLMLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKCYPTVSEEYLKAVDKCKRKLRGLIAEKNCAPLMLRLAWHSAGTYDVCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAEQ HGAN GLDIA++LLEP +EQFP ISHAD YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFKAEQAHGANNGLDIALRLLEPIREQFPTISHADFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG+DHLR VF KQMGLSDKDIVALSG HTLGR HKERSGFEGPWT
Sbjct  121  DKPEPPVEGRLPDATKGSDHLRVVFKKQMGLSDKDIVALSGAHTLGRAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELLSGEKEGLLQLPSDKALL DP FRPL
Sbjct  181  ANPLIFDNSYFTELLSGEKEGLLQLPSDKALLCDPAFRPL  220



>ref|XP_008783664.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic isoform X1 [Phoenix 
dactylifera]
 ref|XP_008783667.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic isoform X2 [Phoenix 
dactylifera]
Length=250

 Score =   392 bits (1008),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 184/220 (84%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS EY KA+EKCRRKLRGFIAEK CAPLMLR+AWHSAGT+DV TK+GGP+GTM
Sbjct  1    MGKSYPTVSEEYRKAVEKCRRKLRGFIAEKNCAPLMLRLAWHSAGTYDVSTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAEQGH AN GL+IAV+LLEP KEQFPI+S+ D YQLAGVVAVEITGGPEVPFHPGR+
Sbjct  61   RYKAEQGHEANNGLEIAVRLLEPIKEQFPILSYGDFYQLAGVVAVEITGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLRDVFV  MGL+DKDIVALSGGHTLGRCHK+RSGFEG WT
Sbjct  121  DKPEPPKEGRLPDATKGCDHLRDVFVAHMGLTDKDIVALSGGHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL+GEKE LLQLPSDKALL+DP FRPL
Sbjct  181  SNPLIFDNSYFKELLTGEKEDLLQLPSDKALLTDPAFRPL  220



>ref|XP_009597491.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic [Nicotiana tomentosiformis]
Length=250

 Score =   391 bits (1004),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 182/220 (83%), Positives = 201/220 (91%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS EY+KA++K +RKLRG IAEK CAPLMLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MTKCYPTVSEEYVKAVDKAKRKLRGLIAEKNCAPLMLRLAWHSAGTYDVCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAE  HGAN G+DIA++LLEP KEQFP +S+AD YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFKAELSHGANNGVDIAIRLLEPIKEQFPTLSYADFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPPLEGRLP+A KG+DHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKTEPPLEGRLPDATKGSDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  ANPLIFDNSYFRELLSGEKEGLLQLPSDKALLSDPVFRPL  220



>gb|ACF93235.1| ascorbate peroxidase [Picrorhiza kurrooa]
Length=250

 Score =   390 bits (1001),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 202/220 (92%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EYLKA++K +RKL+GFIAEK CAPLMLR+AWHSAGTFD  +K+GGP+GTM
Sbjct  1    MVKNYPAVSEEYLKAVDKAKRKLKGFIAEKNCAPLMLRLAWHSAGTFDQCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAEQGH AN G+DIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP+VPFHPGR 
Sbjct  61   RFKAEQGHAANNGVDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDVPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP+EGRLP+A KG+DHLRDVFVKQMGLSD+DIVALSG HTLGRCHKERSGFEGPWT
Sbjct  121  DKQEPPVEGRLPDATKGSDHLRDVFVKQMGLSDQDIVALSGAHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            +NPLIFDNSYFTELLSGEKEGLLQLPSDKALL+DP FRPL
Sbjct  181  QNPLIFDNSYFTELLSGEKEGLLQLPSDKALLADPAFRPL  220



>ref|XP_010689420.1| PREDICTED: L-ascorbate peroxidase, cytosolic [Beta vulgaris subsp. 
vulgaris]
Length=250

 Score =   389 bits (1000),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 202/220 (92%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS +Y K+IEK +RKLRG IAEK CAP+MLR+AWHSAGTFDVQ+++GGP+GTM
Sbjct  1    MGKSYPTVSEDYQKSIEKAKRKLRGLIAEKHCAPIMLRLAWHSAGTFDVQSRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R K E  HGAN GLDIAV+LLEP KEQFP +S+AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   RHKGELAHGANNGLDIAVRLLEPIKEQFPELSYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLRDVF+KQMGL+D+DIVALSGGHTLGRCHK+RSGFEGPWT
Sbjct  121  DKPEPPQEGRLPDATKGCDHLRDVFIKQMGLTDQDIVALSGGHTLGRCHKDRSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPL+FDNSYFTELL+GEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLVFDNSYFTELLTGEKEGLLQLPSDKALLSDPVFRPL  220



>ref|XP_009784425.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic [Nicotiana sylvestris]
Length=250

 Score =   389 bits (1000),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 200/220 (91%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS EY+KA++K +R LRG IAEK CAPLMLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MTKCYPTVSEEYVKAVDKAKRNLRGLIAEKNCAPLMLRLAWHSAGTYDVCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAE  HGAN G+DIA++LLEP KEQFP +S+AD YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFKAELSHGANNGVDIAIRLLEPIKEQFPTLSYADFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPPLEGRLP+A KG+DHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKTEPPLEGRLPDATKGSDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  ANPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPVFRPL  220



>ref|XP_010691257.1| PREDICTED: L-ascorbate peroxidase, cytosolic-like [Beta vulgaris 
subsp. vulgaris]
Length=250

 Score =   389 bits (1000),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 201/220 (91%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS +Y K+IEK +RKLRG IAEK CAP+MLR+AWHSAGTFDVQ+++GGP+GTM
Sbjct  1    MGKCYPTVSEDYQKSIEKAKRKLRGLIAEKHCAPIMLRLAWHSAGTFDVQSRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R K E  HGAN GLDIAV+LLEP KEQFP +S+ D YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   RHKGELAHGANNGLDIAVRLLEPIKEQFPELSYGDFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLPNA KG+DHLRDVF+KQMGL+D+DIVALSGGHTLGRCHK+RSGFEGPWT
Sbjct  121  DKPEPPQEGRLPNATKGSDHLRDVFIKQMGLNDQDIVALSGGHTLGRCHKDRSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELL+GEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFTELLTGEKEGLLQLPSDKALLSDPVFRPL  220



>ref|XP_003606510.1| Cytosolic ascorbate peroxidase [Medicago truncatula]
 gb|AES88707.1| L-ascorbate peroxidase [Medicago truncatula]
 gb|AFK34745.1| unknown [Medicago truncatula]
Length=250

 Score =   388 bits (997),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 183/220 (83%), Positives = 201/220 (91%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KA+EK +RKLRGFIAEK CAPLMLR+AWHSAGTFD +TK+GGP+GT+
Sbjct  1    MGKSYPTVSADYQKAVEKAKRKLRGFIAEKKCAPLMLRLAWHSAGTFDSKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            + +AE  HGAN GLDIAV+LLEP KEQFPIIS+AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   KHQAELAHGANNGLDIAVRLLEPLKEQFPIISYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHT+G  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTIGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELL GEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFTELLGGEKEGLLQLPSDKALLSDPVFRPL  220



>ref|XP_010557305.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic [Tarenaya hassleriana]
Length=250

 Score =   388 bits (996),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EY KA+EKC+RKLRG IAEKGCAPLMLR+AWHSAGTFD  +K+GGP+GTM
Sbjct  1    MTKNYPAVSEEYKKAVEKCKRKLRGLIAEKGCAPLMLRLAWHSAGTFDHSSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN G++IA++LLEP KEQFP IS AD YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFAAEQAHGANNGINIALRLLEPIKEQFPTISFADFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P PP EGRLP+A KG+DHLRDVFVKQMGLSD+DIVALSGGHTLGRCHK+RSGFEGPWT
Sbjct  121  DKPAPPPEGRLPDATKGSDHLRDVFVKQMGLSDQDIVALSGGHTLGRCHKDRSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  ANPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPVFRPL  220



>gb|AAZ79357.1| ascorbate peroxidase [Vitis pseudoreticulata]
Length=250

 Score =   388 bits (996),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 182/220 (83%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS EY KA+EK R+KLRG IAEK CAP+MLRIAWHSAGTFDV+T++GGP+GTM
Sbjct  1    MGKSYPTVSEEYKKAVEKARKKLRGLIAEKNCAPIMLRIAWHSAGTFDVKTRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            ++  E  HGAN GLDIAV+LLEP KEQFPIIS+AD YQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   KMPEELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLR VFV QMGL+DKDIVALSG HTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGCDHLRQVFVTQMGLNDKDIVALSGAHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDP FRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPAFRPL  220



>gb|ACJ84589.1| unknown [Medicago truncatula]
Length=250

 Score =   388 bits (996),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 183/220 (83%), Positives = 201/220 (91%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KA+EK +RKLRGFIAEK CAPLMLR+AWHSAGTFD +TK+GGP+GT+
Sbjct  1    MGKSYPTVSADYQKAVEKAKRKLRGFIAEKKCAPLMLRLAWHSAGTFDSKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            + +AE  HGAN GLDIAV+LLEP KEQFPIIS+AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   KHQAELAHGANNGLDIAVRLLEPLKEQFPIISYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHT+G  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTIGATHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELL GEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFTELLGGEKEGLLQLPSDKALLSDPVFRPL  220



>gb|KEH30074.1| L-ascorbate peroxidase [Medicago truncatula]
Length=246

 Score =   387 bits (995),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 183/220 (83%), Positives = 201/220 (91%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KA+EK +RKLRGFIAEK CAPLMLR+AWHSAGTFD +TK+GGP+GT+
Sbjct  1    MGKSYPTVSADYQKAVEKAKRKLRGFIAEKKCAPLMLRLAWHSAGTFDSKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            + +AE  HGAN GLDIAV+LLEP KEQFPIIS+AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   KHQAELAHGANNGLDIAVRLLEPLKEQFPIISYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHT+G  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTIGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELL GEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFTELLGGEKEGLLQLPSDKALLSDPVFRPL  220



>gb|AAF22246.1| ascorbate peroxidase [Spuriopimpinella brachycarpa]
Length=250

 Score =   387 bits (995),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 183/220 (83%), Positives = 197/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY  A+EKCRRKLRGFIAEK CAPLMLR+AWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MGKCYPTVSEEYKVAVEKCRRKLRGFIAEKNCAPLMLRLAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R K EQ H AN GLD+AV+LLEPFKEQFPIIS+ DLYQLAGVVAVEITGGP+VPFHPGR 
Sbjct  61   RQKLEQSHAANNGLDVAVRLLEPFKEQFPIISYGDLYQLAGVVAVEITGGPDVPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLPNA  GNDHLR+VFVK MGLSDKDIV LSGGHTLGR HKERSGFEGPWT
Sbjct  121  DKDEPPQEGRLPNATLGNDHLRNVFVKTMGLSDKDIVTLSGGHTLGRAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL+GEKEGLLQLP+DK+LL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLTGEKEGLLQLPTDKSLLEDPVFRPL  220



>gb|AAS19934.1| ascorbate peroxidase [Rehmannia glutinosa]
Length=250

 Score =   387 bits (995),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS EYL A+EKC++KLRG IAEK CAP+MLR+AWHSAGTFD  +K+GGP+GTM
Sbjct  1    MVKNYPTVSEEYLNAVEKCKKKLRGLIAEKNCAPIMLRLAWHSAGTFDQCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAEQGH AN GLDIA++LL+P +EQFPI+SHAD YQLAGVVAVE+TGGPEVPFHPGR 
Sbjct  61   RFKAEQGHAANNGLDIALRLLQPIREQFPILSHADFYQLAGVVAVEVTGGPEVPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP+EGRLP+A KG+DHLRDVF KQMGLSD+DIVALSG HTLGRCHKERSGFEGPWT
Sbjct  121  DKEEPPVEGRLPDATKGSDHLRDVFTKQMGLSDQDIVALSGAHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL+DP FRPL
Sbjct  181  ANPLIFDNSYFKELLSGEKEGLLQLPSDKALLADPSFRPL  220



>ref|NP_001234782.1| cytosolic ascorbate peroxidase 1 [Solanum lycopersicum]
 gb|AAZ77770.1| cytosolic ascorbate peroxidase 1 [Solanum lycopersicum]
 gb|AAZ83363.1| cytosolic ascorbate peroxidase 1 [Solanum lycopersicum]
Length=250

 Score =   387 bits (993),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EYLKA++KC+RKLRG IAEK CAP+MLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKCYPTVSEEYLKAVDKCKRKLRGLIAEKNCAPIMLRLAWHSAGTYDVCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAE  HGAN GLDIA++LLEP +EQFP +SHAD +QLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFKAELAHGANNGLDIALRLLEPIREQFPTLSHADFHQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG DHLRDVF KQMGLSD+DIVALSG HTLGR HKERSGFEGPWT
Sbjct  121  DKPEPPVEGRLPDATKGCDHLRDVFKKQMGLSDQDIVALSGAHTLGRAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELLSGEKEGLLQLPSDKALL DP FRPL
Sbjct  181  ANPLIFDNSYFTELLSGEKEGLLQLPSDKALLCDPAFRPL  220



>gb|ABP65326.1| asorbate peroxidase [Cenchrus americanus]
Length=250

 Score =   386 bits (992),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 200/220 (91%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVSAEY +A+EK RRKLR  IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GTM
Sbjct  1    MAKCYPTVSAEYQEAVEKARRKLRALIAEKSCAPLMLRLAWHSAGTFDVSTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AEQ HGAN GLDIAV++LEP KE+FPI+S+ADLYQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   KNPAEQAHGANAGLDIAVRMLEPVKEEFPILSYADLYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG+DHLR VF KQMGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPQPPPEGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            RNPL+FDNSYF ELL+G+KEGLLQLPSDK LLSDPVFRPL
Sbjct  181  RNPLVFDNSYFKELLTGDKEGLLQLPSDKTLLSDPVFRPL  220



>gb|ACN60159.1| cytosolic ascorbate peroxidase [Tamarix hispida]
Length=250

 Score =   385 bits (988),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/220 (83%), Positives = 196/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS EY KAIEK RRKLR  IAEK CAPLMLR+AWHSAGTFDVQ+K+GGP+GTM
Sbjct  1    MGKSYPTVSEEYQKAIEKARRKLRALIAEKNCAPLMLRLAWHSAGTFDVQSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAEQGH AN G+DIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR 
Sbjct  61   RHKAEQGHAANNGIDIAVRLLEPLKEQFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+A KG DHLR VFVKQMGLSDKDIV L GGHTLGRCHKERSGF+GPWT
Sbjct  121  DKEEPPQEGRLPDATKGCDHLRQVFVKQMGLSDKDIVVLPGGHTLGRCHKERSGFDGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL+G+KEGLLQLPSDKALL  PVFRPL
Sbjct  181  SNPLIFDNSYFKELLTGDKEGLLQLPSDKALLEGPVFRPL  220



>emb|CAB58361.1| ascorbate peroxidase [Solanum lycopersicum]
Length=250

 Score =   385 bits (988),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EYLKA++KC+RKLRG IAEK CAP+MLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKCYPTVSEEYLKAVDKCKRKLRGLIAEKNCAPIMLRLAWHSAGTYDVCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAE  HGAN GLDIA++LLEP +EQFP +SHAD +QLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFKAELQHGANNGLDIALRLLEPIREQFPTLSHADFHQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG DHLRDVF KQMGLSD+DIVALSG HTLGR HKERSGFEGPWT
Sbjct  121  DKPEPPVEGRLPDATKGCDHLRDVFKKQMGLSDQDIVALSGAHTLGRAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELLSGEK+GLLQLPSDKALL DP FRPL
Sbjct  181  ANPLIFDNSYFTELLSGEKQGLLQLPSDKALLCDPAFRPL  220



>gb|EYU18888.1| hypothetical protein MIMGU_mgv1a012445mg [Erythranthe guttata]
Length=250

 Score =   385 bits (988),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EYLKA++KC++KLRGFIAEK CAPLMLR+AWHSAGTFD  +K+GGP+GTM
Sbjct  1    MVKNYPAVSEEYLKAVDKCKKKLRGFIAEKNCAPLMLRLAWHSAGTFDQGSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAEQGHGAN G+ IA+ LLEP KEQFPI+S+AD YQLAGVVAVEITGGPEVPFHPGRQ
Sbjct  61   RFKAEQGHGANNGIHIAINLLEPIKEQFPILSYADFYQLAGVVAVEITGGPEVPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP+EGRLP+A KG DHLRDVF KQMGLSD+DIVALSGGHTLGRCHKERSGF+GPWT
Sbjct  121  DKEEPPIEGRLPDATKGCDHLRDVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFDGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFT LL G+KEGLL LPSDKALLSDPVFRPL
Sbjct  181  PNPLIFDNSYFTVLLGGDKEGLLMLPSDKALLSDPVFRPL  220



>ref|XP_011089855.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic-like [Sesamum 
indicum]
Length=250

 Score =   384 bits (987),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 200/220 (91%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS EYLKA++KC++KLRG IAEK CAP+MLR+AWHSAGTF+  +K+GGP+GTM
Sbjct  1    MVKNYPTVSEEYLKAVDKCKKKLRGLIAEKNCAPIMLRLAWHSAGTFEQCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAEQGH AN GLDIA++LL+P ++QFP ++HAD YQLAGVVAVE+TGGPEVPFHPGR 
Sbjct  61   RFKAEQGHAANNGLDIALRLLQPIRDQFPTLTHADFYQLAGVVAVEVTGGPEVPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP+EGRLP+A KG+DHLRDVFVKQMGL+D+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKEEPPVEGRLPDATKGSDHLRDVFVKQMGLTDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDP FRP 
Sbjct  181  ANPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPAFRPF  220



>gb|AFC01206.1| ascorbate peroxidase, partial [Ammopiptanthus mongolicus]
Length=243

 Score =   384 bits (986),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 200/220 (91%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KA+EK ++KLRG IAEKGCAPLMLR+AWHSAGT+DV TK+GGP+GTM
Sbjct  1    MGKSYPTVSADYQKAVEKAKKKLRGLIAEKGCAPLMLRLAWHSAGTYDVSTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  +E  HGAN+GLDIAV+LLEP K QFP +S+AD YQLAGVVAVEITGGPEVPFHPGR+
Sbjct  61   KHASELAHGANSGLDIAVRLLEPIKGQFPTLSYADFYQLAGVVAVEITGGPEVPFHPGRK  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHTLGR HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTLGRAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL+DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLNDPVFRPL  220



>gb|AHI54569.1| ascorbate peroxidase [Camellia japonica]
Length=250

 Score =   384 bits (987),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY KAI+K +RKLRGFIA+K CAPLMLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKCYPTVSEEYKKAIDKAKRKLRGFIADKNCAPLMLRLAWHSAGTYDVSSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R K EQGH AN GL+IAV+LLEP KEQFPI+S+ D YQLAGVVAVEITGGP+VPFHPGR+
Sbjct  61   RHKLEQGHAANNGLEIAVRLLEPLKEQFPILSYGDFYQLAGVVAVEITGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG DHLRDVFVK MGLSDKDIV LSGGHTLGRCHKERSGF+G WT
Sbjct  121  DKPEPPIEGRLPDATKGCDHLRDVFVKHMGLSDKDIVVLSGGHTLGRCHKERSGFDGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDN+YFTELL+GEKEGLLQLPSDKALL DP FRPL
Sbjct  181  TNPLIFDNTYFTELLTGEKEGLLQLPSDKALLDDPAFRPL  220



>ref|XP_004505943.1| PREDICTED: L-ascorbate peroxidase, cytosolic-like isoform X1 
[Cicer arietinum]
Length=250

 Score =   384 bits (987),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 203/220 (92%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KA+EK ++KLRGFIAEK CAPL+LR+AWHSAGTFDV+TK+GGP+GT+
Sbjct  1    MGKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLILRLAWHSAGTFDVKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            + +AE  HGAN+GLDIAV+LLEP KEQFPIIS+AD YQL GVVAVE+TGGPEVPFHPGR+
Sbjct  61   KHQAELAHGANSGLDIAVRLLEPLKEQFPIISYADFYQLGGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHT+G  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTIGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELL+GEKEGLL+LPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFTELLNGEKEGLLKLPSDKALLSDPVFRPL  220



>ref|XP_004984819.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic-like [Setaria 
italica]
Length=250

 Score =   384 bits (986),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVSAEY +A+EK RRKLR  IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GTM
Sbjct  1    MAKCYPTVSAEYQEAVEKARRKLRALIAEKSCAPLMLRLAWHSAGTFDVSTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AEQ HGAN GLDIAV++LEP KE+FPI+S+ADLYQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   KNPAEQAHGANAGLDIAVRMLEPVKEEFPILSYADLYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG+DHLR VF KQMGLSD+DIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            RNPL+FDNSYF EL+SG+KEGLLQLPSDKALLSDP FRPL
Sbjct  181  RNPLVFDNSYFKELVSGDKEGLLQLPSDKALLSDPAFRPL  220



>ref|XP_004505944.1| PREDICTED: L-ascorbate peroxidase, cytosolic-like isoform X2 
[Cicer arietinum]
Length=246

 Score =   384 bits (985),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 203/220 (92%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KA+EK ++KLRGFIAEK CAPL+LR+AWHSAGTFDV+TK+GGP+GT+
Sbjct  1    MGKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLILRLAWHSAGTFDVKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            + +AE  HGAN+GLDIAV+LLEP KEQFPIIS+AD YQL GVVAVE+TGGPEVPFHPGR+
Sbjct  61   KHQAELAHGANSGLDIAVRLLEPLKEQFPIISYADFYQLGGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHT+G  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTIGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELL+GEKEGLL+LPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFTELLNGEKEGLLKLPSDKALLSDPVFRPL  220



>gb|ABM45856.1| cytosolic ascorbate peroxidase [Arachis hypogaea]
 gb|AGL61514.1| cytosolic ascorbate peroxidase [Arachis hypogaea]
Length=250

 Score =   384 bits (985),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 182/220 (83%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KA+EK ++KLRGFIAEK CAPLMLR+AWHSAGTFDV TKSGGP+GT+
Sbjct  1    MGKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDVATKSGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  +E  HGAN GLDIAV+LLEP KEQFP +S+AD YQLAGVVAVEITGGPE+PFHPGR+
Sbjct  61   KHPSELAHGANAGLDIAVRLLEPIKEQFPTLSYADFYQLAGVVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHTLG  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTLGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPVFRPL  220



>ref|XP_010542605.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic-like [Tarenaya 
hassleriana]
Length=250

 Score =   384 bits (985),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 197/219 (90%), Gaps = 0/219 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M KSYP VS EY +A+EKC+RKLRG I+EK CAPLMLR+AWHSAGTFDV +K+GGP+GTM
Sbjct  1    MTKSYPVVSEEYKRAVEKCKRKLRGLISEKNCAPLMLRLAWHSAGTFDVCSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN G++IA+ LL+P KEQFP IS AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   RFSAEQAHGANNGINIALSLLKPIKEQFPTISFADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF+KQMGLSDKDIVALSGGHTLG+CHK+RSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFIKQMGLSDKDIVALSGGHTLGKCHKDRSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRP  789
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDPVF P
Sbjct  181  ANPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPVFHP  219



>ref|XP_010521780.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic-like [Tarenaya 
hassleriana]
Length=250

 Score =   384 bits (985),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS +Y +A+EKC+RKLRG IAEKGCAPLMLR+AWHSAGTFD  +K+GGP+GTM
Sbjct  1    MAKNYPVVSEDYKQAVEKCKRKLRGLIAEKGCAPLMLRLAWHSAGTFDCGSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN G+ IA++LL+P KEQFP ISHAD +QLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   RFSAEQAHGANNGIVIALRLLDPIKEQFPTISHADFHQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLRDVFVKQMGLSDKDIVALSGGHTLGRCHK+RSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGCDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKDRSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF EL+SGEKEGLLQLPSDKALLSD VFRPL
Sbjct  181  ANPLIFDNSYFKELVSGEKEGLLQLPSDKALLSDTVFRPL  220



>ref|XP_002463451.1| hypothetical protein SORBIDRAFT_02g044060 [Sorghum bicolor]
 gb|EER99972.1| hypothetical protein SORBIDRAFT_02g044060 [Sorghum bicolor]
 gb|AFO59576.1| ascorbate peroxidase [Saccharum hybrid cultivar GT28]
Length=250

 Score =   383 bits (984),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +YLKA++K +RKLRG IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GTM
Sbjct  1    MVKAYPTVSEDYLKAVDKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVATKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AEQ HGAN GL+IAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP+VPFHPGRQ
Sbjct  61   KNPAEQAHGANAGLEIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDVPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A +G+DHLR VF  QMGLSD+DIVALSGGHTLGRCHK+RSGFEG WT
Sbjct  121  DKPEPPPEGRLPDATQGSDHLRQVFSTQMGLSDQDIVALSGGHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDP FRPL
Sbjct  181  SNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPSFRPL  220



>ref|XP_010253495.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic [Nelumbo nucifera]
Length=250

 Score =   383 bits (984),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 197/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY KA+EKC++KLRG IAEK CAPLMLR+AWHSAGTFDV++K+GGP+GTM
Sbjct  1    MGKCYPTVSEEYQKAVEKCKKKLRGLIAEKNCAPLMLRLAWHSAGTFDVKSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE GH AN GLDIAV+LLEP KEQFP +S+AD YQLAGVVAVEITGGPE+PFHPGR+
Sbjct  61   KQPAELGHAANNGLDIAVRLLEPIKEQFPTLSYADFYQLAGVVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLR VF  QMGLSDKDIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRQVFSVQMGLSDKDIVALSGGHTLGRCHKERSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDN+YF ELLSGEKEGLLQLPSDKALLSDP FRPL
Sbjct  181  FNPLIFDNTYFKELLSGEKEGLLQLPSDKALLSDPAFRPL  220



>ref|XP_008224940.1| PREDICTED: L-ascorbate peroxidase, cytosolic [Prunus mume]
Length=250

 Score =   383 bits (983),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS EY KAI+K +RKLRGFIAEK CAPLMLRIAWHSAGT+D +TK+GGP+GTM
Sbjct  1    MGKSYPTVSEEYKKAIDKAKRKLRGFIAEKACAPLMLRIAWHSAGTYDSKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AEQ HGAN GLDIAV+LLEP K+QFPI+S+AD YQLAGVVAVEITGGP+VPFHPGR+
Sbjct  61   KHAAEQSHGANAGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEITGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KGNDHLRDVF K MGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGNDHLRDVFGKTMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFT LLSG+ +GLL LP+D ALLSDPVFRPL
Sbjct  181  PNPLIFDNSYFTVLLSGKYDGLLMLPTDTALLSDPVFRPL  220



>ref|XP_011008849.1| PREDICTED: L-ascorbate peroxidase, cytosolic [Populus euphratica]
Length=249

 Score =   383 bits (983),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 197/219 (90%), Gaps = 1/219 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS EY KA+EK ++KLR  IAEK CAPLMLR+AWHSAGTFDV+TK+GGP+GTM
Sbjct  1    MTKNYPTVSEEYCKAVEKAKKKLRSLIAEKSCAPLMLRLAWHSAGTFDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AE  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVEITGGPEVPFHPGR+
Sbjct  61   RYSAELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEITGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRP  789
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDP+FRP
Sbjct  180  ANPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPIFRP  218



>gb|ACB45429.3| ascorbate peroxidase [Camellia sinensis]
Length=250

 Score =   383 bits (983),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY KAI+K +RKLRGFIAEK CAPLMLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MGKCYPTVSEEYKKAIDKAKRKLRGFIAEKNCAPLMLRLAWHSAGTYDVNSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R K EQGH AN GL+IAV LLEP KEQFPI+S+ D YQLAGVVAVEITGGP+VPFHPGR+
Sbjct  61   RHKLEQGHEANNGLEIAVGLLEPLKEQFPILSYGDFYQLAGVVAVEITGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG DHLRDVFVK MGLSDKDIV LSGGHTLGRCHKERSGF+G WT
Sbjct  121  DKPEPPIEGRLPDAAKGCDHLRDVFVKHMGLSDKDIVVLSGGHTLGRCHKERSGFDGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDN+YFTELL+GEKEGLLQLPSDKALL+DP FRPL
Sbjct  181  TNPLIFDNTYFTELLTGEKEGLLQLPSDKALLNDPAFRPL  220



>gb|AAB03844.1| cytosolic ascorbate peroxidase [Vigna unguiculata]
Length=250

 Score =   382 bits (981),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KAIEK ++KLRGFIAEK CAPLMLR+AWHSAGTFDV TK+GGP+GT+
Sbjct  1    MGKSYPTVSADYQKAIEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDVSTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   KHPAELAHGANNGLDIAVRLLEPIKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHT+G  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTIGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPVFRPL  220



>gb|AGG14280.1| cytosolic ascorbate peroxidase [Pyrus pyrifolia]
Length=250

 Score =   382 bits (980),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 196/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY  AI+K RRKLRG IAEK CAPLMLRIAWHSAGT+D +TK+GGP+GTM
Sbjct  1    MGKCYPTVSKEYKTAIDKARRKLRGLIAEKNCAPLMLRIAWHSAGTYDTKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN GLDIAV+LLEP K+QFPI+S+AD YQLAGVVAVEITGGP+VPFHPGR+
Sbjct  61   RCPAEQAHGANNGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEITGGPDVPFHPGRK  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DAPEPPPEGRLPDATKGSDHLRDVFSKTMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFT LL G++EGLL LPSDKALL DPVFRPL
Sbjct  181  PNPLIFDNSYFTVLLGGDQEGLLMLPSDKALLDDPVFRPL  220



>ref|XP_009352414.1| PREDICTED: L-ascorbate peroxidase, cytosolic-like [Pyrus x bretschneideri]
 ref|XP_009347691.1| PREDICTED: L-ascorbate peroxidase, cytosolic-like [Pyrus x bretschneideri]
Length=250

 Score =   381 bits (979),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 196/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY  AI+K RRKLRG IAEK CAPLMLRIAWHSAGT+D +TK+GGP+GTM
Sbjct  1    MGKCYPTVSEEYKTAIDKARRKLRGLIAEKNCAPLMLRIAWHSAGTYDTKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN GLDIAV+LLEP K+QFPI+S+AD YQLAGVVAVEITGGP+VPFHPGR+
Sbjct  61   RCPAEQAHGANNGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEITGGPDVPFHPGRK  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DAPEPPPEGRLPDATKGSDHLRDVFSKTMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFT LL G++EGLL LPSDKALL DPVFRPL
Sbjct  181  PNPLIFDNSYFTVLLGGDQEGLLMLPSDKALLDDPVFRPL  220



>gb|ACL78796.1| cytosolic ascorbate peroxidase 2 [Solanum lycopersicum]
Length=234

 Score =   380 bits (977),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = +1

Query  157  SAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMRLKAEQGH  336
            SAEYLKA++KC+RKLR  IAEK CAP+MLR+AWHSAGT+DV +K+GGP+GTMR KAEQ H
Sbjct  1    SAEYLKAVDKCKRKLRALIAEKNCAPIMLRLAWHSAGTYDVCSKTGGPFGTMRFKAEQAH  60

Query  337  GANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQDNPEPPLE  516
            GAN GLDIA++LLEP +EQFP +SHAD +QLAGVVAVE+TGGP+VPFHPGR+D PEPP+E
Sbjct  61   GANNGLDIALRLLEPIREQFPTLSHADFHQLAGVVAVEVTGGPDVPFHPGREDKPEPPVE  120

Query  517  GRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDN  696
            GRLP+A KG DHLRDVFVKQMGLS KDIVALSG HTLGRCHKERSGFEGPWT NPLIFDN
Sbjct  121  GRLPDATKGCDHLRDVFVKQMGLSYKDIVALSGAHTLGRCHKERSGFEGPWTANPLIFDN  180

Query  697  SYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            SYFTELLSGEKEGLLQLPSDKALLSDP FRPL
Sbjct  181  SYFTELLSGEKEGLLQLPSDKALLSDPAFRPL  212



>gb|AIG92779.1| ascorbate peroxidase, partial [Solanum melongena]
Length=235

 Score =   380 bits (977),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = +1

Query  151  TVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMRLKAEQ  330
            TVS +YLKA++KC+RKLR  IAEK CAP+MLR+AWHSAGT+DV +K+GGP+GTMR KAEQ
Sbjct  1    TVSEDYLKAVDKCKRKLRALIAEKNCAPIMLRLAWHSAGTYDVSSKTGGPFGTMRFKAEQ  60

Query  331  GHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQDNPEPP  510
             HGAN GLDIA++LLEP +EQFPI+SHAD +QL GVVAVE+TGGP+VPFHPGR+D PEPP
Sbjct  61   AHGANNGLDIALRLLEPIREQFPILSHADFHQLTGVVAVEVTGGPDVPFHPGREDKPEPP  120

Query  511  LEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIF  690
            +EGRLP+A KG+DHLRDVFVKQMGLSD+DIVALSG HTLGRCHKERSGFEGPWT NPLIF
Sbjct  121  VEGRLPDATKGSDHLRDVFVKQMGLSDQDIVALSGAHTLGRCHKERSGFEGPWTTNPLIF  180

Query  691  DNSYFTELLSGEKEGLLQLPSDKALLSDPVFR  786
            DNSYF ELLSGEKEGLLQLPSDKALLSDP FR
Sbjct  181  DNSYFKELLSGEKEGLLQLPSDKALLSDPAFR  212



>ref|XP_010043678.1| PREDICTED: L-ascorbate peroxidase, cytosolic [Eucalyptus grandis]
 ref|XP_010043679.1| PREDICTED: L-ascorbate peroxidase, cytosolic [Eucalyptus grandis]
 gb|KCW85673.1| hypothetical protein EUGRSUZ_B02456 [Eucalyptus grandis]
 gb|KCW85674.1| hypothetical protein EUGRSUZ_B02456 [Eucalyptus grandis]
Length=249

 Score =   380 bits (977),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 200/220 (91%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY KA+EKC++KLRG IAEK CAPLMLR+AWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MGKCYPTVSEEYSKAVEKCKKKLRGLIAEKNCAPLMLRLAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN GLDIAV+LLEP KEQFP++S+AD YQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   KHAAELAHGANNGLDIAVRLLEPIKEQFPVLSYADFYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF   MGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVF-GHMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDN+YFTELL+G+KE LLQLPSDKALL+DPVFRPL
Sbjct  180  TNPLIFDNTYFTELLTGDKEDLLQLPSDKALLTDPVFRPL  219



>ref|XP_007205774.1| hypothetical protein PRUPE_ppa010431mg [Prunus persica]
 gb|EMJ06973.1| hypothetical protein PRUPE_ppa010431mg [Prunus persica]
Length=240

 Score =   380 bits (976),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS EY KAI+K +RKLRGFIAEK CAPLMLRIAWHSAGT+D +TK+GGP+GTM
Sbjct  1    MGKSYPTVSEEYKKAIDKAKRKLRGFIAEKACAPLMLRIAWHSAGTYDSRTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AEQ HGAN GLDIAV+LLEP K+QFPI+S+AD YQLAGVVAVEITGGP+VPFHPGR+
Sbjct  61   KHAAEQSHGANAGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEITGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KGNDHLRDVF K MGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGNDHLRDVFGKTMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFT LLS + +GLL LP+D ALLSDPVFRPL
Sbjct  181  PNPLIFDNSYFTVLLSEKYDGLLMLPTDTALLSDPVFRPL  220



>gb|KCW85676.1| hypothetical protein EUGRSUZ_B02456 [Eucalyptus grandis]
Length=245

 Score =   380 bits (976),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 200/220 (91%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY KA+EKC++KLRG IAEK CAPLMLR+AWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MGKCYPTVSEEYSKAVEKCKKKLRGLIAEKNCAPLMLRLAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN GLDIAV+LLEP KEQFP++S+AD YQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   KHAAELAHGANNGLDIAVRLLEPIKEQFPVLSYADFYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF   MGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVF-GHMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDN+YFTELL+G+KE LLQLPSDKALL+DPVFRPL
Sbjct  180  TNPLIFDNTYFTELLTGDKEDLLQLPSDKALLTDPVFRPL  219



>gb|AAD41404.1|AF159629_1 cytosolic ascorbate peroxidase [Fragaria x ananassa]
 gb|AAD41406.1|AF159631_1 cytosolic ascorbate peroxidase [Fragaria x ananassa]
 gb|AAD43337.1| cytosolic ascorbate peroxidase APX19 [Fragaria x ananassa]
Length=250

 Score =   380 bits (976),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY KAI+K +RKLRG IAEK CAPLMLR+AWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MGKCYPTVSEEYKKAIDKAKRKLRGLIAEKNCAPLMLRLAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   KQSAELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLR+VF K MGLSD+DIVALSGGHTLGR HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDAGKGSDHLREVFGKTMGLSDQDIVALSGGHTLGRAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFT LLSGEKEGLLQLP+DKALLSDPVFRPL
Sbjct  181  PNPLIFDNSYFTVLLSGEKEGLLQLPTDKALLSDPVFRPL  220



>ref|XP_007205775.1| hypothetical protein PRUPE_ppa010431mg [Prunus persica]
 ref|XP_007205776.1| hypothetical protein PRUPE_ppa010431mg [Prunus persica]
 gb|EMJ06974.1| hypothetical protein PRUPE_ppa010431mg [Prunus persica]
 gb|EMJ06975.1| hypothetical protein PRUPE_ppa010431mg [Prunus persica]
Length=250

 Score =   380 bits (975),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS EY KAI+K +RKLRGFIAEK CAPLMLRIAWHSAGT+D +TK+GGP+GTM
Sbjct  1    MGKSYPTVSEEYKKAIDKAKRKLRGFIAEKACAPLMLRIAWHSAGTYDSRTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AEQ HGAN GLDIAV+LLEP K+QFPI+S+AD YQLAGVVAVEITGGP+VPFHPGR+
Sbjct  61   KHAAEQSHGANAGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEITGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KGNDHLRDVF K MGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGNDHLRDVFGKTMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFT LLS + +GLL LP+D ALLSDPVFRPL
Sbjct  181  PNPLIFDNSYFTVLLSEKYDGLLMLPTDTALLSDPVFRPL  220



>gb|AAB95222.1| cytosolic ascorbate peroxidase [Fragaria x ananassa]
 gb|AAD43336.1| cytosolic ascorbate peroxidase [Fragaria x ananassa]
Length=250

 Score =   380 bits (975),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY KAI+K +RKLRG IAEK CAPLMLR+AWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MGKCYPTVSEEYKKAIDKAKRKLRGLIAEKNCAPLMLRLAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   KQSAELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLR+VF K MGLSD+DIVALSGGHTLGR HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDAGKGSDHLREVFGKTMGLSDQDIVALSGGHTLGRAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFT LLSGEKEGLLQLP+DKALLSDPVFRPL
Sbjct  181  PNPLIFDNSYFTVLLSGEKEGLLQLPTDKALLSDPVFRPL  220



>ref|XP_006658179.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic-like [Oryza brachyantha]
Length=250

 Score =   380 bits (975),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 195/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EYL A+ K +RKLRG IAEK CAPLMLR+AWHSAGTFDV +++GGP+GTM
Sbjct  1    MGKCYPTVSEEYLAAVAKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVSSRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AEQ H AN GLDIAV+LLEP KEQ P++S+AD YQLAGVVAVE+TGGPEVPFHPGRQ
Sbjct  61   KNPAEQAHAANAGLDIAVRLLEPIKEQLPLLSYADFYQLAGVVAVEVTGGPEVPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A +G+DHLR VF  QMGLSDKDIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKPEPPPEGRLPDATQGSDHLRQVFSTQMGLSDKDIVALSGGHTLGRCHKERSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTEL+SGEKEGLLQLPSDKAL++DP FRPL
Sbjct  181  SNPLIFDNSYFTELVSGEKEGLLQLPSDKALMADPAFRPL  220



>gb|EMT09178.1| L-ascorbate peroxidase 2, cytosolic [Aegilops tauschii]
Length=256

 Score =   380 bits (976),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 194/219 (89%), Gaps = 0/219 (0%)
 Frame = +1

Query  136  GKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMR  315
             K YPTVS EYL A+ K +RKLRGFIAEK CAPLMLR+AWHSAGTFDV TK+GGP+GTM+
Sbjct  3    AKCYPTVSDEYLAAVAKAKRKLRGFIAEKNCAPLMLRLAWHSAGTFDVATKTGGPFGTMK  62

Query  316  LKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQD  495
              AE  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGPEVPFHPGRQD
Sbjct  63   CPAELAHGANAGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRQD  122

Query  496  NPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTR  675
             PEPP EGRLP+A +G+DHLR VF  QMGLSD+DIVALSGGHTLGRCHKERSGFEG WT 
Sbjct  123  KPEPPPEGRLPDATQGSDHLRQVFSTQMGLSDQDIVALSGGHTLGRCHKERSGFEGAWTA  182

Query  676  NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            NPLIFDNSYFTELLSGEKEGLLQLP+DK LL+DP FRPL
Sbjct  183  NPLIFDNSYFTELLSGEKEGLLQLPTDKTLLTDPAFRPL  221



>ref|XP_003558178.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic [Brachypodium 
distachyon]
Length=250

 Score =   380 bits (975),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 197/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVSAEY +A+EK RRKLR  IAEK CAPLMLR+AWHSAGTFDV +K+GGP+GTM
Sbjct  1    MAKTYPTVSAEYQEAVEKARRKLRALIAEKSCAPLMLRLAWHSAGTFDVSSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AEQ H AN GLDIAV++LEP KE+ P IS+ADLYQLAGVVAVE++GGPE+PFHPGR+
Sbjct  61   KKPAEQAHAANAGLDIAVRMLEPIKEEIPTISYADLYQLAGVVAVEVSGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG+DHLR VF KQMGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPQPPPEGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            R PL FDN+YFTELLSG+KEGLLQLPSDK LLSDPVFRPL
Sbjct  181  REPLKFDNTYFTELLSGDKEGLLQLPSDKTLLSDPVFRPL  220



>sp|P48534.2|APX1_PEA RecName: Full=L-ascorbate peroxidase, cytosolic; Short=AP; AltName: 
Full=PsAPx01 [Pisum sativum]
 emb|CAA43992.1| L-ascorbate peroxidase [Pisum sativum]
 gb|AAA33645.1| ascorbate peroxidase [Pisum sativum]
Length=250

 Score =   380 bits (975),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 200/220 (91%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS +Y KAIEK +RKLRGFIAEK CAPL+LR+AWHSAGTFD +TK+GGP+GT+
Sbjct  1    MGKSYPTVSPDYQKAIEKAKRKLRGFIAEKKCAPLILRLAWHSAGTFDSKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            + +AE  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVEITGGPEVPFHPGR+
Sbjct  61   KHQAELAHGANNGLDIAVRLLEPIKEQFPIVSYADFYQLAGVVAVEITGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHT+G  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTIGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELL+GEK+GLLQLPSDKALL+D VFRPL
Sbjct  181  SNPLIFDNSYFTELLTGEKDGLLQLPSDKALLTDSVFRPL  220



>tpg|DAA41857.1| TPA: APx2-Cytosolic Ascorbate Peroxidase [Zea mays]
Length=286

 Score =   381 bits (978),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 200/223 (90%), Gaps = 0/223 (0%)
 Frame = +1

Query  124  SVAMGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPY  303
            S AM K+YPTV+ +YLKA++K +RKLRG IAEK CAPLMLR+AWHSAGTFDV TK+GGP+
Sbjct  34   SAAMVKAYPTVNEDYLKAVDKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVATKTGGPF  93

Query  304  GTMRLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHP  483
            GTM+  AEQ HGAN GL+IA++LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP+VPFHP
Sbjct  94   GTMKNPAEQAHGANAGLEIAIRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDVPFHP  153

Query  484  GRQDNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEG  663
            GRQD PEPP EGRLP+A +G+DHLR VF  QMGLSD+DIVALSGGHTLGRCHK+RSGFEG
Sbjct  154  GRQDKPEPPPEGRLPDATQGSDHLRQVFSTQMGLSDQDIVALSGGHTLGRCHKDRSGFEG  213

Query  664  PWTRNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             WT NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDP FRPL
Sbjct  214  AWTSNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPSFRPL  256



>tpg|DAA41856.1| TPA: hypothetical protein ZEAMMB73_314819 [Zea mays]
Length=282

 Score =   380 bits (977),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 200/223 (90%), Gaps = 0/223 (0%)
 Frame = +1

Query  124  SVAMGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPY  303
            S AM K+YPTV+ +YLKA++K +RKLRG IAEK CAPLMLR+AWHSAGTFDV TK+GGP+
Sbjct  34   SAAMVKAYPTVNEDYLKAVDKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVATKTGGPF  93

Query  304  GTMRLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHP  483
            GTM+  AEQ HGAN GL+IA++LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP+VPFHP
Sbjct  94   GTMKNPAEQAHGANAGLEIAIRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDVPFHP  153

Query  484  GRQDNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEG  663
            GRQD PEPP EGRLP+A +G+DHLR VF  QMGLSD+DIVALSGGHTLGRCHK+RSGFEG
Sbjct  154  GRQDKPEPPPEGRLPDATQGSDHLRQVFSTQMGLSDQDIVALSGGHTLGRCHKDRSGFEG  213

Query  664  PWTRNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             WT NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDP FRPL
Sbjct  214  AWTSNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPSFRPL  256



>ref|NP_001152249.1| APx1 - Cytosolic Ascorbate Peroxidase [Zea mays]
 gb|ACG46606.1| APx1 - Cytosolic Ascorbate Peroxidase [Zea mays]
Length=250

 Score =   379 bits (974),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVSAEY +A+EK RRKLR  IAEK CAPLMLR+AWHSAGTFDV +++GGP+GTM
Sbjct  1    MAKNYPTVSAEYSEAVEKARRKLRALIAEKSCAPLMLRLAWHSAGTFDVSSRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            + ++E  HGAN GLDIAV+LLEP KE+FPI+S+AD YQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   KHQSELAHGANAGLDIAVRLLEPIKEEFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG+DHLR VF KQMGLSD+DIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPL+FDNSYF ELLSG+KEGLLQLPSDKALLSDPVFRPL
Sbjct  181  TNPLVFDNSYFKELLSGDKEGLLQLPSDKALLSDPVFRPL  220



>ref|XP_004294686.1| PREDICTED: L-ascorbate peroxidase, cytosolic-like [Fragaria vesca 
subsp. vesca]
 gb|AAD41405.1|AF159630_1 cytosolic ascorbate peroxidase [Fragaria x ananassa]
 gb|AAB94574.1| cytosolic ascorbate peroxidase [Fragaria x ananassa]
Length=250

 Score =   379 bits (974),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY KAI+K +RKLRG IAEK CAPLMLR+AWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MGKCYPTVSEEYKKAIDKAKRKLRGLIAEKNCAPLMLRLAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   KQPAELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLR+VF K MGLSD+DIVALSGGHTLGR HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDAGKGSDHLREVFGKTMGLSDQDIVALSGGHTLGRAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFT LLSGEKEGLLQLP+DKALLSDPVFRPL
Sbjct  181  PNPLIFDNSYFTVLLSGEKEGLLQLPTDKALLSDPVFRPL  220



>emb|CBI32625.3| unnamed protein product [Vitis vinifera]
Length=253

 Score =   379 bits (974),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 196/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK+YP VS EY KA+EKC+RKLRGFIAEK CAPLMLR+AWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MGKAYPIVSEEYQKAVEKCKRKLRGFIAEKKCAPLMLRLAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +   E  H AN GLDIAV+LLEP KEQFPI+S+ D YQLAGVVAVE+TGGPE+PFHPGRQ
Sbjct  61   KHPEELAHEANNGLDIAVRLLEPIKEQFPILSYGDFYQLAGVVAVEVTGGPEIPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLPNA KG+DHLRDVF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKSEPPPEGRLPNATKGSDHLRDVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGL+QLPSDKALL DPVFRPL
Sbjct  180  TNPLIFDNSYFKELLSGEKEGLIQLPSDKALLEDPVFRPL  219



>gb|AAD41402.1|AF159627_1 cytosolic ascorbate peroxidase [Fragaria x ananassa]
 gb|AAD41403.1|AF159628_1 cytosolic ascorbate peroxidase [Fragaria x ananassa]
Length=250

 Score =   379 bits (973),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTV+ EY KAI+K +RKLRG IAEK CAPLMLR+AWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MGKCYPTVTEEYKKAIDKAKRKLRGLIAEKNCAPLMLRLAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   KQSAELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLR+VF K MGLSD+DIVALSGGHTLGR HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDAGKGSDHLREVFGKTMGLSDQDIVALSGGHTLGRAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFT LLSGEKEGLLQLP+DKALLSDPVFRPL
Sbjct  181  PNPLIFDNSYFTVLLSGEKEGLLQLPTDKALLSDPVFRPL  220



>ref|NP_001267988.1| cytosolic ascorbate peroxidase [Vitis vinifera]
 gb|ABX79340.1| cytosolic ascorbate peroxidase [Vitis vinifera]
Length=253

 Score =   379 bits (973),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 196/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK+YP VS EY KA+EKC+RKLRGFIAEK CAPLMLR+AWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MGKAYPIVSEEYQKAVEKCKRKLRGFIAEKKCAPLMLRLAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +   E  H AN GLDIAV+LLEP KEQFPI+S+ D YQLAGVVAVE+TGGPE+PFHPGRQ
Sbjct  61   KHPEELAHEANNGLDIAVRLLEPIKEQFPILSYGDFYQLAGVVAVEVTGGPEIPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLPNA KG+DHLRDVF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKSEPPPEGRLPNATKGSDHLRDVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGL+QLPSDKALL DPVFRPL
Sbjct  180  TNPLIFDNSYFKELLSGEKEGLIQLPSDKALLEDPVFRPL  219



>gb|ABP87792.1| ascorbate peroxidase [Malus domestica]
Length=250

 Score =   379 bits (973),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 194/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY  AI+K RRKLRG IAEK CAPLMLRIAWHSAGT+D +TK+GGP+GTM
Sbjct  1    MGKCYPTVSEEYKTAIDKARRKLRGLIAEKNCAPLMLRIAWHSAGTYDTKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN GLDIAV+LLEP K+QFPI+S+AD YQLAGVVAVEITGGP+VPFHPGR+
Sbjct  61   RCPAEQAHGANNGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEITGGPDVPFHPGRK  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLRDVF K MGLSDKDIV LSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DAPEPPPEGRLPDATKGCDHLRDVFCKTMGLSDKDIVTLSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFT LL G++EGLL LPSDKALL DPVFRPL
Sbjct  181  PNPLIFDNSYFTVLLGGDQEGLLMLPSDKALLDDPVFRPL  220



>gb|AAD41407.1|AF159632_1 cytosolic ascorbate peroxidase [Fragaria x ananassa]
 gb|AAD41408.1|AF159633_1 cytosolic ascorbate peroxidase [Fragaria x ananassa]
 gb|AAD43338.1| cytosolic ascorbate peroxidase APX26 [Fragaria x ananassa]
Length=250

 Score =   379 bits (973),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTV+ EY KAI+K +RKLRG IAEK CAPLMLR+AWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MGKCYPTVTEEYKKAIDKAKRKLRGLIAEKNCAPLMLRLAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   KQSAELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLR+VF K MGLSD+DIVALSGGHTLGR HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDAGKGSDHLREVFGKTMGLSDQDIVALSGGHTLGRAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFT LLSGEKEGLLQLP+DKALLSDPVFRPL
Sbjct  181  PNPLIFDNSYFTVLLSGEKEGLLQLPTDKALLSDPVFRPL  220



>gb|ACF87724.1| unknown [Zea mays]
Length=250

 Score =   379 bits (973),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTV+ +YLKA++K +RKLRG IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GTM
Sbjct  1    MVKAYPTVNEDYLKAVDKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVATKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AEQ HGAN GL+IA++LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP+VPFHPGRQ
Sbjct  61   KNPAEQAHGANAGLEIAIRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDVPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A +G+DHLR VF  QMGLSD+DIVALSGGHTLGRCHK+RSGFEG WT
Sbjct  121  DKPEPPPEGRLPDATQGSDHLRQVFSTQMGLSDQDIVALSGGHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDP FRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPSFRPL  220



>ref|XP_010653439.1| PREDICTED: cytosolic ascorbate peroxidase isoform X1 [Vitis vinifera]
Length=246

 Score =   379 bits (972),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 196/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK+YP VS EY KA+EKC+RKLRGFIAEK CAPLMLR+AWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MGKAYPIVSEEYQKAVEKCKRKLRGFIAEKKCAPLMLRLAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +   E  H AN GLDIAV+LLEP KEQFPI+S+ D YQLAGVVAVE+TGGPE+PFHPGRQ
Sbjct  61   KHPEELAHEANNGLDIAVRLLEPIKEQFPILSYGDFYQLAGVVAVEVTGGPEIPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLPNA KG+DHLRDVF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKSEPPPEGRLPNATKGSDHLRDVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGL+QLPSDKALL DPVFRPL
Sbjct  180  TNPLIFDNSYFKELLSGEKEGLIQLPSDKALLEDPVFRPL  219



>gb|AAL08496.1| ascorbate peroxidase [Hordeum vulgare subsp. vulgare]
Length=256

 Score =   379 bits (973),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 193/219 (88%), Gaps = 0/219 (0%)
 Frame = +1

Query  136  GKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMR  315
             K YPTVS EYL A+ K RRKLRG IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GTM+
Sbjct  3    AKCYPTVSDEYLAAVAKARRKLRGLIAEKNCAPLMLRLAWHSAGTFDVATKTGGPFGTMK  62

Query  316  LKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQD  495
              AE  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGPEVPFHPGRQD
Sbjct  63   CPAELAHGANAGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRQD  122

Query  496  NPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTR  675
             PEPP EGRLP+A +G+DHLR VF  QMGLSD+DIVALSGGHTLGRCHKERSGFEG WT 
Sbjct  123  KPEPPPEGRLPDATQGSDHLRQVFSTQMGLSDQDIVALSGGHTLGRCHKERSGFEGAWTA  182

Query  676  NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            NPLIFDNSYFTELLSGEKEGLLQLP+DK LL+DP FRPL
Sbjct  183  NPLIFDNSYFTELLSGEKEGLLQLPTDKVLLTDPAFRPL  221



>gb|EYU36225.1| hypothetical protein MIMGU_mgv1a012399mg [Erythranthe guttata]
Length=246

 Score =   379 bits (972),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS EYLKA+EK ++KLRG IAEK CAP+MLR+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MVKNYPTVSEEYLKAVEKAKKKLRGLIAEKNCAPIMLRLAWHSAGTFDQCSRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AE  HGAN+GLDIA++LL P +EQFP IS+AD YQLAGVVAVE+TGGPEVPFHPGR 
Sbjct  61   RFDAELAHGANSGLDIALRLLAPIREQFPTISYADFYQLAGVVAVEVTGGPEVPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP+EGRLP+A KG+DHLRDVFVKQMGL+D+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKAEPPVEGRLPDATKGSDHLRDVFVKQMGLTDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL+DP FRP+
Sbjct  181  ENPLIFDNSYFKELLSGEKEGLLQLPSDKALLADPSFRPI  220



>gb|AFW88739.1| hypothetical protein ZEAMMB73_022439 [Zea mays]
Length=299

 Score =   380 bits (977),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 176/222 (79%), Positives = 198/222 (89%), Gaps = 0/222 (0%)
 Frame = +1

Query  127  VAMGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYG  306
             AM K+YPTVSAEY +A+EK RRKLR  IAEK CAPLMLR+AWHSAGTFDV +++GGP+G
Sbjct  52   AAMAKNYPTVSAEYSEAVEKARRKLRALIAEKSCAPLMLRLAWHSAGTFDVSSRTGGPFG  111

Query  307  TMRLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPG  486
            TM+  AE  HGAN GLDIAV+LLEP KE+FP +S+AD YQLAGVVAVE+TGGPE+PFHPG
Sbjct  112  TMKCPAELAHGANAGLDIAVRLLEPIKEEFPTLSYADFYQLAGVVAVEVTGGPEIPFHPG  171

Query  487  RQDNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGP  666
            R+D P+PP EGRLP+A KG+DHLR VF KQMGLSD+DIVALSGGHTLGRCHKERSGFEG 
Sbjct  172  REDKPQPPPEGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFEGA  231

Query  667  WTRNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            WT NPL+FDNSYF ELLSG+KEGLLQLPSDKALLSDPVFRPL
Sbjct  232  WTTNPLVFDNSYFKELLSGDKEGLLQLPSDKALLSDPVFRPL  273



>ref|XP_008385256.1| PREDICTED: L-ascorbate peroxidase, cytosolic-like [Malus domestica]
Length=250

 Score =   379 bits (972),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 195/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY  AI+K RRKLRG IAEK CAPLMLRIAWHSAGT+D +TK+GGP+GTM
Sbjct  1    MGKCYPTVSEEYKTAIDKARRKLRGLIAEKNCAPLMLRIAWHSAGTYDTKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN GLDIAV+LLEP K+QFPI+S+AD YQLAGVVAVEITGGP+VPFHPGR+
Sbjct  61   RCPAEQSHGANNGLDIAVRLLEPIKQQFPILSYADXYQLAGVVAVEITGGPDVPFHPGRK  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLRDVF K MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DAPEPPPEGRLPDATKGCDHLRDVFGKTMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFT LL G++EGLL LPSDKALL DPVFRPL
Sbjct  181  PNPLIFDNSYFTVLLGGDQEGLLMLPSDKALLDDPVFRPL  220



>ref|NP_001235587.1| L-ascorbate peroxidase 2 [Glycine max]
 dbj|BAC92740.1| cytosolic ascorbate peroxidase 2 [Glycine max]
Length=250

 Score =   378 bits (971),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KA+EK ++KLRGFIAEK CAPLMLR+AWHSAGT+DV +K+GGP+GT+
Sbjct  1    MGKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTYDVSSKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  +E  HGAN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   KHPSELAHGANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHT+G  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDRDIVALSGGHTIGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPVFRPL  220



>gb|EYU36222.1| hypothetical protein MIMGU_mgv1a012399mg [Erythranthe guttata]
 gb|EYU36223.1| hypothetical protein MIMGU_mgv1a012399mg [Erythranthe guttata]
 gb|EYU36224.1| hypothetical protein MIMGU_mgv1a012399mg [Erythranthe guttata]
Length=251

 Score =   379 bits (972),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS EYLKA+EK ++KLRG IAEK CAP+MLR+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MVKNYPTVSEEYLKAVEKAKKKLRGLIAEKNCAPIMLRLAWHSAGTFDQCSRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AE  HGAN+GLDIA++LL P +EQFP IS+AD YQLAGVVAVE+TGGPEVPFHPGR 
Sbjct  61   RFDAELAHGANSGLDIALRLLAPIREQFPTISYADFYQLAGVVAVEVTGGPEVPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP+EGRLP+A KG+DHLRDVFVKQMGL+D+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKAEPPVEGRLPDATKGSDHLRDVFVKQMGLTDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL+DP FRP+
Sbjct  181  ENPLIFDNSYFKELLSGEKEGLLQLPSDKALLADPSFRPI  220



>ref|NP_001152746.1| ascorbate peroxidase [Zea mays]
 gb|ACG46109.1| APx1 - Cytosolic Ascorbate Peroxidase [Zea mays]
 gb|ACO06084.1| ascorbate peroxidase [Zea mays]
 tpg|DAA44795.1| TPA: APx1-Cytosolic Ascorbate Peroxidase [Zea mays]
Length=250

 Score =   378 bits (971),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVSAEY +A++K RRKLR  IAEK CAPLMLR+AWHSAGTFDV +++GGP+GTM
Sbjct  1    MAKNYPTVSAEYSEAVDKARRKLRALIAEKSCAPLMLRLAWHSAGTFDVSSRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            + ++E  HGAN GLDIAV+LLEP KE+FPI+S+AD YQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   KHQSELAHGANAGLDIAVRLLEPIKEEFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG+DHLR VF KQMGLSD+DIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPL+FDNSYF ELLSG+KEGLLQLPSDKALLSDPVFRPL
Sbjct  181  TNPLVFDNSYFKELLSGDKEGLLQLPSDKALLSDPVFRPL  220



>gb|ADC95633.1| L-ascorbate peroxidase [Bruguiera gymnorhiza]
Length=250

 Score =   378 bits (971),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 197/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M KSYP VS EY KA+E  +RKLRG I EK CAP+MLRIAWHSAGT+DV++K+GGP+GTM
Sbjct  1    MTKSYPIVSEEYKKAVENAKRKLRGLINEKNCAPIMLRIAWHSAGTYDVKSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN+GLDIAV+LLEP K QFPIIS+AD YQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   KHPAELAHGANSGLDIAVRLLEPIKAQFPIISYADFYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF  QMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NP++FDNSYF ELLSG+KEGLLQLP+DKALLSDPVFRPL
Sbjct  181  SNPVVFDNSYFKELLSGDKEGLLQLPTDKALLSDPVFRPL  220



>ref|XP_004958803.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic-like isoform X1 
[Setaria italica]
Length=229

 Score =   377 bits (969),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 196/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +YLKAI+K +RKLRG IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GTM
Sbjct  1    MVKAYPTVSEDYLKAIDKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVGTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN GLDIAV+LLEP KEQFP IS+AD YQLAGVVAVE+TGGP+VPFHPGRQ
Sbjct  61   KDPAELAHGANAGLDIAVRLLEPIKEQFPTISYADFYQLAGVVAVEVTGGPDVPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A +G+DHLR VF  QMGLSD+DIVALSGGHTLGRCHK+RSGFEG WT
Sbjct  121  DKPEPPPEGRLPDATQGSDHLRQVFSTQMGLSDQDIVALSGGHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDP FRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPSFRPL  220



>ref|NP_001150192.1| APx1 - Cytosolic Ascorbate Peroxidase [Zea mays]
 ref|XP_008660258.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic [Zea mays]
 gb|ACG38188.1| APx1 - Cytosolic Ascorbate Peroxidase [Zea mays]
 gb|AFW88741.1| APx1-Cytosolic Ascorbate Peroxidase [Zea mays]
Length=250

 Score =   378 bits (971),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 197/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVSAEY +A+EK RRKLR  IAEK CAPLMLR+AWHSAGTFDV +++GGP+GTM
Sbjct  1    MAKNYPTVSAEYSEAVEKARRKLRALIAEKSCAPLMLRLAWHSAGTFDVSSRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN GLDIAV+LLEP KE+FP +S+AD YQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   KCPAELAHGANAGLDIAVRLLEPIKEEFPTLSYADFYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG+DHLR VF KQMGLSD+DIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPL+FDNSYF ELLSG+KEGLLQLPSDKALLSDPVFRPL
Sbjct  181  TNPLVFDNSYFKELLSGDKEGLLQLPSDKALLSDPVFRPL  220



>ref|XP_002313506.1| cytosolic ascorbate peroxidase family protein [Populus trichocarpa]
 gb|EEE87461.1| cytosolic ascorbate peroxidase family protein [Populus trichocarpa]
Length=249

 Score =   378 bits (970),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 195/219 (89%), Gaps = 1/219 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS EY KA+EK ++KLR  IAEK CAPLMLR+AWHSAGTFDV+TK+GGP+GTM
Sbjct  1    MTKNYPTVSEEYSKAVEKAKKKLRSLIAEKSCAPLMLRLAWHSAGTFDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AE  HGAN GLDIAV+LLE  KEQFPI+S+AD YQLAGVV VEITGGPEVPFHPGR+
Sbjct  61   RYSAELAHGANNGLDIAVRLLESIKEQFPILSYADFYQLAGVVGVEITGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRP  789
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDP+FRP
Sbjct  180  ANPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPIFRP  218



>ref|XP_004958804.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic-like isoform X2 
[Setaria italica]
Length=250

 Score =   378 bits (970),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 196/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +YLKAI+K +RKLRG IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GTM
Sbjct  1    MVKAYPTVSEDYLKAIDKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVGTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN GLDIAV+LLEP KEQFP IS+AD YQLAGVVAVE+TGGP+VPFHPGRQ
Sbjct  61   KDPAELAHGANAGLDIAVRLLEPIKEQFPTISYADFYQLAGVVAVEVTGGPDVPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A +G+DHLR VF  QMGLSD+DIVALSGGHTLGRCHK+RSGFEG WT
Sbjct  121  DKPEPPPEGRLPDATQGSDHLRQVFSTQMGLSDQDIVALSGGHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDP FRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPSFRPL  220



>gb|AEC11053.1| ascorbate peroxidase, partial [Camellia sinensis]
Length=217

 Score =   377 bits (967),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 177/213 (83%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS EY KAI+K +RKLRG IAEK CAP+MLR+AWHSAGT+DV TK+GGP+GTM
Sbjct  1    MEKCYPTVSEEYKKAIDKAKRKLRGLIAEKNCAPIMLRLAWHSAGTYDVTTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R K EQGH AN GL+IAV+LLEP KEQFPIIS+AD YQLAGVVAVEITGGP+VPFHPGR+
Sbjct  61   RHKLEQGHAANNGLEIAVRLLEPIKEQFPIISYADFYQLAGVVAVEITGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG DHLRDVFVK MGL+DKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPVEGRLPDATKGTDHLRDVFVKHMGLTDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLS  771
             NPLIFDNSYFTELL+GEKEGLLQLPSDKALL+
Sbjct  181  ANPLIFDNSYFTELLTGEKEGLLQLPSDKALLN  213



>gb|AAO14118.1|AF457210_1 ascorbate peroxidase [Hevea brasiliensis]
Length=250

 Score =   378 bits (970),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 175/219 (80%), Positives = 195/219 (89%), Gaps = 0/219 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EY KAI+K +RKLRGFIAEKGCAPLMLRIAWHSAGT+D  TK+GGP+GTM
Sbjct  1    MTKNYPKVSEEYQKAIDKAKRKLRGFIAEKGCAPLMLRIAWHSAGTYDANTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ H AN GLDIAV+LLEP K+QFPI+S+AD YQLAGVVAVEITGGPE+PFHPGR+
Sbjct  61   RHAAEQAHAANNGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLPNA KG DHLR+VF K MGLSDKDIV LSGGHTLGRCHKERSGF+GPWT
Sbjct  121  DKPEPPPEGRLPNATKGADHLREVFGKTMGLSDKDIVVLSGGHTLGRCHKERSGFDGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRP  789
             NPLIFDNS+FTELL+G+KEGLLQLP+D  L++DPVFRP
Sbjct  181  ANPLIFDNSFFTELLAGQKEGLLQLPTDTVLVTDPVFRP  219



>gb|AHG54007.1| cytosolic ascorbate peroxidase [Populus tomentosa]
Length=249

 Score =   378 bits (970),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 179/219 (82%), Positives = 196/219 (89%), Gaps = 1/219 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +Y KA+EK ++KLR  I+EK CAPLMLRIAWHSAGTFDV+TK+GGP+GTM
Sbjct  1    MTKNYPTVSEDYSKAVEKAKKKLRSLISEKSCAPLMLRIAWHSAGTFDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AE  HGAN+GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVEITGGPEVPFHPGR+
Sbjct  61   RYSAELAHGANSGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEITGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF   MGLSDKDIVALSG HTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVF-GHMGLSDKDIVALSGAHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRP  789
             NPLIFDNSYF ELL GEKEGLLQLPSDKALLSDP+FRP
Sbjct  180  ANPLIFDNSYFKELLGGEKEGLLQLPSDKALLSDPIFRP  218



>emb|CAA06996.1| ascorbate peroxidase [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   377 bits (969),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 197/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M KSYP VSAEYL+A+EK R+KLR  IAEK C+PLMLR+AWHSAGTFDV +K+GGP+GTM
Sbjct  1    MAKSYPVVSAEYLEAVEKARQKLRALIAEKNCSPLMLRLAWHSAGTFDVSSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AEQ H AN GLDIAV++LEP KE+ P IS+ADLYQLAGVVAVE++GGP +PFHPGR+
Sbjct  61   KKPAEQAHAANAGLDIAVRMLEPIKEEIPTISYADLYQLAGVVAVEVSGGPVIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG+DHLR VF KQMGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPQPPPEGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            RNPL FDNSYFTELLSG+KEGLLQLPSDK LL+DPVFRPL
Sbjct  181  RNPLKFDNSYFTELLSGDKEGLLQLPSDKTLLTDPVFRPL  220



>dbj|BAM28755.1| ascorbate peroxidase [Ziziphus jujuba]
Length=250

 Score =   377 bits (969),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY KA+EK +RKLRG IAEK CAP+MLR+AWHSAGTFDV+T++GGP+GT+
Sbjct  1    MGKCYPTVSEEYKKAVEKAKRKLRGLIAEKNCAPIMLRLAWHSAGTFDVKTRTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  +E  HGAN GLDIAV+LLEP KEQFPI+++AD YQLAG+VAVEITGGPE+PFHPGR+
Sbjct  61   KHPSELAHGANNGLDIAVRLLEPIKEQFPILTYADFYQLAGIVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLR VF  QMGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGTDHLRTVFGHQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDN+YF ELLSGEKEGLLQLP+DKALL+DPVFRPL
Sbjct  181  TNPLIFDNTYFKELLSGEKEGLLQLPTDKALLNDPVFRPL  220



>pdb|1APX|A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
 pdb|1APX|B Chain B, Crystal Structure Of Recombinant Ascorbate Peroxidase
 pdb|1APX|C Chain C, Crystal Structure Of Recombinant Ascorbate Peroxidase
 pdb|1APX|D Chain D, Crystal Structure Of Recombinant Ascorbate Peroxidase
Length=249

 Score =   377 bits (969),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = +1

Query  136  GKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMR  315
            GKSYPTVS +Y KAIEK +RKLRGFIAEK CAPL+LR+AWHSAGTFD +TK+GGP+GT++
Sbjct  1    GKSYPTVSPDYQKAIEKAKRKLRGFIAEKKCAPLILRLAWHSAGTFDSKTKTGGPFGTIK  60

Query  316  LKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQD  495
             +AE  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVEITGGPEVPFHPGR+D
Sbjct  61   HQAELAHGANNGLDIAVRLLEPIKEQFPIVSYADFYQLAGVVAVEITGGPEVPFHPGRED  120

Query  496  NPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTR  675
             PEPP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHT+G  HKERSGFEGPWT 
Sbjct  121  KPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTIGAAHKERSGFEGPWTS  180

Query  676  NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            NPLIFDNSYFTELL+GEK+GLLQLPSDKALL+D VFRPL
Sbjct  181  NPLIFDNSYFTELLTGEKDGLLQLPSDKALLTDSVFRPL  219



>ref|NP_001237785.1| ascorbate peroxidase 1, cytosolic [Glycine max]
 gb|AAA61779.1| ascorbate peroxidase [Glycine max]
 dbj|BAC92739.1| cytosolic ascorbate peroxidase 1 [Glycine max]
Length=250

 Score =   377 bits (969),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KA+EK ++KLRGFIAEK CAPLMLR+AWHSAGTFD  TK+GGP+GT+
Sbjct  1    MGKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  H AN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   KHPAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGL+D+DIVALSGGHT+G  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  220



>gb|AAB01221.1| ascorbate peroxidase 2 [Glycine max]
Length=250

 Score =   377 bits (969),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 199/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KA+EK ++KLRGFIAEK CAPLMLR+AWHSAGT+DV +K+GGP+GT+
Sbjct  1    MGKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTYDVSSKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  +E  HGAN GLDIAV+LLEP K +FPI+++AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   KHPSELAHGANNGLDIAVRLLEPLKAEFPILTYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHT+G  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDRDIVALSGGHTIGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPVFRPL  220



>gb|AEZ00894.1| putative cytosolic ascorbate peroxidase protein [Elaeis guineensis]
Length=249

 Score =   377 bits (968),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 196/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYP VS EY KA++KC++KLRGFIAEK CAPLMLRIAWHSAGT+DV+TK+GGP+GT+
Sbjct  1    MGKSYPKVSEEYQKAVDKCKKKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  H AN GLDIAV+LLEP KEQFPIIS AD YQLAGVVAVEITGGPE+PFHPGR+
Sbjct  61   KHPAELAHEANKGLDIAVRLLEPIKEQFPIISCADFYQLAGVVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLPNA KG DHLRDVF   MGLSD+DIVALSGGHTLGRCH ERSGFEG WT
Sbjct  121  DKPEPPEEGRLPNATKGADHLRDVF-GHMGLSDQDIVALSGGHTLGRCHMERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL+DPVFRPL
Sbjct  180  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLTDPVFRPL  219



>gb|ACO57439.1| cytosolic ascorbate peroxidase [Elaeis oleifera]
Length=249

 Score =   377 bits (968),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 197/220 (90%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK+YP VS EY KA++KC++KLRGFIAEK CAPLM+RIAWHSAGT+DV+TK+GGP+GT+
Sbjct  1    MGKTYPKVSEEYQKAVDKCKKKLRGFIAEKNCAPLMVRIAWHSAGTYDVKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE GH AN GLDIAV+LLEP KEQFPIIS+AD YQLAGVVAVEITGGPE+PFHPGR+
Sbjct  61   KHTAELGHEANKGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLPNA KG DHLRDVF   MGLSD+DIVALSGGHTLGRCH ERSGFEG WT
Sbjct  121  DKPEPPEEGRLPNATKGADHLRDVF-GHMGLSDQDIVALSGGHTLGRCHMERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIF NSYF ELLSGEKEGLLQLPSDKALL+DPVFRPL
Sbjct  180  SNPLIFHNSYFKELLSGEKEGLLQLPSDKALLTDPVFRPL  219



>ref|XP_009409550.1| PREDICTED: L-ascorbate peroxidase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=249

 Score =   377 bits (968),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 198/220 (90%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYP VS EYLKA+EK +RKLRGFIAEK CAPLMLR+AWHSAGT+DV +K+GGP+GT+
Sbjct  1    MGKSYPVVSDEYLKAVEKAKRKLRGFIAEKNCAPLMLRLAWHSAGTYDVVSKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R +AE  HGAN GLDIAV+LLEP K QFPI+++AD YQLAGVVAVEITGGPE+PFHPGR+
Sbjct  61   RNQAELAHGANNGLDIAVRLLEPIKAQFPILTYADFYQLAGVVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG DHLRDVF   MGLSD+DIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKPEPPVEGRLPDATKGCDHLRDVF-GHMGLSDQDIVALSGGHTLGRCHKERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF EL+SGEKEGLLQLPSDKALL+DPVFRP 
Sbjct  180  PNPLIFDNSYFQELVSGEKEGLLQLPSDKALLTDPVFRPF  219



>gb|ABK32072.1| ascorbate peroxidase [Acanthus ebracteatus]
Length=250

 Score =   377 bits (968),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EYL A++K ++KLRGFIAEK CAPLMLR+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MVKNYPVVSEEYLIAVDKAKKKLRGFIAEKNCAPLMLRLAWHSAGTFDQCSRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R KAEQ H AN G+DIA++LLEP KEQFPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR 
Sbjct  61   RFKAEQAHSANNGIDIAIRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP+EGRLP+A KG+DHLRDVF+KQMGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKEEPPVEGRLPDAYKGSDHLRDVFIKQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF EL+ GE++GLLQLPSDKALL+DPVF PL
Sbjct  181  ENPLIFDNSYFKELVCGERDGLLQLPSDKALLADPVFHPL  220



>gb|AEI98602.1| ascorbate peroxidase [Eleusine coracana]
Length=250

 Score =   377 bits (968),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 197/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP+VSAEY + +EK RRKLR  IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GTM
Sbjct  1    MAKNYPSVSAEYQETVEKARRKLRALIAEKSCAPLMLRLAWHSAGTFDVSTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AEQ HGAN GLDIAV++LEP KE+FP +S+ DLYQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   KNPAEQAHGANAGLDIAVRMLEPIKEEFPTLSYGDLYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF KQMGLSD+DIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGTDHLRQVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            RNPL+FD+SYF ELLSG+KEGLLQLPSDKALL+DPVFRPL
Sbjct  181  RNPLVFDHSYFKELLSGDKEGLLQLPSDKALLNDPVFRPL  220



>ref|XP_010920944.1| PREDICTED: L-ascorbate peroxidase, cytosolic [Elaeis guineensis]
Length=249

 Score =   377 bits (967),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/220 (82%), Positives = 196/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYP VS EY KA++KC++KLRGFIAEK CAPLMLRIAWHSAGT+DV+TK+GGP+GT+
Sbjct  1    MGKSYPKVSEEYQKAVDKCKKKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  H AN GLDIAV+LLEP KEQFPIIS AD YQLAGVVAVEITGGPE+PFHPGR+
Sbjct  61   KHPAELAHEANKGLDIAVRLLEPIKEQFPIISCADFYQLAGVVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLPNA KG DHLRDVF   MGLSD+DIVALSGGHTLGRCH ERSGFEG WT
Sbjct  121  DKPEPPEEGRLPNATKGADHLRDVF-GHMGLSDQDIVALSGGHTLGRCHVERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL+DPVFRPL
Sbjct  180  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLTDPVFRPL  219



>ref|XP_009399887.1| PREDICTED: L-ascorbate peroxidase, cytosolic [Musa acuminata 
subsp. malaccensis]
 gb|AIP90106.1| ascorbate peroxidase 3 [Musa AB Group]
Length=249

 Score =   377 bits (967),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 197/220 (90%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M KSYPTVS EY KA+EK +RKLRG IAEK CAPLMLR+AWHSAGT+DV +K+GGP+GTM
Sbjct  1    MAKSYPTVSEEYQKAVEKAKRKLRGLIAEKNCAPLMLRLAWHSAGTYDVVSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AE  HGAN GL+IAV+LLEP KEQFPI+++AD YQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFPAELAHGANNGLNIAVRLLEPIKEQFPILTYADFYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG+DHLRDVF   MGLSD+DIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKPEPPVEGRLPDATKGSDHLRDVF-GHMGLSDQDIVALSGGHTLGRCHKERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKE LLQLPSDKALL+DPVFRPL
Sbjct  180  SNPLIFDNSYFKELLSGEKEDLLQLPSDKALLTDPVFRPL  219



>gb|AEG80145.1| cytosolic ascorbate peroxidase [Aeluropus littoralis]
Length=250

 Score =   377 bits (967),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 197/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YP+VSAEY + +EK R KLR  IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GTM
Sbjct  1    MVKGYPSVSAEYQETVEKARCKLRVLIAEKSCAPLMLRLAWHSAGTFDVSTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AEQ HGAN GLDIAV++LEP KE+FPI+S+ADLYQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   KNPAEQAHGANAGLDIAVRMLEPVKEEFPILSYADLYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VFVKQMGLSD+DIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGTDHLRQVFVKQMGLSDQDIVALSGGHTLGRCHKERSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            RNPL+FDNSYF ELLSG+KE LLQLPSDKALL+DPVFRPL
Sbjct  181  RNPLVFDNSYFKELLSGDKEDLLQLPSDKALLNDPVFRPL  220



>ref|XP_002468053.1| hypothetical protein SORBIDRAFT_01g038760 [Sorghum bicolor]
 gb|EER95051.1| hypothetical protein SORBIDRAFT_01g038760 [Sorghum bicolor]
Length=250

 Score =   376 bits (966),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 197/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M KSYPTVSAEY +A+EK R+KLR  IAEK CAPLMLR+AWHSAGTFDV +++GGP+GTM
Sbjct  1    MAKSYPTVSAEYSEAVEKARQKLRALIAEKSCAPLMLRLAWHSAGTFDVSSRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN GLDIAV+LLEP KE+FPI+S+AD YQLAGVVAVE+TGGP++PFHPGR+
Sbjct  61   KNPAELAHGANAGLDIAVRLLEPIKEEFPILSYADFYQLAGVVAVEVTGGPQIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG+DHLR VF KQMGLSD+DIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPL+FDNSYF ELLSG+KEGLLQLPSDKALLSDP FRPL
Sbjct  181  SNPLVFDNSYFKELLSGDKEGLLQLPSDKALLSDPAFRPL  220



>gb|AIP90104.1| ascorbate peroxidase [Musa AB Group]
Length=249

 Score =   376 bits (966),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 198/220 (90%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYP VS EYLKA+EK +RKLRGFIAEK CAPLMLR+AWHSAGT+DV +K+GGP+GT+
Sbjct  1    MGKSYPVVSDEYLKAVEKAKRKLRGFIAEKNCAPLMLRLAWHSAGTYDVVSKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R + E  HGAN GLDIAV+LLEP K QFPI+++AD YQLAGVVAVEITGGPE+PFHPGR+
Sbjct  61   RNQVELAHGANNGLDIAVRLLEPIKAQFPILTYADFYQLAGVVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP+EGRLP+A KG DHLRDVF   MGLSD+DIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKPEPPVEGRLPDATKGCDHLRDVF-GHMGLSDQDIVALSGGHTLGRCHKERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF EL+SGEKEGLLQLPSDKALL+DPVFRPL
Sbjct  180  PNPLIFDNSYFKELVSGEKEGLLQLPSDKALLTDPVFRPL  219



>gb|ACG41151.1| APx2 - Cytosolic Ascorbate Peroxidase [Zea mays]
Length=250

 Score =   376 bits (966),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 197/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTV+ +YLKA++K +RKLRG IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GTM
Sbjct  1    MVKAYPTVNEDYLKAVDKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVATKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AEQ HGAN GL+IA++LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP+VPFHPGRQ
Sbjct  61   KNPAEQAHGANAGLEIAIRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDVPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PE P EGRLP+A +G+DHLR VF  QMGLSD+DIVALSGGHTLGRCHK+RSGFEG WT
Sbjct  121  DKPEAPPEGRLPDATQGSDHLRQVFSTQMGLSDQDIVALSGGHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDP FRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPSFRPL  220



>ref|XP_006488195.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic-like isoform X1 
[Citrus sinensis]
 ref|XP_006488196.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic-like isoform X2 
[Citrus sinensis]
 gb|ACM17464.1| ascorbate peroxidase 2 [Citrus maxima]
 gb|KDO73090.1| hypothetical protein CISIN_1g024615mg [Citrus sinensis]
 gb|KDO73091.1| hypothetical protein CISIN_1g024615mg [Citrus sinensis]
 gb|KDO73092.1| hypothetical protein CISIN_1g024615mg [Citrus sinensis]
 gb|KDO73093.1| hypothetical protein CISIN_1g024615mg [Citrus sinensis]
Length=250

 Score =   376 bits (966),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 184/220 (84%), Positives = 201/220 (91%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +Y KA+EKC+RKLRGFIAEK CAPLMLRIAWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            RL AEQ H AN GLDIAV+LLEPFKEQFP IS+ADLYQLAGVV VE+TGGP++PFHPGR 
Sbjct  61   RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+A +GNDHLR VF  QMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            RNPLIFDNSYFTELL+GEK+GLLQLPSDKALL DPVFRPL
Sbjct  181  RNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPL  220



>emb|CAN59923.1| hypothetical protein VITISV_005618 [Vitis vinifera]
Length=253

 Score =   376 bits (965),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 195/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK+YP VS EY KA+EKC+RKLRGFIAEK CAPLMLR+AWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MGKAYPIVSEEYQKAVEKCKRKLRGFIAEKKCAPLMLRLAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +   E  H AN GLDIAV+LLEP KEQFPI+S+ D YQLAGVVAVE+TGGPE+PFHPGRQ
Sbjct  61   KHPEELAHEANNGLDIAVRLLEPIKEQFPILSYGDFYQLAGVVAVEVTGGPEIPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLPNA KG+DHLRDVF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKSEPPPEGRLPNATKGSDHLRDVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGL+ LPSDKALL DPVFRPL
Sbjct  180  TNPLIFDNSYFKELLSGEKEGLIXLPSDKALLEDPVFRPL  219



>gb|AAC08576.1| ascorbate peroxidase [Zantedeschia aethiopica]
Length=250

 Score =   375 bits (964),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 194/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYP VS EY  A+ K +RKLR  IAEK CAPLMLR+AWHSAGT+DV T++GGP+GTM
Sbjct  1    MGKSYPAVSEEYQTAVGKAKRKLRALIAEKNCAPLMLRLAWHSAGTYDVSTRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R +AE  HGAN G+DIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFQAELAHGANNGIDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P PP+EGRLP+A KG+DHLR VF +QMGL+D+DIVALSG HTLGRCHKERSGFEG WT
Sbjct  121  DKPAPPVEGRLPDATKGSDHLRQVFSQQMGLNDQDIVALSGAHTLGRCHKERSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKE LLQLPSDKALLSDPVFRPL
Sbjct  181  TNPLIFDNSYFKELLSGEKEDLLQLPSDKALLSDPVFRPL  220



>gb|ACN25039.1| ascorbate peroxidase [Doritis pulcherrima x Phalaenopsis hybrid 
cultivar]
Length=249

 Score =   375 bits (964),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 198/220 (90%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M KSYPTVS E+LKA++KCR+KLRGFIAEK CAPLMLR+AWHSAGT+DV+T++GGP+GT+
Sbjct  1    MVKSYPTVSEEHLKAVDKCRKKLRGFIAEKNCAPLMLRLAWHSAGTYDVKTRTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GL IAV LLEP KEQFPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   RQPDELAHGANNGLSIAVGLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLR+VF   MGLSD+DIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKPEPPEEGRLPDATKGSDHLREVF-GHMGLSDQDIVALSGGHTLGRCHKERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELLSGEKEGL+QLPSDKALLSDPVFRP 
Sbjct  180  SNPLIFDNSYFTELLSGEKEGLIQLPSDKALLSDPVFRPF  219



>ref|XP_006424675.1| hypothetical protein CICLE_v10030198mg, partial [Citrus clementina]
 gb|ESR37915.1| hypothetical protein CICLE_v10030198mg, partial [Citrus clementina]
Length=285

 Score =   377 bits (967),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 184/220 (84%), Positives = 201/220 (91%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +Y KA+EKC+RKLRGFIAEK CAPLMLRIAWHSAGT+DV+TK+GGP+GTM
Sbjct  36   MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM  95

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            RL AEQ H AN GLDIAV+LLEPFKEQFP IS+ADLYQLAGVV VE+TGGP++PFHPGR 
Sbjct  96   RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD  155

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+A +GNDHLR VF  QMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  156  DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  215

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            RNPLIFDNSYFTELL+GEK+GLLQLPSDKALL DPVFRPL
Sbjct  216  RNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPL  255



>gb|KHN05706.1| L-ascorbate peroxidase, cytosolic [Glycine soja]
Length=250

 Score =   375 bits (963),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KA+EK ++KL GFIAEK CAPLMLR+AWHSAGT+DV +K+GGP+GT+
Sbjct  1    MGKSYPTVSADYQKAVEKAKKKLIGFIAEKRCAPLMLRLAWHSAGTYDVSSKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  +E  HGAN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   KHPSELAHGANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHT+G  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDRDIVALSGGHTIGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPVFRPL  220



>gb|KHN22028.1| L-ascorbate peroxidase, cytosolic [Glycine soja]
Length=250

 Score =   375 bits (963),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 197/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KA+EK ++KLRG IAEK CAPLMLR+AWHSAGTFD  TK+GGP+GT+
Sbjct  1    MGKSYPTVSADYQKAVEKAKKKLRGIIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  H AN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   KHPAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGL+D+DIVALSGGHT+G  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  220



>ref|NP_001105500.1| ascorbate peroxidase2 [Zea mays]
 emb|CAA84406.1| cytosolic ascorbate peroxidase [Zea mays]
 prf||2111423A ascorbate peroxidase
Length=250

 Score =   375 bits (963),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 196/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTV+ +YLKA++K +RKLRG IAEK CAPLMLR+AWHS GTFDV TK+GGP+GTM
Sbjct  1    MVKAYPTVNEDYLKAVDKAKRKLRGLIAEKNCAPLMLRLAWHSVGTFDVVTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +   EQ HGAN GL+IA++LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP+VPFHPGRQ
Sbjct  61   KNPVEQAHGANAGLEIAIRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDVPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A +G+DHLR VF  QMGLSD+DIVALSGGHTLGRCHK+RSGFEG WT
Sbjct  121  DKPEPPPEGRLPDATQGSDHLRQVFSTQMGLSDQDIVALSGGHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDP FRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPSFRPL  220



>gb|AAA99518.1| ascorbate peroxidase [Spinacia oleracea]
 dbj|BAA12890.1| cytosolic ascorbate peroxidase [Spinacia oleracea]
Length=250

 Score =   375 bits (963),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 195/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS  Y K+IEK RRKLRG IAEK CAPLMLR+AWHSAGTFD  +K+GGP+GTM
Sbjct  1    MGKSYPTVSENYQKSIEKARRKLRGLIAEKQCAPLMLRLAWHSAGTFDCTSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            + +AE  HGAN GL IAV+LLEP KEQFP I++AD YQLA  VAVE+TGGPEVPFHPGR+
Sbjct  61   KHQAELAHGANNGLVIAVRLLEPIKEQFPEITYADFYQLAEFVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLRDVF+KQMGL+D+DIVALSGGHTLGRCHK+RSGFEG WT
Sbjct  121  DKPEPPQEGRLPDATKGCDHLRDVFIKQMGLTDQDIVALSGGHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPL+FDN+YF ELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  TNPLVFDNTYFKELLSGEKEGLLQLPSDKALLSDPVFRPL  220



>gb|ACO90193.1| ascorbate peroxidase [Cucumis sativus]
Length=249

 Score =   375 bits (962),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 195/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YP VS EY KAIEK +RKLRGFIAEK CAPLMLR+AWHSAGTF   +K+GGP+GTM
Sbjct  1    MGKCYPVVSEEYQKAIEKAKRKLRGFIAEKNCAPLMLRLAWHSAGTFCKDSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R K+E  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   RFKSELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF   MGLSD+DIVALSGGHTLGR HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFY-TMGLSDQDIVALSGGHTLGRAHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFD SYFTELL+GEKEGLLQL SDKALLSDPVFRPL
Sbjct  180  TNPLIFDKSYFTELLTGEKEGLLQLASDKALLSDPVFRPL  219



>ref|XP_010907515.1| PREDICTED: L-ascorbate peroxidase, cytosolic-like [Elaeis guineensis]
Length=249

 Score =   375 bits (962),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 195/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYP VS EY KA++KC++K RGFIAEK CAPLMLRIAWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MGKSYPKVSEEYQKAVDKCKKKFRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +   E  HGAN GLDIAV+LL+P KEQFPI+S+ D YQLAGVVAVEITGGPE+PFHPGR+
Sbjct  61   KFPTELAHGANNGLDIAVRLLDPIKEQFPILSYGDFYQLAGVVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+A KG+DHLRDVF   MGLSD+DIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKSEPPEEGRLPDATKGSDHLRDVF-GHMGLSDQDIVALSGGHTLGRCHKERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL+DPVFR L
Sbjct  180  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLTDPVFRSL  219



>ref|XP_002889670.1| hypothetical protein ARALYDRAFT_470824 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65929.1| hypothetical protein ARALYDRAFT_470824 [Arabidopsis lyrata subsp. 
lyrata]
Length=250

 Score =   375 bits (962),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 195/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +Y KAIEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD Q+++GGP+GTM
Sbjct  1    MTKNYPTVSEDYKKAIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN+GL IA++LL+P +EQFP IS AD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFDAEQAHGANSGLHIALRLLDPIREQFPTISFADFHQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLRDVF KQMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPL  220



>gb|ACU15299.1| unknown [Glycine max]
Length=255

 Score =   375 bits (962),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 197/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KA+EK ++KLRGFIAEK CAPLMLR+AWHSAGTFD  TK+GGP+GT+
Sbjct  1    MGKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  H AN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+ GGPEVPFHPGR+
Sbjct  61   KHPAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVAGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGL+D+DIVALSGGHT+G  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  220



>pdb|2XIF|A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii
 pdb|2XIH|A Chain A, The Structure Of Ascorbate Peroxidase Compound Iii
 pdb|2XI6|A Chain A, The Structure Of Ascorbate Peroxidase Compound I
 pdb|2XJ6|A Chain A, The Structure Of Ferrous Ascorbate Peroxidase
Length=249

 Score =   375 bits (962),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 197/219 (90%), Gaps = 0/219 (0%)
 Frame = +1

Query  136  GKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMR  315
            GKSYPTVSA+Y KA+EK ++KLRGFIAEK CAPLMLR+AWHSAGTFD  TK+GGP+GT++
Sbjct  1    GKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTIK  60

Query  316  LKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQD  495
              AE  H AN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+D
Sbjct  61   HPAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRED  120

Query  496  NPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTR  675
             PEPP EGRLP+A KG+DHLRDVF K MGL+D+DIVALSGGHT+G  HKERSGFEGPWT 
Sbjct  121  KPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWTS  180

Query  676  NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  219



>gb|ACU19647.1| unknown [Glycine max]
Length=250

 Score =   374 bits (961),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KA+EK ++KLRGFIAEK CAPLMLR+AWHSAGT+DV +K+GGP+GT+
Sbjct  1    MGKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTYDVSSKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  +E  HGAN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   KHPSELAHGANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHT+G  HKERSG EGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDRDIVALSGGHTIGAAHKERSGSEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPVFRPL  220



>gb|EMS61931.1| L-ascorbate peroxidase 1, cytosolic [Triticum urartu]
 gb|EMT33286.1| L-ascorbate peroxidase 1, cytosolic [Aegilops tauschii]
Length=250

 Score =   374 bits (961),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 196/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VSAEY +A+EK R+KLR  IAEK C+PLMLR+AWHSAGTFDV +K+GGP+GTM
Sbjct  1    MAKTYPVVSAEYQEAVEKARQKLRALIAEKNCSPLMLRLAWHSAGTFDVSSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AEQ H AN GLDIAV++LEP KE+ P IS+ADLYQLAGVVAVE++GGP +PFHPGR+
Sbjct  61   KKPAEQAHAANAGLDIAVRMLEPIKEEIPTISYADLYQLAGVVAVEVSGGPVIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG+DHLR VF KQMGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPQPPPEGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            RNPL FDNSYFTELLSG+KEGLLQLPSDK LL+DPVFRPL
Sbjct  181  RNPLKFDNSYFTELLSGDKEGLLQLPSDKTLLTDPVFRPL  220



>ref|XP_009358268.1| PREDICTED: L-ascorbate peroxidase, cytosolic-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009358269.1| PREDICTED: L-ascorbate peroxidase, cytosolic-like isoform X2 
[Pyrus x bretschneideri]
Length=250

 Score =   374 bits (961),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY  AI+K RRKLRG IAEK CAP+MLRIAWHSAGT+D +TK+GGP+GTM
Sbjct  1    MGKCYPTVSEEYKTAIDKARRKLRGLIAEKNCAPIMLRIAWHSAGTYDTKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN GLDIAV+LLEP K+QFPI+S+AD YQLAGVVAVEITGGP+VPFHPGR 
Sbjct  61   RCPAEQAHGANNGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEITGGPDVPFHPGRT  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLRDVF K MGLSDKDIV LSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DAPKPPPEGRLPDATKGTDHLRDVFCKTMGLSDKDIVTLSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF  LL G++EGLL LP+DKALL DPVFRPL
Sbjct  181  PNPLIFDNSYFKVLLGGDQEGLLMLPTDKALLDDPVFRPL  220



>ref|XP_006361765.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic-like isoform X1 
[Solanum tuberosum]
Length=250

 Score =   374 bits (961),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 197/220 (90%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS EY KA+EKC+RKLRG IAEK CAP++LR+AWHSAGT+DV+TK+GGP+GT+
Sbjct  1    MVKCYPTVSGEYQKAVEKCKRKLRGLIAEKNCAPIILRLAWHSAGTYDVKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP++PFHPGRQ
Sbjct  61   RHPDELKHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDIPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+ANKG+DHLR+VF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKTEPPPEGRLPDANKGSDHLREVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  180  NNPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPL  219



>pdb|2Y6B|A Chain A, Ascorbate Peroxidase R38k Mutant
Length=249

 Score =   374 bits (960),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 197/219 (90%), Gaps = 0/219 (0%)
 Frame = +1

Query  136  GKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMR  315
            GKSYPTVSA+Y KA+EK ++KLRGFIAEK CAPLML++AWHSAGTFD  TK+GGP+GT++
Sbjct  1    GKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLKLAWHSAGTFDKGTKTGGPFGTIK  60

Query  316  LKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQD  495
              AE  H AN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+D
Sbjct  61   HPAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRED  120

Query  496  NPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTR  675
             PEPP EGRLP+A KG+DHLRDVF K MGL+D+DIVALSGGHT+G  HKERSGFEGPWT 
Sbjct  121  KPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWTS  180

Query  676  NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  219



>gb|AFN21427.1| ascorbate peroxidase [Macrotyloma uniflorum]
Length=250

 Score =   374 bits (960),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KA+EK +++LRGFIAEK CAPLMLR+AWHSAGT+DV TK+GGP+GT+
Sbjct  1    MGKSYPTVSADYQKAVEKAKKRLRGFIAEKRCAPLMLRLAWHSAGTYDVSTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  +E  HGAN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   KHPSELAHGANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P PP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHTLG  HKERSGFEGPWT
Sbjct  121  DKPHPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTLGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSG+KEGLL+LPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGDKEGLLKLPSDKALLSDPVFRPL  220



>gb|AFN21424.1| ascorbate peroxidase [Macrotyloma uniflorum]
 gb|AFN21425.1| ascorbate peroxidase [Macrotyloma uniflorum]
 gb|AFN21426.1| ascorbate peroxidase [Macrotyloma uniflorum]
Length=250

 Score =   374 bits (960),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KA+EK +++LRGFIAEK CAPLMLR+AWHSAGT+DV TK+GGP+GT+
Sbjct  1    MGKSYPTVSADYQKAVEKAKKRLRGFIAEKRCAPLMLRLAWHSAGTYDVSTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  +E  HGAN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   KHPSELAHGANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P PP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHTLG  HKERSGFEGPWT
Sbjct  121  DKPHPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTLGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSG+KEGLL+LPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGDKEGLLKLPSDKALLSDPVFRPL  220



>gb|ACO90196.1| ascorbate peroxidase [Triticum aestivum]
Length=243

 Score =   374 bits (959),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 191/213 (90%), Gaps = 0/213 (0%)
 Frame = +1

Query  154  VSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMRLKAEQG  333
            VS EYL A+ K RRKLRG IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GTM+  AE  
Sbjct  1    VSDEYLAAVAKARRKLRGLIAEKNCAPLMLRLAWHSAGTFDVATKTGGPFGTMKCPAELA  60

Query  334  HGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQDNPEPPL  513
            HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGPEVPFHPGRQD PEPP 
Sbjct  61   HGANAGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRQDKPEPPP  120

Query  514  EGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFD  693
            EGRLP+A +G+DHLR VF  QMGLSD+DIVALSGGHTLGRCHKERSGFEGPWTRNPL FD
Sbjct  121  EGRLPDATQGSDHLRQVFSTQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWTRNPLKFD  180

Query  694  NSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            NSYFTELLSG+KEGLLQLPSDK LL+DPVFRPL
Sbjct  181  NSYFTELLSGDKEGLLQLPSDKTLLTDPVFRPL  213



>ref|XP_006361766.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic-like isoform X2 
[Solanum tuberosum]
Length=245

 Score =   374 bits (959),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 197/220 (90%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS EY KA+EKC+RKLRG IAEK CAP++LR+AWHSAGT+DV+TK+GGP+GT+
Sbjct  1    MVKCYPTVSGEYQKAVEKCKRKLRGLIAEKNCAPIILRLAWHSAGTYDVKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP++PFHPGRQ
Sbjct  61   RHPDELKHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDIPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+ANKG+DHLR+VF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKTEPPPEGRLPDANKGSDHLREVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  180  NNPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPL  219



>ref|NP_001267635.1| L-ascorbate peroxidase, cytosolic-like [Cucumis sativus]
 dbj|BAA13671.1| cytosolic ascorbate peroxidase [Cucumis sativus]
 gb|KGN65655.1| hypothetical protein Csa_1G479610 [Cucumis sativus]
Length=249

 Score =   374 bits (959),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 195/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YP VS EY KAIEK +RKLRGFIAEK CAPLMLR+AWHSAGTF   +K+GGP+GTM
Sbjct  1    MGKCYPVVSEEYQKAIEKAKRKLRGFIAEKNCAPLMLRLAWHSAGTFCKDSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R K+E  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFKSELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF   MGLSD+DIVALSGGHTLGR HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFY-TMGLSDQDIVALSGGHTLGRAHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFD SYFTELL+GEKEGLLQL SDKALLSDPVFRPL
Sbjct  180  TNPLIFDKSYFTELLTGEKEGLLQLASDKALLSDPVFRPL  219



>ref|NP_172267.1| L-ascorbate peroxidase 1 [Arabidopsis thaliana]
 ref|NP_849607.1| L-ascorbate peroxidase 1 [Arabidopsis thaliana]
 ref|NP_973786.1| L-ascorbate peroxidase 1 [Arabidopsis thaliana]
 ref|NP_001030991.2| L-ascorbate peroxidase 1 [Arabidopsis thaliana]
 ref|NP_001030992.2| L-ascorbate peroxidase 1 [Arabidopsis thaliana]
 ref|NP_001077482.1| L-ascorbate peroxidase 1 [Arabidopsis thaliana]
 ref|NP_001117244.1| L-ascorbate peroxidase 1 [Arabidopsis thaliana]
 sp|Q05431.2|APX1_ARATH RecName: Full=L-ascorbate peroxidase 1, cytosolic; Short=AP; 
Short=AtAPx01 [Arabidopsis thaliana]
 gb|AAF75066.1|AC007583_2 Strong similarity to L-ascorbate peroxidase from Arabidopsis 
thaliana gi|728873. ESTs gb|T04087, gb|H37385,gb|H36515 and 
gb|R90494 come from this gene [Arabidopsis thaliana]
 emb|CAA42168.1| L-ascorbate peroxidase [Arabidopsis thaliana]
 dbj|BAA03334.1| ascorbate peroxidase [Arabidopsis thaliana]
 gb|AAB07880.1| ascorbate peroxidase [Arabidopsis thaliana]
 gb|AAK63983.1| At1g07890/F24B9_2 [Arabidopsis thaliana]
 gb|AAL08251.1| At1g07890/F24B9_2 [Arabidopsis thaliana]
 gb|AAM16263.1| At1g07890/F24B9_2 [Arabidopsis thaliana]
 gb|AAM63427.1| L-ascorbate peroxidase [Arabidopsis thaliana]
 dbj|BAF01915.1| L-ascorbate peroxidase [Arabidopsis thaliana]
 gb|AEE28200.1| L-ascorbate peroxidase 1 [Arabidopsis thaliana]
 gb|AEE28201.1| L-ascorbate peroxidase 1 [Arabidopsis thaliana]
 gb|AEE28202.1| L-ascorbate peroxidase 1 [Arabidopsis thaliana]
 gb|AEE28203.1| L-ascorbate peroxidase 1 [Arabidopsis thaliana]
 gb|AEE28204.1| L-ascorbate peroxidase 1 [Arabidopsis thaliana]
 gb|AEE28206.1| L-ascorbate peroxidase 1 [Arabidopsis thaliana]
 gb|AEE28207.1| L-ascorbate peroxidase 1 [Arabidopsis thaliana]
Length=250

 Score =   374 bits (959),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 195/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +Y KA+EKCRRKLRG IAEK CAP+M+R+AWHSAGTFD Q+++GGP+GTM
Sbjct  1    MTKNYPTVSEDYKKAVEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN+G+ IA++LL+P +EQFP IS AD +QLAGVVAVE+TGGP++PFHPGR+
Sbjct  61   RFDAEQAHGANSGIHIALRLLDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLRDVF KQMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPL  220



>gb|AAK57005.1|AF378131_1 ascorbate peroxidase [Zantedeschia aethiopica]
Length=250

 Score =   374 bits (959),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 196/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYP VS EY KA++K ++KLRG IAEK CAPLMLR+AWHSAGTFDV TKSGGP+GTM
Sbjct  1    MGKSYPAVSEEYQKAVDKAKKKLRGLIAEKNCAPLMLRLAWHSAGTFDVCTKSGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            RL  E GHGAN GLDIA++LLEP KEQFPI+S+AD YQLAGVVAVEITGGPE+P +PGR+
Sbjct  61   RLAEELGHGANNGLDIAIRLLEPIKEQFPILSYADFYQLAGVVAVEITGGPEIPLNPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P PP EGRLP+A KG+DHLR VF +QMGL D+DIVALSGGHTLGR H+ERSGFEG WT
Sbjct  121  DKPVPPPEGRLPDATKGSDHLRQVFGQQMGLCDQDIVALSGGHTLGRAHRERSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELL+GEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFTELLTGEKEGLLQLPSDKALLSDPVFRPL  220



>gb|ACJ38537.1| ascorbate peroxidase [Oncidium hybrid cultivar]
Length=249

 Score =   374 bits (959),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 197/220 (90%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M KSYP VS EYLKA+EKCRRKLRGFIAEK CAP++LR+AWHSAGT+DV TK+GGP+GT+
Sbjct  1    MVKSYPKVSEEYLKAVEKCRRKLRGFIAEKNCAPIILRLAWHSAGTYDVNTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GLDIA++LLEP KE+FPI+S+AD YQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RHPDELAHGANNGLDIAIRLLEPIKEKFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  E P EGRLP+A KG+DHLRDVF   MGLSD+DIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKSESPEEGRLPDATKGSDHLRDVF-GHMGLSDQDIVALSGGHTLGRCHKERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELL+GEKEGLLQLPSDKALLSDPVFRPL
Sbjct  180  PNPLIFDNSYFTELLTGEKEGLLQLPSDKALLSDPVFRPL  219



>gb|AAN60070.1| cytosolic ascorbate peroxidase [Retama raetam]
Length=220

 Score =   372 bits (956),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS +Y KA+EK ++KLRGFIAEK CAPL+LR+AWHSAGTFDV+TK+GGP+GT+
Sbjct  1    MGKSYPTVSGDYQKAVEKAKKKLRGFIAEKSCAPLILRLAWHSAGTFDVKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN GLDIAV+LLEP KEQFPI+S+AD YQL GVVAVEITGGPEVPFHPGR+
Sbjct  61   KNPAELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLGGVVAVEITGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHT+G  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTIGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVF  783
             NPLIFDNSYFTELLSGEKEGLL+LPSD ALLSDPVF
Sbjct  181  SNPLIFDNSYFTELLSGEKEGLLKLPSDTALLSDPVF  217



>gb|ACV50426.1| cytosolic ascorbate peroxidase-1 [Jatropha curcas]
 gb|KDP44134.1| hypothetical protein JCGZ_05601 [Jatropha curcas]
Length=250

 Score =   374 bits (959),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EY KA++K +RKLRG IAEK CAP+MLR+AWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MAKNYPKVSEEYQKAVDKAKRKLRGVIAEKNCAPIMLRLAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AE  H ANTGLDIA+++++P KEQFPI+S+AD YQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RHSAELAHAANTGLDIALRIIDPIKEQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP AN+G+DHLR VF +QMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPGANEGSDHLRVVFGEQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEK+GLLQL +DKALLSDPVFRPL
Sbjct  181  TNPLIFDNSYFKELLSGEKDGLLQLQTDKALLSDPVFRPL  220



>dbj|BAC92738.1| cytosolic ascorbate peroxidase 1 [Glycine max]
Length=257

 Score =   374 bits (959),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 197/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVSA+Y KA+EK ++KLRG IAEK CAPLMLR+AWHSAGTFD  TK+GGP+GT+
Sbjct  1    MGKSYPTVSADYQKAVEKAKKKLRGIIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  H AN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   KHPAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGL+D+DIVALSGGHT+G  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  220



>gb|KDO73089.1| hypothetical protein CISIN_1g024615mg [Citrus sinensis]
Length=250

 Score =   374 bits (959),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/220 (83%), Positives = 200/220 (91%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +Y KA+EKC+RKLRGFIAEK CAPLMLRIAWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            RL AEQ H AN GLDIAV+LLEPFKEQFP IS+ADLYQLAGVV VE+TGGP++PFHPGR 
Sbjct  61   RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+A +GNDHLR VF  QMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            RNPLIFDNSYFT LL+GEK+GLLQLPSDKALL DPVFRPL
Sbjct  181  RNPLIFDNSYFTYLLTGEKDGLLQLPSDKALLDDPVFRPL  220



>ref|XP_008344846.1| PREDICTED: L-ascorbate peroxidase, cytosolic-like [Malus domestica]
Length=250

 Score =   373 bits (958),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY  A++K RRKLRG IAEK CAPLMLRIAWHSAGT+D +TK+GGP+GTM
Sbjct  1    MGKCYPTVSEEYKTAVDKARRKLRGLIAEKNCAPLMLRIAWHSAGTYDTKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN GL+IAV+LLEP K+QFPI+S+AD YQLAGVVAVEITGGP+VPFHPGR 
Sbjct  61   RCPAEQAHGANNGLEIAVRLLEPIKQQFPILSYADFYQLAGVVAVEITGGPDVPFHPGRT  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P PP EGRLP+A KGNDHLRDVF K MGLSDKDIV LSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DAPVPPPEGRLPDATKGNDHLRDVFCKXMGLSDKDIVTLSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF  LL G++EGLL LP+DKALL DPVFRPL
Sbjct  181  PNPLIFDNSYFKVLLGGDQEGLLMLPTDKALLDDPVFRPL  220



>pdb|2Y6A|A Chain A, Ascorbate Peroxidase R38a Mutant
Length=249

 Score =   373 bits (958),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 196/219 (89%), Gaps = 0/219 (0%)
 Frame = +1

Query  136  GKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMR  315
            GKSYPTVSA+Y KA+EK ++KLRGFIAEK CAPLML +AWHSAGTFD  TK+GGP+GT++
Sbjct  1    GKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLALAWHSAGTFDKGTKTGGPFGTIK  60

Query  316  LKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQD  495
              AE  H AN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+D
Sbjct  61   HPAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRED  120

Query  496  NPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTR  675
             PEPP EGRLP+A KG+DHLRDVF K MGL+D+DIVALSGGHT+G  HKERSGFEGPWT 
Sbjct  121  KPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWTS  180

Query  676  NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  219



>ref|NP_001077481.1| L-ascorbate peroxidase 1 [Arabidopsis thaliana]
 gb|AEE28205.1| L-ascorbate peroxidase 1 [Arabidopsis thaliana]
Length=249

 Score =   373 bits (958),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 195/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +Y KA+EKCRRKLRG IAEK CAP+M+R+AWHSAGTFD Q+++GGP+GTM
Sbjct  1    MTKNYPTVSEDYKKAVEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN+G+ IA++LL+P +EQFP IS AD +QLAGVVAVE+TGGP++PFHPGR+
Sbjct  61   RFDAEQAHGANSGIHIALRLLDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLRDVF KQMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPL  220



>ref|XP_006417755.1| hypothetical protein EUTSA_v10008402mg [Eutrema salsugineum]
 dbj|BAJ33866.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36108.1| hypothetical protein EUTSA_v10008402mg [Eutrema salsugineum]
Length=250

 Score =   373 bits (957),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 194/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +YLKAIEKCRRKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MTKNYPTVSEDYLKAIEKCRRKLRGMIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN+G+ +A++ LEP +EQFP IS AD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFDAEQAHGANSGIHVALRFLEPIREQFPTISFADFHQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLRDVF KQMGL+DKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPEPPPEGRLPDATKGCDHLRDVFAKQMGLTDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL+GEKEGL+QL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLTGEKEGLIQLVSDKALLDDPVFRPL  220



>ref|NP_001060741.1| Os07g0694700 [Oryza sativa Japonica Group]
 sp|Q9FE01.1|APX2_ORYSJ RecName: Full=L-ascorbate peroxidase 2, cytosolic; AltName: Full=APXb; 
AltName: Full=OsAPx02 [Oryza sativa Japonica Group]
 dbj|BAB17666.1| ascorbate peroxidase [Oryza sativa Japonica Group]
 dbj|BAB20889.1| L-ascorbate peroxidase [Oryza sativa Japonica Group]
 dbj|BAC84063.1| ascorbate peroxidase [Oryza sativa Japonica Group]
 dbj|BAF22655.1| Os07g0694700 [Oryza sativa Japonica Group]
 dbj|BAG88062.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82743.1| hypothetical protein OsI_27453 [Oryza sativa Indica Group]
 gb|EEE67880.1| hypothetical protein OsJ_25704 [Oryza sativa Japonica Group]
 gb|ADM86869.1| ascorbate peroxidase [Oryza sativa Japonica Group]
Length=251

 Score =   373 bits (957),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 173/218 (79%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = +1

Query  139  KSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMRL  318
            KSYPTVS EYL A+ K +RKLRG IAEK CAPLMLR+AWHSAGTFDV +++GGP+GTM+ 
Sbjct  4    KSYPTVSDEYLAAVGKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVSSRTGGPFGTMKN  63

Query  319  KAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQDN  498
              EQ H AN GLDIAV+LL+P K+Q PI+S+AD YQLAGVVAVE+TGGPEVPFHPGRQD 
Sbjct  64   PGEQSHAANAGLDIAVRLLDPIKDQLPILSYADFYQLAGVVAVEVTGGPEVPFHPGRQDK  123

Query  499  PEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRN  678
            PEPP EGRLP+A +G+DHLR VF  QMGLSDKDIVALSGGHTLGRCHKERSGFEG WT N
Sbjct  124  PEPPPEGRLPDATQGSDHLRQVFSAQMGLSDKDIVALSGGHTLGRCHKERSGFEGAWTSN  183

Query  679  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            PLIFDNSYFTEL+SGEKEGLLQLPSDKAL++DP FRPL
Sbjct  184  PLIFDNSYFTELVSGEKEGLLQLPSDKALMADPAFRPL  221



>gb|KHG13785.1| L-ascorbate peroxidase 1, cytosolic [Gossypium arboreum]
Length=250

 Score =   373 bits (957),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS EY K++EK +RKLRG IAEK CAPLMLR+AWHSAGTFDV+TK+GGP+GTM
Sbjct  1    MTKCYPTVSEEYQKSVEKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +   E  H AN GLDIAV+LLEP KEQFP +++AD YQLAGVVAVEITGGPE+PFHPGR+
Sbjct  61   KHPDELAHAANNGLDIAVRLLEPIKEQFPNLTYADFYQLAGVVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P PP EGRLP+A KG+DHLR VF  QMGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPHPPPEGRLPDATKGSDHLRQVFSAQMGLSDRDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLP+DK LLSDPVFRPL
Sbjct  181  TNPLIFDNSYFKELLSGEKEGLLQLPTDKVLLSDPVFRPL  220



>ref|XP_006305338.1| hypothetical protein CARUB_v10009719mg [Capsella rubella]
 gb|EOA38236.1| hypothetical protein CARUB_v10009719mg [Capsella rubella]
Length=328

 Score =   375 bits (964),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 195/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +YLKAIEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  79   MTKNYPTVSEDYLKAIEKCKRKLRGMIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  138

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN+G+ IA++LLEP +EQFP IS AD +QLAGVVAVE+TGGP+VPFHPGR+
Sbjct  139  RFDAEQAHGANSGIHIALRLLEPIREQFPTISFADFHQLAGVVAVEVTGGPDVPFHPGRE  198

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLRDVF KQMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  199  DKPQPPPEGRLPDATKGCDHLRDVFSKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT  258

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQL SDKALL DPVFRPL
Sbjct  259  SNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPL  298



>pdb|1OAF|A Chain A, Ascobate Peroxidase From Soybean Cytosol In Complex 
With Ascorbate
 pdb|1OAG|A Chain A, Ascorbate Peroxidase From Soybean Cytosol
 pdb|1V0H|X Chain X, Ascobate Peroxidase From Soybean Cytosol In Complex 
With Salicylhydroxamic Acid
 pdb|2GHH|X Chain X, Conformational Mobility In The Active Site Of A Heme 
Peroxidase
 pdb|2GHK|X Chain X, Conformational Mobility In The Active Site Of A Heme 
Peroxidase
Length=261

 Score =   373 bits (958),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +1

Query  139  KSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMRL  318
            KSYPTVSA+Y KA+EK ++KLRGFIAEK CAPLMLR+AWHSAGTFD  TK+GGP+GT++ 
Sbjct  14   KSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTIKH  73

Query  319  KAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQDN  498
             AE  H AN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+D 
Sbjct  74   PAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDK  133

Query  499  PEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRN  678
            PEPP EGRLP+A KG+DHLRDVF K MGL+D+DIVALSGGHT+G  HKERSGFEGPWT N
Sbjct  134  PEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWTSN  193

Query  679  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  194  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  231



>ref|XP_011004154.1| PREDICTED: L-ascorbate peroxidase, cytosolic [Populus euphratica]
Length=249

 Score =   372 bits (956),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 194/220 (88%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS EY KA+EKC+RKLRG I+EK CAPLMLR+AWHSAGTFDV TK+GGP+GT+
Sbjct  1    MGKSYPTVSEEYQKAVEKCKRKLRGLISEKNCAPLMLRLAWHSAGTFDVHTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGPE+PFHPGR 
Sbjct  61   RHPDELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  +PP EGRLP+A KG+DHLRDVF   MGLSD DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKSDPPPEGRLPDATKGSDHLRDVF-GHMGLSDTDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPL+FDNSYF ELLSGEKEGL+QLPSDK LL DPVFRPL
Sbjct  180  PNPLVFDNSYFKELLSGEKEGLIQLPSDKTLLEDPVFRPL  219



>gb|AFL70595.1| ascorbate peroxidase [Anthurium andraeanum]
Length=250

 Score =   372 bits (956),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYP V  EYL+A++K ++KLRG IA K CAPLMLR+AWHSAGTFDV T++GGP+GTM
Sbjct  1    MGKSYPAVREEYLEAVDKAKKKLRGLIAGKNCAPLMLRLAWHSAGTFDVGTRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AE GH AN GLDIAV+LLEP KEQFPI+S AD YQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFPAELGHAANNGLDIAVRLLEPIKEQFPILSFADFYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P PP+EGRLP+A KG+DHLR VF  QMGLSD+DIVALSG HTLGRCHKERSGFEG WT
Sbjct  121  DKPAPPVEGRLPDATKGSDHLRQVFSHQMGLSDQDIVALSGAHTLGRCHKERSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKE L+QLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEDLIQLPSDKALLSDPVFRPL  220



>gb|ABR18607.1| cytosolic ascorbate peroxidase 1 [Gossypium hirsutum]
Length=250

 Score =   372 bits (956),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS EY K++EK +RKLRG IAEK CAPLMLR+AWHSAGTFDV+TK+GGP+GTM
Sbjct  1    MTKCYPTVSEEYQKSVEKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  H AN GLDIAV+LLEP KEQFP +++AD YQLAGVVAVEITGGPE+PFHPGR+
Sbjct  61   KHPAELAHAANNGLDIAVRLLEPIKEQFPNLTYADFYQLAGVVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P PP EGRLP+A KG+DHLR VF  QMGLSD+ IVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPHPPPEGRLPDATKGSDHLRQVFSAQMGLSDQHIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLP+DK LLSDPVFRPL
Sbjct  181  TNPLIFDNSYFKELLSGEKEGLLQLPTDKVLLSDPVFRPL  220



>gb|AGJ72850.1| ascorbate peroxidase [Cucumis sativus]
Length=249

 Score =   372 bits (956),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 194/220 (88%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YP VS EY KAIEK +RKLRGFIAEK CAPLMLR+AWHSAGTF   +K+GGP+GTM
Sbjct  1    MGKCYPVVSEEYQKAIEKAKRKLRGFIAEKNCAPLMLRLAWHSAGTFCKDSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R K+E  HGAN GLDIAV+LLEP KEQFPI S+AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   RFKSELAHGANNGLDIAVRLLEPIKEQFPIPSYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF   MGLSD+DIVALSGGHTLGR HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFY-TMGLSDQDIVALSGGHTLGRAHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFD SYFTELL+GEKEGLLQL SDKALLSDPVFRPL
Sbjct  180  TNPLIFDKSYFTELLTGEKEGLLQLASDKALLSDPVFRPL  219



>pdb|2VCF|X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean 
Ascorbate Peroxidase
Length=264

 Score =   373 bits (957),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +1

Query  139  KSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMRL  318
            KSYPTVSA+Y KA+EK ++KLRGFIAEK CAPLMLR+AWHSAGTFD  TK+GGP+GT++ 
Sbjct  14   KSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTIKH  73

Query  319  KAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQDN  498
             AE  H AN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+D 
Sbjct  74   PAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDK  133

Query  499  PEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRN  678
            PEPP EGRLP+A KG+DHLRDVF K MGL+D+DIVALSGGHT+G  HKERSGFEGPWT N
Sbjct  134  PEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWTSN  193

Query  679  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  194  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  231



>ref|XP_006381500.1| ascorbate peroxidase family protein [Populus trichocarpa]
 gb|ERP59297.1| ascorbate peroxidase family protein [Populus trichocarpa]
Length=249

 Score =   372 bits (955),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 194/220 (88%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS EY KA+EKC+RKLRG IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GT+
Sbjct  1    MGKSYPTVSEEYQKAVEKCKRKLRGLIAEKHCAPLMLRLAWHSAGTFDVHTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GLDIA++LLEP KEQFPI+S+AD YQLAGVVAVE+TGGPE+PFHPGR 
Sbjct  61   RHPDELAHGANNGLDIAIRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  +PP EGRLP+A KG+DHLRDVF   MGLSD DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKSDPPPEGRLPDATKGSDHLRDVF-GHMGLSDTDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPL+FDNSYF ELLSGEKEGL+QLPSDK LL DPVFRPL
Sbjct  180  PNPLVFDNSYFKELLSGEKEGLIQLPSDKTLLEDPVFRPL  219



>gb|AAN60795.1| ascorbate peroxidase [Brassica juncea]
Length=250

 Score =   372 bits (955),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 194/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M KSYPTVS +Y KAIEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD  +K+GGP+GTM
Sbjct  1    MTKSYPTVSEDYQKAIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCASKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQGHGAN+G+ IA++LL+P +EQFP IS AD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFDAEQGHGANSGIHIALRLLDPIREQFPTISFADFHQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF KQMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRQVFTKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL+GEKEGLLQL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLTGEKEGLLQLVSDKALLDDPVFRPL  220



>gb|AAN60794.1| ascorbate peroxidase [Brassica juncea]
Length=250

 Score =   372 bits (955),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 194/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M KSYPTVS +Y KAIEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD  +K+GGP+GTM
Sbjct  1    MTKSYPTVSEDYQKAIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCASKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQGHGAN+G+ IA++LL+P +EQFP IS AD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFDAEQGHGANSGIHIALRLLDPIREQFPAISFADFHQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF KQMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRQVFTKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL+GEKEGLLQL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLTGEKEGLLQLVSDKALLDDPVFRPL  220



>gb|ADT80721.1| ascorbate peroxidase [Cucumis sativus]
Length=249

 Score =   372 bits (954),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 195/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YP VS EY KAIEK +RKLRGFIAEK CAPLMLR+AWHSAGTF   +K+GGP+GTM
Sbjct  1    MGKCYPVVSEEYQKAIEKAKRKLRGFIAEKNCAPLMLRLAWHSAGTFCKDSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R K+E  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFKSELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF   MGLSD+DIVALSGGHTLGR HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFY-TMGLSDQDIVALSGGHTLGRAHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             +PLIFD SYFTELL+GEKEGLLQL SDKALLSDPVFRPL
Sbjct  180  TDPLIFDKSYFTELLTGEKEGLLQLASDKALLSDPVFRPL  219



>gb|AAK58449.1| cytosolic ascorbate peroxidase [Suaeda salsa]
Length=250

 Score =   372 bits (954),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 197/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS E  K+IEK ++KLRG I+EK CAP+MLR+AWHSAGTFDVQ+K+ GP+GTM
Sbjct  1    MGKSYPTVSEENQKSIEKAKKKLRGLISEKHCAPIMLRLAWHSAGTFDVQSKTPGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R +AE  HGAN GLDIA++LLEP KEQFP IS AD YQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RHQAELAHGANNGLDIALRLLEPIKEQFPEISFADFYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLRDVF+KQMGL+D+DIVALSGGHTLGRCHK+RSGFEGPWT
Sbjct  121  DKPEPPQEGRLPDATKGCDHLRDVFIKQMGLTDQDIVALSGGHTLGRCHKDRSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPL+FDNS   ELLSGEK+GLLQLPSDKALL+DPVFRPL
Sbjct  181  PNPLVFDNSLLKELLSGEKDGLLQLPSDKALLADPVFRPL  220



>ref|XP_006649890.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic-like [Oryza brachyantha]
Length=250

 Score =   372 bits (954),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VSAEY +A+EK R+KL   I EK CAPLMLR+AWHSAGTFDV +++GGP+GTM
Sbjct  1    MAKNYPVVSAEYQEAVEKARQKLCALITEKSCAPLMLRLAWHSAGTFDVSSRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AEQ H AN GLDIAV++LEP KE+ P IS+ADLYQLAGVVAVE++GGP VPFHPGR+
Sbjct  61   KTPAEQAHAANAGLDIAVRMLEPIKEEIPTISYADLYQLAGVVAVEVSGGPAVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P PP EGRLP+A KG+DHLR VF  QMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPSPPPEGRLPDATKGSDHLRQVFSAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            RNPL FDNSYFTELLSG+KEGLLQLPSDKALLSDP FRPL
Sbjct  181  RNPLQFDNSYFTELLSGDKEGLLQLPSDKALLSDPAFRPL  220



>ref|XP_004246700.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic [Solanum lycopersicum]
Length=250

 Score =   372 bits (954),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 195/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS EY KA+EKC+RKLRG IAEK CAP+MLR+AWHSAGT+DV+TK+GGP+GT+
Sbjct  1    MVKCYPTVSEEYQKAVEKCKRKLRGLIAEKNCAPIMLRLAWHSAGTYDVKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP++PFHPGRQ
Sbjct  61   RHPNELKHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDIPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+A KG+DHLR+VF   MGLSDKDIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKTEPPPEGRLPDATKGSDHLREVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  180  NNPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPL  219



>ref|XP_006417756.1| hypothetical protein EUTSA_v10008402mg [Eutrema salsugineum]
 gb|ESQ36109.1| hypothetical protein EUTSA_v10008402mg [Eutrema salsugineum]
Length=284

 Score =   372 bits (956),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 194/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +YLKAIEKCRRKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MTKNYPTVSEDYLKAIEKCRRKLRGMIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN+G+ +A++ LEP +EQFP IS AD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFDAEQAHGANSGIHVALRFLEPIREQFPTISFADFHQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLRDVF KQMGL+DKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPEPPPEGRLPDATKGCDHLRDVFAKQMGLTDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL+GEKEGL+QL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLTGEKEGLIQLVSDKALLDDPVFRPL  220



>emb|CDY06284.1| BnaA09g49190D [Brassica napus]
Length=253

 Score =   371 bits (953),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M KSYPTVS +Y KAIEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MTKSYPTVSEDYQKAIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQGHGAN+G+ IA++LLEP +EQF  IS AD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFDAEQGHGANSGIHIALRLLEPIREQFSTISFADFHQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF KQMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRQVFTKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPL  220



>ref|XP_002284767.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic [Vitis vinifera]
 ref|XP_010651099.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic [Vitis vinifera]
 emb|CBI16243.3| unnamed protein product [Vitis vinifera]
Length=250

 Score =   371 bits (952),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 182/220 (83%), Positives = 197/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS EY KA+EK ++KLRG IAEK CAP+MLRIAWHSAGTFDV+T++GGP+GTM
Sbjct  1    MGKSYPTVSEEYKKAVEKAKKKLRGLIAEKNCAPIMLRIAWHSAGTFDVKTRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +   E  HGAN GLDIAV+LLEP KEQFPIIS+AD YQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   KKPEELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLR VFV QMGLSDKDIVALSG HTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGCDHLRQVFVTQMGLSDKDIVALSGAHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDP FRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPAFRPL  220



>gb|AAD20022.1| ascorbate peroxidase [Glycine max]
Length=250

 Score =   371 bits (952),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 197/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVSA+Y KA+EK ++KLRGFIAEK CAPLMLR+AWHSAGT+DV +K+GGP+GT+
Sbjct  1    MTKNYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTYDVSSKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  +E  HGAN  LDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+
Sbjct  61   KHPSELAHGANNILDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHT+G  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDRDIVALSGGHTIGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPVFRPL  220



>ref|XP_009118402.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic [Brassica rapa]
 ref|XP_009118404.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic [Brassica rapa]
 ref|XP_009118405.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic [Brassica rapa]
Length=250

 Score =   371 bits (952),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M KSYPTVS +Y KAIEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MTKSYPTVSEDYQKAIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQGHGAN+G+ IA++LLEP +EQF  IS AD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFDAEQGHGANSGIHIALRLLEPIREQFSTISFADFHQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF KQMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRQVFTKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPL  220



>gb|ACJ11731.1| ascorbate peroxidase [Gossypium hirsutum]
 gb|ACT56517.1| cytosolic ascorbate peroxidase [Gossypium hirsutum]
Length=250

 Score =   371 bits (952),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 191/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS +Y  A++K +RKLRG IAEK CAPLMLR+AWHSAGTFDV+TK+GGP+GTM
Sbjct  1    MTKCYPTVSEDYQNAVQKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  H AN GLDIAV+LLEP KEQ PI+S+AD YQLAGVVAVEITGGPE+PFHPGR+
Sbjct  61   KQPAELAHAANNGLDIAVRLLEPIKEQLPILSYADFYQLAGVVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P PP EGRLPNA +G DHLR VF  QMGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPHPPPEGRLPNATEGADHLRQVFSNQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL+GEK GLLQLP+DK LLSDPVFRPL
Sbjct  181  TNPLIFDNSYFKELLTGEKAGLLQLPTDKVLLSDPVFRPL  220



>gb|AGG14281.1| cytosolic ascorbate peroxidase [Pyrus pyrifolia]
Length=250

 Score =   371 bits (952),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 191/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY  AI+K RRKLRG IAEK CAP+MLRIAWHSAGT+D +TK+GGP+GTM
Sbjct  1    MGKCYPTVSEEYKTAIDKARRKLRGLIAEKNCAPIMLRIAWHSAGTYDTKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN GLDIAV+LLEP K+QFPI+S+AD YQLAGV AVEITGGP+VPFHPGR 
Sbjct  61   RCPAEQAHGANNGLDIAVRLLEPIKQQFPILSYADFYQLAGVGAVEITGGPDVPFHPGRT  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLRDVF K MGLSDKDIV LSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DAPKPPPEGRLPDATKGTDHLRDVFCKTMGLSDKDIVTLSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF  LL G++EGLL LP+DKALL DPVFRPL
Sbjct  181  PNPLIFDNSYFKVLLGGDQEGLLMLPTDKALLDDPVFRPL  220



>gb|AGO97076.1| ascorbate peroxidase [Saccharum hybrid cultivar GT28]
Length=252

 Score =   371 bits (952),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 195/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVSAEY +A+EK ++KLR  IAEK CAPLMLR+AWHSAGTFDV T++GGP+GTM
Sbjct  1    MAKCYPTVSAEYSEAVEKAKQKLRALIAEKSCAPLMLRLAWHSAGTFDVSTRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGP++PFHPGR+
Sbjct  61   KNPAELAHGANAGLDIAVRLLEPIKGEFPILSYADFYQLAGVVAVEVTGGPQIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG+DHLR VF KQMGLSD+DIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPL+FDNSYF ELLSG+KEGLLQLPSDKALLSDP FRPL
Sbjct  181  TNPLVFDNSYFKELLSGDKEGLLQLPSDKALLSDPAFRPL  220



>ref|XP_007016653.1| Ascorbate peroxidase 1 [Theobroma cacao]
 gb|ABR68691.2| ascorbate peroxidase [Theobroma cacao]
 gb|EOY34272.1| Ascorbate peroxidase 1 [Theobroma cacao]
Length=250

 Score =   371 bits (952),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS EY KA+EK +RKLRG IAEK CAP+MLR+AWHSAGTFDV+T++GGP+GTM
Sbjct  1    MTKCYPTVSEEYKKAVEKAKRKLRGLIAEKNCAPIMLRLAWHSAGTFDVKTRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN GLDIAV+LLEP KEQFPI+++AD YQLAGVVAVEITGGPE+PFHPGR+
Sbjct  61   KQPAELAHGANNGLDIAVRLLEPIKEQFPILTYADFYQLAGVVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P PP EGRLP+A KG DHLR VF  QMGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPHPPPEGRLPDATKGADHLRQVFTAQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL GEKE LL+LP+D  LLSDPVFRPL
Sbjct  181  TNPLIFDNSYFMELLVGEKEDLLKLPTDVVLLSDPVFRPL  220



>gb|AAQ88015.1| ascorbate peroxidase, partial [Cucumis sativus]
Length=249

 Score =   370 bits (951),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 194/219 (89%), Gaps = 1/219 (0%)
 Frame = +1

Query  136  GKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMR  315
            GK YP VS EY KAIEK +RKLRGFIAEK CAPLMLR+AWHSAGTF   +K+GGP+GTMR
Sbjct  2    GKCYPVVSEEYQKAIEKAKRKLRGFIAEKNCAPLMLRLAWHSAGTFCKDSKTGGPFGTMR  61

Query  316  LKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQD  495
             K+E  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP+VPFHPGR+D
Sbjct  62   FKSELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDVPFHPGRED  121

Query  496  NPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTR  675
             PEPP EGRLP+A KG+DHLRDVF   MGLSD+DIVALSGGHTLGR HKERSGFEGPWT 
Sbjct  122  KPEPPPEGRLPDATKGSDHLRDVFY-TMGLSDQDIVALSGGHTLGRAHKERSGFEGPWTT  180

Query  676  NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            NPLIFD SYFTELL+GEKEGLLQL SDKALLSDPVFRPL
Sbjct  181  NPLIFDKSYFTELLTGEKEGLLQLASDKALLSDPVFRPL  219



>ref|NP_001049769.1| Os03g0285700 [Oryza sativa Japonica Group]
 sp|Q10N21.1|APX1_ORYSJ RecName: Full=L-ascorbate peroxidase 1, cytosolic; Short=APXa; 
AltName: Full=OsAPx01 [Oryza sativa Japonica Group]
 dbj|BAA08264.1| ascorbate peroxidase [Oryza sativa]
 gb|AAO17000.1| Putative ascorbate peroxidase [Oryza sativa Japonica Group]
 gb|AAP13093.1| ascorbate peroxidase [Oryza sativa Indica Group]
 gb|ABF95353.1| L-ascorbate peroxidase 1, cytosolic, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11683.1| Os03g0285700 [Oryza sativa Japonica Group]
 gb|EAZ26516.1| hypothetical protein OsJ_10411 [Oryza sativa Japonica Group]
 dbj|BAG88141.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86863.1| L-ascorbate peroxodase 1 [Oryza sativa Japonica Group]
Length=250

 Score =   370 bits (951),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VSAEY +A+EK R+KLR  IAEK CAPLMLR+AWHSAGTFDV +K+GGP+GTM
Sbjct  1    MAKNYPVVSAEYQEAVEKARQKLRALIAEKSCAPLMLRLAWHSAGTFDVSSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  H AN GLDIAV++LEP KE+ P IS+AD YQLAGVVAVE++GGP VPFHPGR+
Sbjct  61   KTPAELSHAANAGLDIAVRMLEPIKEEIPTISYADFYQLAGVVAVEVSGGPAVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P PP EGRLP+A KG+DHLR VF  QMGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPAPPPEGRLPDATKGSDHLRQVFGAQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            RNPL FDNSYFTELLSG+KEGLLQLPSDKALLSDP FRPL
Sbjct  181  RNPLQFDNSYFTELLSGDKEGLLQLPSDKALLSDPAFRPL  220



>ref|XP_008792380.1| PREDICTED: L-ascorbate peroxidase, cytosolic-like [Phoenix dactylifera]
Length=249

 Score =   370 bits (951),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 194/220 (88%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYP VS EY KA++KC++KLRG IAEK CAPLMLRIAWHSAGT+DV++K+GGP+GTM
Sbjct  1    MGKSYPKVSEEYQKAVDKCKKKLRGLIAEKNCAPLMLRIAWHSAGTYDVKSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  H AN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RCPTELAHEANKGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+A +G DHLRDVF   MGLSD+DIVALSGGHTLGRCH ERSGFEG WT
Sbjct  121  DKSEPPEEGRLPDATQGCDHLRDVF-GHMGLSDQDIVALSGGHTLGRCHMERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL+DPVFRPL
Sbjct  180  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLTDPVFRPL  219



>emb|CDY22715.1| BnaC08g43490D [Brassica napus]
Length=255

 Score =   370 bits (951),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M KSYPTV+ +Y  AIEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MTKSYPTVTEDYQNAIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQGHGAN+G+ IA++LLEP +EQFP IS AD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFDAEQGHGANSGIHIALRLLEPIREQFPTISFADFHQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF KQMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRQVFTKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPL  220



>ref|XP_011048406.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic [Populus euphratica]
Length=250

 Score =   370 bits (950),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 193/220 (88%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY KA+EKC+RKLRG IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GT+
Sbjct  1    MGKCYPTVSEEYQKAVEKCKRKLRGLIAEKHCAPLMLRLAWHSAGTFDVNTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GLDIAV+LLEP KEQFP +S+AD YQLAGVVAVE+TGGPEVPFHPGR 
Sbjct  61   RHPDELAHGANNGLDIAVRLLEPLKEQFPNLSYADFYQLAGVVAVEVTGGPEVPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  +PP EGRLP+A KG+DHLRDVF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKSDPPPEGRLPDATKGSDHLRDVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPL+FDNSYF ELLSGEKEGL+QLPSDK LL DPVFRPL
Sbjct  180  PNPLVFDNSYFKELLSGEKEGLIQLPSDKTLLEDPVFRPL  219



>ref|XP_010475564.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic-like isoform X1 
[Camelina sativa]
Length=250

 Score =   370 bits (950),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 169/220 (77%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +YLKAIEKCRRKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MAKNYPTVSEDYLKAIEKCRRKLRGMIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN+G+ +A++ LEP +EQFP IS AD +QLAGVV +E+TGGPE+PFHPGR+
Sbjct  61   RFDAEQAHGANSGIHVALRFLEPIREQFPTISFADFHQLAGVVGIEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG +HLRDVF KQMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCEHLRDVFSKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPL  220



>dbj|BAB84009.1| ascorbate peroxidase [Brassica oleracea]
Length=250

 Score =   370 bits (950),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M KSYPTV+ +Y  AIEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MTKSYPTVTEDYQNAIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQGHGAN+G+ IA++LLEP +EQFP IS AD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFDAEQGHGANSGIHIALRLLEPIREQFPTISFADFHQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF KQMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRQVFTKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPL  220



>gb|ACV92696.1| APX [Brassica rapa subsp. pekinensis]
 emb|CCC55735.1| ascorbate peroxidase 1 [Brassica rapa subsp. oleifera]
 dbj|BAO42876.1| ascorbate peroxidase [Brassica rapa subsp. pekinensis]
Length=250

 Score =   370 bits (950),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EY KAIEKCRRKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MTKNYPAVSEEYQKAIEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GL IA++LLEP +EQFP ISHAD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFDDELAHGANNGLHIALRLLEPIREQFPTISHADFHQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF+KQMGL+D+DIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRQVFLKQMGLTDQDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLDDPVFRPL  220



>gb|AGJ72851.1| ascorbate peroxidase [Momordica charantia]
Length=249

 Score =   370 bits (950),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 195/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YP VS EY KAIEK +RKLRGFIA+K CAPLMLR+AWHSAGT+   +K+GGP+GTM
Sbjct  1    MGKCYPVVSEEYQKAIEKAKRKLRGFIADKNCAPLMLRLAWHSAGTYCKDSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R ++E  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFRSELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF   MGLSD+DIVALSGGHTLGR HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFY-TMGLSDQDIVALSGGHTLGRAHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFD SYFTELL+GEKEGLLQL SDKALLSDPVFRPL
Sbjct  180  TNPLIFDKSYFTELLTGEKEGLLQLASDKALLSDPVFRPL  219



>pdb|2CL4|X Chain X, Ascorbate Peroxidase R172a Mutant
Length=261

 Score =   370 bits (951),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 175/218 (80%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = +1

Query  139  KSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMRL  318
            KSYPTVSA+Y KA+EK ++KLRGFIAEK CAPLMLR+AWHSAGTFD  TK+GGP+GT++ 
Sbjct  14   KSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTIKH  73

Query  319  KAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQDN  498
             AE  H AN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+D 
Sbjct  74   PAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDK  133

Query  499  PEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRN  678
            PEPP EGRLP+A KG+DHLRDVF K MGL+D+DIVALSGGHT+G  HKE SGFEGPWT N
Sbjct  134  PEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKEASGFEGPWTSN  193

Query  679  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  194  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  231



>ref|XP_010233519.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic isoform X2 [Brachypodium 
distachyon]
Length=250

 Score =   370 bits (950),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 173/219 (79%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = +1

Query  136  GKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMR  315
             K YPTV+ EY  A+ K +RKLRG IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GT++
Sbjct  3    AKCYPTVTDEYQTAVAKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVATKTGGPFGTIK  62

Query  316  LKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQD  495
              AE  HGAN GLDIAV+LLEP K+QFPI+S+AD YQLAGVVAVE+TGGPEVPFHPGRQD
Sbjct  63   CPAELAHGANAGLDIAVRLLEPIKDQFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRQD  122

Query  496  NPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTR  675
             PEPP EGRLP+A +G+DHLR VF  QMGLSD+DIVALSGGHTLGRCHKERSGFEG WT 
Sbjct  123  KPEPPPEGRLPDATQGSDHLRQVFSTQMGLSDQDIVALSGGHTLGRCHKERSGFEGAWTA  182

Query  676  NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            NPLIFDNSYF ELLSGEKEGLLQLP+DK LLSDP FRPL
Sbjct  183  NPLIFDNSYFKELLSGEKEGLLQLPTDKTLLSDPAFRPL  221



>gb|AGY78306.1| ascorbate peroxidase [Populus tomentosa]
Length=250

 Score =   370 bits (950),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 193/220 (88%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY KA+EKC+RKLRG IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GT+
Sbjct  1    MGKCYPTVSEEYQKAVEKCKRKLRGLIAEKHCAPLMLRLAWHSAGTFDVTTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GLDIAV+LLEP KEQFP +S+AD YQLAGVVAVE+TGGPEVPFHPGR 
Sbjct  61   RHPDELAHGANNGLDIAVRLLEPLKEQFPNLSYADFYQLAGVVAVEVTGGPEVPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  +PP EGRLP+A KG+DHLRDVF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKSDPPPEGRLPDATKGSDHLRDVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPL+FDNSYF ELLSGEKEGL+QLPSDK LL DPVFRPL
Sbjct  180  PNPLVFDNSYFKELLSGEKEGLIQLPSDKTLLEDPVFRPL  219



>ref|XP_010475565.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic-like isoform X2 
[Camelina sativa]
Length=249

 Score =   370 bits (949),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 169/220 (77%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +YLKAIEKCRRKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MAKNYPTVSEDYLKAIEKCRRKLRGMIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN+G+ +A++ LEP +EQFP IS AD +QLAGVV +E+TGGPE+PFHPGR+
Sbjct  61   RFDAEQAHGANSGIHVALRFLEPIREQFPTISFADFHQLAGVVGIEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG +HLRDVF KQMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCEHLRDVFSKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPL  220



>ref|XP_002322851.1| ascorbate peroxidase family protein [Populus trichocarpa]
 gb|ABK93180.1| unknown [Populus trichocarpa]
 gb|EEF04612.1| ascorbate peroxidase family protein [Populus trichocarpa]
Length=250

 Score =   370 bits (949),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 193/220 (88%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY KA+EKC+RKLRG IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GT+
Sbjct  1    MGKCYPTVSEEYQKAVEKCKRKLRGLIAEKHCAPLMLRLAWHSAGTFDVNTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GLDIAV+LLEP KEQFP +S+AD YQLAGVVAVEITGGPEVPFHPGR 
Sbjct  61   RHPDELAHGANNGLDIAVRLLEPLKEQFPNLSYADFYQLAGVVAVEITGGPEVPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  +PP EGRLP+A KG+DHLRDVF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKSDPPPEGRLPDATKGSDHLRDVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPL+FDNSYF ELLSGEKEGL+QLP+DK LL DPVFRPL
Sbjct  180  PNPLVFDNSYFKELLSGEKEGLIQLPTDKTLLEDPVFRPL  219



>pdb|2VCS|A Chain A, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean 
Ascorbate Peroxidase Mutant H42a
Length=261

 Score =   370 bits (949),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/218 (80%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = +1

Query  139  KSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMRL  318
            KSYPTVSA+Y KA+EK ++KLRGFIAEK CAPLMLR+AW SAGTFD  TK+GGP+GT++ 
Sbjct  14   KSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWASAGTFDKGTKTGGPFGTIKH  73

Query  319  KAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQDN  498
             AE  H AN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+D 
Sbjct  74   PAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDK  133

Query  499  PEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRN  678
            PEPP EGRLP+A KG+DHLRDVF K MGL+D+DIVALSGGHT+G  HKERSGFEGPWT N
Sbjct  134  PEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWTSN  193

Query  679  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  194  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  231



>ref|NP_001170482.1| ascorbate peroxidase [Zea mays]
 gb|ACN91229.1| cytosolic ascorbate peroxidase [Gossypium hirsutum]
 gb|ACO90192.1| ascorbate peroxidase [Zea mays]
Length=250

 Score =   369 bits (948),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS EY K++EK +RKLRG IAEK CAPLMLR+AWHSAGTFDV+TK+GGP+GTM
Sbjct  1    MTKCYPTVSEEYQKSVEKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  H AN GL+IAV+LLEP KEQFP +++AD YQLAGVVAVEITGGPE+PFHPGR+
Sbjct  61   KHPAELAHAANNGLNIAVRLLEPIKEQFPNLTYADFYQLAGVVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            + P PP EGRLP+A KG+DHLR VF  QMGLSD+ IVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  EKPHPPPEGRLPDATKGSDHLRQVFSAQMGLSDQHIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLP+DK LLSDPVFRPL
Sbjct  181  TNPLIFDNSYFKELLSGEKEGLLQLPTDKVLLSDPVFRPL  220



>gb|AGS10094.1| ascorbate peroxidase [Brassica oleracea var. alboglabra]
 emb|CDX95116.1| BnaC05g05550D [Brassica napus]
Length=250

 Score =   369 bits (948),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EY KAIEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MTKNYPAVSEEYQKAIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GL IA++LLEP +EQFP ISHAD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFDDELAHGANNGLHIALRLLEPIREQFPTISHADFHQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF+KQMGL+D+DIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRQVFLKQMGLTDQDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLDDPVFRPL  220



>ref|XP_003562395.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic isoform X1 [Brachypodium 
distachyon]
Length=256

 Score =   369 bits (948),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 173/219 (79%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = +1

Query  136  GKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMR  315
             K YPTV+ EY  A+ K +RKLRG IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GT++
Sbjct  3    AKCYPTVTDEYQTAVAKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVATKTGGPFGTIK  62

Query  316  LKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQD  495
              AE  HGAN GLDIAV+LLEP K+QFPI+S+AD YQLAGVVAVE+TGGPEVPFHPGRQD
Sbjct  63   CPAELAHGANAGLDIAVRLLEPIKDQFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRQD  122

Query  496  NPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTR  675
             PEPP EGRLP+A +G+DHLR VF  QMGLSD+DIVALSGGHTLGRCHKERSGFEG WT 
Sbjct  123  KPEPPPEGRLPDATQGSDHLRQVFSTQMGLSDQDIVALSGGHTLGRCHKERSGFEGAWTA  182

Query  676  NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            NPLIFDNSYF ELLSGEKEGLLQLP+DK LLSDP FRPL
Sbjct  183  NPLIFDNSYFKELLSGEKEGLLQLPTDKTLLSDPAFRPL  221



>ref|XP_009148036.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic-like isoform X2 
[Brassica rapa]
 ref|XP_009148037.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic-like isoform X2 
[Brassica rapa]
 dbj|BAO42877.1| ascorbate peroxidase [Brassica rapa subsp. pekinensis]
Length=250

 Score =   369 bits (947),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EY KAIEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MTKNYPAVSEEYQKAIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GL IA++LLEP +EQFP ISHAD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFDDELAHGANNGLHIALRLLEPIREQFPTISHADFHQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF+KQMGL+D+DIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRQVFLKQMGLTDQDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLDDPVFRPL  220



>ref|XP_009620318.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic isoform X1 [Nicotiana 
tomentosiformis]
Length=250

 Score =   369 bits (947),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 196/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YP VS EY+KA+EKC+RKLRG IAEK CAP++LR+AWHSAGT+DV+TK+GGP+GT+
Sbjct  1    MGKCYPRVSEEYVKAVEKCKRKLRGLIAEKNCAPIILRLAWHSAGTYDVKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GLDIAV+LLEP KEQFP++S+AD YQLAGVVAV++TGGP++PFHPGRQ
Sbjct  61   RHPDELKHGANNGLDIAVRLLEPIKEQFPVLSYADFYQLAGVVAVKVTGGPDIPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+A KG+DHLR+VF   MGLSDKDIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKTEPPPEGRLPDATKGSDHLREVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  180  NNPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPL  219



>ref|XP_009620319.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic isoform X2 [Nicotiana 
tomentosiformis]
Length=245

 Score =   369 bits (946),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 196/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YP VS EY+KA+EKC+RKLRG IAEK CAP++LR+AWHSAGT+DV+TK+GGP+GT+
Sbjct  1    MGKCYPRVSEEYVKAVEKCKRKLRGLIAEKNCAPIILRLAWHSAGTYDVKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GLDIAV+LLEP KEQFP++S+AD YQLAGVVAV++TGGP++PFHPGRQ
Sbjct  61   RHPDELKHGANNGLDIAVRLLEPIKEQFPVLSYADFYQLAGVVAVKVTGGPDIPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+A KG+DHLR+VF   MGLSDKDIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKTEPPPEGRLPDATKGSDHLREVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  180  NNPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPL  219



>ref|XP_009148034.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic-like isoform X1 
[Brassica rapa]
Length=263

 Score =   369 bits (948),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EY KAIEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  14   MTKNYPAVSEEYQKAIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  73

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GL IA++LLEP +EQFP ISHAD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  74   RFDDELAHGANNGLHIALRLLEPIREQFPTISHADFHQLAGVVAVEVTGGPEIPFHPGRE  133

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF+KQMGL+D+DIVALSG HTLGRCHK+RSGFEG WT
Sbjct  134  DKPQPPPEGRLPDATKGCDHLRQVFLKQMGLTDQDIVALSGAHTLGRCHKDRSGFEGAWT  193

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  194  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLDDPVFRPL  233



>pdb|3ZCY|A Chain A, Ascorbate Peroxidase W41a-h42y Mutant
Length=249

 Score =   369 bits (946),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/219 (80%), Positives = 196/219 (89%), Gaps = 0/219 (0%)
 Frame = +1

Query  136  GKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMR  315
            GKSYPTVSA+Y KA+EK ++KLRGFIAEK CAPLMLR+A +SAGTFD  TK+GGP+GT++
Sbjct  1    GKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAAYSAGTFDKGTKTGGPFGTIK  60

Query  316  LKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQD  495
              AE  H AN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+D
Sbjct  61   HPAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRED  120

Query  496  NPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTR  675
             PEPP EGRLP+A KG+DHLRDVF K MGL+D+DIVALSGGHT+G  HKERSGFEGPWT 
Sbjct  121  KPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWTS  180

Query  676  NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  NPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  219



>gb|AFR23351.1| ascorbate peroxidase, partial [Brassica rapa subsp. oleifera]
Length=252

 Score =   369 bits (946),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EY KAIEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MTKNYPAVSEEYQKAIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GL IA++LLEP +EQFP ISHAD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFDDELAHGANNGLHIALRLLEPIREQFPTISHADFHQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF+KQMGL+D+DIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRQVFLKQMGLTDQDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLDDPVFRPL  220



>emb|CDX93610.1| BnaA06g04380D [Brassica napus]
Length=305

 Score =   370 bits (951),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EY KAIEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  41   MTKNYPAVSEEYQKAIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  100

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GL IA++LLEP +EQFP ISHAD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  101  RFDDELAHGANNGLHIALRLLEPIREQFPTISHADFHQLAGVVAVEVTGGPEIPFHPGRE  160

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF+KQMGL+D+DIVALSG HTLGRCHK+RSGFEG WT
Sbjct  161  DKPQPPPEGRLPDATKGCDHLRQVFLKQMGLTDQDIVALSGAHTLGRCHKDRSGFEGAWT  220

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  221  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLDDPVFRPL  260



>gb|AGG14282.1| cytosolic ascorbate peroxidase [Pyrus pyrifolia]
Length=250

 Score =   369 bits (946),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 193/220 (88%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS EYLKA+EK +RKLRG IAEK CAP++LR+AWHSAGTFD++TK+GGP+GT+
Sbjct  1    MVKQYPTVSEEYLKAVEKSKRKLRGLIAEKNCAPIILRLAWHSAGTFDIETKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  H AN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVEITGGPE+PFHPGR 
Sbjct  61   RHPEELAHEANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEITGGPEIPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLPNA +G+DHLR VF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKQEPPPEGRLPNATEGSDHLRAVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  180  TNPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPL  219



>pdb|2GGN|X Chain X, Conformational Mobility In The Active Site Of A Heme 
Peroxidase
 pdb|2GHC|X Chain X, Conformational Mobility In The Active Site Of A Heme 
Peroxidase
 pdb|2GHD|X Chain X, Conformational Mobility In The Active Site Of A Heme 
Peroxidase
 pdb|2GHE|X Chain X, Conformational Mobility In The Active Site Of A Heme 
Peroxidase
 pdb|2VCN|A Chain A, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean 
Ascorbate Peroxidase Mutant W41a
 pdb|2VNX|X Chain X, Crystal Structure Of Soybean Ascorbate Peroxidase Mutant 
W41a After Exposure To A High Dose Of X-Rays
 pdb|2VNZ|X Chain X, Crystal Structure Of Dithinonite Reduced Soybean Ascorbate 
Peroxidase Mutant W41a.
 pdb|2VO2|X Chain X, Crystal Structure Of Soybean Ascorbate Peroxidase Mutant 
W41a Subjected To Low Dose X-Rays
 pdb|2WD4|A Chain A, Ascorbate Peroxidase As A Heme Oxygenase:  W41a Variant 
Product With T-Butyl Peroxide
Length=261

 Score =   369 bits (946),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/218 (80%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = +1

Query  139  KSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMRL  318
            KSYPTVSA+Y KA+EK ++KLRGFIAEK CAPLMLR+A HSAGTFD  TK+GGP+GT++ 
Sbjct  14   KSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAAHSAGTFDKGTKTGGPFGTIKH  73

Query  319  KAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQDN  498
             AE  H AN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+D 
Sbjct  74   PAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDK  133

Query  499  PEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRN  678
            PEPP EGRLP+A KG+DHLRDVF K MGL+D+DIVALSGGHT+G  HKERSGFEGPWT N
Sbjct  134  PEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWTSN  193

Query  679  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  194  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  231



>gb|AIE12238.1| ascorbate peroxidase 2 [Momordica charantia]
Length=249

 Score =   368 bits (945),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 193/220 (88%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YP VS EY KA+EK +RKLRG IAEK CAPLMLR+AWHSAGTFD ++K+GGP+GT+
Sbjct  1    MGKCYPVVSEEYQKAVEKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDKKSKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVEITGGPEVPFHPGR+
Sbjct  61   RFSNELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEITGGPEVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P P  EGRLP+A KG+DHLRDVF   MGLSD+DIVALSGGHTLGR HKERSGFEGPWT
Sbjct  121  DKPVPLPEGRLPDATKGSDHLRDVFY-TMGLSDQDIVALSGGHTLGRAHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTELL+GEKEGLLQL SDKALLSDPVFRPL
Sbjct  180  SNPLIFDNSYFTELLTGEKEGLLQLVSDKALLSDPVFRPL  219



>ref|XP_009406949.1| PREDICTED: L-ascorbate peroxidase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=249

 Score =   368 bits (944),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 193/220 (88%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYP VS EY KA+EK RRKLRG IAEK CAP+MLR+AWHSAGT+DV TK+GGP+GT+
Sbjct  1    MGKSYPAVSEEYQKAVEKARRKLRGLIAEKNCAPIMLRLAWHSAGTYDVSTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AE  HGAN GLDIA++LLEP KEQFP +S AD YQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFAAELAHGANNGLDIALRLLEPIKEQFPTLSFADFYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  +PP EGRLP+A KG+DHLRDVF   MGLSD+DIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKTQPPEEGRLPDATKGSDHLRDVF-GHMGLSDQDIVALSGGHTLGRCHKERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEK+ ++QLPSDKALL+DPVFRPL
Sbjct  180  SNPLIFDNSYFKELLSGEKDDVIQLPSDKALLTDPVFRPL  219



>dbj|BAB84008.1| ascorbate peroxidase [Brassica oleracea]
 gb|ADZ55659.1| ascorbate peroxidase [Brassica oleracea var. italica]
Length=250

 Score =   368 bits (944),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 169/220 (77%), Positives = 191/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EY KAIEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MTKNYPAVSEEYQKAIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GL IA++LLEP +EQFP ISHAD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFDDELAHGANNGLHIALRLLEPIREQFPTISHADFHQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF+KQMGL+D+DIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRQVFLKQMGLTDQDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGL QLPSDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLFQLPSDKALLDDPVFRPL  220



>ref|XP_002534421.1| L-ascorbate peroxidase, cytosolic, putative [Ricinus communis]
 gb|EEF27962.1| L-ascorbate peroxidase, cytosolic, putative [Ricinus communis]
Length=224

 Score =   367 bits (942),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 195/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EY KA++K ++KLRG IAEK CAP+MLR+AWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MTKNYPKVSEEYQKAVDKAKKKLRGLIAEKNCAPIMLRLAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AE  HGAN GLDIA++L++P KEQFPI+SHAD YQLAGVVAVEITGGPE+PFHPGR+
Sbjct  61   RYPAELAHGANNGLDIALRLIDPIKEQFPILSHADFYQLAGVVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+ HLRDVF   MGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSGHLRDVF-GHMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLL+LPSD ALLSDPVFRP 
Sbjct  180  SNPLIFDNSYFKELLSGEKEGLLKLPSDLALLSDPVFRPF  219



>ref|XP_006828348.1| hypothetical protein AMTR_s00023p00249630 [Amborella trichopoda]
 gb|ERM95764.1| hypothetical protein AMTR_s00023p00249630 [Amborella trichopoda]
Length=252

 Score =   368 bits (944),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 188/217 (87%), Gaps = 0/217 (0%)
 Frame = +1

Query  139  KSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMRL  318
            K YP V  EY KA+EKC+RKLRGFIAEK CAPLM+R AWHSAGTFDV TK+GGP+GTM+ 
Sbjct  5    KCYPEVCEEYQKAVEKCKRKLRGFIAEKNCAPLMVRTAWHSAGTFDVCTKTGGPFGTMKY  64

Query  319  KAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQDN  498
              E  HGAN GLDIAV+LLEP KEQF I+++AD YQLAG+VAVE+TGGPE+PFHPGRQD 
Sbjct  65   PEELAHGANAGLDIAVRLLEPIKEQFLILTYADFYQLAGIVAVEVTGGPEIPFHPGRQDK  124

Query  499  PEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRN  678
             EPP+EGRLP+A KG DHLR VF+KQMGL+DKDIVALSG HTLGRCHKERSGFEG WT N
Sbjct  125  TEPPVEGRLPDATKGPDHLRQVFIKQMGLTDKDIVALSGAHTLGRCHKERSGFEGAWTSN  184

Query  679  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRP  789
            PLIFDNSYF ELLSGEKEGLLQLPSDKAL+ DP F P
Sbjct  185  PLIFDNSYFKELLSGEKEGLLQLPSDKALIEDPAFHP  221



>gb|KDO73088.1| hypothetical protein CISIN_1g024615mg [Citrus sinensis]
Length=260

 Score =   368 bits (945),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 184/230 (80%), Positives = 201/230 (87%), Gaps = 10/230 (4%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +Y KA+EKC+RKLRGFIAEK CAPLMLRIAWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            RL AEQ H AN GLDIAV+LLEPFKEQFP IS+ADLYQLAGVV VE+TGGP++PFHPGR 
Sbjct  61   RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+A +GNDHLR VF  QMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFT----------ELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            RNPLIFDNSYFT          ELL+GEK+GLLQLPSDKALL DPVFRPL
Sbjct  181  RNPLIFDNSYFTYVSLVSLPDMELLTGEKDGLLQLPSDKALLDDPVFRPL  230



>emb|CCC55736.1| ascorbate peroxidase 2 [Brassica rapa subsp. oleifera]
Length=250

 Score =   368 bits (944),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M KSYPTV+ +Y  AIEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MTKSYPTVTEDYQNAIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQGHGAN+G+ IA++LLEP +EQF  IS AD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFDAEQGHGANSGIHIALRLLEPIREQFSTISFADFHQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF KQMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRQVFTKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPL  220



>ref|XP_009342360.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic [Pyrus x bretschneideri]
Length=250

 Score =   368 bits (944),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 192/220 (87%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS EY KA+EKC+RKLRG IAEK CAP++LR+AWHSAGTFD+ TK+GGP+GT+
Sbjct  1    MVKQYPTVSEEYQKAVEKCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDINTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  H AN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGPE+PFHPGR 
Sbjct  61   RHPEELAHEANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+A KG+DHLRDVF   MGLSD DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKQEPPPEGRLPDATKGSDHLRDVF-GHMGLSDNDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  180  TNPLIFDNSYFKELLSGEKEGLLQLPSDKALLKDPVFRPL  219



>gb|KFK43104.1| l-ascorbate peroxidase [Arabis alpina]
Length=250

 Score =   368 bits (944),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M KSYP VS +YLKAI+KC+RKLRG IAE  CAP+M+RIAWHSAGTFD  +++GGP+GTM
Sbjct  1    MTKSYPAVSEDYLKAIDKCKRKLRGMIAENNCAPIMVRIAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R +AEQGHGAN+G+ +A++ LEP ++QFP IS AD +QLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   RFEAEQGHGANSGIHVALRFLEPIRQQFPTISVADFHQLAGVVAVEVTGGPDVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLR VF KQMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPEPPPEGRLPDATKGCDHLRQVFAKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL+GEKEGL+QL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLTGEKEGLIQLVSDKALLDDPVFRPL  220



>gb|AEK05507.1| ascorbate peroxidase [Dimocarpus longan]
Length=240

 Score =   367 bits (942),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = +1

Query  163  EYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMRLKAEQGHGA  342
            EY KAIEK +RKLRG IAEK CAP+MLRIAWHSAGT+DV++K+GGP+GTMR  AE  H A
Sbjct  1    EYKKAIEKAKRKLRGLIAEKNCAPIMLRIAWHSAGTYDVKSKTGGPFGTMRQPAELAHAA  60

Query  343  NTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQDNPEPPLEGR  522
            N GLDIAV+LLEP KEQFPII++ADLYQLAGVVAVEITGGPE+PFHPGR+D P PP EGR
Sbjct  61   NNGLDIAVRLLEPIKEQFPIITYADLYQLAGVVAVEITGGPEIPFHPGREDKPRPPPEGR  120

Query  523  LPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSY  702
            LP+A KG DHLR VF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT NPLIFDNSY
Sbjct  121  LPDATKGTDHLRTVFGATMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTTNPLIFDNSY  180

Query  703  FTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            F ELLSGEKEGLLQLP+DKALLSDPVFRPL
Sbjct  181  FKELLSGEKEGLLQLPTDKALLSDPVFRPL  210



>gb|AAR32786.1| ascorbate peroxidase [Pinus pinaster]
Length=249

 Score =   367 bits (943),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 194/217 (89%), Gaps = 1/217 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS EY  AI+KC+RKLR  IAEK CAP+M+RIAWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MVKAYPTVSEEYKAAIDKCKRKLRALIAEKNCAPIMVRIAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AE  HGAN+GLDIAV+LLEP KEQFPIIS+AD YQLAGVVAVE+TGGP++PFHPGR+
Sbjct  61   RYGAELAHGANSGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVEVTGGPDIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLRDVF   MGL+DK+IVALSG HTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGPDHLRDVF-GHMGLNDKEIVALSGAHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVF  783
             NPLIFDNSYFTEL++GEKEGLLQLPSDKALL+DP F
Sbjct  180  SNPLIFDNSYFTELVTGEKEGLLQLPSDKALLADPSF  216



>ref|XP_004302839.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic-like [Fragaria 
vesca subsp. vesca]
Length=250

 Score =   367 bits (943),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 192/218 (88%), Gaps = 1/218 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YP+VS EY KA+EKC+RKLRG IAEK CAP++LRIAWHSAGTFDV TK+GGP+GT+
Sbjct  1    MGKCYPSVSEEYQKAVEKCKRKLRGLIAEKHCAPIILRIAWHSAGTFDVATKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AE  H AN GLDIAV++LEP KEQFPI+S+AD YQLAGVVAVE+TGGPE+PFHPGR 
Sbjct  61   RDPAELTHEANKGLDIAVRILEPIKEQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  E P EGRLPNANKG DHLRDVF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKKEAPPEGRLPNANKGVDHLRDVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFR  786
             NPLIFDNSYF EL+SGEKEGL+QLPSDKALL DPVFR
Sbjct  180  TNPLIFDNSYFKELISGEKEGLIQLPSDKALLEDPVFR  217



>gb|ABS01350.1| ascorbate peroxidase [Carica papaya]
Length=250

 Score =   367 bits (943),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 173/218 (79%), Positives = 189/218 (87%), Gaps = 0/218 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS EY KA+EKC RKLRGFIAEK CAP+M+RIAWHSAGTFD +TK+GGP+GTM
Sbjct  1    MTKQYPTVSEEYKKAVEKCTRKLRGFIAEKHCAPIMIRIAWHSAGTFDWKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN+GLDIAV  LEPFK+QFPIIS+ADLYQLAGVVA  +TGGPE+PFHPGR+
Sbjct  61   RCPAEQAHGANSGLDIAVNFLEPFKQQFPIISYADLYQLAGVVATWVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLR VF  QMGL+DKDIVALSG HTLG+CHKERSGFEG WT
Sbjct  121  DKPEPPPEGRLPDATKGADHLRQVFGVQMGLTDKDIVALSGAHTLGKCHKERSGFEGRWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFR  786
             N LIFDNSYF ELLSGEKEGLLQLPSDK L+SD  FR
Sbjct  181  ENHLIFDNSYFKELLSGEKEGLLQLPSDKCLVSDSAFR  218



>ref|XP_010488092.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic isoform X1 [Camelina 
sativa]
 ref|XP_010488099.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic isoform X1 [Camelina 
sativa]
 ref|XP_010458001.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic isoform X1 [Camelina 
sativa]
Length=250

 Score =   367 bits (942),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +YLKAIEKCRRKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MVKNYPTVSEDYLKAIEKCRRKLRGMIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN+G+ +A++ LEP +EQFP IS AD +QLAGVV +E+TGGP++PFHPGR+
Sbjct  61   RFDAEQAHGANSGIHVALRFLEPIREQFPTISFADFHQLAGVVGIEVTGGPDIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG +HLRDVF KQMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCEHLRDVFSKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPL  220



>ref|XP_006428887.1| hypothetical protein CICLE_v10012554mg [Citrus clementina]
 ref|XP_006480586.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic-like [Citrus sinensis]
 gb|ESR42127.1| hypothetical protein CICLE_v10012554mg [Citrus clementina]
Length=250

 Score =   367 bits (942),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 192/220 (87%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YP VS EY KA+EKC+RKLRG IAEK CAP++LR+AWHSAGT+DV TK+GGP+GT+
Sbjct  1    MGKCYPKVSDEYQKAVEKCKRKLRGLIAEKHCAPIILRLAWHSAGTYDVNTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  H AN GLDIAV+LLEP K+QFPI+S+AD YQLAGVVAVE+TGGPE+PFHPGR 
Sbjct  61   RHPDELAHEANNGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  +PP EGRLPNA KG+DHLRDVF   MGLSDKDIV LSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKSDPPPEGRLPNATKGSDHLRDVF-GHMGLSDKDIVVLSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  180  NNPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPL  219



>ref|XP_010458002.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic isoform X2 [Camelina 
sativa]
Length=249

 Score =   367 bits (942),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +YLKAIEKCRRKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MVKNYPTVSEDYLKAIEKCRRKLRGMIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN+G+ +A++ LEP +EQFP IS AD +QLAGVV +E+TGGP++PFHPGR+
Sbjct  61   RFDAEQAHGANSGIHVALRFLEPIREQFPTISFADFHQLAGVVGIEVTGGPDIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG +HLRDVF KQMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCEHLRDVFSKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPL  220



>ref|XP_010488105.1| PREDICTED: L-ascorbate peroxidase 1, cytosolic isoform X2 [Camelina 
sativa]
Length=249

 Score =   367 bits (942),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +YLKAIEKCRRKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MVKNYPTVSEDYLKAIEKCRRKLRGMIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQ HGAN+G+ +A++ LEP +EQFP IS AD +QLAGVV +E+TGGP++PFHPGR+
Sbjct  61   RFDAEQAHGANSGIHVALRFLEPIREQFPTISFADFHQLAGVVGIEVTGGPDIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG +HLRDVF KQMGLSDKDIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCEHLRDVFSKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQL SDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPL  220



>sp|A2XFC7.1|APX1_ORYSI RecName: Full=L-ascorbate peroxidase 1, cytosolic; Short=APXa; 
AltName: Full=OsAPx01 [Oryza sativa Indica Group]
 gb|EAY89537.1| hypothetical protein OsI_11071 [Oryza sativa Indica Group]
Length=250

 Score =   367 bits (941),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 191/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VSAEY +A+EK R+KLR  IAEK CAPLMLR+AWHSAGTFDV +K+GGP+GTM
Sbjct  1    MAKNYPVVSAEYQEAVEKARQKLRALIAEKSCAPLMLRLAWHSAGTFDVSSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  H AN GLDIAV++LEP KE+ P IS+AD YQLAGVVAVE++GGP VPFHPGR+
Sbjct  61   KTPAELSHAANAGLDIAVRMLEPIKEEIPTISYADFYQLAGVVAVEVSGGPAVPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P PP EGRLP+A KG+DHLR VF  QMGLSD+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPAPPPEGRLPDATKGSDHLRQVFGAQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            RNPL FDNSYFTELLSG+KEGLLQLPSDKALLSDP F PL
Sbjct  181  RNPLQFDNSYFTELLSGDKEGLLQLPSDKALLSDPAFCPL  220



>ref|XP_009798830.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic [Nicotiana sylvestris]
Length=250

 Score =   367 bits (941),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 194/220 (88%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YP VS EY KA+EKC+RKLRG IAEK CAP++LR+AWHSAGT+DV+TK+GGP+GT+
Sbjct  1    MGKCYPKVSEEYEKAVEKCKRKLRGLIAEKNCAPIILRLAWHSAGTYDVKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGP++PFHPGRQ
Sbjct  61   RHLDELKHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPDIPFHPGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+A KG+DHLR+VF   MGLSDKDIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKTEPPPEGRLPDATKGSDHLREVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVF PL
Sbjct  180  NNPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFCPL  219



>gb|AHF27426.1| ascorbate peroxidase, partial [Cucurbita maxima]
Length=249

 Score =   366 bits (940),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 195/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YP+VS EY KAIEK +RKLRGFIAEK CAPL+LR+AWHSAGTFD ++++GGP+GT+
Sbjct  1    MVKCYPSVSEEYQKAIEKAKRKLRGFIAEKNCAPLILRLAWHSAGTFDKKSRTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVEITGGPE+PFHPGR+
Sbjct  61   RFPNELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLR+VF   MGLSD+DIVALSGGHTLGR HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRNVFY-TMGLSDQDIVALSGGHTLGRAHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL+GEKEGLLQL SDKALLSDPVFRPL
Sbjct  180  SNPLIFDNSYFKELLAGEKEGLLQLVSDKALLSDPVFRPL  219



>gb|KHG05754.1| L-ascorbate peroxidase 2, cytosolic [Gossypium arboreum]
Length=250

 Score =   366 bits (939),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 169/220 (77%), Positives = 191/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS EY  A+++ +RKLR  IAEK CAPLMLR+AWHSAGTFDV+TK+GGP+GT+
Sbjct  1    MTKCYPTVSEEYQNAVQRAKRKLRALIAEKNCAPLMLRLAWHSAGTFDVKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  H AN GLDIAV+LL+P KEQ PI+S+AD YQLAGVVAVEITGGPE+PFHPGR+
Sbjct  61   KQPAELAHAANNGLDIAVRLLDPIKEQLPILSYADFYQLAGVVAVEITGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P PP EGRLPNA +G DHLR VF  QMGL+D+DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPHPPPEGRLPNATEGADHLRQVFSNQMGLNDQDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL+GEK+GLLQLP+DK LLSDPVFRPL
Sbjct  181  TNPLIFDNSYFKELLTGEKDGLLQLPTDKVLLSDPVFRPL  220



>ref|XP_006381499.1| hypothetical protein POPTR_0006s13440g [Populus trichocarpa]
 gb|ERP59296.1| hypothetical protein POPTR_0006s13440g [Populus trichocarpa]
Length=247

 Score =   365 bits (938),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 193/220 (88%), Gaps = 3/220 (1%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS EY KA+EKC+RKLRG IAEK CAPLMLR+AWHSAGTFDV TK+GGP+GT+
Sbjct  1    MGKSYPTVSEEYQKAVEKCKRKLRGLIAEKHCAPLMLRLAWHSAGTFDVHTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GLDIA++LLEP KEQFPI+S+AD YQLAGVVAVE+TGGPE+PFHPGR 
Sbjct  61   RHPDELAHGANNGLDIAIRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
             +P P  EGRLP+A KG+DHLRDVF   MGLSD DIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  SDPPP--EGRLPDATKGSDHLRDVF-GHMGLSDTDIVALSGGHTLGRCHKERSGFEGPWT  177

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPL+FDNSYF ELLSGEKEGL+QLPSDK LL DPVFRPL
Sbjct  178  PNPLVFDNSYFKELLSGEKEGLIQLPSDKTLLEDPVFRPL  217



>dbj|BAO42878.1| ascorbate peroxidase [Brassica rapa subsp. pekinensis]
Length=250

 Score =   365 bits (938),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 169/220 (77%), Positives = 191/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EY KAIEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MTKNYPAVSEEYQKAIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GL IA++LLEP +EQFP ISHAD +QLAGVVAVE+TGGPE+PFHPG +
Sbjct  61   RFDDELAHGANNGLHIALRLLEPIREQFPTISHADFHQLAGVVAVEVTGGPEIPFHPGGE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF+KQMGL+D+DIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRQVFLKQMGLTDQDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLDDPVFRPL  220



>emb|CAA55209.1| L-ascorbate peroxidase [Raphanus sativus]
Length=250

 Score =   365 bits (938),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EY K IEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD  +++GGP+GTM
Sbjct  1    MTKNYPAVSEEYQKEIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCASRTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GL IA++LLEP +EQFP ISHAD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFDDELAHGANNGLHIALRLLEPIREQFPTISHADFHQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A K  DHLR VF+KQMGL+D+DIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKACDHLRQVFLKQMGLTDQDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLDDPVFRPL  220



>gb|AHF27424.1| ascorbate peroxidase, partial [Cucurbita moschata]
Length=249

 Score =   365 bits (938),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 175/220 (80%), Positives = 194/220 (88%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YP+VS EY KAIEK +RKLRGFIAEK CAPL+LR+AWHSAGTFD ++++GGP+GT+
Sbjct  1    MVKCYPSVSEEYQKAIEKAKRKLRGFIAEKNCAPLILRLAWHSAGTFDKKSRTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVEITGGPE+ FHPGR+
Sbjct  61   RFPNELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEITGGPEITFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF   MGLSD+DIVALSGGHTLGR HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFY-TMGLSDQDIVALSGGHTLGRAHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL+GEKEGLLQL SDKALLSDPVFRPL
Sbjct  180  SNPLIFDNSYFKELLAGEKEGLLQLVSDKALLSDPVFRPL  219



>gb|AAX84679.1| ascorbate peroxidase APX2 [Manihot esculenta]
 gb|AAX84680.1| ascorbate peroxidase APX3 [Manihot esculenta]
Length=250

 Score =   365 bits (938),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 172/219 (79%), Positives = 190/219 (87%), Gaps = 0/219 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EY KAI+K RRKLRGFIAEKGCAPLMLRIAWHSAGT+DV+T +GGP+GTM
Sbjct  1    MPKNYPKVSEEYQKAIDKARRKLRGFIAEKGCAPLMLRIAWHSAGTYDVKTNTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AEQGH AN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVEITGGP++PFHPGR+
Sbjct  61   RHAAEQGHAANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEITGGPDIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLPNA KG DHLR+VF K MGL+DKDIV LSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPNATKGADHLREVFGKTMGLTDKDIVVLSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRP  789
             NPLIFDNS+F  LL    E LLQLP+D  L++DPVFRP
Sbjct  181  PNPLIFDNSFFQVLLDEPTEDLLQLPTDSVLVTDPVFRP  219



>ref|XP_010089357.1| L-ascorbate peroxidase 2 [Morus notabilis]
 gb|EXB37691.1| L-ascorbate peroxidase 2 [Morus notabilis]
Length=324

 Score =   368 bits (945),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 196/228 (86%), Gaps = 9/228 (4%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYP VS EY KA+EKC+RKLRG IAEK CAP++LR+AW SAGTFDV+TK+GGP+GT+
Sbjct  1    MGKSYPKVSEEYQKAVEKCKRKLRGLIAEKHCAPIILRLAWQSAGTFDVKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGR-  489
            R  AE GH AN GLDIAV+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGPE+PFHPGR 
Sbjct  61   RHPAELGHVANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRP  120

Query  490  -------QDNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKER  648
                   QD  E P EGRLPNA KG+DHLRDVF   MGLSDKDIVALSGGHTLGRCHK+R
Sbjct  121  TLESVLTQDKQELPPEGRLPNATKGSDHLRDVF-GHMGLSDKDIVALSGGHTLGRCHKDR  179

Query  649  SGFEGPWTRNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            SGFEGPWT NPLIFDNSYF ELLSGEKEGL+QLPSDKALL DP+FRPL
Sbjct  180  SGFEGPWTTNPLIFDNSYFKELLSGEKEGLIQLPSDKALLEDPIFRPL  227



>gb|KDO73087.1| hypothetical protein CISIN_1g024615mg [Citrus sinensis]
Length=265

 Score =   365 bits (938),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 184/235 (78%), Positives = 201/235 (86%), Gaps = 15/235 (6%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +Y KA+EKC+RKLRGFIAEK CAPLMLRIAWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            RL AEQ H AN GLDIAV+LLEPFKEQFP IS+ADLYQLAGVV VE+TGGP++PFHPGR 
Sbjct  61   RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+A +GNDHLR VF  QMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFT---------------ELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            RNPLIFDNSYFT               ELL+GEK+GLLQLPSDKALL DPVFRPL
Sbjct  181  RNPLIFDNSYFTYVSLVSLPDMFGCVLELLTGEKDGLLQLPSDKALLDDPVFRPL  235



>gb|AII01419.1| ascorbate peroxidase [Zostera marina]
Length=250

 Score =   365 bits (936),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YP V  EY KA+EKC+RKLRG IAE  CAP+MLRIAWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MAKCYPDVGEEYQKAVEKCKRKLRGVIAENNCAPIMLRIAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            ++K E  HGAN GL IAV +L+P K+ FPI+S+ D YQLAGVVAVE+TGGP+VPFHPGR+
Sbjct  61   KMKIELAHGANNGLIIAVNILDPIKDLFPILSYGDFYQLAGVVAVEVTGGPDVPFHPGRK  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  +PP+EGRLP+A +G DHLR VFV QMGLSDKDIVALSGGHTLGRCHK+RSGFEGPWT
Sbjct  121  DKNDPPVEGRLPDATQGADHLRQVFVTQMGLSDKDIVALSGGHTLGRCHKDRSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL+GEKEGLL+LP+DK LLSDPVFRPL
Sbjct  181  ANPLIFDNSYFKELLAGEKEGLLKLPTDKVLLSDPVFRPL  220



>pdb|3ZCH|A Chain A, Ascorbate Peroxidase W41a-h42m Mutant
Length=261

 Score =   365 bits (937),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 194/218 (89%), Gaps = 0/218 (0%)
 Frame = +1

Query  139  KSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMRL  318
            KSYPTVSA+Y KA+EK ++KLRGFIAEK CAPLMLR+A  SAGTFD  TK+GGP+GT++ 
Sbjct  14   KSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAAMSAGTFDKGTKTGGPFGTIKH  73

Query  319  KAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQDN  498
             AE  H AN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+D 
Sbjct  74   PAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDK  133

Query  499  PEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRN  678
            PEPP EGRLP+A KG+DHLRDVF K MGL+D+DIVALSGGHT+G  HKERSGFEGPWT N
Sbjct  134  PEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWTSN  193

Query  679  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  194  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  231



>gb|KDP29067.1| hypothetical protein JCGZ_16456 [Jatropha curcas]
Length=250

 Score =   364 bits (934),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 196/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YP VS EY KA+EKC+RKLRG IAEK CAP++LR+AWH+AGTFDV T++GGP+GT+
Sbjct  1    MGKIYPKVSEEYQKAVEKCKRKLRGLIAEKHCAPIVLRLAWHAAGTFDVNTRTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            RL+ E  H AN GLDIAV+LL+P K+QFPI+++AD YQLAGVVAVEITGGPE+PFHPGR 
Sbjct  61   RLQEELAHEANNGLDIAVRLLQPIKDQFPILTYADFYQLAGVVAVEITGGPEIPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  +PP EGRLP+A KG+DHLRDVF  +MGLSDKDIVALSGGHTLGRCHKERSG+EGPWT
Sbjct  121  DKTDPPPEGRLPDAAKGSDHLRDVF-GRMGLSDKDIVALSGGHTLGRCHKERSGYEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGL+QLP+DKALL DPVFRPL
Sbjct  180  LNPLIFDNSYFKELLSGEKEGLIQLPTDKALLEDPVFRPL  219



>gb|KDO55249.1| hypothetical protein CISIN_1g025588mg [Citrus sinensis]
Length=250

 Score =   364 bits (934),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 192/220 (87%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YP VS EY KA+EKC+RKLRG IAEK CAP++LR+AWHSAGT+DV TK+GGP+GT+
Sbjct  1    MGKCYPKVSDEYQKAVEKCKRKLRGLIAEKHCAPIILRLAWHSAGTYDVNTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  H AN GLDIAV+LLEP ++QFPI+S+AD YQLAGVVAVE+TGGPE+PFHPGR 
Sbjct  61   RHPDELAHEANNGLDIAVRLLEPIEQQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  +PP EGRLPNA KG+DHLRDVF   MGLSDK+IV LSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKSDPPPEGRLPNATKGSDHLRDVF-GHMGLSDKEIVVLSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  180  NNPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPL  219



>ref|XP_008350397.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic [Malus domestica]
Length=250

 Score =   364 bits (934),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 191/220 (87%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS EY KA+EKC+RKLRG IAEK CAP++LR+AWHSAGTFD+ TK+GGP+GT+
Sbjct  1    MVKQYPTVSEEYQKAVEKCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDIHTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  H AN GLDI V+LLEP KEQFPI+S+AD YQLAGVVAVE+TGGPE+PFHPGR 
Sbjct  61   RHPEELAHEANNGLDIXVRLLEPIKEQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+A KG+DHLRDVF   MGLSDK IVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKQEPPPEGRLPDATKGSDHLRDVF-GHMGLSDKXIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL+GEKEGLLQLPSDKALL DPVFRPL
Sbjct  180  TNPLIFDNSYFKELLNGEKEGLLQLPSDKALLEDPVFRPL  219



>ref|XP_002960880.1| hypothetical protein SELMODRAFT_270176 [Selaginella moellendorffii]
 gb|EFJ38419.1| hypothetical protein SELMODRAFT_270176 [Selaginella moellendorffii]
Length=250

 Score =   364 bits (934),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 169/220 (77%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYP VS EY  A+EK +RKLRGFIAEK CAPLMLR+AWHSAGT+D Q+K+GGP+GTM
Sbjct  1    MGKSYPAVSEEYKAAVEKAKRKLRGFIAEKNCAPLMLRLAWHSAGTYDCQSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +L  E GH AN GLDIAVKLL+P K+QFPI+S+ D YQLAGVVAVE+TGGPE+PFHPGR 
Sbjct  61   KLAEELGHTANNGLDIAVKLLQPIKDQFPILSYGDFYQLAGVVAVEVTGGPEIPFHPGRV  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P  P+EGRLP+A KG DHLRDVFVK MGL+DKDIVALSGGHTLGR HKERSGFEGPWT
Sbjct  121  DKPTCPMEGRLPDATKGADHLRDVFVKHMGLTDKDIVALSGGHTLGRAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPL FDNSYFT LLSGE+EG+L LP+DK L+ DP FRPL
Sbjct  181  HNPLQFDNSYFTILLSGEQEGILTLPTDKVLVEDPSFRPL  220



>pdb|3ZCG|A Chain A, Ascorbate Peroxidase W41a-h42c Mutant
Length=261

 Score =   364 bits (934),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 194/218 (89%), Gaps = 0/218 (0%)
 Frame = +1

Query  139  KSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMRL  318
            KSYPTVSA+Y KA+EK ++KLRGFIAEK CAPLMLR+A  SAGTFD  TK+GGP+GT++ 
Sbjct  14   KSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAACSAGTFDKGTKTGGPFGTIKH  73

Query  319  KAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQDN  498
             AE  H AN GLDIAV+LLEP K +FPI+S+AD YQLAGVVAVE+TGGPEVPFHPGR+D 
Sbjct  74   PAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDK  133

Query  499  PEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRN  678
            PEPP EGRLP+A KG+DHLRDVF K MGL+D+DIVALSGGHT+G  HKERSGFEGPWT N
Sbjct  134  PEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWTSN  193

Query  679  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  194  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  231



>ref|XP_007027230.1| Ascorbate peroxidase 2 isoform 1 [Theobroma cacao]
 gb|EOY07732.1| Ascorbate peroxidase 2 isoform 1 [Theobroma cacao]
Length=251

 Score =   363 bits (932),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 173/218 (79%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = +1

Query  139  KSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMRL  318
            K YPTVS EY KA+++C+RKLRG IAEK CAP++LR+AWHSAGTFDV TK+GGP+GT+R 
Sbjct  4    KCYPTVSEEYQKAVQRCKRKLRGLIAEKHCAPIILRLAWHSAGTFDVNTKTGGPFGTIRH  63

Query  319  KAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQDN  498
              E  H AN GLDIAV+LLEP KEQFPI+S AD YQLAGVVAVE+TGGPE+PFHPGR D 
Sbjct  64   PDELAHDANNGLDIAVRLLEPIKEQFPILSFADFYQLAGVVAVEVTGGPEIPFHPGRPDK  123

Query  499  PEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRN  678
             EPP EGRLP A KG+DHLRDVF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT N
Sbjct  124  TEPPPEGRLPEATKGSDHLRDVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTNN  182

Query  679  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            PLIFDNSYF ELLSGEKEGL+QLP+DKALL DPVFRPL
Sbjct  183  PLIFDNSYFKELLSGEKEGLIQLPTDKALLEDPVFRPL  220



>ref|XP_007027231.1| Ascorbate peroxidase 2 isoform 2 [Theobroma cacao]
 gb|EOY07733.1| Ascorbate peroxidase 2 isoform 2 [Theobroma cacao]
Length=246

 Score =   363 bits (931),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 173/218 (79%), Positives = 190/218 (87%), Gaps = 1/218 (0%)
 Frame = +1

Query  139  KSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTMRL  318
            K YPTVS EY KA+++C+RKLRG IAEK CAP++LR+AWHSAGTFDV TK+GGP+GT+R 
Sbjct  4    KCYPTVSEEYQKAVQRCKRKLRGLIAEKHCAPIILRLAWHSAGTFDVNTKTGGPFGTIRH  63

Query  319  KAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQDN  498
              E  H AN GLDIAV+LLEP KEQFPI+S AD YQLAGVVAVE+TGGPE+PFHPGR D 
Sbjct  64   PDELAHDANNGLDIAVRLLEPIKEQFPILSFADFYQLAGVVAVEVTGGPEIPFHPGRPDK  123

Query  499  PEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRN  678
             EPP EGRLP A KG+DHLRDVF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT N
Sbjct  124  TEPPPEGRLPEATKGSDHLRDVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTNN  182

Query  679  PLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            PLIFDNSYF ELLSGEKEGL+QLP+DKALL DPVFRPL
Sbjct  183  PLIFDNSYFKELLSGEKEGLIQLPTDKALLEDPVFRPL  220



>ref|XP_007205773.1| hypothetical protein PRUPE_ppa010426mg [Prunus persica]
 gb|EMJ06972.1| hypothetical protein PRUPE_ppa010426mg [Prunus persica]
Length=250

 Score =   363 bits (931),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 192/220 (87%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS EY KA++KC+RKLRG IAEK CAP++LR+AWHSAGTFDVQ+K+GGP+GT+
Sbjct  1    MAKCYPTVSEEYQKAVDKCKRKLRGHIAEKHCAPIILRLAWHSAGTFDVQSKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  H AN GLDIAV+LLEP KE+FPI+S+AD YQLAGVVAVEITGGP+VPFHPGR 
Sbjct  61   RHPEELAHEANNGLDIAVRLLEPIKEKFPILSYADFYQLAGVVAVEITGGPDVPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+ +KG+DHLRDVF   MGLSDKDIV LSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKQEPPPEGRLPDGSKGSDHLRDVF-GHMGLSDKDIVVLSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF EL SGEKEGL+QLPSDKALL DPVFRPL
Sbjct  180  TNPLIFDNSYFKELFSGEKEGLIQLPSDKALLEDPVFRPL  219



>gb|ACM17463.1| ascorbate peroxidase [Citrus maxima]
Length=250

 Score =   362 bits (930),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 190/220 (86%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YP VS EY KA+EKC+RKLRG IAEK CAP++LR+AWHSAGT+DV TK+GGP+GT+
Sbjct  1    MGKCYPKVSDEYQKAVEKCKRKLRGLIAEKHCAPIILRLAWHSAGTYDVNTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
                E  H AN GLDIAV+LLEP K+QFPI+S+AD YQLAGVVAVE+TGGPE+PFHPGR 
Sbjct  61   SHPDELAHEANNGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  +PP EGR PNA KG+DHLRDVF   MGLSDKDIV LSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKSDPPPEGRSPNATKGSDHLRDVF-GHMGLSDKDIVVLSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFRPL
Sbjct  180  NNPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPL  219



>gb|ABK23188.1| unknown [Picea sitchensis]
 gb|ABK24212.1| unknown [Picea sitchensis]
 gb|ACN40916.1| unknown [Picea sitchensis]
Length=249

 Score =   362 bits (930),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 192/217 (88%), Gaps = 1/217 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS EY  AI+K +RKLR  IAEK CAP+M+RIAWHSAGTFDV+TK+GGP+GTM
Sbjct  1    MVKAYPTVSEEYKTAIDKAKRKLRALIAEKNCAPIMVRIAWHSAGTFDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AE  HGAN+GLDIAV+LLEP KEQFP IS+ADLYQLAGVVAVE+TGGP++PFHPGR+
Sbjct  61   RYPAELAHGANSGLDIAVRLLEPIKEQFPTISYADLYQLAGVVAVEVTGGPDIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+A KG+DHLR VF   MGLSDK+IVALSG HTLGRCHKERSGFEGPWT
Sbjct  121  DKLEPPEEGRLPDATKGSDHLRAVF-GHMGLSDKEIVALSGAHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVF  783
             NPLIFDNSYFTEL++GEKEGLLQLPSDKALL+DP F
Sbjct  180  SNPLIFDNSYFTELVTGEKEGLLQLPSDKALLTDPSF  216



>ref|XP_002967132.1| hypothetical protein SELMODRAFT_144791 [Selaginella moellendorffii]
 gb|EFJ31731.1| hypothetical protein SELMODRAFT_144791 [Selaginella moellendorffii]
Length=250

 Score =   362 bits (930),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 168/220 (76%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYP VS EY  A+EK +RKLRGFIAEK CAPL+LR+AWHSAGT+D Q+K+GGP+GTM
Sbjct  1    MGKSYPAVSEEYKAAVEKAKRKLRGFIAEKNCAPLILRLAWHSAGTYDCQSKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +L  E GH AN GLDIAVKLL+P K+QFPI+S+ D YQLAGVVAVE+TGGPE+PFHPGR 
Sbjct  61   KLAEELGHTANNGLDIAVKLLQPIKDQFPILSYGDFYQLAGVVAVEVTGGPEIPFHPGRV  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P  P+EGRLP+A KG DHLRDVFVK MGL+DKDIVALSGGHTLGR HKERSGFEGPWT
Sbjct  121  DKPTCPMEGRLPDATKGADHLRDVFVKHMGLTDKDIVALSGGHTLGRAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPL FDNSYFT LLSGE+EG+L LP+DK L+ DP FRPL
Sbjct  181  HNPLQFDNSYFTILLSGEQEGILTLPTDKVLVEDPSFRPL  220



>gb|AIP90105.1| ascorbate peroxidase [Musa AB Group]
Length=249

 Score =   362 bits (929),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 191/220 (87%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYP VS EY KA+EK RRKLRG IAEK CAP+MLR+AWHSAGT+DV TK+GGP+GT+
Sbjct  1    MGKSYPAVSEEYQKAVEKARRKLRGLIAEKNCAPIMLRLAWHSAGTYDVSTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AE  HGAN G DIA++LLEP KEQFP +  AD YQLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFAAELAHGANNGPDIALRLLEPIKEQFPTLPFADFYQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  +PP EGRLP+A KG+DHLRDVF   MGLSD+DIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKTQPPEEGRLPDATKGSDHLRDVF-GHMGLSDQDIVALSGGHTLGRCHKERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEK+ ++QLPSDKALL+DPVFRPL
Sbjct  180  SNPLIFDNSYFKELLSGEKDDVIQLPSDKALLTDPVFRPL  219



>dbj|BAE48791.1| cytosolic ascorbate peroxidase [Codonopsis lanceolata]
Length=251

 Score =   362 bits (928),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 191/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTV+ EY KA+EKC++KLRG IAEK CAPL+LR+AWH+AGT+D +TK+GGP+GT+
Sbjct  1    MGKCYPTVTEEYEKAVEKCKKKLRGLIAEKKCAPLILRLAWHAAGTYDYKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  H AN GLDIAV+LLEP K+QFPI+S+AD  QLAG+VAVE+TGGPE+PFHPGR+
Sbjct  61   RSPEELSHAANNGLDIAVRLLEPIKQQFPILSYADFDQLAGIVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  +PP EGRLPNA KG DHLR VF  QMGLSD+DIV LSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKTKPPPEGRLPNATKGTDHLRQVFGHQMGLSDQDIVTLSGGHTLGRCHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELL+GEKEGLLQLP+DK LL DPVFRPL
Sbjct  181  FNPLIFDNSYFKELLAGEKEGLLQLPTDKVLLEDPVFRPL  220



>emb|CAA72247.1| L-ascorbate peroxidase [Brassica napus]
Length=250

 Score =   361 bits (927),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 190/220 (86%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YP VS EY KAIEKC+RKLRG IAEK CAP+M+R+AWHSAGTFD  +++G P+GTM
Sbjct  1    MTKNYPAVSEEYQKAIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCASRTGVPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  HGAN+GL IA++LLEP +EQFP ISHAD +QLAGVVAVE+TGGPE+PFHPGR+
Sbjct  61   RFDGELAHGANSGLHIALRLLEPIREQFPTISHADFHQLAGVVAVEVTGGPEIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A K  DHLR VF+KQM L+D+DIVALSG HTLGRCHK+RSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKACDHLRQVFLKQMVLTDQDIVALSGAHTLGRCHKDRSGFEGAWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL +PVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLDEPVFRPL  220



>gb|ABK26677.1| unknown [Picea sitchensis]
 gb|ABR17644.1| unknown [Picea sitchensis]
Length=250

 Score =   361 bits (927),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 189/218 (87%), Gaps = 1/218 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY K++EKC+RKLRG IAEK CAP+MLR+AWHSAGT+DV++K+GGP+GT+
Sbjct  1    MGKLYPTVSEEYQKSVEKCKRKLRGLIAEKKCAPIMLRLAWHSAGTYDVKSKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  H AN GLDIA++LLEP KEQFP IS+AD YQLAGVVA+EITGGP++PFHPGR 
Sbjct  61   RHSDELSHNANNGLDIAIRLLEPIKEQFPTISYADFYQLAGVVAIEITGGPDIPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLRDVF   MGL+DKDIVALSG HTLGRCHKERSGFEG WT
Sbjct  121  DKPEPPEEGRLPDATKGVDHLRDVF-GHMGLTDKDIVALSGAHTLGRCHKERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFR  786
             NPLIFDN YF ELLSGEKEGLLQLPSDKALL DPVFR
Sbjct  180  SNPLIFDNCYFKELLSGEKEGLLQLPSDKALLEDPVFR  217



>dbj|BAE92285.1| putative ascorbate peroxidase [Cryptomeria japonica]
Length=249

 Score =   361 bits (926),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 194/220 (88%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YP VS EY KAI+KCRRKLR  IAEK CAP+M+R+AWH+AGT+DV++K+GGP+GT+
Sbjct  1    MVKVYPQVSEEYKKAIDKCRRKLRALIAEKNCAPIMVRLAWHAAGTYDVKSKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  +E  HGAN+GLDIA+KLLEP K QFPI+++ADLY+LAGVVAVE+TGGP++PFHPGR+
Sbjct  61   RHPSELAHGANSGLDIAIKLLEPIKAQFPIVTYADLYELAGVVAVEVTGGPDIPFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLRDVF   MGLSD+DIVALSG HTLG CHKERSGFEGPWT
Sbjct  121  DKPEPPEEGRLPDATKGADHLRDVF-GHMGLSDQDIVALSGAHTLGSCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYFTEL++GEKEGLLQLPSDKALL+DP F PL
Sbjct  180  SNPLIFDNSYFTELVTGEKEGLLQLPSDKALLTDPKFAPL  219



>ref|XP_010046851.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic [Eucalyptus grandis]
 gb|KCW88853.1| hypothetical protein EUGRSUZ_A01180 [Eucalyptus grandis]
Length=249

 Score =   360 bits (924),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 189/220 (86%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YP VS EY KA  KC+RKLRG IAEK CAP++LR+AWHSAGTFDVQTK+GGP+GT+
Sbjct  1    MAKRYPNVSEEYRKAAAKCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVQTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AE  H AN GLDIAV+LLEP K QFPI+S+AD YQLAGVVAVEITGGPE+PFHPGR 
Sbjct  61   RHSAELAHEANNGLDIAVRLLEPIKAQFPILSYADFYQLAGVVAVEITGGPEIPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP A KG+DHLR VF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKNEPPPEGRLPEATKGSDHLRQVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSG+KEGL++LPSDKAL+ DP+FRPL
Sbjct  180  TNPLIFDNSYFKELLSGDKEGLIKLPSDKALIEDPIFRPL  219



>gb|KCW51442.1| hypothetical protein EUGRSUZ_J00965 [Eucalyptus grandis]
Length=240

 Score =   360 bits (923),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS EY KA+EKC++KLRG IAEK CAPLMLRIAWHSAGTFDV+TK+GGP+GTM
Sbjct  1    MGKSYPTVSEEYKKAVEKCKKKLRGLIAEKSCAPLMLRIAWHSAGTFDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN+GLD+AV+LL+P K+QFP+I++AD YQLAGVVAVE+TGGPEV FHPGR+
Sbjct  61   KHAAELSHGANSGLDVAVRLLQPIKDQFPVITYADFYQLAGVVAVEVTGGPEVAFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF  QMGLSDKDIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRQVFGVQMGLSDKDIVALSGGHTLGRCHKERSGFEGTWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEK+ LLQLPSDKALL+DPVFRPL
Sbjct  181  ANPLIFDNSYFKELLSGEKKELLQLPSDKALLADPVFRPL  220



>gb|ABK23077.1| unknown [Picea sitchensis]
 gb|ACN40084.1| unknown [Picea sitchensis]
Length=250

 Score =   360 bits (923),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 189/218 (87%), Gaps = 1/218 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGK YPTVS EY K++EKC+RKLRG IAEK CAP+MLR+AWHSAGT+DV++K+GGP+GT+
Sbjct  1    MGKLYPTVSEEYQKSVEKCKRKLRGLIAEKKCAPIMLRLAWHSAGTYDVKSKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  H AN GLDIA++LLEP KEQFP IS+AD YQLAGVVA+EITGGP++PFHPGR 
Sbjct  61   RHSDELSHNANNGLDIAIRLLEPIKEQFPTISYADFYQLAGVVAIEITGGPDIPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG DHLRDVF   MGL+DK IVALSG HTLGRCHKERSGFEG WT
Sbjct  121  DKPEPPEEGRLPDATKGVDHLRDVF-GHMGLTDKGIVALSGAHTLGRCHKERSGFEGAWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFR  786
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALL DPVFR
Sbjct  180  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFR  217



>ref|XP_010032055.1| PREDICTED: L-ascorbate peroxidase, cytosolic-like [Eucalyptus 
grandis]
 gb|KCW51440.1| hypothetical protein EUGRSUZ_J00965 [Eucalyptus grandis]
 gb|KCW51441.1| hypothetical protein EUGRSUZ_J00965 [Eucalyptus grandis]
Length=250

 Score =   359 bits (922),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYPTVS EY KA+EKC++KLRG IAEK CAPLMLRIAWHSAGTFDV+TK+GGP+GTM
Sbjct  1    MGKSYPTVSEEYKKAVEKCKKKLRGLIAEKSCAPLMLRIAWHSAGTFDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  AE  HGAN+GLD+AV+LL+P K+QFP+I++AD YQLAGVVAVE+TGGPEV FHPGR+
Sbjct  61   KHAAELSHGANSGLDVAVRLLQPIKDQFPVITYADFYQLAGVVAVEVTGGPEVAFHPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D P+PP EGRLP+A KG DHLR VF  QMGLSDKDIVALSGGHTLGRCHKERSGFEG WT
Sbjct  121  DKPQPPPEGRLPDATKGCDHLRQVFGVQMGLSDKDIVALSGGHTLGRCHKERSGFEGTWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEK+ LLQLPSDKALL+DPVFRPL
Sbjct  181  ANPLIFDNSYFKELLSGEKKELLQLPSDKALLADPVFRPL  220



>ref|XP_008239139.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic [Prunus mume]
Length=250

 Score =   359 bits (922),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 192/220 (87%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPTVS  Y KA++KC+RKLRG IAEK CAP++LR+AWHSAGTFDVQ+++GGP+GT+
Sbjct  1    MAKCYPTVSEGYKKAVDKCKRKLRGHIAEKHCAPIILRLAWHSAGTFDVQSRTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  H AN GLDIAV+LLEP KE+FPI+S+AD YQLAGVVAVEITGGP+VPFHPGR 
Sbjct  61   RHPEELAHEANNGLDIAVRLLEPIKEKFPILSYADFYQLAGVVAVEITGGPDVPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+ +KG+DHLRDVF   MGLSDKDIV LSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKQEPPPEGRLPDGSKGSDHLRDVF-GHMGLSDKDIVVLSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGL+QLPSDKALL DPVFRPL
Sbjct  180  TNPLIFDNSYFKELLSGEKEGLIQLPSDKALLEDPVFRPL  219



>ref|XP_006407656.1| hypothetical protein EUTSA_v10021381mg [Eutrema salsugineum]
 gb|ESQ49109.1| hypothetical protein EUTSA_v10021381mg [Eutrema salsugineum]
Length=252

 Score =   358 bits (920),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 193/220 (88%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M KSYP V+ +Y KAI++C+RKLRG IAEK CAP++LR+AWHSAGTFDV+TK+GGPYGT+
Sbjct  1    MVKSYPEVTEDYKKAIQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPYGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  H AN GLDIAV+LL+P KE FPI+S+AD YQLAGVVAVEITGGPE+PFHPGR 
Sbjct  61   RHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRL  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP A KG DHLRDVF  +MGL+DKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKVEPPPEGRLPQATKGVDHLRDVF-GRMGLNDKDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            +NPLIFDNSYF E+LSGEKEGLLQLP+DKALL DP+FRPL
Sbjct  180  QNPLIFDNSYFKEILSGEKEGLLQLPTDKALLQDPLFRPL  219



>ref|XP_008359525.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate peroxidase 2, cytosolic-like 
[Malus domestica]
Length=246

 Score =   358 bits (919),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 174/221 (79%), Positives = 191/221 (86%), Gaps = 2/221 (1%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YPT+S EY KA+EKC+RKLRG I EK CAP++LR+AWHSAGTFD++TK+GGP+GT+
Sbjct  1    MVKQYPTMSEEYQKAVEKCKRKLRGLIXEKNCAPIILRLAWHSAGTFDIETKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R   E  H AN GLDIAV+LLEP KEQFPI+S+AD YQLAGV AVEITGGPE+PFHPGR 
Sbjct  61   RHPEELAHEANNGLDIAVRLLEPXKEQFPILSYADFYQLAGVXAVEITGGPEIPFHPGRP  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLPNA +G+DHLR VF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKQEPPPEGRLPNATEGSDHLRAVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPS-DKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPS DKALL DPVFRPL
Sbjct  180  TNPLIFDNSYFKELLSGEKEGLLQLPSIDKALLEDPVFRPL  220



>ref|XP_011094725.1| PREDICTED: L-ascorbate peroxidase 2, cytosolic [Sesamum indicum]
Length=250

 Score =   357 bits (916),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 169/220 (77%), Positives = 192/220 (87%), Gaps = 1/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K YP VS EY  A+EKC+RKLRGFIAEK CAP++LR+AWHSAGT+D +TK+GGP+GT+
Sbjct  1    MVKKYPVVSEEYQAAVEKCKRKLRGFIAEKQCAPIVLRLAWHSAGTYDWKTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            R  AE  H AN GLDIAV+LLEP K+QFPI+S+AD YQLAGVVAVE+TGGPE+PFH GRQ
Sbjct  61   RHPAELSHEANNGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEVTGGPEIPFHAGRQ  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  +PP EGRLP+A KG++HLR+VF   MGLSDKDIVALSGGHTLGRCHKERSGFEGPWT
Sbjct  121  DKTDPPPEGRLPDAKKGSEHLREVF-GHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  179

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            RNPLIFDNSYF ELLSGEKEGL+QLP+DKALL D  FRPL
Sbjct  180  RNPLIFDNSYFKELLSGEKEGLIQLPTDKALLEDRSFRPL  219



>ref|XP_007132164.1| hypothetical protein PHAVU_011G071300g [Phaseolus vulgaris]
 gb|AGV54549.1| cytosolic ascorbate peroxidase [Phaseolus vulgaris]
 gb|ESW04158.1| hypothetical protein PHAVU_011G071300g [Phaseolus vulgaris]
Length=250

 Score =   357 bits (915),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/220 (81%), Positives = 198/220 (90%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            MGKSYP+VSA+Y KAIEK +RKLRGFIAEK CAPLMLR+AWHSAGTFDV TK+GGP+GT+
Sbjct  1    MGKSYPSVSADYQKAIEKAKRKLRGFIAEKRCAPLMLRLAWHSAGTFDVSTKTGGPFGTI  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            +  +E  HGAN GLDIAV+LLEP K +FPI+S+AD YQLAGVV VE+TGGPEVPF+PGR+
Sbjct  61   KHPSELAHGANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVGVEVTGGPEVPFYPGRE  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D PEPP EGRLP+A KG+DHLRDVF K MGLSD+DIVALSGGHT+G  HKERSGFEGPWT
Sbjct  121  DKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTIGAAHKERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
             NPLIFDNSYF ELLSGEKEGLLQLPSDKALLSDPVFRPL
Sbjct  181  SNPLIFDNSYFKELLSGEKEGLLQLPSDKALLSDPVFRPL  220



>gb|ADK38619.1| ascorbate peroxidase [Citrus limon]
Length=250

 Score =   355 bits (911),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 182/220 (83%), Positives = 201/220 (91%), Gaps = 0/220 (0%)
 Frame = +1

Query  133  MGKSYPTVSAEYLKAIEKCRRKLRGFIAEKGCAPLMLRIAWHSAGTFDVQTKSGGPYGTM  312
            M K+YPTVS +Y KA++KC+RKLRGFIAEK CAPLMLRIAWHSAGT+DV+TK+GGP+GTM
Sbjct  1    MTKNYPTVSEDYKKAVKKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM  60

Query  313  RLKAEQGHGANTGLDIAVKLLEPFKEQFPIISHADLYQLAGVVAVEITGGPEVPFHPGRQ  492
            RL AEQ H AN GLDIAV+LLEPFKEQFP IS+ADLYQLAGVV VE+TGGP++PFHPGR 
Sbjct  61   RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD  120

Query  493  DNPEPPLEGRLPNANKGNDHLRDVFVKQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWT  672
            D  EPP EGRLP+A +GNDHLR VF  QMGLSDKDIVALSGGHTLGRCH+ERSGFEGPWT
Sbjct  121  DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHRERSGFEGPWT  180

Query  673  RNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPL  792
            RNPLIFDNSYFTELL+GEK+GLLQLPSDKALL DPVFRPL
Sbjct  181  RNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPL  220



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1450662993712