BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15915_g1_i2 len=198 path=[128:0-110 239:111-197]

Length=198
                                                                      Score     E

ref|XP_007133113.1|  hypothetical protein PHAVU_011G152400g           88.6    2e-18   
ref|XP_009757564.1|  PREDICTED: G-type lectin S-receptor-like ser...  88.2    3e-18   
ref|XP_009768622.1|  PREDICTED: G-type lectin S-receptor-like ser...  86.7    9e-18   
ref|XP_009624080.1|  PREDICTED: receptor-like serine/threonine-pr...  86.7    1e-17   
ref|XP_006343406.1|  PREDICTED: receptor-like serine/threonine-pr...  84.7    6e-17   
ref|XP_009370608.1|  PREDICTED: G-type lectin S-receptor-like ser...  84.0    8e-17   
ref|XP_009361761.1|  PREDICTED: G-type lectin S-receptor-like ser...  84.0    8e-17   
ref|XP_009361760.1|  PREDICTED: G-type lectin S-receptor-like ser...  84.0    8e-17   
ref|XP_007025881.1|  S-locus lectin protein kinase family protein...  83.6    1e-16   
gb|KGN64596.1|  hypothetical protein Csa_1G070610                     83.2    1e-16   
ref|XP_009370697.1|  PREDICTED: G-type lectin S-receptor-like ser...  83.2    1e-16   
ref|XP_004505470.1|  PREDICTED: uncharacterized protein LOC101500771  83.6    2e-16   
ref|XP_004164063.1|  PREDICTED: G-type lectin S-receptor-like ser...  83.2    2e-16   
ref|XP_004146620.1|  PREDICTED: G-type lectin S-receptor-like ser...  83.2    2e-16   
ref|XP_009370405.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.4    3e-16   
ref|XP_009352927.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.4    3e-16   
ref|XP_011030934.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.4    3e-16   
ref|XP_006377797.1|  hypothetical protein POPTR_0011s12930g           82.4    3e-16   
ref|XP_007213399.1|  hypothetical protein PRUPE_ppa026218mg           82.4    3e-16   
gb|KHN45738.1|  G-type lectin S-receptor-like serine/threonine-pr...  82.0    3e-16   
ref|XP_003532567.1|  PREDICTED: G-type lectin S-receptor-like ser...  82.0    4e-16   
ref|XP_002530641.1|  B-Raf proto-oncogene serine/threonine-protei...  82.4    4e-16   Ricinus communis
ref|XP_009370304.1|  PREDICTED: G-type lectin S-receptor-like ser...  79.0    4e-16   
ref|XP_009591798.1|  PREDICTED: G-type lectin S-receptor-like ser...  81.6    5e-16   
ref|XP_009370055.1|  PREDICTED: G-type lectin S-receptor-like ser...  78.6    6e-16   
emb|CBI20433.3|  unnamed protein product                              77.4    6e-16   
ref|XP_007159227.1|  hypothetical protein PHAVU_002G219900g           81.3    7e-16   
ref|XP_010433919.1|  PREDICTED: cysteine-rich receptor-like prote...  80.9    7e-16   
ref|XP_010448730.1|  PREDICTED: putative cysteine-rich receptor-l...  79.7    7e-16   
ref|XP_009352344.1|  PREDICTED: G-type lectin S-receptor-like ser...  78.6    8e-16   
gb|KHN28392.1|  G-type lectin S-receptor-like serine/threonine-pr...  80.9    9e-16   
ref|XP_006582222.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.9    1e-15   
ref|XP_006582221.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.9    1e-15   
ref|XP_007133116.1|  hypothetical protein PHAVU_011G152700g           80.9    1e-15   
ref|XP_007021201.1|  S-locus lectin protein kinase family protein...  80.5    1e-15   
emb|CAN70178.1|  hypothetical protein VITISV_000003                   80.5    1e-15   Vitis vinifera
ref|XP_007214501.1|  hypothetical protein PRUPE_ppa018069mg           80.5    1e-15   
ref|XP_011015680.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.5    1e-15   
ref|XP_010448723.1|  PREDICTED: cysteine-rich receptor-like prote...  79.7    1e-15   
ref|XP_011003373.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.5    1e-15   
ref|XP_010448721.1|  PREDICTED: cysteine-rich receptor-like prote...  80.1    1e-15   
ref|XP_010448722.1|  PREDICTED: cysteine-rich receptor-like prote...  80.1    2e-15   
ref|XP_008372832.1|  PREDICTED: G-type lectin S-receptor-like ser...  80.1    2e-15   
ref|XP_007213646.1|  hypothetical protein PRUPE_ppa001663mg           80.1    2e-15   
ref|XP_010439188.1|  PREDICTED: cysteine-rich receptor-like prote...  79.7    2e-15   
ref|XP_010445180.1|  PREDICTED: putative cysteine-rich receptor-l...  79.7    2e-15   
ref|XP_008371231.1|  PREDICTED: receptor-like serine/threonine-pr...  76.3    2e-15   
ref|XP_008349266.1|  PREDICTED: G-type lectin S-receptor-like ser...  79.0    2e-15   
ref|XP_008362569.1|  PREDICTED: G-type lectin S-receptor-like ser...  77.4    2e-15   
ref|XP_010247752.1|  PREDICTED: receptor-like serine/threonine-pr...  79.7    2e-15   
sp|O65483.2|CRK24_ARATH  RecName: Full=Cysteine-rich receptor-lik...  79.3    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007133709.1|  hypothetical protein PHAVU_011G202200g           79.7    3e-15   
ref|XP_010316635.1|  PREDICTED: G-type lectin S-receptor-like ser...  79.3    3e-15   
ref|XP_008345502.1|  PREDICTED: uncharacterized protein LOC103408424  79.3    3e-15   
ref|XP_008454614.1|  PREDICTED: G-type lectin S-receptor-like ser...  79.3    4e-15   
ref|XP_008454615.1|  PREDICTED: G-type lectin S-receptor-like ser...  79.3    4e-15   
ref|XP_009370505.1|  PREDICTED: G-type lectin S-receptor-like ser...  79.0    5e-15   
gb|KHG05572.1|  hypothetical protein F383_31410                       79.0    5e-15   
ref|XP_008383964.1|  PREDICTED: G-type lectin S-receptor-like ser...  79.0    5e-15   
ref|XP_004154883.1|  PREDICTED: receptor-like serine/threonine-pr...  79.0    7e-15   
ref|XP_004146866.1|  PREDICTED: receptor-like serine/threonine-pr...  78.6    7e-15   
ref|XP_006582220.1|  PREDICTED: G-type lectin S-receptor-like ser...  78.2    8e-15   
ref|XP_007214214.1|  hypothetical protein PRUPE_ppa021071mg           78.2    8e-15   
ref|XP_006284983.1|  hypothetical protein CARUB_v10006289mg           77.8    8e-15   
ref|XP_008232167.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...  78.2    9e-15   
ref|XP_008384001.1|  PREDICTED: cysteine-rich receptor-like prote...  74.3    9e-15   
ref|XP_003607714.1|  Cysteine-rich receptor-like protein kinase       78.2    9e-15   
ref|XP_008386060.1|  PREDICTED: G-type lectin S-receptor-like ser...  77.8    1e-14   
ref|XP_009349779.1|  PREDICTED: uncharacterized protein LOC103941313  78.2    1e-14   
ref|XP_009137323.1|  PREDICTED: LOW QUALITY PROTEIN: putative cys...  75.9    1e-14   
ref|XP_007213028.1|  hypothetical protein PRUPE_ppa023127mg           77.8    1e-14   
ref|XP_008386058.1|  PREDICTED: G-type lectin S-receptor-like ser...  77.8    1e-14   
ref|XP_007133048.1|  hypothetical protein PHAVU_011G147100g           77.8    1e-14   
ref|XP_007133049.1|  hypothetical protein PHAVU_011G147100g           77.8    1e-14   
gb|KEH30779.1|  cysteine-rich RLK (receptor-like kinase) protein      77.8    1e-14   
ref|XP_007021127.1|  S-locus lectin protein kinase family protein...  77.8    1e-14   
ref|XP_011002478.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  78.2    1e-14   
ref|XP_008386059.1|  PREDICTED: G-type lectin S-receptor-like ser...  77.8    1e-14   
ref|XP_009361851.1|  PREDICTED: G-type lectin S-receptor-like ser...  77.8    1e-14   
ref|XP_007021124.1|  S-locus lectin protein kinase family protein...  77.8    1e-14   
ref|XP_003607717.1|  Cysteine-rich receptor-like protein kinase       77.8    1e-14   
ref|XP_010247749.1|  PREDICTED: G-type lectin S-receptor-like ser...  77.8    1e-14   
ref|XP_007021216.1|  Serine/threonine-protein kinase receptor, pu...  78.2    1e-14   
gb|AES89911.2|  S-locus lectin kinase family protein                  77.4    1e-14   
ref|XP_007214643.1|  hypothetical protein PRUPE_ppa001761mg           77.4    1e-14   
ref|XP_008345858.1|  PREDICTED: G-type lectin S-receptor-like ser...  77.4    1e-14   
ref|XP_006370372.1|  hypothetical protein POPTR_0001s42070g           77.4    1e-14   
ref|XP_006582737.1|  PREDICTED: uncharacterized protein LOC100812022  77.8    1e-14   
ref|XP_007212501.1|  hypothetical protein PRUPE_ppa017634mg           77.4    1e-14   
ref|XP_010052476.1|  PREDICTED: G-type lectin S-receptor-like ser...  77.4    1e-14   
ref|XP_010433921.1|  PREDICTED: putative cysteine-rich receptor-l...  77.4    2e-14   
ref|XP_008225013.1|  PREDICTED: G-type lectin S-receptor-like ser...  77.4    2e-14   
ref|XP_007133112.1|  hypothetical protein PHAVU_011G152300g           77.0    2e-14   
gb|KCW76500.1|  hypothetical protein EUGRSUZ_D00887                   74.7    2e-14   
ref|XP_008369911.1|  PREDICTED: G-type lectin S-receptor-like ser...  74.3    2e-14   
ref|XP_010644397.1|  PREDICTED: uncharacterized protein LOC100262430  77.4    2e-14   
ref|XP_007213580.1|  hypothetical protein PRUPE_ppa014995mg           76.6    2e-14   
ref|XP_007133111.1|  hypothetical protein PHAVU_011G152300g           77.0    2e-14   
ref|XP_007133110.1|  hypothetical protein PHAVU_011G152300g           77.0    2e-14   
gb|KEH30775.1|  S-locus lectin kinase family protein                  77.0    2e-14   
ref|XP_008386061.1|  PREDICTED: G-type lectin S-receptor-like ser...  77.0    2e-14   
ref|XP_007099569.1|  S-locus-specific glycoprotein S6, putative       73.2    2e-14   
gb|KHN28391.1|  G-type lectin S-receptor-like serine/threonine-pr...  76.6    3e-14   
ref|XP_009361847.1|  PREDICTED: G-type lectin S-receptor-like ser...  76.6    3e-14   
ref|XP_006582223.1|  PREDICTED: G-type lectin S-receptor-like ser...  76.6    3e-14   
ref|XP_006594795.1|  PREDICTED: G-type lectin S-receptor-like ser...  76.6    3e-14   
ref|XP_009355685.1|  PREDICTED: uncharacterized protein LOC103946653  77.0    3e-14   
ref|XP_008358731.1|  PREDICTED: G-type lectin S-receptor-like ser...  76.6    3e-14   
ref|XP_004295401.1|  PREDICTED: G-type lectin S-receptor-like ser...  76.6    3e-14   
gb|KCW76501.1|  hypothetical protein EUGRSUZ_D00889                   76.6    3e-14   
ref|XP_010451227.1|  PREDICTED: cysteine-rich receptor-like prote...  76.3    3e-14   
ref|XP_009136919.1|  PREDICTED: putative cysteine-rich receptor-l...  76.3    3e-14   
ref|XP_008386045.1|  PREDICTED: G-type lectin S-receptor-like ser...  76.3    3e-14   
gb|KDO74333.1|  hypothetical protein CISIN_1g003832mg                 76.3    3e-14   
ref|XP_006475243.1|  PREDICTED: G-type lectin S-receptor-like ser...  76.3    3e-14   
ref|XP_008226159.1|  PREDICTED: G-type lectin S-receptor-like ser...  76.6    4e-14   
gb|KCW76518.1|  hypothetical protein EUGRSUZ_D00907                   75.9    4e-14   
ref|XP_010240988.1|  PREDICTED: receptor-like serine/threonine-pr...  76.3    4e-14   
ref|XP_002518594.1|  Negative regulator of the PHO system, putative   76.6    4e-14   Ricinus communis
ref|XP_007133047.1|  hypothetical protein PHAVU_011G147000g           76.3    4e-14   
emb|CBI20438.3|  unnamed protein product                              76.3    4e-14   
ref|XP_009370814.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  76.6    4e-14   
gb|KHN28389.1|  Receptor-like serine/threonine-protein kinase SD1-8   76.3    4e-14   
ref|XP_008789837.1|  PREDICTED: receptor-like serine/threonine-pr...  76.6    4e-14   
gb|KCW76519.1|  hypothetical protein EUGRSUZ_D00907                   75.9    4e-14   
ref|XP_009136911.1|  PREDICTED: putative cysteine-rich receptor-l...  76.3    4e-14   
emb|CDY10848.1|  BnaC01g14630D                                        76.3    4e-14   
ref|XP_009377332.1|  PREDICTED: uncharacterized protein LOC103965953  76.6    4e-14   
ref|XP_002530266.1|  S-locus-specific glycoprotein S13 precursor,...  76.3    4e-14   Ricinus communis
ref|XP_002316689.2|  hypothetical protein POPTR_0011s02090g           76.3    4e-14   Populus trichocarpa [western balsam poplar]
ref|XP_008355367.1|  PREDICTED: G-type lectin S-receptor-like ser...  74.7    4e-14   
ref|XP_007214639.1|  hypothetical protein PRUPE_ppa001616mg           76.3    4e-14   
ref|XP_010644286.1|  PREDICTED: G-type lectin S-receptor-like ser...  76.3    4e-14   
gb|KCW76498.1|  hypothetical protein EUGRSUZ_D00886                   76.6    4e-14   
ref|XP_010644287.1|  PREDICTED: G-type lectin S-receptor-like ser...  76.3    4e-14   
ref|XP_008363599.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.9    4e-14   
emb|CDY41245.1|  BnaA01g12940D                                        75.9    5e-14   
ref|XP_006377803.1|  hypothetical protein POPTR_0011s13030g           72.4    5e-14   
ref|XP_007021200.1|  S-locus lectin protein kinase family protein     76.3    5e-14   
ref|XP_011008158.1|  PREDICTED: G-type lectin S-receptor-like ser...  75.9    5e-14   
gb|KDP34761.1|  hypothetical protein JCGZ_10541                       75.9    5e-14   
ref|XP_007021206.1|  S-locus lectin protein kinase family protein...  76.3    5e-14   
gb|KEH19660.1|  S-locus lectin kinase family protein                  75.9    5e-14   
ref|XP_010052477.1|  PREDICTED: G-type lectin S-receptor-like ser...  75.9    5e-14   
gb|EYU33571.1|  hypothetical protein MIMGU_mgv1a020014mg              75.9    5e-14   
gb|KEH19659.1|  S-locus lectin kinase family protein                  75.9    5e-14   
ref|XP_010052478.1|  PREDICTED: G-type lectin S-receptor-like ser...  75.9    5e-14   
ref|XP_008226752.1|  PREDICTED: G-type lectin S-receptor-like ser...  75.9    6e-14   
gb|KCW76512.1|  hypothetical protein EUGRSUZ_D00902                   74.3    6e-14   
ref|XP_008226748.1|  PREDICTED: G-type lectin S-receptor-like ser...  75.5    6e-14   
ref|XP_008441715.1|  PREDICTED: G-type lectin S-receptor-like ser...  75.9    6e-14   
ref|XP_010433928.1|  PREDICTED: cysteine-rich receptor-like prote...  75.5    6e-14   
ref|XP_006377788.1|  hypothetical protein POPTR_0011s12840g           75.9    6e-14   
ref|XP_002316940.2|  hypothetical protein POPTR_0011s13040g           75.5    6e-14   Populus trichocarpa [western balsam poplar]
ref|XP_003526165.1|  PREDICTED: G-type lectin S-receptor-like ser...  75.5    6e-14   
ref|XP_010054453.1|  PREDICTED: uncharacterized protein LOC104442758  75.9    7e-14   
gb|KHN28390.1|  Receptor-like serine/threonine-protein kinase SD1-8   75.5    7e-14   
gb|KDO75650.1|  hypothetical protein CISIN_1g005599mg                 75.5    7e-14   
ref|XP_006283296.1|  hypothetical protein CARUB_v10004334mg           75.5    7e-14   
ref|XP_002316691.2|  hypothetical protein POPTR_0011s02060g           75.5    7e-14   Populus trichocarpa [western balsam poplar]
gb|KCW76510.1|  hypothetical protein EUGRSUZ_D00899                   75.5    7e-14   
ref|XP_008224902.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  75.9    7e-14   
ref|XP_006582219.1|  PREDICTED: G-type lectin S-receptor-like ser...  75.5    7e-14   
ref|XP_010445184.1|  PREDICTED: putative cysteine-rich receptor-l...  74.7    8e-14   
ref|NP_194060.3|  cysteine-rich receptor-like protein kinase 21       75.5    8e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006449167.1|  hypothetical protein CICLE_v10014259mg           75.5    8e-14   
ref|NP_849550.1|  cysteine-rich receptor-like protein kinase 21       75.1    8e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010644302.1|  PREDICTED: G-type lectin S-receptor-like ser...  75.5    8e-14   
gb|KEH30777.1|  Serine/Threonine kinase family protein                75.5    8e-14   
ref|XP_007021195.1|  S-locus lectin protein kinase family protein...  75.5    8e-14   
ref|XP_010644300.1|  PREDICTED: G-type lectin S-receptor-like ser...  75.5    8e-14   
ref|XP_010644299.1|  PREDICTED: G-type lectin S-receptor-like ser...  75.5    8e-14   
ref|XP_008372163.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.6    8e-14   
ref|XP_010052475.1|  PREDICTED: G-type lectin S-receptor-like ser...  75.5    8e-14   
ref|XP_008226333.1|  PREDICTED: G-type lectin S-receptor-like ser...  75.5    8e-14   
ref|XP_003607720.1|  Cysteine-rich receptor-like protein kinase       75.5    9e-14   
ref|XP_006387001.1|  hypothetical protein POPTR_2263s002002g          72.4    9e-14   
gb|KDP36269.1|  hypothetical protein JCGZ_09834                       74.7    9e-14   
ref|XP_008366485.1|  PREDICTED: receptor-like serine/threonine-pr...  75.5    1e-13   
ref|XP_002867725.1|  predicted protein                                74.7    1e-13   
ref|XP_007214023.1|  hypothetical protein PRUPE_ppa016527mg           75.1    1e-13   
ref|XP_010448735.1|  PREDICTED: putative cysteine-rich receptor-l...  74.3    1e-13   
ref|XP_009611412.1|  PREDICTED: G-type lectin S-receptor-like ser...  75.1    1e-13   
ref|XP_010445177.1|  PREDICTED: cysteine-rich receptor-like prote...  72.8    1e-13   
ref|XP_008441725.1|  PREDICTED: G-type lectin S-receptor-like ser...  75.1    1e-13   
ref|XP_009369777.1|  PREDICTED: G-type lectin S-receptor-like ser...  75.1    1e-13   
ref|XP_006383976.1|  hypothetical protein POPTR_0004s02760g           74.3    1e-13   
ref|XP_006286462.1|  hypothetical protein CARUB_v10000407mg           74.7    1e-13   
ref|XP_009587205.1|  PREDICTED: G-type lectin S-receptor-like ser...  75.1    1e-13   
gb|KCW67068.1|  hypothetical protein EUGRSUZ_F008421                  72.4    1e-13   
ref|XP_010445182.1|  PREDICTED: putative cysteine-rich receptor-l...  71.6    1e-13   
ref|XP_008363600.1|  PREDICTED: G-type lectin S-receptor-like ser...  71.6    1e-13   
ref|XP_006468224.1|  PREDICTED: uncharacterized protein LOC102627899  75.1    1e-13   
ref|XP_010644281.1|  PREDICTED: uncharacterized protein LOC100246941  75.1    1e-13   
ref|XP_006383979.1|  hypothetical protein POPTR_0004s02800g           73.6    1e-13   
gb|AES68383.2|  S-locus lectin kinase family protein                  74.7    1e-13   
gb|KHN28385.1|  Receptor-like serine/threonine-protein kinase SD1-8   74.7    1e-13   
ref|XP_010054462.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.9    1e-13   
ref|XP_006582722.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.9    1e-13   
ref|XP_011008152.1|  PREDICTED: G-type lectin S-receptor-like ser...  74.7    1e-13   
ref|XP_007212456.1|  hypothetical protein PRUPE_ppa017389mg           74.7    1e-13   
ref|XP_010247751.1|  PREDICTED: G-type lectin S-receptor-like ser...  74.7    1e-13   
ref|XP_007021194.1|  S-locus lectin protein kinase family protein...  74.7    1e-13   
emb|CBI20427.3|  unnamed protein product                              75.1    1e-13   
ref|XP_009136842.1|  PREDICTED: cysteine-rich receptor-like prote...  74.3    1e-13   
emb|CAN73738.1|  hypothetical protein VITISV_036172                   74.3    1e-13   Vitis vinifera
ref|XP_006592562.1|  PREDICTED: G-type lectin S-receptor-like ser...  74.7    1e-13   
ref|XP_010317453.1|  PREDICTED: G-type lectin S-receptor-like ser...  74.7    1e-13   
ref|XP_004234263.1|  PREDICTED: G-type lectin S-receptor-like ser...  74.7    1e-13   
gb|KHN05773.1|  G-type lectin S-receptor-like serine/threonine-pr...  74.7    2e-13   
ref|XP_006592561.1|  PREDICTED: G-type lectin S-receptor-like ser...  74.7    2e-13   
ref|XP_003593411.1|  S-receptor kinase-like protein                   74.7    2e-13   
ref|XP_003526146.1|  PREDICTED: G-type lectin S-receptor-like ser...  74.7    2e-13   
ref|XP_006582215.1|  PREDICTED: G-type lectin S-receptor-like ser...  74.7    2e-13   
gb|ABK95123.1|  unknown                                               73.6    2e-13   Populus trichocarpa [western balsam poplar]
gb|KDO74340.1|  hypothetical protein CISIN_1g003254mg                 74.3    2e-13   
gb|EYU32848.1|  hypothetical protein MIMGU_mgv1a022873mg              74.3    2e-13   
gb|KHN11180.1|  G-type lectin S-receptor-like serine/threonine-pr...  74.3    2e-13   
ref|XP_009397155.1|  PREDICTED: receptor-like serine/threonine-pr...  74.3    2e-13   
ref|XP_004295400.1|  PREDICTED: G-type lectin S-receptor-like ser...  74.3    2e-13   
ref|XP_006452072.1|  hypothetical protein CICLE_v10007451mg           74.3    2e-13   
ref|XP_010448734.1|  PREDICTED: putative cysteine-rich receptor-l...  74.3    2e-13   
ref|XP_009800154.1|  PREDICTED: G-type lectin S-receptor-like ser...  74.3    2e-13   
emb|CDY41241.1|  BnaA01g12980D                                        73.9    2e-13   
gb|KDP38976.1|  hypothetical protein JCGZ_00733                       74.3    2e-13   
ref|XP_006285512.1|  hypothetical protein CARUB_v10006953mg           72.8    2e-13   
emb|CAN70179.1|  hypothetical protein VITISV_000004                   74.3    2e-13   Vitis vinifera
ref|XP_009355686.1|  PREDICTED: G-type lectin S-receptor-like ser...  74.3    2e-13   
ref|XP_003526125.2|  PREDICTED: G-type lectin S-receptor-like ser...  74.3    2e-13   
ref|XP_006582198.1|  PREDICTED: G-type lectin S-receptor-like ser...  74.3    2e-13   
ref|XP_007021209.1|  S-locus-specific glycoprotein S6, putative i...  70.5    2e-13   
ref|XP_011012090.1|  PREDICTED: G-type lectin S-receptor-like ser...  74.3    2e-13   
gb|KHN38597.1|  Receptor-like serine/threonine-protein kinase SD1-8   73.9    2e-13   
ref|XP_010060393.1|  PREDICTED: G-type lectin S-receptor-like ser...  70.5    2e-13   
ref|XP_002316587.2|  hypothetical protein POPTR_0011s021802g          72.8    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_008363596.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.9    2e-13   
ref|XP_006592524.1|  PREDICTED: receptor-like serine/threonine-pr...  73.9    2e-13   
ref|XP_010647533.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.9    2e-13   
ref|XP_006449168.1|  hypothetical protein CICLE_v10018293mg           72.8    2e-13   
ref|XP_008225015.1|  PREDICTED: receptor-like serine/threonine-pr...  74.3    2e-13   
emb|CDY10924.1|  BnaA03g45830D                                        73.6    2e-13   
ref|XP_010247750.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.9    2e-13   
gb|KCW76511.1|  hypothetical protein EUGRSUZ_D00901                   72.8    2e-13   
ref|XP_010052484.1|  PREDICTED: receptor-like serine/threonine-pr...  73.9    2e-13   
ref|XP_009137329.1|  PREDICTED: cysteine-rich receptor-like prote...  73.9    2e-13   
ref|XP_010530411.1|  PREDICTED: putative cysteine-rich receptor-l...  73.9    2e-13   
ref|XP_007149662.1|  hypothetical protein PHAVU_005G088700g           73.9    2e-13   
ref|XP_003541757.1|  PREDICTED: receptor-like serine/threonine-pr...  73.9    2e-13   
gb|KHN35775.1|  G-type lectin S-receptor-like serine/threonine-pr...  73.9    3e-13   
ref|XP_010247747.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.9    3e-13   
gb|KGN64595.1|  hypothetical protein Csa_1G070600                     73.9    3e-13   
gb|KHN38599.1|  G-type lectin S-receptor-like serine/threonine-pr...  73.9    3e-13   
ref|XP_010247745.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.9    3e-13   
ref|XP_006577460.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.6    3e-13   
ref|XP_007214500.1|  hypothetical protein PRUPE_ppa018064mg           73.9    3e-13   
ref|XP_010644289.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.6    3e-13   
ref|XP_002528887.1|  S-locus-specific glycoprotein S6 precursor, ...  73.9    3e-13   Ricinus communis
ref|XP_008355368.1|  PREDICTED: G-type lectin S-receptor-like ser...  71.6    3e-13   
emb|CBI20460.3|  unnamed protein product                              73.6    3e-13   
ref|XP_009137328.1|  PREDICTED: cysteine-rich receptor-like prote...  73.6    3e-13   
ref|XP_006594796.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.9    3e-13   
gb|KGN64597.1|  hypothetical protein Csa_1G070620                     73.6    3e-13   
gb|KDP30509.1|  hypothetical protein JCGZ_16689                       73.6    3e-13   
ref|XP_006598304.1|  PREDICTED: uncharacterized protein LOC100797331  73.9    3e-13   
emb|CBI20422.3|  unnamed protein product                              70.1    3e-13   
emb|CBI20437.3|  unnamed protein product                              70.9    3e-13   
ref|XP_010436424.1|  PREDICTED: putative cysteine-rich receptor-l...  73.9    3e-13   
ref|XP_007021208.1|  S-locus-specific glycoprotein S6, putative i...  70.1    3e-13   
gb|AAM90694.1|AF403126_1  S-locus receptor-like kinase RLK14          73.6    3e-13   Oryza sativa [red rice]
ref|XP_004295782.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.9    3e-13   
gb|KHN36756.1|  G-type lectin S-receptor-like serine/threonine-pr...  73.6    3e-13   
ref|XP_006593148.1|  PREDICTED: uncharacterized protein LOC100812007  73.9    3e-13   
emb|CDY10864.1|  BnaC01g14790D                                        73.6    3e-13   
ref|XP_007214096.1|  hypothetical protein PRUPE_ppa015608mg           73.6    3e-13   
gb|KHN38600.1|  G-type lectin S-receptor-like serine/threonine-pr...  73.6    3e-13   
emb|CDY10854.1|  BnaC01g14690D                                        73.2    3e-13   
gb|KCW67248.1|  hypothetical protein EUGRSUZ_F01042                   72.8    3e-13   
ref|XP_010106715.1|  G-type lectin S-receptor-like serine/threoni...  73.6    3e-13   
gb|KDP20843.1|  hypothetical protein JCGZ_21314                       73.6    3e-13   
ref|XP_007212497.1|  hypothetical protein PRUPE_ppa017572mg           73.6    4e-13   
ref|XP_009354953.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.6    4e-13   
ref|XP_010052480.1|  PREDICTED: receptor-like serine/threonine-pr...  70.1    4e-13   
ref|NP_001053984.1|  Os04g0631800                                     73.6    4e-13   
emb|CDO99673.1|  unnamed protein product                              73.2    4e-13   
ref|XP_003607718.1|  Cysteine-rich receptor-like protein kinase       73.6    4e-13   
ref|XP_006594641.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.6    4e-13   
ref|XP_009355548.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.6    4e-13   
ref|XP_010268959.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.6    4e-13   
gb|KHN19082.1|  G-type lectin S-receptor-like serine/threonine-pr...  73.2    4e-13   
ref|XP_003598129.1|  Serine/threonine protein kinase                  72.0    4e-13   
ref|XP_008228523.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.6    4e-13   
ref|XP_006383982.1|  hypothetical protein POPTR_0004s02820g           73.6    4e-13   
ref|XP_006360116.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.6    4e-13   
ref|XP_009136868.1|  PREDICTED: cysteine-rich receptor-like prote...  73.2    4e-13   
ref|XP_007148275.1|  hypothetical protein PHAVU_006G194600g           73.6    4e-13   
ref|XP_010451228.1|  PREDICTED: cysteine-rich receptor-like prote...  73.2    4e-13   
ref|XP_009777837.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.6    4e-13   
ref|XP_006413565.1|  hypothetical protein EUTSA_v10024670mg           73.2    4e-13   
ref|XP_009777836.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.6    4e-13   
emb|CDY05483.1|  BnaA02g32080D                                        70.9    4e-13   
ref|XP_010665762.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.6    4e-13   
ref|XP_006383983.1|  hypothetical protein POPTR_0004s02820g           73.2    4e-13   
ref|XP_006391384.1|  hypothetical protein EUTSA_v10019425mg           69.7    4e-13   
ref|XP_002304971.2|  hypothetical protein POPTR_0004s02820g           73.2    4e-13   
emb|CAI44641.1|  OSJNBb0015D13.18                                     73.9    4e-13   
emb|CAJ86025.1|  B0808H03.2                                           73.9    4e-13   
ref|XP_006377216.1|  hypothetical protein POPTR_0011s02070g           73.2    4e-13   
emb|CBI20421.3|  unnamed protein product                              72.0    4e-13   
emb|CDY05366.1|  BnaC02g40740D                                        70.5    4e-13   
emb|CAJ86035.1|  H0105C05.10                                          73.6    5e-13   
gb|EYU32849.1|  hypothetical protein MIMGU_mgv1a001388mg              73.2    5e-13   
gb|EYU32850.1|  hypothetical protein MIMGU_mgv1a001388mg              73.2    5e-13   
ref|XP_006475248.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.2    5e-13   
ref|XP_006343404.1|  PREDICTED: uncharacterized protein LOC102601228  73.6    5e-13   
ref|XP_004146621.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.6    5e-13   
gb|KHG07104.1|  G-type lectin S-receptor-like serine/threonine-pr...  73.2    5e-13   
emb|CDY10870.1|  BnaC01g14850D                                        72.0    5e-13   
gb|KDO74347.1|  hypothetical protein CISIN_1g003391mg                 72.8    5e-13   
emb|CDY10868.1|  BnaC01g14830D                                        72.8    5e-13   
ref|XP_010448742.1|  PREDICTED: cysteine-rich receptor-like prote...  72.8    5e-13   
ref|XP_006370367.1|  hypothetical protein POPTR_0001s42020g           73.2    5e-13   
ref|XP_010448743.1|  PREDICTED: cysteine-rich receptor-like prote...  72.8    5e-13   
ref|XP_006475249.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.2    5e-13   
ref|XP_008224906.1|  PREDICTED: G-type lectin S-receptor-like ser...  73.2    5e-13   
ref|XP_006452075.1|  hypothetical protein CICLE_v10007466mg           73.2    5e-13   
gb|KDO74346.1|  hypothetical protein CISIN_1g003391mg                 73.2    5e-13   
ref|XP_007025869.1|  Receptor kinase 3                                73.2    6e-13   
gb|KHN19080.1|  G-type lectin S-receptor-like serine/threonine-pr...  72.8    6e-13   
ref|XP_006377224.1|  hypothetical protein POPTR_0011s02130g           70.5    6e-13   
ref|XP_006377792.1|  hypothetical protein POPTR_0011s12880g           72.8    6e-13   
ref|XP_010324340.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    6e-13   
gb|KDP38977.1|  hypothetical protein JCGZ_00734                       72.8    6e-13   
ref|XP_011029379.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    6e-13   
ref|XP_009408779.1|  PREDICTED: receptor-like serine/threonine-pr...  72.8    6e-13   
ref|XP_009355541.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    6e-13   
emb|CDP05835.1|  unnamed protein product                              72.8    6e-13   
ref|XP_009361850.1|  PREDICTED: uncharacterized protein LOC103952043  73.2    6e-13   
ref|XP_008358032.1|  PREDICTED: G-type lectin S-receptor-like ser...  71.6    6e-13   
ref|XP_010320278.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    6e-13   
ref|XP_009355540.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    6e-13   
ref|XP_009355538.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    6e-13   
emb|CBI20456.3|  unnamed protein product                              72.0    6e-13   
ref|XP_004295695.1|  PREDICTED: uncharacterized protein LOC101304265  73.2    6e-13   
gb|EEE61753.1|  hypothetical protein OsJ_16291                        73.2    6e-13   
ref|XP_006396901.1|  hypothetical protein EUTSA_v10028502mg           72.8    6e-13   
ref|XP_009129974.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...  71.6    6e-13   
ref|XP_010445181.1|  PREDICTED: putative cysteine-rich receptor-l...  72.8    6e-13   
gb|EEC78077.1|  hypothetical protein OsI_17553                        73.2    6e-13   
ref|XP_006377282.1|  hypothetical protein POPTR_0011s03710g           70.1    6e-13   
ref|XP_006475273.1|  PREDICTED: uncharacterized protein LOC102626595  73.2    6e-13   
ref|XP_006594643.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    6e-13   
ref|XP_006594642.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    6e-13   
ref|XP_007212629.1|  hypothetical protein PRUPE_ppa016146mg           72.4    7e-13   
ref|XP_006646397.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    7e-13   
ref|XP_011008156.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    7e-13   
ref|XP_010529589.1|  PREDICTED: putative cysteine-rich receptor-l...  72.4    7e-13   
ref|XP_011008157.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    7e-13   
ref|XP_008392323.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    7e-13   
ref|XP_009617832.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    7e-13   
ref|XP_009617833.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    7e-13   
emb|CAN77004.1|  hypothetical protein VITISV_027305                   72.8    7e-13   
ref|XP_002528889.1|  ATP binding protein, putative                    73.2    7e-13   
ref|XP_010064357.1|  PREDICTED: receptor-like serine/threonine-pr...  72.8    7e-13   
ref|XP_010064434.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...  72.8    7e-13   
sp|O65476.2|CRK16_ARATH  RecName: Full=Putative cysteine-rich rec...  72.4    7e-13   
ref|XP_004295392.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    7e-13   
emb|CAN70180.1|  hypothetical protein VITISV_000005                   69.7    7e-13   
ref|XP_008367405.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    8e-13   
dbj|BAJ98102.1|  predicted protein                                    72.4    8e-13   
ref|XP_003607719.1|  Serine/threonine protein kinase                  72.8    8e-13   
emb|CDY10920.1|  BnaA03g45790D                                        70.1    8e-13   
emb|CBI14789.3|  unnamed protein product                              69.7    8e-13   
ref|XP_003598133.1|  Serine/threonine protein kinase                  71.2    8e-13   
ref|XP_008226732.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.4    8e-13   
ref|XP_004295388.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.4    8e-13   
gb|KHN36352.1|  G-type lectin S-receptor-like serine/threonine-pr...  72.4    8e-13   
ref|XP_010054459.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    8e-13   
ref|XP_007214693.1|  hypothetical protein PRUPE_ppa024127mg           72.0    8e-13   
gb|KCW67236.1|  hypothetical protein EUGRSUZ_F01024                   72.4    9e-13   
ref|XP_010060465.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.4    9e-13   
ref|XP_006452071.1|  hypothetical protein CICLE_v10007645mg           72.4    9e-13   
ref|NP_194058.2|  cysteine-rich receptor-like protein kinase 19       72.0    9e-13   
ref|XP_008369984.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.8    9e-13   
gb|EMT01983.1|  Cysteine-rich receptor-like protein kinase 6          72.0    9e-13   
ref|XP_003526141.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.4    9e-13   
ref|XP_009345095.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.4    9e-13   
ref|XP_004234262.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.4    9e-13   
ref|XP_008226792.1|  PREDICTED: uncharacterized protein LOC103326355  72.8    9e-13   
gb|EAY76083.1|  hypothetical protein OsI_04010                        72.0    9e-13   
gb|EMT25968.1|  Putative serine/threonine-protein kinase receptor     72.4    1e-12   
ref|XP_006593151.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.4    1e-12   
gb|KHN36762.1|  G-type lectin S-receptor-like serine/threonine-pr...  72.4    1e-12   
gb|KCW70069.1|  hypothetical protein EUGRSUZ_F03372                   72.4    1e-12   
gb|KHN36765.1|  G-type lectin S-receptor-like serine/threonine-pr...  72.0    1e-12   
gb|AES89916.2|  S-locus lectin kinase family protein                  72.4    1e-12   
ref|XP_007212862.1|  hypothetical protein PRUPE_ppa021546mg           72.4    1e-12   
ref|XP_008226734.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.4    1e-12   
ref|XP_007214072.1|  hypothetical protein PRUPE_ppa017664mg           72.4    1e-12   
gb|AAP92126.1|  receptor-like protein kinase ARK1                     72.4    1e-12   
ref|NP_001044463.1|  Os01g0784700                                     72.4    1e-12   
dbj|BAD53361.1|  putative receptor-like protein kinase ARK1           72.4    1e-12   
emb|CDX94170.1|  BnaC07g38040D                                        72.0    1e-12   
ref|XP_007214410.1|  hypothetical protein PRUPE_ppa026351mg           72.4    1e-12   
ref|XP_007149663.1|  hypothetical protein PHAVU_005G088800g           72.0    1e-12   
emb|CBI33179.3|  unnamed protein product                              71.2    1e-12   
ref|XP_008225017.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.4    1e-12   
ref|XP_006356822.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.0    1e-12   
gb|KCW76507.1|  hypothetical protein EUGRSUZ_D00896                   72.0    1e-12   
ref|XP_007214794.1|  hypothetical protein PRUPE_ppa014934mg           72.0    1e-12   
ref|XP_006377805.1|  hypothetical protein POPTR_0011s130601g          69.3    1e-12   
ref|XP_010054457.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.4    1e-12   
gb|KHN35584.1|  G-type lectin S-receptor-like serine/threonine-pr...  72.0    1e-12   
ref|XP_010271902.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.0    1e-12   
ref|XP_007213637.1|  hypothetical protein PRUPE_ppa001795mg           72.0    1e-12   
ref|XP_003607713.1|  Receptor protein kinase                          72.0    1e-12   
ref|XP_003522060.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.0    1e-12   
ref|XP_007021631.1|  S-locus lectin protein kinase family protein     72.0    1e-12   
ref|XP_006576520.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.0    1e-12   
ref|XP_002316939.2|  hypothetical protein POPTR_0011s12830g           72.0    1e-12   
ref|XP_007213167.1|  hypothetical protein PRUPE_ppa026828mg           72.0    1e-12   
ref|XP_007214473.1|  hypothetical protein PRUPE_ppa023339mg           72.0    1e-12   
emb|CBI25825.3|  unnamed protein product                              71.6    1e-12   
ref|XP_008225014.1|  PREDICTED: uncharacterized protein LOC103324696  72.4    1e-12   
gb|KCW76531.1|  hypothetical protein EUGRSUZ_D00919                   69.7    1e-12   
ref|XP_006595444.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.4    1e-12   
ref|XP_007021205.1|  S-locus lectin protein kinase family protein...  72.0    1e-12   
ref|XP_009355542.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.0    1e-12   
gb|AES89910.2|  S-locus lectin kinase family protein                  72.0    1e-12   
ref|XP_008386049.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.0    1e-12   
ref|XP_008386047.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.0    1e-12   
gb|KHN13342.1|  G-type lectin S-receptor-like serine/threonine-pr...  72.0    1e-12   
ref|XP_009135684.1|  PREDICTED: putative cysteine-rich receptor-l...  71.6    1e-12   
ref|XP_006377277.1|  hypothetical protein POPTR_0011s036602g          68.9    1e-12   
ref|XP_008386046.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.0    1e-12   
ref|XP_006377231.1|  hypothetical protein POPTR_0011s02200g           72.0    1e-12   
ref|XP_007133103.1|  hypothetical protein PHAVU_011G151900g           72.0    1e-12   
ref|XP_010240482.1|  PREDICTED: receptor-like serine/threonine-pr...  72.0    1e-12   
ref|XP_007099540.1|  S-locus lectin protein kinase family protein     71.6    1e-12   
ref|XP_010240481.1|  PREDICTED: receptor-like serine/threonine-pr...  72.0    1e-12   
ref|XP_010064916.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  72.4    1e-12   
ref|XP_008226733.1|  PREDICTED: receptor-like serine/threonine-pr...  68.6    1e-12   
ref|XP_007021210.1|  S-locus lectin protein kinase family protein...  72.0    1e-12   
ref|XP_006386771.1|  hypothetical protein POPTR_0002s210401g          68.6    1e-12   
ref|XP_009355544.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.0    1e-12   
ref|XP_004238059.2|  PREDICTED: G-type lectin S-receptor-like ser...  72.0    1e-12   
ref|XP_009355543.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.0    1e-12   
gb|AFK35884.1|  unknown                                               70.1    1e-12   
ref|XP_010240989.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.0    1e-12   
emb|CBI20425.3|  unnamed protein product                              72.0    1e-12   
gb|EMT02927.1|  Putative serine/threonine-protein kinase receptor     71.6    1e-12   
ref|XP_007021196.1|  S-locus lectin protein kinase family protein...  72.0    1e-12   
ref|XP_010451232.1|  PREDICTED: cysteine-rich receptor-like prote...  71.6    1e-12   
ref|XP_006377227.1|  hypothetical protein POPTR_0011s021702g          70.1    1e-12   
emb|CDX79132.1|  BnaA01g11990D                                        71.6    1e-12   
ref|XP_007214543.1|  hypothetical protein PRUPE_ppa001808mg           71.6    1e-12   
ref|XP_008355366.1|  PREDICTED: G-type lectin S-receptor-like ser...  71.6    1e-12   
ref|XP_003608288.1|  Serine/threonine protein kinase                  71.6    1e-12   
gb|AES90485.2|  G-type lectin S-receptor-like Serine/Threonine-ki...  71.6    1e-12   
ref|XP_002316693.1|  hypothetical protein POPTR_0011s03620g           71.6    1e-12   
gb|EMT13210.1|  Putative serine/threonine-protein kinase receptor     71.6    1e-12   
ref|XP_008226190.1|  PREDICTED: G-type lectin S-receptor-like ser...  71.6    1e-12   
ref|XP_010455562.1|  PREDICTED: putative cysteine-rich receptor-l...  71.2    1e-12   
ref|XP_006452099.1|  hypothetical protein CICLE_v10009316mg           68.9    2e-12   
ref|XP_010644279.1|  PREDICTED: G-type lectin S-receptor-like ser...  71.6    2e-12   
ref|XP_008384002.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.0    2e-12   
ref|XP_010455560.1|  PREDICTED: putative cysteine-rich receptor-l...  71.6    2e-12   
ref|XP_007025878.1|  S-locus lectin protein kinase family protein...  71.6    2e-12   
ref|XP_010647107.1|  PREDICTED: G-type lectin S-receptor-like ser...  71.6    2e-12   
ref|XP_008348373.1|  PREDICTED: G-type lectin S-receptor-like ser...  72.0    2e-12   
emb|CDY10917.1|  BnaA03g45760D                                        71.2    2e-12   
tpg|DAA35834.1|  TPA: putative S-locus receptor-like protein kina...  71.6    2e-12   
ref|XP_007025867.1|  S-locus-specific glycoprotein S6, putative       71.6    2e-12   
ref|XP_009377330.1|  PREDICTED: G-type lectin S-receptor-like ser...  70.1    2e-12   
ref|XP_008364412.1|  PREDICTED: G-type lectin S-receptor-like ser...  71.6    2e-12   
ref|XP_007214211.1|  hypothetical protein PRUPE_ppa021012mg           71.2    2e-12   
gb|KDO74350.1|  hypothetical protein CISIN_1g005933mg                 71.2    2e-12   
ref|XP_009137711.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  70.1    2e-12   
ref|NP_192886.1|  putative cysteine-rich receptor-like protein ki...  71.2    2e-12   
ref|XP_006582208.1|  PREDICTED: G-type lectin S-receptor-like ser...  71.6    2e-12   
gb|KDP20845.1|  hypothetical protein JCGZ_21316                       71.6    2e-12   
ref|XP_006582209.1|  PREDICTED: G-type lectin S-receptor-like ser...  71.6    2e-12   
gb|KCW67078.1|  hypothetical protein EUGRSUZ_F00850                   70.1    2e-12   
ref|XP_010647105.1|  PREDICTED: G-type lectin S-receptor-like ser...  71.6    2e-12   
ref|XP_009778629.1|  PREDICTED: uncharacterized protein LOC104227947  71.6    2e-12   
ref|XP_008671072.1|  PREDICTED: receptor-like serine/threonine-pr...  71.6    2e-12   
ref|XP_009619490.1|  PREDICTED: G-type lectin S-receptor-like ser...  71.2    2e-12   
emb|CDY41243.1|  BnaA01g12960D                                        71.2    2e-12   
ref|XP_007025866.1|  S-locus-specific glycoprotein S6, putative       71.2    2e-12   
ref|XP_010320279.1|  PREDICTED: G-type lectin S-receptor-like ser...  71.2    2e-12   
emb|CAN64973.1|  hypothetical protein VITISV_025930                   71.6    2e-12   
ref|XP_010040962.1|  PREDICTED: G-type lectin S-receptor-like ser...  68.2    2e-12   
ref|XP_007021202.1|  S-locus lectin protein kinase family protein...  71.2    2e-12   
ref|XP_010455558.1|  PREDICTED: putative cysteine-rich receptor-l...  71.2    2e-12   
ref|XP_009352889.1|  PREDICTED: G-type lectin S-receptor-like ser...  71.2    2e-12   
ref|XP_009352888.1|  PREDICTED: G-type lectin S-receptor-like ser...  71.2    2e-12   
ref|XP_007133387.1|  hypothetical protein PHAVU_011G175000g           71.2    2e-12   
gb|KCW67251.1|  hypothetical protein EUGRSUZ_F01044                   70.9    2e-12   
gb|KCW67250.1|  hypothetical protein EUGRSUZ_F01044                   70.9    2e-12   
gb|KHN01760.1|  G-type lectin S-receptor-like serine/threonine-pr...  71.2    2e-12   
gb|KEH31162.1|  G-type lectin S-receptor-like Serine/Threonine-ki...  71.2    2e-12   



>ref|XP_007133113.1| hypothetical protein PHAVU_011G152400g [Phaseolus vulgaris]
 gb|ESW05107.1| hypothetical protein PHAVU_011G152400g [Phaseolus vulgaris]
Length=819

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPGFI  189
            M++VD++LGD+    EVLRCIHVGLLCVQLYP+DRP M+ VIFMLS+   L  PK PGF+
Sbjct  729  MKLVDAALGDTFTVSEVLRCIHVGLLCVQLYPEDRPNMASVIFMLSSENTLPTPKEPGFL  788

Query  190  FNQ  198
             ++
Sbjct  789  IDR  791



>ref|XP_009757564.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1 [Nicotiana sylvestris]
Length=841

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++++E+VD  LG+  +  EVLRCI +GLLCVQ Y +DRPIMSEV+FML N I+LA P  P
Sbjct  747  DKAIEVVDPLLGEWYETGEVLRCIQIGLLCVQSYANDRPIMSEVVFMLCNEIKLANPGQP  806

Query  181  GFIF  192
            GF+F
Sbjct  807  GFVF  810



>ref|XP_009768622.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Nicotiana sylvestris]
Length=831

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++++++ D  LGDS +  EVLRCIH+GLLCVQ + DDRP MSEV+FML N  +L  PK P
Sbjct  737  DKALDVADPLLGDSYEACEVLRCIHIGLLCVQSFVDDRPTMSEVVFMLCNETKLPFPKEP  796

Query  181  GFIF  192
             FIF
Sbjct  797  SFIF  800



>ref|XP_009624080.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nicotiana tomentosiformis]
Length=1599

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +1

Query  1     ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
             ++++++ D  LGDS +  EVLRCIH+GLLCVQ + DDRP MSEV+FML N  +L  PK P
Sbjct  1505  DKALDVADPLLGDSYEACEVLRCIHIGLLCVQSFVDDRPTMSEVVFMLCNETKLPFPKEP  1564

Query  181   GFIF  192
              FIF
Sbjct  1565  SFIF  1568



>ref|XP_006343406.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8-like 
[Solanum tuberosum]
Length=1642

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +1

Query  1     ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
             ++++++VD SLGD  +  EVLRCI +GLLCVQ Y ++RP+MS+V+FML N  +L+ P  P
Sbjct  1548  DKAIDVVDPSLGDWYESSEVLRCIQIGLLCVQSYANERPMMSQVVFMLCNETKLSNPGQP  1607

Query  181   GFIF  192
             GF+F
Sbjct  1608  GFVF  1611


 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +1

Query  13   EIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFML-SNNIELARPKPPGF  186
            E++DSS+G+S    EV+RCI VGLLCVQ   +DRP M+ V+ ML S    + +PK PGF
Sbjct  771  ELLDSSVGESFSPCEVIRCIQVGLLCVQEQAEDRPNMATVVLMLGSETATMPQPKHPGF  829



>ref|XP_009370608.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Pyrus x bretschneideri]
Length=838

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R++EI+DSSLG+S    +VLRCIH+ LLCVQ    DRP+MS V+FML N+  +  PK PG
Sbjct  745  RALEIIDSSLGESYPVNKVLRCIHIALLCVQEQAKDRPLMSAVVFMLGNDAAIPSPKQPG  804

Query  184  FIFNQ  198
            F+ N+
Sbjct  805  FLLNR  809



>ref|XP_009361761.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Pyrus x bretschneideri]
Length=822

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++ +E++D +L DS +  EV+RC+HVGLLCVQ  P+DRP MS V+ MLSN++ L  PK P
Sbjct  732  DKQLELIDKTLSDSSNMYEVVRCLHVGLLCVQRVPEDRPSMSSVVLMLSNDVALPSPKQP  791

Query  181  GF  186
            GF
Sbjct  792  GF  793



>ref|XP_009361760.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Pyrus x bretschneideri]
Length=825

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++ +E++D +L DS +  EV+RC+HVGLLCVQ  P+DRP MS V+ MLSN++ L  PK P
Sbjct  735  DKQLELIDKTLSDSSNMYEVVRCLHVGLLCVQRVPEDRPSMSSVVLMLSNDVALPSPKQP  794

Query  181  GF  186
            GF
Sbjct  795  GF  796



>ref|XP_007025881.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY28503.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=838

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            +R+ME+VDS+LGDS    E L+CI +GLLCVQ +  DRP MS V+FML N   LA PK P
Sbjct  746  DRAMEVVDSTLGDSCPANEFLKCIQIGLLCVQEHATDRPTMSTVVFMLGNETVLAPPKQP  805

Query  181  GFIFNQ  198
             FI  +
Sbjct  806  AFIMKK  811



>gb|KGN64596.1| hypothetical protein Csa_1G070610 [Cucumis sativus]
Length=704

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            + +MEIVDSSL +S  G E++RC+ +GLLCVQ  P DRP MS V FML N +E+  PK P
Sbjct  611  DNAMEIVDSSLEESSCGYEIMRCLQIGLLCVQEDPTDRPTMSTVTFMLENEVEVPSPKKP  670

Query  181  GFIFNQ  198
             FI  +
Sbjct  671  AFILKK  676



>ref|XP_009370697.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Pyrus x bretschneideri]
Length=752

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R++EI+DSSLG+S    EVLRCIH+ +LCVQ   +DRP+MS V+FML N+  +  PK PG
Sbjct  659  RALEIIDSSLGESYPVNEVLRCIHIAILCVQEQANDRPLMSAVVFMLGNDTAIPSPKQPG  718

Query  184  FIFNQ  198
            F+  +
Sbjct  719  FLLKR  723



>ref|XP_004505470.1| PREDICTED: uncharacterized protein LOC101500771 [Cicer arietinum]
Length=1629

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ER ++I+DS++ DS    EV RCIHVGLLCVQ YP+DRP M++VI ML + + L  PK P
Sbjct  716  ERELQIIDSNIEDSCVVSEVSRCIHVGLLCVQQYPEDRPTMADVILMLGSEMTLDEPKEP  775

Query  181  GFI  189
            GFI
Sbjct  776  GFI  778


 Score = 70.1 bits (170),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  4     RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
             +++E+++  + +S    EVLRCIHV LLCVQ YP+DRP M+ V+ ML + +EL   K PG
Sbjct  1536  KALELIEIKIKESCVVSEVLRCIHVSLLCVQQYPEDRPTMTSVVQMLGSEMELVEAKKPG  1595

Query  184   F  186
             F
Sbjct  1596  F  1596



>ref|XP_004164063.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1-like, partial [Cucumis sativus]
Length=973

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            + +MEIVDSSL +S  G E++RC+ +GLLCVQ  P DRP MS V FML N +E+  PK P
Sbjct  880  DNAMEIVDSSLEESSCGYEIMRCLQIGLLCVQEDPTDRPTMSTVTFMLENEVEVPSPKKP  939

Query  181  GFIFNQ  198
             FI  +
Sbjct  940  AFILKK  945



>ref|XP_004146620.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1-like [Cucumis sativus]
Length=1604

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            + +MEIVDSSL +S  G E++RC+ +GLLCVQ  P DRP MS V FML N +E+  PK P
Sbjct  726  DNAMEIVDSSLEESSCGYEIMRCLQIGLLCVQEDPTDRPTMSTVTFMLENEVEVPSPKKP  785

Query  181  GFIFNQ  198
             FI  +
Sbjct  786  AFILKK  791


 Score = 73.9 bits (180),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  1     ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
             + +ME+VDSSL  S    E+ RC+ +GLLCVQ  P DRP MS V+FML N   L  PK P
Sbjct  1507  DNAMELVDSSLEGSSFEYEITRCLQIGLLCVQEDPTDRPTMSTVVFMLENEANLPCPKKP  1566

Query  181   GFIFNQ  198
              FI  +
Sbjct  1567  AFILKR  1572



>ref|XP_009370405.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Pyrus x bretschneideri]
Length=844

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R++E++DSSLG+S    EVLRC H+ LLC+Q    DRP+MS V+FML N+  +  PK PG
Sbjct  751  RALELIDSSLGESYPVNEVLRCFHIALLCIQEQAKDRPLMSAVVFMLGNDATIPSPKQPG  810

Query  184  FIFNQ  198
            F+ N+
Sbjct  811  FLLNR  815



>ref|XP_009352927.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Pyrus x bretschneideri]
Length=847

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R++E++DSSLG+S    EVLRC H+ LLC+Q    DRP+MS V+FML N+  +  PK PG
Sbjct  754  RALELIDSSLGESYPVNEVLRCFHIALLCIQEQAKDRPLMSTVVFMLGNDATIPSPKQPG  813

Query  184  FIFNQ  198
            F+ N+
Sbjct  814  FLLNR  818



>ref|XP_011030934.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=817

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ERS E+++ SL D+ +  EVLR IHVGLLCVQ  P+DRP MS V+ MLS+NI L  PK P
Sbjct  724  ERSFELINDSLKDTCNLSEVLRVIHVGLLCVQQAPEDRPTMSTVVLMLSSNIALPDPKEP  783

Query  181  GF  186
            GF
Sbjct  784  GF  785



>ref|XP_006377797.1| hypothetical protein POPTR_0011s12930g [Populus trichocarpa]
 gb|ERP55594.1| hypothetical protein POPTR_0011s12930g [Populus trichocarpa]
Length=817

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ERS E+++ SL D+ +  EVLR IHVGLLCVQ  P+DRP MS V+ MLS+NI L  PK P
Sbjct  724  ERSFELINDSLKDTCNLSEVLRVIHVGLLCVQQAPEDRPTMSTVVLMLSSNIALPDPKEP  783

Query  181  GF  186
            GF
Sbjct  784  GF  785



>ref|XP_007213399.1| hypothetical protein PRUPE_ppa026218mg [Prunus persica]
 gb|EMJ14598.1| hypothetical protein PRUPE_ppa026218mg [Prunus persica]
Length=903

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            E+ +E++D +L DS    EVLRC+HVGLLCVQ  P+DRP MS V+ MLS++I L  PK P
Sbjct  719  EKPLELIDKTLSDSCTISEVLRCLHVGLLCVQRVPEDRPSMSSVVLMLSSDITLPPPKQP  778

Query  181  GF  186
            GF
Sbjct  779  GF  780



>gb|KHN45738.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Glycine soja]
Length=801

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            ++MEIVD SLG+S    EV RCI +GLLCVQ Y  DRP MS V+FML N+  L  PK P 
Sbjct  709  KTMEIVDQSLGESCSDHEVQRCIQIGLLCVQDYAADRPSMSAVVFMLGNDSTLPDPKQPA  768

Query  184  FIFNQ  198
            F+F +
Sbjct  769  FVFKK  773



>ref|XP_003532567.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410-like [Glycine max]
Length=838

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            ++MEIVD SLG+S    EV RCI +GLLCVQ Y  DRP MS V+FML N+  L  PK P 
Sbjct  746  KTMEIVDQSLGESCSDHEVQRCIQIGLLCVQDYAADRPSMSAVVFMLGNDSTLPDPKQPA  805

Query  184  FIFNQ  198
            F+F +
Sbjct  806  FVFKK  810



>ref|XP_002530641.1| B-Raf proto-oncogene serine/threonine-protein kinase, putative 
[Ricinus communis]
 gb|EEF31749.1| B-Raf proto-oncogene serine/threonine-protein kinase, putative 
[Ricinus communis]
Length=1517

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  1     ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
             ER++EIVDSSL  S +  EVLRCI VGLLCVQ    DRPIMSEV+ ML ++  L  PK P
Sbjct  1424  ERALEIVDSSLTGSCNSDEVLRCIQVGLLCVQEDAVDRPIMSEVVLMLKSDSSLPSPKQP  1483

Query  181   GFIF  192
              FIF
Sbjct  1484  AFIF  1487


 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ER++EIVDSSL  S +  EVLRCI VGLLCVQ    DRP M EV+ ML ++  L  PK P
Sbjct  573  ERALEIVDSSLTGSCNSDEVLRCIQVGLLCVQEDAMDRPAMLEVVLMLKSDSSLPSPKQP  632

Query  181  GFIF  192
             FIF
Sbjct  633  AFIF  636



>ref|XP_009370304.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Pyrus x bretschneideri]
Length=247

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R++EI+DSSLG+S    EVLRCIH+ LLCVQ    DRP+MS V+ ML N+  +  PK PG
Sbjct  154  RALEIIDSSLGESYPVNEVLRCIHIALLCVQEQAKDRPLMSAVVSMLGNDAAIPSPKQPG  213

Query  184  FIFNQ  198
            F+ N+
Sbjct  214  FLLNK  218



>ref|XP_009591798.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1 [Nicotiana tomentosiformis]
Length=842

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++++E+VD  LG+  +  EVLRCI +GLLCVQ + +DRP+MSEV+FML N  +L+ P  P
Sbjct  748  DKAIEVVDPLLGEWYETGEVLRCIQIGLLCVQSHANDRPMMSEVVFMLCNETKLSNPGQP  807

Query  181  GFIF  192
            GF+F
Sbjct  808  GFVF  811



>ref|XP_009370055.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Pyrus x bretschneideri]
Length=247

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R++EI+DSSLG+S    EVLRCIH+ LLCVQ    DRP+MS V+ ML N+  +  PK PG
Sbjct  154  RALEIIDSSLGESYPVNEVLRCIHIALLCVQEQAKDRPLMSAVVSMLGNDAAIPSPKQPG  213

Query  184  FIFNQ  198
            F+ N+
Sbjct  214  FLLNR  218



>emb|CBI20433.3| unnamed protein product [Vitis vinifera]
Length=153

 Score = 77.4 bits (189),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            RS+E++D+S+GD+ +  EVLR IHVGLLCVQ  PDDRP MS VI ML +   L +PK PG
Sbjct  63   RSLELIDASMGDTCNLSEVLRSIHVGLLCVQRSPDDRPSMSSVILMLGSEGALPQPKKPG  122

Query  184  FI  189
            F 
Sbjct  123  FF  124



>ref|XP_007159227.1| hypothetical protein PHAVU_002G219900g [Phaseolus vulgaris]
 gb|ESW31221.1| hypothetical protein PHAVU_002G219900g [Phaseolus vulgaris]
Length=837

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            ++MEIVD SLG+S    EV RCI +GLLCVQ Y  DRP MS V+FML N+  L  PK P 
Sbjct  745  KTMEIVDQSLGESRCDLEVQRCIQIGLLCVQDYAADRPSMSAVVFMLGNDSTLPAPKQPA  804

Query  184  FIFNQ  198
            FIF +
Sbjct  805  FIFKK  809



>ref|XP_010433919.1| PREDICTED: cysteine-rich receptor-like protein kinase 24, partial 
[Camelina sativa]
Length=650

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKP  177
            E  +E+VD+++G++ D  EV+RCIH+GLLCVQ  P DRP MS V  ML+N +I L  P+P
Sbjct  551  ESLLELVDAAMGENYDRNEVIRCIHIGLLCVQENPADRPTMSTVFHMLTNTSITLHVPQP  610

Query  178  PGFIF  192
            PGF+F
Sbjct  611  PGFVF  615



>ref|XP_010448730.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
16 [Camelina sativa]
Length=408

 Score = 79.7 bits (195),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPGF  186
            +E+VD ++G++ D  EV+RCIH+GLLCVQ  P DRP MS VI ML+N +I L  P+PPGF
Sbjct  309  LELVDPTMGENYDKYEVVRCIHIGLLCVQENPADRPTMSTVIKMLTNTSITLPVPQPPGF  368

Query  187  IF  192
            +F
Sbjct  369  VF  370



>ref|XP_009352344.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410, partial [Pyrus x bretschneideri]
Length=285

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R++EI+DSSLG+S    EVLRCIH+ LLCVQ    DRP+MS V+ ML N+  +  PK PG
Sbjct  206  RALEIIDSSLGESYPVNEVLRCIHIALLCVQEQAKDRPLMSAVVSMLGNDATIPSPKQPG  265

Query  184  FIFNQ  198
            F+ N+
Sbjct  266  FLLNR  270



>gb|KHN28392.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Glycine soja]
Length=771

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R+ EI+DS++ DS    E++RCIHVGLLCVQ YP+DRP M+ V+ ML + +EL  PK PG
Sbjct  686  RTSEIIDSNIEDSCIESEIIRCIHVGLLCVQQYPEDRPTMTSVVLMLGSEMELDEPKKPG  745



>ref|XP_006582222.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X2 [Glycine max]
Length=809

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R+ EI+DS++ DS    E++RCIHVGLLCVQ YP+DRP M+ V+ ML + +EL  PK PG
Sbjct  724  RTSEIIDSNIEDSCIESEIIRCIHVGLLCVQQYPEDRPTMTSVVLMLGSEMELDEPKKPG  783



>ref|XP_006582221.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X1 [Glycine max]
Length=815

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R+ EI+DS++ DS    E++RCIHVGLLCVQ YP+DRP M+ V+ ML + +EL  PK PG
Sbjct  730  RTSEIIDSNIEDSCIESEIIRCIHVGLLCVQQYPEDRPTMTSVVLMLGSEMELDEPKKPG  789



>ref|XP_007133116.1| hypothetical protein PHAVU_011G152700g [Phaseolus vulgaris]
 gb|ESW05110.1| hypothetical protein PHAVU_011G152700g [Phaseolus vulgaris]
Length=777

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    SMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPGF  186
            ++E+VDSS+ DS    EVLRCIHV LLCVQ Y +DRP+MS V+ ML +  ELA PK PGF
Sbjct  688  AIEMVDSSIEDSCVLSEVLRCIHVSLLCVQQYAEDRPVMSAVVLMLGSESELAEPKEPGF  747



>ref|XP_007021201.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY12726.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=823

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            +R ME++D +LGD     EVLRCIHVGLLCVQ  P+DRP MS VI ML +   L +PK P
Sbjct  730  KRPMELIDDALGDFRLPSEVLRCIHVGLLCVQQRPEDRPNMSSVILMLGSESALPQPKQP  789

Query  181  GF  186
            GF
Sbjct  790  GF  791



>emb|CAN70178.1| hypothetical protein VITISV_000003 [Vitis vinifera]
Length=754

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            RSME++DSS+GD  D  +VL  I+VGLLCVQ  PDDRP MS V+ MLS++  L +PK PG
Sbjct  665  RSMELIDSSVGDMHDLSQVLCSINVGLLCVQCSPDDRPSMSSVVLMLSSDSSLPQPKEPG  724

Query  184  F  186
            F
Sbjct  725  F  725



>ref|XP_007214501.1| hypothetical protein PRUPE_ppa018069mg [Prunus persica]
 gb|EMJ15700.1| hypothetical protein PRUPE_ppa018069mg [Prunus persica]
Length=731

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R +E++D+ LG S    EVLRCIHV LLCVQ +P+DRP M+ V+ ML + I LA+PK PG
Sbjct  641  RPLELIDTRLGSSYTLSEVLRCIHVSLLCVQHHPEDRPTMASVLIMLGSEIPLAQPKQPG  700

Query  184  F  186
            F
Sbjct  701  F  701



>ref|XP_011015680.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1, partial [Populus euphratica]
Length=818

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            E+++++VD  L  S    EVLRCI +GLLCVQ +PDDRP M EV+FML N I L  PK P
Sbjct  725  EKALDMVDPMLEQSCPPHEVLRCIQIGLLCVQEFPDDRPTMLEVVFMLGNEITLPSPKKP  784

Query  181  GFIF  192
             F+ 
Sbjct  785  AFVL  788



>ref|XP_010448723.1| PREDICTED: cysteine-rich receptor-like protein kinase 24 isoform 
X3 [Camelina sativa]
Length=528

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKP  177
            E  +E+VD+++G++ D  EV+RCIH+GLLCVQ  P DRP MS V  ML+N +I L  P+P
Sbjct  429  ESLLELVDAAMGENYDRNEVIRCIHIGLLCVQENPCDRPTMSTVFHMLTNTSITLHVPQP  488

Query  178  PGFIF  192
            PGF+F
Sbjct  489  PGFVF  493



>ref|XP_011003373.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1 [Populus euphratica]
Length=833

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            E+++++VD  L  S    EVLRCI +GLLCVQ +PDDRP M EV+FML N I L  PK P
Sbjct  740  EKALDMVDPMLEQSCPPHEVLRCIQIGLLCVQEFPDDRPTMLEVVFMLGNEITLPSPKKP  799

Query  181  GFIF  192
             F+ 
Sbjct  800  AFVL  803



>ref|XP_010448721.1| PREDICTED: cysteine-rich receptor-like protein kinase 24 isoform 
X1 [Camelina sativa]
Length=638

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKP  177
            E  +E+VD+++G++ D  EV+RCIH+GLLCVQ  P DRP MS V  ML+N +I L  P+P
Sbjct  539  ESLLELVDAAMGENYDRNEVIRCIHIGLLCVQENPCDRPTMSTVFHMLTNTSITLHVPQP  598

Query  178  PGFIF  192
            PGF+F
Sbjct  599  PGFVF  603



>ref|XP_010448722.1| PREDICTED: cysteine-rich receptor-like protein kinase 24 isoform 
X2 [Camelina sativa]
Length=609

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKP  177
            E  +E+VD+++G++ D  EV+RCIH+GLLCVQ  P DRP MS V  ML+N +I L  P+P
Sbjct  510  ESLLELVDAAMGENYDRNEVIRCIHIGLLCVQENPCDRPTMSTVFHMLTNTSITLHVPQP  569

Query  178  PGFIF  192
            PGF+F
Sbjct  570  PGFVF  574



>ref|XP_008372832.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Malus domestica]
Length=797

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++ +E++D +L DS +  EV+RC+HVGLLCVQ  P+DRP MS V+ MLS+++ L  PK P
Sbjct  707  DKQLELIDKTLSDSCNIYEVVRCLHVGLLCVQRVPEDRPSMSSVVLMLSSDVALPSPKQP  766

Query  181  GF  186
            GF
Sbjct  767  GF  768



>ref|XP_007213646.1| hypothetical protein PRUPE_ppa001663mg [Prunus persica]
 gb|EMJ14845.1| hypothetical protein PRUPE_ppa001663mg [Prunus persica]
Length=784

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++ +E++D++L DS +  EVLRC+HVGLLCVQ  P+DRP MS V+ MLS++I L  PK P
Sbjct  694  DKQLELIDTTLYDSCNISEVLRCLHVGLLCVQRVPEDRPNMSYVVLMLSSDITLPPPKQP  753

Query  181  GF  186
            GF
Sbjct  754  GF  755



>ref|XP_010439188.1| PREDICTED: cysteine-rich receptor-like protein kinase 24 [Camelina 
sativa]
Length=638

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKP  177
            E  +E+VD+++G + D  EV+RCIH+GLLCVQ  P DRP MS V  ML+N +I L  P+P
Sbjct  539  ESLLELVDAAMGQNYDRNEVIRCIHIGLLCVQENPADRPTMSTVFHMLTNTSITLHVPQP  598

Query  178  PGFIF  192
            PGF+F
Sbjct  599  PGFVF  603



>ref|XP_010445180.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
16 [Camelina sativa]
Length=567

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPGF  186
            +E+VD ++ ++ D  EV+RCIH+GLLCVQ  PDDRP MS VI ML+N +I L  P+PPGF
Sbjct  468  LELVDPAMRENYDKYEVVRCIHIGLLCVQENPDDRPTMSTVIKMLTNTSITLPVPQPPGF  527

Query  187  IF  192
            +F
Sbjct  528  VF  529



>ref|XP_008371231.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-7 
[Malus domestica]
Length=182

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R++EI+DSSLG+S    EVLRCIH+ LLCVQ    DRP+MS V+ ML N+  +  PK PG
Sbjct  89   RALEIIDSSLGESYPVNEVLRCIHIALLCVQEQAKDRPLMSAVVSMLGNDAAIPSPKQPG  148

Query  184  FIFNQ  198
            F+  +
Sbjct  149  FLLKR  153



>ref|XP_008349266.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Malus domestica]
Length=457

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  7    SMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPGF  186
            ++EI+DSSLG+S    EVLRCI + LLCVQ +  DRP+MS V+FML N+  L  P+ PGF
Sbjct  365  ALEIIDSSLGESYPVSEVLRCIQIALLCVQEHATDRPLMSAVVFMLGNDAALPSPRQPGF  424

Query  187  IFNQ  198
            +  +
Sbjct  425  LLKR  428



>ref|XP_008362569.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Malus domestica]
 ref|XP_008363898.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Malus domestica]
Length=300

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R++EI+DSSLG+S    EVLRCIH+ LLCVQ    DRP+MS V+ ML N+  +  PK PG
Sbjct  212  RALEIIDSSLGESYHVNEVLRCIHIALLCVQEQAKDRPLMSAVVSMLGNDAAIPSPKQPG  271

Query  184  FIF  192
            F+ 
Sbjct  272  FLL  274



>ref|XP_010247752.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X2 [Nelumbo nucifera]
Length=793

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = +1

Query  4    RSMEIVDSSLGDSD--DGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKP  177
            + ++IVDS +G+ D   G EVLRCIHVGLLCVQ  P DRP MS V+FMLSN   +  P  
Sbjct  698  KGLDIVDSCMGEGDCYPGDEVLRCIHVGLLCVQESPSDRPTMSNVVFMLSNQTIMPPPNQ  757

Query  178  PGFIFNQ  198
            P FI  +
Sbjct  758  PAFIMKR  764



>sp|O65483.2|CRK24_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 24; 
Short=Cysteine-rich RLK24; Flags: Precursor [Arabidopsis thaliana]
Length=636

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKP  177
            E  +E+VD+ +G++ D  EV+RCIH+GLLCVQ  P DRP MS V  ML+N +I L  P+P
Sbjct  537  EPLLELVDAPMGENYDRNEVIRCIHIGLLCVQENPADRPTMSTVFHMLTNTSITLHVPQP  596

Query  178  PGFIF  192
            PGF+F
Sbjct  597  PGFVF  601



>ref|XP_007133709.1| hypothetical protein PHAVU_011G202200g [Phaseolus vulgaris]
 gb|ESW05703.1| hypothetical protein PHAVU_011G202200g [Phaseolus vulgaris]
Length=794

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +1

Query  13   EIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPGF  186
            +++DSS+ DS    EVLRC HV LLCVQ YPDDRP MS VI ML + +EL  PK PGF
Sbjct  704  QLIDSSIKDSCVVSEVLRCTHVSLLCVQQYPDDRPTMSSVIQMLGSEMELVEPKEPGF  761



>ref|XP_010316635.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 isoform X1 [Solanum lycopersicum]
Length=826

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            E+++  VD  L  S +  EVLRCIH+GLLCVQ + DDRP MSEV+FML N   L  PK P
Sbjct  731  EKALNAVDPLLSGSYEACEVLRCIHIGLLCVQPFTDDRPTMSEVVFMLCNETNLPFPKQP  790

Query  181  GFIF  192
              IF
Sbjct  791  SLIF  794



>ref|XP_008345502.1| PREDICTED: uncharacterized protein LOC103408424 [Malus domestica]
Length=720

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R++EI+DSSLG+S    EVLRCIH+ LLCVQ    DRP+MS V+ ML N+  +  PK PG
Sbjct  348  RALEIIDSSLGESYHVNEVLRCIHIALLCVQEQAKDRPLMSAVVSMLGNDAAIPSPKQPG  407

Query  184  FIF  192
            F+ 
Sbjct  408  FLL  410



>ref|XP_008454614.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Cucumis melo]
Length=812

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            + +E++D+S+G+S    EVLRCIHV LLC+Q  P+DRP MS V+ MLS+   LA+PK PG
Sbjct  720  KPLELIDASIGESYALSEVLRCIHVSLLCLQQLPEDRPTMSNVVLMLSSESSLAQPKQPG  779

Query  184  F  186
            F
Sbjct  780  F  780



>ref|XP_008454615.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Cucumis melo]
Length=810

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            + +E++D+S+G+S    EVLRCIHV LLC+Q  P+DRP MS V+ MLS+   LA+PK PG
Sbjct  718  KPLELIDASIGESYALSEVLRCIHVSLLCLQQLPEDRPTMSNVVLMLSSESSLAQPKQPG  777

Query  184  F  186
            F
Sbjct  778  F  778



>ref|XP_009370505.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Pyrus x bretschneideri]
Length=834

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            +++EI+DSSLG+S    EVLRCIH+ LLCVQ    DRP+MS V+FML N+  +  PK PG
Sbjct  741  KALEIIDSSLGESYPVNEVLRCIHIALLCVQKQAKDRPLMSAVVFMLGNDTAIPSPKQPG  800

Query  184  FIFNQ  198
            F+  +
Sbjct  801  FLLKR  805



>gb|KHG05572.1| hypothetical protein F383_31410 [Gossypium arboreum]
Length=837

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            +R +EI+DS  GDS    E L+CI +GLLCVQ +  DRP+MS V+FMLSN   L  PK P
Sbjct  745  DREIEIIDSVFGDSYSANEFLKCIQIGLLCVQEHATDRPMMSTVVFMLSNETALPSPKQP  804

Query  181  GF  186
             F
Sbjct  805  AF  806



>ref|XP_008383964.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Malus domestica]
Length=844

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +1

Query  7    SMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPGF  186
            ++EI+DSSLG+S    EVLRCI + LLCVQ +  DRP+MS V+FML N+  L  P+ PGF
Sbjct  752  ALEIIDSSLGESYPVSEVLRCIQIALLCVQEHATDRPLMSAVVFMLGNDAALPSPRQPGF  811

Query  187  IFNQ  198
            +  +
Sbjct  812  LLKR  815



>ref|XP_004154883.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8-like 
[Cucumis sativus]
Length=1267

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            + +E++D+S+G+S    EVLRCIHV LLC+Q  P+DRP MS V+ MLS+   LA+PK PG
Sbjct  722  KPLELIDASIGESYALSEVLRCIHVSLLCLQQLPEDRPTMSNVVLMLSSEGSLAQPKQPG  781

Query  184  F  186
            F
Sbjct  782  F  782



>ref|XP_004146866.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8-like 
[Cucumis sativus]
Length=814

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            + +E++D+S+G+S    EVLRCIHV LLC+Q  P+DRP MS V+ MLS+   LA+PK PG
Sbjct  722  KPLELIDASIGESYALSEVLRCIHVSLLCLQQLPEDRPTMSNVVLMLSSEGSLAQPKQPG  781

Query  184  F  186
            F
Sbjct  782  F  782



>ref|XP_006582220.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Glycine max]
Length=806

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPGF  186
            ++++DS++ DS   +EVLRCIHV LLCVQ YP+DRP M+ VI ML + +EL  PK PGF
Sbjct  716  LQLIDSNIMDSCVIQEVLRCIHVSLLCVQQYPEDRPTMTSVIQMLGSEMELVEPKEPGF  774



>ref|XP_007214214.1| hypothetical protein PRUPE_ppa021071mg, partial [Prunus persica]
 gb|EMJ15413.1| hypothetical protein PRUPE_ppa021071mg, partial [Prunus persica]
Length=753

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            E+++ +VD SLG+S    EV RCI +GLLCVQ    DRP MSEVIFML N   L  PK P
Sbjct  661  EQALAMVDPSLGESYPAHEVSRCIQIGLLCVQESASDRPTMSEVIFMLGNETTLPHPKKP  720

Query  181  GFIF  192
             FI 
Sbjct  721  AFIL  724



>ref|XP_006284983.1| hypothetical protein CARUB_v10006289mg [Capsella rubella]
 gb|EOA17881.1| hypothetical protein CARUB_v10006289mg [Capsella rubella]
Length=640

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKP  177
            E  +E+VD+++ ++ D  EV+RCIH+GLLCVQ  P DRP MS V  ML+N +I L  P+P
Sbjct  540  ESLLELVDAAMEENYDRNEVIRCIHIGLLCVQENPADRPTMSTVFHMLTNTSITLHVPQP  599

Query  178  PGFIFN  195
            PGF+F+
Sbjct  600  PGFVFS  605



>ref|XP_008232167.1| PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like 
serine/threonine-protein kinase At4g27290 [Prunus mume]
Length=825

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++  E++D++L DS +  EVLRC+HVGLLCVQ  P+DRP MS V+ MLS++I L  PK P
Sbjct  735  DKQRELIDTTLYDSCNISEVLRCLHVGLLCVQRIPEDRPNMSYVVLMLSSDITLPPPKQP  794

Query  181  GF  186
            GF
Sbjct  795  GF  796



>ref|XP_008384001.1| PREDICTED: cysteine-rich receptor-like protein kinase 5 [Malus 
domestica]
Length=146

 Score = 74.3 bits (181),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            +++EIVDSS+G+S    EV+RCI + LLCVQ +  DRP MS V+FML N + +  PK P 
Sbjct  58   KALEIVDSSMGESYHVNEVVRCIQIALLCVQEFAADRPTMSAVVFMLGNEVAVPSPKQPA  117

Query  184  FI  189
            F+
Sbjct  118  FL  119



>ref|XP_003607714.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=817

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFML-SNNIELARPKPP  180
            R+++I+DS++ DS    EV RCIHVGLLCVQ YP+DRP M++VI ML S  + L  PK P
Sbjct  724  RALQIIDSNIVDSCIVSEVSRCIHVGLLCVQQYPEDRPTMADVILMLGSEMMTLDEPKEP  783

Query  181  GFIFNQ  198
            GFI  +
Sbjct  784  GFIMRK  789



>ref|XP_008386060.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X3 [Malus domestica]
Length=736

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R +E++D+ LG+S    EVLRCIHV LLCVQ  P+DRP M+ V+ ML ++  LA+PK PG
Sbjct  645  RPLEVIDTGLGNSFSLSEVLRCIHVSLLCVQHEPEDRPSMASVVIMLGSDGALAQPKQPG  704

Query  184  F  186
            F
Sbjct  705  F  705



>ref|XP_009349779.1| PREDICTED: uncharacterized protein LOC103941313 [Pyrus x bretschneideri]
Length=1647

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R +E++D+ LG+S    EVLRCIHV LLCVQ  P+DRP M+ V+ ML +   LA+PK PG
Sbjct  716  RPLEVIDTGLGNSSSLSEVLRCIHVSLLCVQHEPEDRPSMASVVIMLGSAGALAQPKQPG  775

Query  184  FIFNQ  198
            F   +
Sbjct  776  FFIEK  780


 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  4     RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
             R +E++D+ L +S    E+LRC+HV LLCVQ  P+DRP M+ V+ ML ++  LA+PK PG
Sbjct  1556  RPLEVIDTGLRNSLSLSEMLRCVHVSLLCVQHEPEDRPSMASVVIMLGSDGALAQPKQPG  1615

Query  184   F  186
             F
Sbjct  1616  F  1616



>ref|XP_009137323.1| PREDICTED: LOW QUALITY PROTEIN: putative cysteine-rich receptor-like 
protein kinase 16 [Brassica rapa]
Length=350

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKP  177
            E  +E+VD ++G++ D  EV RCIH+GLLCVQ  P DRP MS +  ML+N +I L  P+P
Sbjct  250  ESLLELVDPAVGENYDKHEVTRCIHIGLLCVQENPADRPTMSTIFQMLTNTSITLHVPQP  309

Query  178  PGFIF  192
            PGF F
Sbjct  310  PGFFF  314



>ref|XP_007213028.1| hypothetical protein PRUPE_ppa023127mg, partial [Prunus persica]
 gb|EMJ14227.1| hypothetical protein PRUPE_ppa023127mg, partial [Prunus persica]
Length=748

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R +E+VD  L DS    EV+RC+H+GLLCVQ    DRPIM +V+FMLS+  +L +PK P 
Sbjct  658  RGLELVDKVLADSSSSSEVMRCVHIGLLCVQDNAADRPIMPDVVFMLSSETDLPQPKRPI  717

Query  184  FIF  192
            F F
Sbjct  718  FTF  720



>ref|XP_008386058.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Malus domestica]
Length=828

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R +E++D+ LG+S    EVLRCIHV LLCVQ  P+DRP M+ V+ ML ++  LA+PK PG
Sbjct  737  RPLEVIDTGLGNSFSLSEVLRCIHVSLLCVQHEPEDRPSMASVVIMLGSDGALAQPKQPG  796

Query  184  F  186
            F
Sbjct  797  F  797



>ref|XP_007133048.1| hypothetical protein PHAVU_011G147100g [Phaseolus vulgaris]
 gb|ESW05042.1| hypothetical protein PHAVU_011G147100g [Phaseolus vulgaris]
Length=803

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R+ME+VDS+  +S    EVLRC+HV LLCVQ YP+DRP M+ VI ML   +EL  PK  G
Sbjct  711  RAMELVDSNKMESCIIAEVLRCLHVSLLCVQQYPEDRPTMASVILMLETQMELVEPKEHG  770

Query  184  FI  189
            FI
Sbjct  771  FI  772



>ref|XP_007133049.1| hypothetical protein PHAVU_011G147100g [Phaseolus vulgaris]
 gb|ESW05043.1| hypothetical protein PHAVU_011G147100g [Phaseolus vulgaris]
Length=815

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R+ME+VDS+  +S    EVLRC+HV LLCVQ YP+DRP M+ VI ML   +EL  PK  G
Sbjct  723  RAMELVDSNKMESCIIAEVLRCLHVSLLCVQQYPEDRPTMASVILMLETQMELVEPKEHG  782

Query  184  FI  189
            FI
Sbjct  783  FI  784



>gb|KEH30779.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=824

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFML--SNNIELARPK  174
            ER++E++DS+LG++    EVLRC+HV LLC Q  P+DRP MS VI ML  S  +EL  P+
Sbjct  729  ERALELIDSNLGETYVVSEVLRCMHVSLLCAQQNPEDRPTMSSVILMLGSSTEMELREPE  788

Query  175  PPGFI  189
             PGFI
Sbjct  789  EPGFI  793



>ref|XP_007021127.1| S-locus lectin protein kinase family protein isoform 4 [Theobroma 
cacao]
 gb|EOY12652.1| S-locus lectin protein kinase family protein isoform 4 [Theobroma 
cacao]
Length=790

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R ++++DS L +S    EV+RCI +GLLCVQ YP+DRP MS V+ ML +   L++PK PG
Sbjct  697  RPLDLMDSFLQESSALSEVVRCIQIGLLCVQYYPEDRPNMSSVVVMLGSENALSQPKEPG  756

Query  184  FIFNQ  198
            F+ N+
Sbjct  757  FLMNK  761



>ref|XP_011002478.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105109454 
[Populus euphratica]
Length=1646

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++S E++D SL ++ D  EVLR IHVGLLCVQ  P+DRP MS V+ ML++NI L  PK P
Sbjct  724  QKSFELIDESLNNTCDLSEVLRVIHVGLLCVQQAPEDRPTMSTVVLMLTSNITLPEPKEP  783

Query  181  GFI  189
            GF 
Sbjct  784  GFF  786


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  4     RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
             R ++++D S+ DS    EV R I V LLCVQ  P+DRP MS V+ MLS++I L +PK PG
Sbjct  1554  RPLDLIDESIVDSCIISEVSRSIEVALLCVQKSPEDRPKMSTVVLMLSSDIVLPQPKEPG  1613

Query  184   FI  189
             F 
Sbjct  1614  FF  1615



>ref|XP_008386059.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Malus domestica]
Length=817

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R +E++D+ LG+S    EVLRCIHV LLCVQ  P+DRP M+ V+ ML ++  LA+PK PG
Sbjct  726  RPLEVIDTGLGNSFSLSEVLRCIHVSLLCVQHEPEDRPSMASVVIMLGSDGALAQPKQPG  785

Query  184  F  186
            F
Sbjct  786  F  786



>ref|XP_009361851.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Pyrus x bretschneideri]
Length=822

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++ +E++D +  DS +  EV+RC+HVGLLCVQ  P+DRP MS V+ MLS+++ L  PK P
Sbjct  732  DKPLELIDKTFCDSCNISEVIRCLHVGLLCVQRVPEDRPSMSSVVLMLSSDVALPPPKQP  791

Query  181  GFIFNQ  198
            GF   Q
Sbjct  792  GFYTEQ  797



>ref|XP_007021124.1| S-locus lectin protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY12649.1| S-locus lectin protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=827

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R ++++DS L +S    EV+RCI +GLLCVQ YP+DRP MS V+ ML +   L++PK PG
Sbjct  734  RPLDLMDSFLQESSALSEVVRCIQIGLLCVQYYPEDRPNMSSVVVMLGSENALSQPKEPG  793

Query  184  FIFNQ  198
            F+ N+
Sbjct  794  FLMNK  798



>ref|XP_003607717.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=807

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFML--SNNIELARPK  174
            ER++E++DS+LG++    EVLRC+HV LLC Q  P+DRP MS VI ML  S  +EL  P+
Sbjct  712  ERALELIDSNLGETYVVSEVLRCMHVSLLCAQQNPEDRPTMSSVILMLGSSTEMELREPE  771

Query  175  PPGFI  189
             PGFI
Sbjct  772  EPGFI  776



>ref|XP_010247749.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nelumbo nucifera]
Length=836

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +1

Query  4    RSMEIVDSSLGDS--DDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKP  177
            R+ME++D S+ DS   D  EVLRCIHVGLLCVQ   +DRP M+ V+ MLS+   LA+P+ 
Sbjct  742  RAMELIDPSMRDSCCGDEVEVLRCIHVGLLCVQQNTEDRPTMASVVLMLSSECALAKPQQ  801

Query  178  PGF  186
            PGF
Sbjct  802  PGF  804



>ref|XP_007021216.1| Serine/threonine-protein kinase receptor, putative [Theobroma 
cacao]
 gb|EOY12741.1| Serine/threonine-protein kinase receptor, putative [Theobroma 
cacao]
Length=1621

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/68 (51%), Positives = 49/68 (72%), Gaps = 2/68 (3%)
 Frame = +1

Query  1     ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNN--IELARPK  174
             +R++E++D+SL +S    EV+RCI VGLLCVQ +P+DRP MS V+ ML+N     L +PK
Sbjct  1524  DRALELIDTSLEESCVRPEVVRCIQVGLLCVQEFPEDRPAMSSVLLMLTNESAATLPQPK  1583

Query  175   PPGFIFNQ  198
             PPGF   +
Sbjct  1584  PPGFFIQR  1591


 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIE-LARPKPPGF  186
            +E+++S + DS      +R I++ LLCVQ   +DRP MS+V+ MLSN +  L  P  P F
Sbjct  761  LELMESVIQDSSFTTAAIRYINIALLCVQERAEDRPTMSDVVSMLSNELTVLPSPMKPAF  820



>gb|AES89911.2| S-locus lectin kinase family protein [Medicago truncatula]
Length=817

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFML-SNNIELARPKPP  180
            R+++I+DS++ DS    EV RCIH+GLLCVQ YP+DRP M++VI ML S  + L  PK P
Sbjct  724  RALQIIDSNIVDSCIVSEVSRCIHIGLLCVQQYPEDRPTMADVILMLGSEMMTLDEPKEP  783

Query  181  GFIFNQ  198
            GFI  +
Sbjct  784  GFIMRK  789



>ref|XP_007214643.1| hypothetical protein PRUPE_ppa001761mg [Prunus persica]
 gb|EMJ15842.1| hypothetical protein PRUPE_ppa001761mg [Prunus persica]
Length=768

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            RS+E++D+S+GDS D  EVLR IHVGLLCVQ  P DRP M   + MLS    L +P+ PG
Sbjct  677  RSIEVLDTSVGDSSDPHEVLRSIHVGLLCVQRNPADRPSMPAAVVMLSGEGSLPQPQKPG  736

Query  184  F  186
            F
Sbjct  737  F  737



>ref|XP_008345858.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Malus domestica]
Length=849

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +1

Query  7    SMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPGF  186
            ++EI+DSSLG+S    EVLRCIH+ LLCVQ    DRP+MS V+ ML N+  +  PK PGF
Sbjct  757  ALEIIDSSLGESYPVNEVLRCIHIALLCVQEQAKDRPLMSAVVSMLGNDAAIPSPKQPGF  816

Query  187  IFNQ  198
            +  +
Sbjct  817  LLKR  820



>ref|XP_006370372.1| hypothetical protein POPTR_0001s42070g [Populus trichocarpa]
 gb|ERP66941.1| hypothetical protein POPTR_0001s42070g [Populus trichocarpa]
Length=773

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++S E++D SL ++ D  EV+R I VGLLCVQ  P+DRP MS V+ ML++NI L  PK P
Sbjct  680  QKSFELIDESLNNTCDLSEVMRVIQVGLLCVQQAPEDRPTMSTVVLMLTSNITLPEPKEP  739

Query  181  GF  186
            GF
Sbjct  740  GF  741



>ref|XP_006582737.1| PREDICTED: uncharacterized protein LOC100812022 [Glycine max]
Length=1643

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            + +++++DSS+ DS    EVLRCIHV LLCVQ YP+DRP M+ VI ML + +++  PK P
Sbjct  719  QNALQLIDSSIKDSCVISEVLRCIHVSLLCVQQYPEDRPTMTSVIQMLGSEMDMVEPKEP  778

Query  181  GF  186
            GF
Sbjct  779  GF  780


 Score = 75.5 bits (184),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  1     ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
             + +++++DS + DS    EVLRCIHV LLCVQ YP+DRP M+ VI ML + +++  PK P
Sbjct  1554  QNALQLIDSGIKDSCVIPEVLRCIHVSLLCVQQYPEDRPTMTSVIQMLGSEMDMVEPKEP  1613

Query  181   GF  186
             GF
Sbjct  1614  GF  1615



>ref|XP_007212501.1| hypothetical protein PRUPE_ppa017634mg [Prunus persica]
 gb|EMJ13700.1| hypothetical protein PRUPE_ppa017634mg [Prunus persica]
Length=820

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++++E++D +L DS    EVLRC+HV LLCVQ  P+DRP MS V+ MLS+++ L  PK P
Sbjct  731  DKALELIDKTLRDSCTISEVLRCLHVALLCVQRVPEDRPSMSSVVLMLSSDVTLPPPKQP  790

Query  181  GF  186
            GF
Sbjct  791  GF  792



>ref|XP_010052476.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 isoform X2 [Eucalyptus grandis]
Length=840

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLS-NNIELARPKP  177
            E  +++VD S+GDS    EVLRCI +GLLCVQ + +DRP MS V+FML+ NN+ LA PK 
Sbjct  747  ENCVDVVDESMGDSCSKEEVLRCIQIGLLCVQEFAEDRPNMSAVVFMLANNNVVLASPKR  806

Query  178  PGFIF  192
            P ++F
Sbjct  807  PAYVF  811



>ref|XP_010433921.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
16 [Camelina sativa]
Length=668

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPGF  186
            +E+VD ++G++ D  EV+RCIH+GLLCVQ  P DRP MS +  ML+N +I L  P+PPGF
Sbjct  569  LELVDPAMGENYDKYEVIRCIHIGLLCVQENPADRPTMSTIFQMLTNTSITLPVPQPPGF  628

Query  187  IF  192
            +F
Sbjct  629  VF  630



>ref|XP_008225013.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Prunus mume]
Length=819

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            E+++ +VD SLG+S    EV RCI +GLLCVQ    DRP MSEVIFML N   L  PK P
Sbjct  728  EQALGMVDPSLGESYPAHEVSRCIQIGLLCVQESASDRPTMSEVIFMLGNETTLPSPKKP  787

Query  181  GFIF  192
             FI 
Sbjct  788  AFIL  791



>ref|XP_007133112.1| hypothetical protein PHAVU_011G152300g [Phaseolus vulgaris]
 gb|ESW05106.1| hypothetical protein PHAVU_011G152300g [Phaseolus vulgaris]
Length=624

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPK  174
            E  M++VD+SLGD+    E LRCIHVGLLCVQL+PD+RP M+ VIF+LS+   L +PK
Sbjct  558  ETPMQLVDTSLGDTFTISEALRCIHVGLLCVQLHPDNRPNMASVIFLLSSENILPQPK  615



>gb|KCW76500.1| hypothetical protein EUGRSUZ_D00887 [Eucalyptus grandis]
Length=284

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +1

Query  13   EIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPGFI  189
            +++D S+GDS    E LRCI +GLLCVQ + DDRP MS V+FML+N ++ LA PK P + 
Sbjct  195  DVIDESMGDSCTKEEALRCIQIGLLCVQEFADDRPDMSTVVFMLANKDVVLASPKRPAYF  254

Query  190  F  192
            F
Sbjct  255  F  255



>ref|XP_008369911.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1 [Malus domestica]
Length=257

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R++EI+DSSLG+S    +VLRCIH+ LLCVQ    DRP+MS V+ ML N+  +  PK PG
Sbjct  164  RALEIIDSSLGESYPVNKVLRCIHIALLCVQEQAKDRPLMSAVVSMLGNDAAIPSPKQPG  223

Query  184  FIFNQ  198
            F+   
Sbjct  224  FLLKS  228



>ref|XP_010644397.1| PREDICTED: uncharacterized protein LOC100262430 [Vitis vinifera]
Length=1658

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            + +E++D+S+GDS +  EVLR ++VGLLCVQ  PDDRP MS V+ MLS+   L +PK PG
Sbjct  721  KPLELIDASMGDSCNQSEVLRALNVGLLCVQRSPDDRPSMSSVVLMLSSESALHQPKEPG  780

Query  184  F  186
            F
Sbjct  781  F  781


 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  1     ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
             +RS E +D+S+G+  +  EVLR I++GLLCVQ +P+DRP M  V+ ML     L +PK P
Sbjct  1572  DRSSEFIDASMGNICNLSEVLRSINLGLLCVQRFPEDRPSMHYVVLMLGGEGALPQPKEP  1631

Query  181   GFIFNQ  198
              F  ++
Sbjct  1632  CFFTDK  1637



>ref|XP_007213580.1| hypothetical protein PRUPE_ppa014995mg [Prunus persica]
 gb|EMJ14779.1| hypothetical protein PRUPE_ppa014995mg [Prunus persica]
Length=584

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            RS+E++D SL DS    EVL CIH+ LLCVQ  P+DRP MS VI ML +   L +PK PG
Sbjct  492  RSLELIDESLSDSCALSEVLHCIHISLLCVQQLPEDRPTMSSVILMLGDGGALPQPKRPG  551

Query  184  F  186
            F
Sbjct  552  F  552



>ref|XP_007133111.1| hypothetical protein PHAVU_011G152300g [Phaseolus vulgaris]
 gb|ESW05105.1| hypothetical protein PHAVU_011G152300g [Phaseolus vulgaris]
Length=766

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPK  174
            E  M++VD+SLGD+    E LRCIHVGLLCVQL+PD+RP M+ VIF+LS+   L +PK
Sbjct  700  ETPMQLVDTSLGDTFTISEALRCIHVGLLCVQLHPDNRPNMASVIFLLSSENILPQPK  757



>ref|XP_007133110.1| hypothetical protein PHAVU_011G152300g [Phaseolus vulgaris]
 gb|ESW05104.1| hypothetical protein PHAVU_011G152300g [Phaseolus vulgaris]
Length=787

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPK  174
            E  M++VD+SLGD+    E LRCIHVGLLCVQL+PD+RP M+ VIF+LS+   L +PK
Sbjct  721  ETPMQLVDTSLGDTFTISEALRCIHVGLLCVQLHPDNRPNMASVIFLLSSENILPQPK  778



>gb|KEH30775.1| S-locus lectin kinase family protein [Medicago truncatula]
Length=821

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/61 (54%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            +++E+++S + +S    EVLRCIHV LLCVQ YP+DRP M+ VI ML +++EL  PK PG
Sbjct  730  KALELIESRIKESCVVSEVLRCIHVSLLCVQQYPEDRPTMTSVIQMLGSDMELVEPKAPG  789

Query  184  F  186
            F
Sbjct  790  F  790



>ref|XP_008386061.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Malus domestica]
Length=823

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R +E++D+ LG+S    EVLRCIHV LLCVQ  P+DRP M+ V+ ML +   LA+PK PG
Sbjct  732  RPLEVIDTGLGNSCSLSEVLRCIHVSLLCVQHEPEDRPSMASVVIMLGSAGALAQPKQPG  791

Query  184  FIFNQ  198
            F   +
Sbjct  792  FFIEK  796



>ref|XP_007099569.1| S-locus-specific glycoprotein S6, putative [Theobroma cacao]
 gb|EOY20462.1| S-locus-specific glycoprotein S6, putative [Theobroma cacao]
Length=168

 Score = 73.2 bits (178),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            +R ME++D +LGD     EVLRCIHVGLLCVQ  P+DRP MS  I ML +   L +PK P
Sbjct  75   KRPMELIDDALGDFRLPSEVLRCIHVGLLCVQQRPEDRPNMSSAIVMLGSESALPQPKQP  134

Query  181  GFI  189
            GF 
Sbjct  135  GFF  137



>gb|KHN28391.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Glycine soja]
Length=777

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            + + +++DS++ DS    EVLRCIHV LLCVQ YP+DRP M+ VI ML + +EL  PK P
Sbjct  684  QNTSQLIDSNIKDSCVIPEVLRCIHVSLLCVQQYPEDRPTMTSVIQMLGSEMELVEPKEP  743

Query  181  GF  186
            GF
Sbjct  744  GF  745



>ref|XP_009361847.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Pyrus x bretschneideri]
Length=797

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++ +E++D +  DS +  EV+RC+HVGLLCVQ  P+DRP MS V+ MLS+++ L  PK P
Sbjct  707  DKPLELIDKTFCDSCNISEVVRCLHVGLLCVQRVPEDRPSMSSVVLMLSSDVALPPPKQP  766

Query  181  GF  186
            GF
Sbjct  767  GF  768



>ref|XP_006582223.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Glycine max]
Length=845

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            + + +++DS++ DS    EVLRCIHV LLCVQ YP+DRP M+ VI ML + +EL  PK P
Sbjct  752  QNTSQLIDSNIKDSCVIPEVLRCIHVSLLCVQQYPEDRPTMTSVIQMLGSEMELVEPKEP  811

Query  181  GF  186
            GF
Sbjct  812  GF  813



>ref|XP_006594795.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Glycine max]
Length=818

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  13   EIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPGF  186
            EIVD+++ DS +  EVLR IHVGLLCVQL PDDRP MS V+ MLS+  EL +P  PGF
Sbjct  729  EIVDATIIDSLNLPEVLRTIHVGLLCVQLSPDDRPNMSSVVLMLSSESELPQPNLPGF  786



>ref|XP_009355685.1| PREDICTED: uncharacterized protein LOC103946653 [Pyrus x bretschneideri]
Length=1692

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R +E++D+ LG+S    EVLRCIHV LLCVQ  P+DRP M+ V+ ML +   LA+PK PG
Sbjct  687  RPLEVIDTGLGNSCSLSEVLRCIHVSLLCVQHEPEDRPSMASVVIMLGSAGALAQPKQPG  746

Query  184  FIFNQ  198
            F   +
Sbjct  747  FFIEK  751


 Score = 72.4 bits (176),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  4     RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
             R +E++D+ L +S    E+LRC+HV LLCVQ  P+DRP M+ V+ ML ++  LA+PK PG
Sbjct  1601  RPLEVIDTGLRNSLSLSEMLRCVHVSLLCVQHEPEDRPSMASVVIMLGSDGALAQPKQPG  1660

Query  184   F  186
             F
Sbjct  1661  F  1661



>ref|XP_008358731.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1 [Malus domestica]
Length=801

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            +R++EIVDSSL DS    EV+RCI VGLLCVQ    DRP MS V+FMLS    L  P+ P
Sbjct  709  DRALEIVDSSL-DSYQSDEVMRCIQVGLLCVQEDSKDRPTMSAVVFMLSGEASLPSPQQP  767

Query  181  GFIFNQ  198
             F+F +
Sbjct  768  AFVFRK  773



>ref|XP_004295401.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1-like [Fragaria vesca subsp. vesca]
Length=800

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/65 (49%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R++EI+D++LG+S    EVLRCIH+ LLCVQ + +DRP MS V+ +L N+  L  P+ PG
Sbjct  707  RALEIIDATLGESYPESEVLRCIHIALLCVQEFANDRPTMSTVVSVLGNDAALPSPRKPG  766

Query  184  FIFNQ  198
            F+  +
Sbjct  767  FLLKR  771



>gb|KCW76501.1| hypothetical protein EUGRSUZ_D00889, partial [Eucalyptus grandis]
Length=793

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +1

Query  13   EIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNN-IELARPKPPGFI  189
            +++D S+GDS    E LRCI +GLLCVQ + DDRP MS V+FML+NN + LA PK P F+
Sbjct  704  DVIDESMGDSCSKEEALRCIQIGLLCVQEFADDRPNMSAVVFMLANNDVALAFPKRPAFV  763

Query  190  F  192
            F
Sbjct  764  F  764



>ref|XP_010451227.1| PREDICTED: cysteine-rich receptor-like protein kinase 21 [Camelina 
sativa]
Length=636

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPGF  186
            +E+VD ++G++ D  EV+RCIH+GLLCVQ  P DRP MS +  ML+N +I L  P+PPGF
Sbjct  537  LELVDPAIGENYDKDEVIRCIHIGLLCVQENPGDRPSMSTIFRMLTNASIALPVPQPPGF  596

Query  187  IFNQ  198
             F +
Sbjct  597  FFRE  600



>ref|XP_009136919.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
16 isoform X2 [Brassica rapa]
Length=605

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKP  177
            E  +E++D ++G++ D  EV RCIH+GLLCVQ  P DRP MS V  ML+N +I L  P+P
Sbjct  502  ESLLELMDPAMGENYDKDEVTRCIHIGLLCVQENPADRPTMSTVFQMLTNTSITLPVPQP  561

Query  178  PGFIF  192
            PGF F
Sbjct  562  PGFFF  566



>ref|XP_008386045.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 [Malus domestica]
Length=644

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R +E++D SL DS    EV+RCIHVGLLCVQ  P+DRP MS VI ML N+  L  PK PG
Sbjct  552  RYLELIDESLRDSLTLSEVVRCIHVGLLCVQQLPEDRPTMSSVILMLGNDSRLPEPKQPG  611

Query  184  FI  189
            F 
Sbjct  612  FF  613



>gb|KDO74333.1| hypothetical protein CISIN_1g003832mg [Citrus sinensis]
Length=792

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            +R+ME+   +L DS    EVLRCIHVGLLCVQ  P+DRP MS V+ MLS++  L  P  P
Sbjct  699  KRAMELAGDTLADSHPPTEVLRCIHVGLLCVQHRPEDRPNMSSVVLMLSSDSLLPEPNRP  758

Query  181  GF  186
            GF
Sbjct  759  GF  760



>ref|XP_006475243.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1-like [Citrus sinensis]
Length=801

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            +R+ME+   +L DS    EVLRCIHVGLLCVQ  P+DRP MS V+ MLS++  L  P  P
Sbjct  708  KRAMELAGDTLADSHPPTEVLRCIHVGLLCVQHRPEDRPNMSSVVLMLSSDSLLPEPNRP  767

Query  181  GF  186
            GF
Sbjct  768  GF  769



>ref|XP_008226159.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290, partial [Prunus mume]
Length=996

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            E+ +E++D +L DS    EVLRCIHVGLLCVQ  P+DRP MS V+ MLS++I L  PK P
Sbjct  98   EKPLELIDKTLSDSCIISEVLRCIHVGLLCVQRVPEDRPSMSSVVLMLSSDITLPPPKQP  157

Query  181  GF  186
            GF
Sbjct  158  GF  159


 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPGF  186
            +E++D SL DS    EVLRC+HV LLCVQ  P+DRP MS V+ MLS+ + L  PK PGF
Sbjct  909  LELIDKSLSDSCTISEVLRCLHVALLCVQQVPEDRPSMSSVVLMLSSEVALPPPKQPGF  967



>gb|KCW76518.1| hypothetical protein EUGRSUZ_D00907 [Eucalyptus grandis]
Length=593

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLS-NNIELARPKPPGF  186
            ++IVD ++GDS    EVLRCI +GLLCVQ + +DRP MS V+FML+ NN+ LA PK P +
Sbjct  503  VDIVDETMGDSCSKEEVLRCIQIGLLCVQEFAEDRPNMSAVVFMLANNNVVLASPKRPAY  562

Query  187  IF  192
            +F
Sbjct  563  VF  564



>ref|XP_010240988.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Nelumbo nucifera]
Length=867

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNI-ELARPKPP  180
            R++E+VD+S+GDS    EVLRCI VGLLCVQ   +DRPIMS V+ MLS+    + +PK P
Sbjct  772  RALELVDTSVGDSYHTYEVLRCIQVGLLCVQERAEDRPIMSTVVLMLSSETATMPQPKEP  831

Query  181  GF  186
            GF
Sbjct  832  GF  833



>ref|XP_002518594.1| Negative regulator of the PHO system, putative [Ricinus communis]
 gb|EEF43981.1| Negative regulator of the PHO system, putative [Ricinus communis]
Length=1480

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +1

Query  4     RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
             R++EIVD SLGD+    EVLRCI +GLLCVQ    DRP M+ V+FMLSN+  L  P  P 
Sbjct  1388  RALEIVDISLGDAYPEHEVLRCIQIGLLCVQESAVDRPAMTTVVFMLSNHTILPSPNQPA  1447

Query  184   FIFNQ  198
             FI  +
Sbjct  1448  FIMKR  1452



>ref|XP_007133047.1| hypothetical protein PHAVU_011G147000g [Phaseolus vulgaris]
 gb|ESW05041.1| hypothetical protein PHAVU_011G147000g [Phaseolus vulgaris]
Length=830

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  55   EVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPGFI  189
            EVLRC+HVGLLCVQ YPDDRP M  VI ML ++IELA PK P FI
Sbjct  757  EVLRCLHVGLLCVQQYPDDRPTMMSVILMLESHIELAEPKEPAFI  801



>emb|CBI20438.3| unnamed protein product [Vitis vinifera]
Length=910

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +1

Query  1    ERS-MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKP  177
            ER+ +E++D+S+GD+ +  EVLR ++VGLLCVQ +PDDRP MS V+ MLS+   L +PK 
Sbjct  706  ERTPLELIDASVGDTYNQSEVLRALNVGLLCVQRHPDDRPNMSSVVLMLSSEGALRQPKE  765

Query  178  PGF  186
            PGF
Sbjct  766  PGF  768



>ref|XP_009370814.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103960095 
[Pyrus x bretschneideri]
Length=1636

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  1     ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
             +R++EIVDSSL +S    EVLRCI VGLLCVQ  P+DRP M+ V+FMLS       PK P
Sbjct  1544  DRALEIVDSSL-ESYQSEEVLRCIQVGLLCVQEDPEDRPTMAAVVFMLSGEASPPVPKQP  1602

Query  181   GFIFNQ  198
              F+F +
Sbjct  1603  AFVFRK  1608


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            +R++EIVDSSL +S+   EV+RCI VGLLCVQ  P+DRP M+ V+ MLS       PK P
Sbjct  714  DRALEIVDSSL-ESNQSEEVVRCIQVGLLCVQEDPEDRPTMAAVVVMLSGEASPPVPKQP  772

Query  181  GFIFNQ  198
             F+F +
Sbjct  773  AFVFRK  778



>gb|KHN28389.1| Receptor-like serine/threonine-protein kinase SD1-8 [Glycine 
soja]
Length=809

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            + ++++ DSS+ DS    EVLRCIHV LLCVQ YP+DRP M+ VI ML + +++  PK P
Sbjct  716  QNALQLFDSSIKDSCVISEVLRCIHVSLLCVQQYPEDRPTMTSVIQMLGSEMDMVEPKEP  775

Query  181  GF  186
            GF
Sbjct  776  GF  777



>ref|XP_008789837.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-7 
[Phoenix dactylifera]
Length=1551

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFML-SNNIELARPKP  177
            E+S+++VD SLG     +EV++CI VGLLCVQ +P+DRP+MS V+ ML S++  L  PK 
Sbjct  727  EKSLQLVDESLGYDFSAKEVIKCIKVGLLCVQEHPEDRPLMSSVVLMLGSDSAALPNPKQ  786

Query  178  PGFI  189
            PGF+
Sbjct  787  PGFV  790


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +1

Query  13    EIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPGF  186
             E+VD S+ +S    E L CI VGLLCVQ  P DRP MS V+ MLS+ N     PK PGF
Sbjct  1461  ELVDKSISNSIYMVEALNCIKVGLLCVQECPKDRPTMSSVVLMLSSKNASSTNPKHPGF  1519



>gb|KCW76519.1| hypothetical protein EUGRSUZ_D00907 [Eucalyptus grandis]
Length=596

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLS-NNIELARPKPPGF  186
            ++IVD ++GDS    EVLRCI +GLLCVQ + +DRP MS V+FML+ NN+ LA PK P +
Sbjct  506  VDIVDETMGDSCSKEEVLRCIQIGLLCVQEFAEDRPNMSAVVFMLANNNVVLASPKRPAY  565

Query  187  IF  192
            +F
Sbjct  566  VF  567



>ref|XP_009136911.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
16 isoform X1 [Brassica rapa]
Length=667

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKP  177
            E  +E++D ++G++ D  EV RCIH+GLLCVQ  P DRP MS V  ML+N +I L  P+P
Sbjct  564  ESLLELMDPAMGENYDKDEVTRCIHIGLLCVQENPADRPTMSTVFQMLTNTSITLPVPQP  623

Query  178  PGFIF  192
            PGF F
Sbjct  624  PGFFF  628



>emb|CDY10848.1| BnaC01g14630D [Brassica napus]
Length=673

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKP  177
            E  +E++D ++G++ D  EV RCIH+GLLCVQ  P DRP MS V  ML+N +I L  P+P
Sbjct  570  ESLLELMDPAMGENYDKDEVTRCIHIGLLCVQENPADRPTMSTVFQMLTNTSITLPVPQP  629

Query  178  PGFIF  192
            PGF F
Sbjct  630  PGFFF  634



>ref|XP_009377332.1| PREDICTED: uncharacterized protein LOC103965953 [Pyrus x bretschneideri]
Length=1291

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  4     RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
             RS+E++D  L DS    EVLRCIHV LLCVQ  P+DRP MS V+ ML     L +PK PG
Sbjct  1189  RSLELIDEYLTDSCSLSEVLRCIHVSLLCVQHLPEDRPTMSSVVLMLGGESALPQPKKPG  1248

Query  184   FIFNQ  198
             F   +
Sbjct  1249  FFIGK  1253


 Score = 73.2 bits (178),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            RS+E++D  L DS    EVLRCIHV LLCVQ  P+DRP MS V+ ML     L +PK PG
Sbjct  496  RSLELIDEYLTDSCSLSEVLRCIHVSLLCVQQLPEDRPTMSSVVLMLGGEGALPQPKMPG  555

Query  184  FIFNQ  198
                +
Sbjct  556  LFIGK  560



>ref|XP_002530266.1| S-locus-specific glycoprotein S13 precursor, putative [Ricinus 
communis]
 gb|EEF32106.1| S-locus-specific glycoprotein S13 precursor, putative [Ricinus 
communis]
Length=793

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            +R++EI+DSSL +S D  E LRCI +GLLCVQ    DRP MS V+ MLS+ I L  PK  
Sbjct  702  DRALEIIDSSLKESYDSHEALRCIQIGLLCVQANEMDRPTMSNVLLMLSSEISLPSPKQS  761

Query  181  GFIFNQ  198
             FI ++
Sbjct  762  AFIVSK  767



>ref|XP_002316689.2| hypothetical protein POPTR_0011s02090g [Populus trichocarpa]
 gb|EEE97301.2| hypothetical protein POPTR_0011s02090g [Populus trichocarpa]
Length=811

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++++EIVD SL +  D RE L+CI +GLLCVQ    DRP M  V+FMLSN  E+  PK P
Sbjct  717  DKALEIVDPSLAELYDPREALKCIQIGLLCVQEDAADRPSMLAVVFMLSNETEIPSPKQP  776

Query  181  GFIFNQ  198
             F+F +
Sbjct  777  AFLFRK  782



>ref|XP_008355367.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X2 [Malus domestica]
Length=357

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            RS+E++D  L DS    EVLRCIHV LLCVQ  P+DRP MS V+ ML     L +PK PG
Sbjct  255  RSLELIDEYLTDSCSLSEVLRCIHVSLLCVQQLPEDRPTMSSVVLMLGGESALPQPKKPG  314

Query  184  FIFNQ  198
                +
Sbjct  315  LFIGK  319



>ref|XP_007214639.1| hypothetical protein PRUPE_ppa001616mg [Prunus persica]
 gb|EMJ15838.1| hypothetical protein PRUPE_ppa001616mg [Prunus persica]
Length=792

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            +R++EIVDSSL +S    EVLRCI VGLLCVQ   +DRP MS V+FMLS    L  P+ P
Sbjct  700  DRALEIVDSSL-ESYHSDEVLRCIQVGLLCVQEDSEDRPTMSAVLFMLSGEASLPSPQQP  758

Query  181  GFIFNQ  198
             F+F +
Sbjct  759  AFVFRK  764



>ref|XP_010644286.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Vitis vinifera]
Length=820

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +1

Query  1    ERS-MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKP  177
            ER+ +E++D+S+GD+ +  EVLR ++VGLLCVQ +PDDRP MS V+ MLS+   L +PK 
Sbjct  726  ERTPLELIDASVGDTYNQSEVLRALNVGLLCVQRHPDDRPNMSSVVLMLSSEGALRQPKE  785

Query  178  PGF  186
            PGF
Sbjct  786  PGF  788



>gb|KCW76498.1| hypothetical protein EUGRSUZ_D00886 [Eucalyptus grandis]
Length=1284

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = +1

Query  13    EIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNN-IELARPKPPGFI  189
             +++D S+GDS    E LRCI +GLLCVQ + DDRP MS V+ ML+NN + LA PK P ++
Sbjct  1195  DVIDESMGDSCSKEEALRCIQIGLLCVQEFADDRPNMSAVVLMLANNDVALAFPKRPAYV  1254

Query  190   FNQ  198
             F +
Sbjct  1255  FKR  1257



>ref|XP_010644287.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Vitis vinifera]
Length=818

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +1

Query  1    ERS-MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKP  177
            ER+ +E++D+S+GD+ +  EVLR ++VGLLCVQ +PDDRP MS V+ MLS+   L +PK 
Sbjct  724  ERTPLELIDASVGDTYNQSEVLRALNVGLLCVQRHPDDRPNMSSVVLMLSSEGALRQPKE  783

Query  178  PGF  186
            PGF
Sbjct  784  PGF  786



>ref|XP_008363599.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X2 [Malus domestica]
Length=303

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            RS+E++D  L DS    EVLRCIHV LLCVQ  P+DRP MS V+ ML     L +PK PG
Sbjct  201  RSLELIDEYLTDSCSLSEVLRCIHVSLLCVQHLPEDRPTMSSVVLMLGGESALPQPKKPG  260

Query  184  FIFNQ  198
            F   +
Sbjct  261  FFIGK  265



>emb|CDY41245.1| BnaA01g12940D [Brassica napus]
Length=672

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKP  177
            E  +E++D ++G++ D  EV RCIH+GLLCVQ  P DRP MS V  ML+N +I L  P+P
Sbjct  569  ESLLELMDPAMGENYDKDEVTRCIHIGLLCVQENPADRPTMSTVFQMLTNTSITLPVPQP  628

Query  178  PGFIF  192
            PGF F
Sbjct  629  PGFFF  633



>ref|XP_006377803.1| hypothetical protein POPTR_0011s13030g [Populus trichocarpa]
 gb|ERP55600.1| hypothetical protein POPTR_0011s13030g [Populus trichocarpa]
Length=149

 Score = 72.4 bits (176),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPP  180
            R+ E++D+ L D+    ++LRCI VGLLCVQ  P+DRP+MS V+FML+N    L +PK P
Sbjct  57   RASELIDTGLEDTSGKSQLLRCIQVGLLCVQKLPEDRPVMSTVVFMLANEGAVLPQPKQP  116

Query  181  GFIFNQ  198
            GF   +
Sbjct  117  GFFIER  122



>ref|XP_007021200.1| S-locus lectin protein kinase family protein [Theobroma cacao]
 gb|EOY12725.1| S-locus lectin protein kinase family protein [Theobroma cacao]
Length=1735

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  1     ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
             +R ME++D + GD     E+LRCIHVGLLCVQ  P+DRP MS VI ML +   L +PK P
Sbjct  1642  KRPMELIDDAFGDFCLPSEMLRCIHVGLLCVQQRPEDRPNMSSVIVMLGSESALPQPKQP  1701

Query  181   GF  186
             GF
Sbjct  1702  GF  1703


 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R ME++D +L +     EV RCIHVGLLCVQ  P+DRP MS VI ML +   L +PK PG
Sbjct  723  RPMELIDDALRNFCLPSEVQRCIHVGLLCVQQRPEDRPHMSSVIVMLGSENALPQPKQPG  782

Query  184  F  186
            F
Sbjct  783  F  783



>ref|XP_011008158.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1 isoform X6 [Populus euphratica]
Length=846

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++++EIVD SL +  D RE L+CI +GLLCVQ  P DRP M  V+FMLS+  E+  PK P
Sbjct  752  DKALEIVDPSLYELYDPREALKCIQIGLLCVQEDPTDRPSMLAVVFMLSSETEIPSPKQP  811

Query  181  GFIFNQ  198
             F+F +
Sbjct  812  AFLFRK  817



>gb|KDP34761.1| hypothetical protein JCGZ_10541 [Jatropha curcas]
Length=823

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ER +E++D+ LG+S    E++RCIHVGLLC Q  P+DRP MS V+ ML     L +PK P
Sbjct  730  ERPLELMDNMLGESATLSEIIRCIHVGLLCAQQRPEDRPNMSTVVLMLGGESSLPQPKQP  789

Query  181  GF  186
            GF
Sbjct  790  GF  791



>ref|XP_007021206.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY12731.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=1524

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  1     ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
             ER +E++D++LG+S    EVLRCI+V LLCVQ +P+DRP MS V+ MLS    L +PK P
Sbjct  1431  ERPLELIDNALGNSYIVAEVLRCINVALLCVQRHPEDRPNMSMVLLMLSGETILPKPKQP  1490

Query  181   GFIFNQ  198
             GF   +
Sbjct  1491  GFFIER  1496


 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ER +E+ D++LG+S    EVLRCI+V LLCVQ +P+DRP MS V+ MLS    L +PK P
Sbjct  685  ERPLELTDNALGNSYIVAEVLRCINVALLCVQRHPEDRPNMSMVLLMLSGQTILPQPKQP  744

Query  181  GFIFNQ  198
            GF   +
Sbjct  745  GFFIER  750



>gb|KEH19660.1| S-locus lectin kinase family protein [Medicago truncatula]
Length=824

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 32/65 (49%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R++E++D ++ D+    E LRCIHV LLCVQ +P+DRP M  VI ML ++ E A+PK PG
Sbjct  732  RALELIDKNIKDACVESEALRCIHVSLLCVQQFPEDRPGMPSVILMLGSDGEFAKPKEPG  791

Query  184  FIFNQ  198
            +  N+
Sbjct  792  YYVNK  796



>ref|XP_010052477.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 isoform X1 [Eucalyptus grandis]
Length=840

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLS-NNIELARPKPPGF  186
            ++IVD ++GDS    EVLRCI +GLLCVQ + +DRP MS V+FML+ NN+ LA PK P +
Sbjct  750  VDIVDETMGDSCSKEEVLRCIQIGLLCVQEFAEDRPNMSAVVFMLANNNVVLASPKRPAY  809

Query  187  IF  192
            +F
Sbjct  810  VF  811



>gb|EYU33571.1| hypothetical protein MIMGU_mgv1a020014mg [Erythranthe guttata]
Length=808

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ERS+E+VDS L +S   REVLR I VGLLCVQ  P+DRP MS V+FMLSN   L   K P
Sbjct  715  ERSLELVDSYLINSGYLREVLRSIEVGLLCVQERPEDRPNMSTVVFMLSNECVLPEAKHP  774

Query  181  GF  186
            GF
Sbjct  775  GF  776



>gb|KEH19659.1| S-locus lectin kinase family protein [Medicago truncatula]
Length=786

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 32/65 (49%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R++E++D ++ D+    E LRCIHV LLCVQ +P+DRP M  VI ML ++ E A+PK PG
Sbjct  694  RALELIDKNIKDACVESEALRCIHVSLLCVQQFPEDRPGMPSVILMLGSDGEFAKPKEPG  753

Query  184  FIFNQ  198
            +  N+
Sbjct  754  YYVNK  758



>ref|XP_010052478.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 isoform X2 [Eucalyptus grandis]
Length=837

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLS-NNIELARPKPPGF  186
            ++IVD ++GDS    EVLRCI +GLLCVQ + +DRP MS V+FML+ NN+ LA PK P +
Sbjct  747  VDIVDETMGDSCSKEEVLRCIQIGLLCVQEFAEDRPNMSAVVFMLANNNVVLASPKRPAY  806

Query  187  IF  192
            +F
Sbjct  807  VF  808



>ref|XP_008226752.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Prunus mume]
Length=711

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            RS+E++D  L DS    EVLRC+HV LLCVQ  P+DRP MS V+ ML    +L +PK P 
Sbjct  608  RSLEMIDKCLSDSCTLSEVLRCVHVSLLCVQQLPEDRPTMSTVVLMLGGESDLPQPKKPA  667

Query  184  FIFNQ  198
            F   +
Sbjct  668  FFLGK  672



>gb|KCW76512.1| hypothetical protein EUGRSUZ_D00902 [Eucalyptus grandis]
Length=364

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +1

Query  13   EIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNN-IELARPKPPGFI  189
            +++D S+GDS    E LRCI +GLLCVQ + DDRP MS V+ ML+NN + LA PK P ++
Sbjct  275  DVIDESMGDSWSKEEALRCIQIGLLCVQEFADDRPNMSAVVLMLANNDVALAFPKRPAYV  334

Query  190  F  192
            F
Sbjct  335  F  335



>ref|XP_008226748.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Prunus mume]
 ref|XP_008226749.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Prunus mume]
 ref|XP_008226750.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Prunus mume]
 ref|XP_008226751.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Prunus mume]
Length=713

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            RS+E++D  L DS    EVLRC+HV LLCVQ  P+DRP MS V+ ML    +L +PK P 
Sbjct  610  RSLEMIDKCLSDSCTLSEVLRCVHVSLLCVQQLPEDRPTMSTVVLMLGGESDLPQPKKPA  669

Query  184  FIFNQ  198
            F   +
Sbjct  670  FFLGK  674



>ref|XP_008441715.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 [Cucumis melo]
Length=834

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPGFI  189
            ME+VDSSL ++    +++RC+ +GLLCVQ  P DRP MS V+FML N + L  PK P FI
Sbjct  744  MELVDSSLEETSCKYKIMRCLQIGLLCVQEDPTDRPTMSTVVFMLGNEVSLPSPKKPAFI  803

Query  190  FNQ  198
              +
Sbjct  804  LKR  806



>ref|XP_010433928.1| PREDICTED: cysteine-rich receptor-like protein kinase 11 [Camelina 
sativa]
Length=649

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFML-SNNIELARPKP  177
            E  +E+VDSS+ ++ +  EV RCIH+ LLCVQ  P DRP +SE++ ML S+ I+L  P+P
Sbjct  559  ESPLELVDSSISENYENEEVTRCIHIALLCVQKDPKDRPTLSEILLMLTSDTIDLPDPQP  618

Query  178  PGFIFN  195
            PGF+ +
Sbjct  619  PGFLIS  624



>ref|XP_006377788.1| hypothetical protein POPTR_0011s12840g [Populus trichocarpa]
 gb|ERP55585.1| hypothetical protein POPTR_0011s12840g [Populus trichocarpa]
Length=816

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ERS+E+ D++LG S    E++R IHVGLLCVQ  PDDRP MS  + ML     L +PK P
Sbjct  723  ERSLELTDNTLGASHALSEIIRYIHVGLLCVQQQPDDRPNMSTAVLMLGGESSLPQPKQP  782

Query  181  GFIFNQ  198
            GF   +
Sbjct  783  GFFLER  788



>ref|XP_002316940.2| hypothetical protein POPTR_0011s13040g [Populus trichocarpa]
 gb|EEE97552.2| hypothetical protein POPTR_0011s13040g [Populus trichocarpa]
Length=784

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ERS+E+ D++LG S    E++R IHVGLLCVQ  PDDRP MS  + ML     L +PK P
Sbjct  691  ERSLELTDNTLGASHALSEIIRYIHVGLLCVQQQPDDRPNMSTAVLMLGGESSLPQPKQP  750

Query  181  GFIFNQ  198
            GF   +
Sbjct  751  GFFLER  756



>ref|XP_003526165.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1-like [Glycine max]
Length=810

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            + +++++DS + DS    EVLRCIHV LLCVQ YP+DRP M+ VI ML + +++  PK P
Sbjct  721  QNALQLIDSGIKDSCVIPEVLRCIHVSLLCVQQYPEDRPTMTSVIQMLGSEMDMVEPKEP  780

Query  181  GF  186
            GF
Sbjct  781  GF  782



>ref|XP_010054453.1| PREDICTED: uncharacterized protein LOC104442758 [Eucalyptus grandis]
Length=1681

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/61 (54%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +1

Query  13    EIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPGFI  189
             +++D S+GDS    E LRCI +GLLCVQ + DDRP MS V+FML+N ++ LA PK P ++
Sbjct  1592  DVIDESMGDSCTKEEALRCIQIGLLCVQEFADDRPDMSTVVFMLANKDVVLASPKRPAYV  1651

Query  190   F  192
             F
Sbjct  1652  F  1652


 Score = 75.9 bits (185),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = +1

Query  13   EIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNN-IELARPKPPGFI  189
            +++D S+GDS    E LRCI +GLLCVQ + DDRP MS V+ ML+NN + LA PK P ++
Sbjct  752  DVIDESMGDSCSKEEALRCIQIGLLCVQEFADDRPNMSAVVLMLANNDVALAFPKRPAYV  811

Query  190  FNQ  198
            F +
Sbjct  812  FKR  814



>gb|KHN28390.1| Receptor-like serine/threonine-protein kinase SD1-8 [Glycine 
soja]
Length=810

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            + +++++DS + DS    EVLRCIHV LLCVQ YP+DRP M+ VI ML + +++  PK P
Sbjct  721  QNALQLIDSGIKDSCVIPEVLRCIHVSLLCVQQYPEDRPTMTSVIQMLGSEMDMVEPKEP  780

Query  181  GF  186
            GF
Sbjct  781  GF  782



>gb|KDO75650.1| hypothetical protein CISIN_1g005599mg [Citrus sinensis]
Length=688

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++++EIVDSS+ DS    E LRCI VGLLCVQ    DRP MS V+FMLSN   +  PK P
Sbjct  596  DKALEIVDSSMADSCPAPEALRCIQVGLLCVQDRTTDRPSMSTVVFMLSNETSVPSPKQP  655

Query  181  GF  186
             F
Sbjct  656  TF  657



>ref|XP_006283296.1| hypothetical protein CARUB_v10004334mg [Capsella rubella]
 gb|EOA16194.1| hypothetical protein CARUB_v10004334mg [Capsella rubella]
Length=649

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFML-SNNIELARPKP  177
            E  +E+VDSS+ ++ +  EV RCIH+ LLCVQ  P DRP +S ++ ML SN I+L  P+P
Sbjct  559  ESLLELVDSSISENCEKEEVKRCIHIALLCVQKDPKDRPTLSTILLMLTSNTIDLPDPQP  618

Query  178  PGFIFN  195
            PGF F+
Sbjct  619  PGFFFS  624



>ref|XP_002316691.2| hypothetical protein POPTR_0011s02060g [Populus trichocarpa]
 gb|EEE97303.2| hypothetical protein POPTR_0011s02060g [Populus trichocarpa]
Length=811

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++++EIVD SL +  D RE L+CI +GLLCVQ    DRP M  V+FMLSN  E+  PK P
Sbjct  717  DKALEIVDPSLTELYDPREALKCIQIGLLCVQEDATDRPSMLAVVFMLSNETEIPSPKQP  776

Query  181  GFIFNQ  198
             F+F +
Sbjct  777  AFLFRK  782



>gb|KCW76510.1| hypothetical protein EUGRSUZ_D00899 [Eucalyptus grandis]
Length=732

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/61 (54%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +1

Query  13   EIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPGFI  189
            +++D S+GDS    E LRCI +GLLCVQ + DDRP MS V+FML+N ++ LA PK P ++
Sbjct  643  DVIDESMGDSCTKEEALRCIQIGLLCVQEFADDRPDMSTVVFMLANKDVVLASPKRPAYV  702

Query  190  F  192
            F
Sbjct  703  F  703



>ref|XP_008224902.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103324604 
[Prunus mume]
Length=1622

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  1     ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
             +R++EIVDSSL  S    EVLRCI VGLLCVQ   +DRP MS V+FMLS    L  P+ P
Sbjct  1530  DRALEIVDSSL-QSYHSDEVLRCIQVGLLCVQEDSEDRPTMSAVVFMLSGEASLPSPQQP  1588

Query  181   GFIFNQ  198
              F+F +
Sbjct  1589  AFVFRK  1594


 Score = 70.9 bits (172),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            +R++EIVDS L +S    EV RCI VGLLCVQ    DRP MS V+FMLS    L  P+ P
Sbjct  714  DRALEIVDSLL-ESYHSDEVTRCIQVGLLCVQEDSKDRPTMSAVVFMLSGEASLPSPQQP  772

Query  181  GFIFNQ  198
             F+F +
Sbjct  773  AFVFRK  778



>ref|XP_006582219.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Glycine max]
Length=816

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 48/63 (76%), Gaps = 1/63 (2%)
 Frame = +1

Query  4    RSMEIVD-SSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            R+++++D S++ +S    EVLRCIHVGLLCVQ YP+DRP M+ VI ML +++EL  PK  
Sbjct  723  RALDLIDDSNMKESCVISEVLRCIHVGLLCVQQYPEDRPTMASVILMLESHMELVEPKEH  782

Query  181  GFI  189
            GFI
Sbjct  783  GFI  785



>ref|XP_010445184.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
16 [Camelina sativa]
Length=519

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPGF  186
            +E+VD ++G++ D  EV+RCIH+GLLCVQ  P DRP MS +  ML+N +I L  P+PPGF
Sbjct  420  LELVDPAMGENYDKYEVIRCIHIGLLCVQENPADRPTMSTIFQMLTNTSITLPVPQPPGF  479

Query  187  IF  192
            +F
Sbjct  480  VF  481



>ref|NP_194060.3| cysteine-rich receptor-like protein kinase 21 [Arabidopsis thaliana]
 sp|Q3E9X6.1|CRK21_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 21; 
Short=Cysteine-rich RLK21; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE84735.1| cysteine-rich receptor-like protein kinase 21 [Arabidopsis thaliana]
Length=690

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPGF  186
            +E+VD ++G++ D  EV+RCIH+GLLCVQ  PDDRP MS +  ML+N +I L  P+PPGF
Sbjct  591  LELVDPAIGENYDKDEVIRCIHIGLLCVQENPDDRPSMSTIFRMLTNVSITLPVPQPPGF  650

Query  187  IFNQ  198
             F +
Sbjct  651  FFRE  654



>ref|XP_006449167.1| hypothetical protein CICLE_v10014259mg [Citrus clementina]
 gb|ESR62407.1| hypothetical protein CICLE_v10014259mg [Citrus clementina]
Length=845

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++++EIVDSS+ DS    E LRCI VGLLCVQ    DRP MS V+FMLSN   +  PK P
Sbjct  753  DKALEIVDSSMADSCPAPEALRCIQVGLLCVQDRTTDRPSMSTVVFMLSNETSVPSPKQP  812

Query  181  GF  186
             F
Sbjct  813  TF  814



>ref|NP_849550.1| cysteine-rich receptor-like protein kinase 21 [Arabidopsis thaliana]
 gb|AAM20434.1| serine/threonine kinase-like protein [Arabidopsis thaliana]
 gb|AAN15560.1| serine/threonine kinase-like protein [Arabidopsis thaliana]
 gb|AEE84734.1| cysteine-rich receptor-like protein kinase 21 [Arabidopsis thaliana]
Length=600

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPGF  186
            +E+VD ++G++ D  EV+RCIH+GLLCVQ  PDDRP MS +  ML+N +I L  P+PPGF
Sbjct  501  LELVDPAIGENYDKDEVIRCIHIGLLCVQENPDDRPSMSTIFRMLTNVSITLPVPQPPGF  560

Query  187  IFNQ  198
             F +
Sbjct  561  FFRE  564



>ref|XP_010644302.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X3 [Vitis vinifera]
Length=773

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            RSME++D+S+GD  D  +VLR I+VGLLCVQ   DDRP M  V+ MLS++  L +PK PG
Sbjct  684  RSMELIDTSVGDMHDLSQVLRSINVGLLCVQCSLDDRPSMYSVVLMLSSDGALPQPKEPG  743

Query  184  F  186
            F
Sbjct  744  F  744



>gb|KEH30777.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=815

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFML-SNNIELARPKPP  180
            R ++I+DS++ DS    EV RCIHVGLLCVQ YP+DRP M++VI ML S  + L  PK P
Sbjct  722  RPLQIIDSNIVDSCIVSEVSRCIHVGLLCVQQYPEDRPTMADVILMLGSEMMTLDEPKEP  781

Query  181  GF  186
            GF
Sbjct  782  GF  783



>ref|XP_007021195.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY12720.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=1121

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R ME++D +L D     EV RCIHVGLLCVQ  P+DRP MS VI MLS+   L +PK PG
Sbjct  729  RPMELIDDALRDFCLPSEVQRCIHVGLLCVQQRPEDRPNMSSVILMLSSESALPQPKQPG  788

Query  184  F  186
            F
Sbjct  789  F  789



>ref|XP_010644300.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Vitis vinifera]
Length=821

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            RSME++D+S+GD  D  +VLR I+VGLLCVQ   DDRP M  V+ MLS++  L +PK PG
Sbjct  732  RSMELIDTSVGDMHDLSQVLRSINVGLLCVQCSLDDRPSMYSVVLMLSSDGALPQPKEPG  791

Query  184  F  186
            F
Sbjct  792  F  792



>ref|XP_010644299.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Vitis vinifera]
Length=822

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            RSME++D+S+GD  D  +VLR I+VGLLCVQ   DDRP M  V+ MLS++  L +PK PG
Sbjct  733  RSMELIDTSVGDMHDLSQVLRSINVGLLCVQCSLDDRPSMYSVVLMLSSDGALPQPKEPG  792

Query  184  F  186
            F
Sbjct  793  F  793



>ref|XP_008372163.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520, partial [Malus domestica]
Length=335

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPP  180
            + +E++D +LGDS +G ++LRCIHVGLLCV     DRP MS+VI ML+N ++EL +PK P
Sbjct  242  KELELMDPTLGDSYNGNQLLRCIHVGLLCVDENAADRPTMSDVISMLTNESMELPKPKKP  301

Query  181  GF  186
             +
Sbjct  302  AY  303



>ref|XP_010052475.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 isoform X1 [Eucalyptus grandis]
 gb|KCW76522.1| hypothetical protein EUGRSUZ_D00910 [Eucalyptus grandis]
Length=840

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLS-NNIELARPKPPGF  186
            ++IVD ++ DS    EVLRCI +GLLCVQ + +DRP MS V+FML+ NN+ LA PK P +
Sbjct  750  VDIVDETMDDSCSKEEVLRCIQIGLLCVQEFAEDRPNMSAVVFMLANNNVVLASPKRPAY  809

Query  187  IF  192
            +F
Sbjct  810  VF  811



>ref|XP_008226333.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290, partial [Prunus mume]
Length=1318

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++ +E++D  L DS    EVLRC+HV LLCVQ  P+DRP MS V+ MLS+++ L  PK P
Sbjct  731  DKPLELIDKILRDSCTISEVLRCLHVALLCVQRVPEDRPSMSSVVLMLSSDVTLPPPKQP  790

Query  181  GF  186
            GF
Sbjct  791  GF  792



>ref|XP_003607720.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=984

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFML-SNNIELARPKPP  180
            R ++I+DS++ DS    EV RCIHVGLLCVQ YP+DRP M++VI ML S  + L  PK P
Sbjct  800  RPLQIIDSNIVDSCIVSEVSRCIHVGLLCVQQYPEDRPTMADVILMLGSEMMTLDEPKEP  859

Query  181  GF  186
            GF
Sbjct  860  GF  861



>ref|XP_006387001.1| hypothetical protein POPTR_2263s002002g, partial [Populus trichocarpa]
 gb|ERP45915.1| hypothetical protein POPTR_2263s002002g, partial [Populus trichocarpa]
Length=227

 Score = 72.4 bits (176),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++++EIVD SL +  D RE L+CI +GLLCVQ    DRP M  V+FMLSN  E+  PK P
Sbjct  133  DKALEIVDPSLTELYDPREALKCIQIGLLCVQEDAADRPSMLAVVFMLSNETEIPSPKQP  192

Query  181  GFIFNQ  198
             F+F +
Sbjct  193  AFLFRK  198



>gb|KDP36269.1| hypothetical protein JCGZ_09834 [Jatropha curcas]
Length=567

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ERS E+VD++L DS   RE LRCIHVGLLCVQ  P++RP MS V+ MLS++  L +PK P
Sbjct  475  ERSSELVDNTL-DSYSIREALRCIHVGLLCVQQRPEERPSMSTVVVMLSSDSALPQPKQP  533

Query  181  GFI  189
            GF 
Sbjct  534  GFF  536



>ref|XP_008366485.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-6 
[Malus domestica]
Length=1640

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R  E++D+ LG S    EVLRCIHV LLCVQ +P+DRP M+ V+ ML   I LA PK PG
Sbjct  731  RHSELMDTCLGSSCVLSEVLRCIHVSLLCVQHHPEDRPSMASVVIMLGTEIALAPPKQPG  790

Query  184  FIFNQ  198
            F   +
Sbjct  791  FFMER  795


 Score = 70.5 bits (171),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  4     RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
             R +E++D+ L  S    E LRCIHV LLCVQ  P+DRP M+ V+ ML + I L  PK PG
Sbjct  1553  RPLELIDTCLAGSCMLSEALRCIHVSLLCVQHNPEDRPNMASVVIMLGSEIALTHPKQPG  1612

Query  184   F  186
             F
Sbjct  1613  F  1613



>ref|XP_002867725.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43984.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=660

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +1

Query  7    SMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNN-IELARPKPPG  183
            S+E++D ++G++ D  EV+RCIH+GLLCVQ  P DRP MS V  ML+NN I L  P+ PG
Sbjct  560  SLELIDPAIGENYDKDEVIRCIHIGLLCVQENPADRPTMSNVFQMLTNNSITLPVPQTPG  619

Query  184  FIFN  195
            F+F 
Sbjct  620  FVFT  623



>ref|XP_007214023.1| hypothetical protein PRUPE_ppa016527mg [Prunus persica]
 gb|EMJ15222.1| hypothetical protein PRUPE_ppa016527mg [Prunus persica]
Length=859

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R +E++D  LG S    EVLRCIHV LLCVQ +P+DRP M+ V+ ML + I LA+PK PG
Sbjct  769  RPLELIDMRLGSSYTLSEVLRCIHVSLLCVQHHPEDRPTMASVLIMLGSEIPLAQPKQPG  828

Query  184  FI  189
            F 
Sbjct  829  FF  830



>ref|XP_010448735.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
16 isoform X2 [Camelina sativa]
Length=478

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPGF  186
            +E+VD ++G++ D  EV+RCIH+GLLCVQ  P DRP MS +  ML+N +I L  P+PPGF
Sbjct  379  LELVDPAMGENYDKYEVIRCIHIGLLCVQENPADRPAMSTIFQMLTNISITLPVPQPPGF  438

Query  187  IF  192
            +F
Sbjct  439  VF  440



>ref|XP_009611412.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nicotiana tomentosiformis]
Length=828

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 39/61 (64%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R +E+VDS+L DS    EVLR IHVGLLCVQ  P+DRP MS VI MLSN   L  PK PG
Sbjct  736  RQLELVDSNLVDSCYVSEVLRSIHVGLLCVQQNPEDRPSMSTVIMMLSNEGILPPPKHPG  795

Query  184  F  186
            F
Sbjct  796  F  796



>ref|XP_010445177.1| PREDICTED: cysteine-rich receptor-like protein kinase 21 [Camelina 
sativa]
Length=310

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPGF  186
            +E+VD ++G++ D  EV+RCIH+GLLCVQ  P DRP MS +  ML+N +I L  P+PPGF
Sbjct  211  LELVDPAIGENYDKDEVIRCIHIGLLCVQENPGDRPSMSTIFRMLTNASITLPVPQPPGF  270

Query  187  IFNQ  198
             F +
Sbjct  271  FFRE  274



>ref|XP_008441725.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1 [Cucumis melo]
Length=838

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            + +ME+VDSSL  +    E+ RC+ +GLLCVQ  P DRP MS VIFML N + L  PK P
Sbjct  741  DNAMELVDSSLEGASFEYEITRCLQIGLLCVQEDPTDRPTMSTVIFMLENEVNLPCPKKP  800

Query  181  GFIFNQ  198
             FI  +
Sbjct  801  AFILKR  806



>ref|XP_009369777.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11410 isoform X1 [Pyrus x bretschneideri]
Length=838

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            + ++I+DSSL  S    EV+RCI +GLLCVQ YP DRP M +V+FML N   L RPK   
Sbjct  749  KVLDIIDSSLNQSYSTPEVMRCIQIGLLCVQEYPTDRPTMLDVVFMLGNETTLPRPKKAA  808

Query  184  F  186
            F
Sbjct  809  F  809



>ref|XP_006383976.1| hypothetical protein POPTR_0004s02760g [Populus trichocarpa]
 gb|ERP61773.1| hypothetical protein POPTR_0004s02760g [Populus trichocarpa]
Length=526

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            E++++IVD  L  +    EVLRC+ +GLLCVQ +PDDRP M EV+FML N I L  PK P
Sbjct  433  EKALDIVDPMLEQACPPHEVLRCVQIGLLCVQEFPDDRPAMLEVVFMLGNEIALPSPKKP  492

Query  181  GFIF  192
             F+ 
Sbjct  493  AFVL  496



>ref|XP_006286462.1| hypothetical protein CARUB_v10000407mg [Capsella rubella]
 gb|EOA19360.1| hypothetical protein CARUB_v10000407mg [Capsella rubella]
Length=662

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKP  177
            E  +E++D ++ +S D  EV+RCIH+G+LCVQ  P DRP MS +  ML+N +I L  P+P
Sbjct  560  ESPLELIDPAIKESYDNDEVIRCIHIGILCVQETPADRPAMSTIFQMLTNSSITLPVPRP  619

Query  178  PGFIF  192
            PGF F
Sbjct  620  PGFFF  624



>ref|XP_009587205.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Nicotiana tomentosiformis]
Length=808

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            +RS+E++D  L DS    +VLR I VGLLCVQ +PDDRP MS V+ ML+N   L + K P
Sbjct  716  DRSLELIDEQLADSCHVSQVLRSIQVGLLCVQQHPDDRPSMSSVVLMLANESLLPKAKEP  775

Query  181  GF  186
            GF
Sbjct  776  GF  777



>gb|KCW67068.1| hypothetical protein EUGRSUZ_F008421, partial [Eucalyptus grandis]
Length=287

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            +S E++D  L D+ +  +VLRC+H+GLLC+Q +P+DRP MS V+ MLS++  LA P+ PG
Sbjct  196  KSSELIDPCLADTSNLSQVLRCVHIGLLCLQEHPEDRPSMSSVVTMLSSDNSLAVPQQPG  255

Query  184  FI  189
            F+
Sbjct  256  FL  257



>ref|XP_010445182.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
16 [Camelina sativa]
Length=191

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKP  177
            E  +E+VD ++G++ D  EV+RCIH+GLLCVQ  P DRP MS +  M +N +I L  P+P
Sbjct  89   ESFLELVDPAMGENYDKDEVIRCIHIGLLCVQENPTDRPTMSTIFQMFTNISIILPVPQP  148

Query  178  PGFIF  192
            PG++F
Sbjct  149  PGYVF  153



>ref|XP_008363600.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 [Malus domestica]
Length=191

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            RS+E++D  L DS    EVLRCIHV LLCVQ  P+DRP MS V+ ML     L +PK PG
Sbjct  89   RSLELIDEYLTDSCSLSEVLRCIHVSLLCVQQLPEDRPTMSSVVLMLGGESALPQPKKPG  148

Query  184  FIFNQ  198
                +
Sbjct  149  LFIGK  153



>ref|XP_006468224.1| PREDICTED: uncharacterized protein LOC102627899 [Citrus sinensis]
Length=1716

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  1     ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
             ++++EIVDSS+ DS    E LRCI VGLLCVQ    DRP MS V+FMLSN   +  PK P
Sbjct  1624  DKALEIVDSSMADSCPAPEALRCIQVGLLCVQDRTTDRPSMSTVVFMLSNETSVPSPKQP  1683

Query  181   GF  186
              F
Sbjct  1684  TF  1685


 Score = 71.2 bits (173),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            +++EIVDSS+ +S    E LRCI VGLLCVQ    DRP MS V+FMLSN   +  PK P 
Sbjct  755  KALEIVDSSMANSCLASEALRCIQVGLLCVQDRTTDRPSMSTVVFMLSNETFVPSPKQPT  814

Query  184  F  186
            F
Sbjct  815  F  815



>ref|XP_010644281.1| PREDICTED: uncharacterized protein LOC100246941 [Vitis vinifera]
Length=1583

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  4     RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
             RSME++DSS+GD  D  +VL  I+VGLLCVQ  PDDRP MS V+ MLS++  L +PK PG
Sbjct  1494  RSMELIDSSVGDMHDLSQVLCSINVGLLCVQCSPDDRPSMSSVVLMLSSDSSLPQPKEPG  1553

Query  184   FI  189
             F 
Sbjct  1554  FF  1555


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            RSME++DSS+GD  +  +VLR I+VGLLCVQ  PD+RP MS V+ MLS++  L +PK PG
Sbjct  722  RSMELIDSSVGDIHNLSQVLRLINVGLLCVQCGPDERPSMSSVVLMLSSDSTLPQPKEPG  781

Query  184  FI  189
            F 
Sbjct  782  FF  783



>ref|XP_006383979.1| hypothetical protein POPTR_0004s02800g [Populus trichocarpa]
 gb|ERP61776.1| hypothetical protein POPTR_0004s02800g [Populus trichocarpa]
Length=371

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R++E+VD+ +GDS    +VLRCI +GLLCVQ    DRP MS V+FMLSN+  L  PK P 
Sbjct  280  RALELVDTLMGDSYPEDQVLRCIQIGLLCVQESAMDRPSMSNVVFMLSNDTTLPSPKQPA  339

Query  184  FIFNQ  198
            FI  +
Sbjct  340  FILKK  344



>gb|AES68383.2| S-locus lectin kinase family protein [Medicago truncatula]
Length=867

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +1

Query  7    SMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPGF  186
            S E++D  L DS    E LRCI VGLLC+QL+P+DRP M+ V+ ML+N   LA+PK PGF
Sbjct  739  SEELIDDCLRDSYIPSEALRCIQVGLLCLQLHPNDRPNMTYVLAMLTNESVLAQPKEPGF  798

Query  187  IFNQ  198
            I  +
Sbjct  799  IMQR  802



>gb|KHN28385.1| Receptor-like serine/threonine-protein kinase SD1-8 [Glycine 
soja]
Length=804

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            + +++IVD ++ DS    EVLRCIH+GLLCVQ YP+DRP M+ V+ +L + +EL   K P
Sbjct  715  DMALQIVDPNMEDSCIASEVLRCIHIGLLCVQQYPEDRPTMTSVVLLLGSEVELDEAKEP  774

Query  181  G  183
            G
Sbjct  775  G  775



>ref|XP_010054462.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1 [Eucalyptus grandis]
Length=476

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +1

Query  13   EIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNN-IELARPKPPGFI  189
            +++D S+GDS    E LRCI +GLLCVQ + DDRP MS V+ ML+NN + LA PK P ++
Sbjct  387  DVIDESMGDSWSKEEALRCIQIGLLCVQEFADDRPNMSAVVLMLANNDVALAFPKRPAYV  446

Query  190  F  192
            F
Sbjct  447  F  447



>ref|XP_006582722.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1-like [Glycine max]
Length=453

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ER++E++D  LG+  +  EV+RCI VGLLCVQ  P+DRP MS V+ +L+ +  L++PK P
Sbjct  359  ERALELLDEVLGEQCEPAEVIRCIQVGLLCVQQRPEDRPDMSSVVLLLNGDKLLSKPKVP  418

Query  181  GF  186
            GF
Sbjct  419  GF  420



>ref|XP_011008152.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1 isoform X1 [Populus euphratica]
Length=846

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            E+++EIVD SL +  D RE L+CI +GLLCVQ  P DRP M  V+FMLS+  E+  PK P
Sbjct  752  EKALEIVDPSLTELYDPREALKCIQIGLLCVQEDPTDRPSMLAVVFMLSSETEIPSPKQP  811

Query  181  GFIFNQ  198
             F+F +
Sbjct  812  AFLFRK  817



>ref|XP_007212456.1| hypothetical protein PRUPE_ppa017389mg [Prunus persica]
 gb|EMJ13655.1| hypothetical protein PRUPE_ppa017389mg [Prunus persica]
Length=700

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R +E+V   L DS    EV+RC+H+GLLCVQ    DRPIM +V+FMLS+  +L +PK P 
Sbjct  610  RGLELVVKVLADSSSSSEVMRCVHIGLLCVQDNAADRPIMPDVVFMLSSETDLPQPKRPI  669

Query  184  FIF  192
            F F
Sbjct  670  FTF  672



>ref|XP_010247751.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1 isoform X1 [Nelumbo nucifera]
Length=849

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +1

Query  4    RSMEIVDSSLGDSD--DGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKP  177
            + ++IVDS +G+ D   G EVLRCIHVGLLCVQ  P DRP MS V+FMLSN   +  P  
Sbjct  754  KGLDIVDSCMGEGDCYPGDEVLRCIHVGLLCVQESPSDRPTMSNVVFMLSNQTIMPPPNQ  813

Query  178  PGFI  189
            P FI
Sbjct  814  PAFI  817



>ref|XP_007021194.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY12719.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=695

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            +R ME++D +L D     EV RCIHVGLLCVQ  P+DRP MS VI ML +   L +PK P
Sbjct  602  KRPMELIDDALKDFCLPSEVQRCIHVGLLCVQQRPEDRPNMSSVILMLGSESALPQPKQP  661

Query  181  GF  186
            GF
Sbjct  662  GF  663



>emb|CBI20427.3| unnamed protein product [Vitis vinifera]
Length=2646

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  4     RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
             RSME++DSS+GD  D  +VL  I+VGLLCVQ  PDDRP MS V+ MLS++  L +PK PG
Sbjct  2557  RSMELIDSSVGDMHDLSQVLCSINVGLLCVQCSPDDRPSMSSVVLMLSSDSSLPQPKEPG  2616

Query  184   FI  189
             F 
Sbjct  2617  FF  2618


 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  4     RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
             RSME++DSS+GD  +  +VLR I+VGLLCVQ  PD+RP MS V+ MLS++  L +PK PG
Sbjct  1783  RSMELIDSSVGDIHNLSQVLRLINVGLLCVQCGPDERPSMSSVVLMLSSDSTLPQPKEPG  1842

Query  184   FI  189
             F 
Sbjct  1843  FF  1844



>ref|XP_009136842.1| PREDICTED: cysteine-rich receptor-like protein kinase 24 [Brassica 
rapa]
Length=660

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPGF  186
            +E+VD  +GD+ D  EV+RC+H+GLLCVQ  P DRP M  +  ML+N +I L  P+PPGF
Sbjct  561  LELVDPVIGDNYDKYEVIRCVHIGLLCVQENPTDRPSMFTIFQMLTNTSITLPAPQPPGF  620

Query  187  IF  192
             F
Sbjct  621  FF  622



>emb|CAN73738.1| hypothetical protein VITISV_036172 [Vitis vinifera]
Length=677

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R +E++D+SLG++ +  EVLR ++VGLLCVQ  PDDRP MS V+ ML +   L +PK PG
Sbjct  585  RPLELIDASLGEAYNQSEVLRALNVGLLCVQSNPDDRPNMSSVVLMLGSEGALPQPKEPG  644

Query  184  FIFNQ  198
            F F Q
Sbjct  645  F-FTQ  648



>ref|XP_006592562.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X2 [Glycine max]
Length=765

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            + M+ +D+SL DS +  E LRCIH+GLLCVQ +P+DRP M+ V+  LSN   L  PK P 
Sbjct  675  KPMQFIDTSLKDSYNLHEALRCIHIGLLCVQHHPNDRPNMASVVVSLSNENALPLPKNPS  734

Query  184  FIFN  195
            ++ N
Sbjct  735  YLLN  738



>ref|XP_010317453.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g61370 isoform X2 [Solanum lycopersicum]
Length=848

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPGFI  189
            ++++D S+ DSD    VLRCIH+GLLCVQ +  DRP M  ++ MLS+ ++L +PK P FI
Sbjct  759  LDLMDKSILDSDSSATVLRCIHIGLLCVQDHATDRPSMPSIVLMLSSEMDLPQPKQPTFI  818

Query  190  FNQ  198
            F +
Sbjct  819  FQR  821



>ref|XP_004234263.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g61370 isoform X1 [Solanum lycopersicum]
Length=852

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPGFI  189
            ++++D S+ DSD    VLRCIH+GLLCVQ +  DRP M  ++ MLS+ ++L +PK P FI
Sbjct  763  LDLMDKSILDSDSSATVLRCIHIGLLCVQDHATDRPSMPSIVLMLSSEMDLPQPKQPTFI  822

Query  190  FNQ  198
            F +
Sbjct  823  FQR  825



>gb|KHN05773.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Glycine soja]
Length=816

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            + M+ +D+SL DS +  E LRCIH+GLLCVQ +P+DRP M+ V+  LSN   L  PK P 
Sbjct  726  KPMQFIDTSLKDSYNLHEALRCIHIGLLCVQHHPNDRPNMASVVVSLSNENALPLPKNPS  785

Query  184  FIFN  195
            ++ N
Sbjct  786  YLLN  789



>ref|XP_006592561.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X1 [Glycine max]
Length=821

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            + M+ +D+SL DS +  E LRCIH+GLLCVQ +P+DRP M+ V+  LSN   L  PK P 
Sbjct  731  KPMQFIDTSLKDSYNLHEALRCIHIGLLCVQHHPNDRPNMASVVVSLSNENALPLPKNPS  790

Query  184  FIFN  195
            ++ N
Sbjct  791  YLLN  794



>ref|XP_003593411.1| S-receptor kinase-like protein [Medicago truncatula]
 gb|AES63662.1| S-locus lectin kinase family protein [Medicago truncatula]
Length=817

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPP  180
            R++E +D++L  +    E+LRC+ +GLLCVQ +P+DRP MS V+FML N +I LA+PK P
Sbjct  726  RALEFMDANLDLTSIPSELLRCLQIGLLCVQKFPEDRPDMSSVVFMLGNESIALAQPKKP  785

Query  181  GF  186
            GF
Sbjct  786  GF  787



>ref|XP_003526146.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X1 [Glycine max]
 gb|KHN08370.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Glycine soja]
Length=829

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  13   EIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPGFIF  192
            E++D+ L DS    E LRCIH+GLLC+Q  P+DRP M+ V+ MLS++ EL +PK PGF+ 
Sbjct  740  ELIDNCLQDSCIISEALRCIHIGLLCLQRQPNDRPNMASVVVMLSSDNELTQPKEPGFLI  799

Query  193  NQ  198
            ++
Sbjct  800  DR  801



>ref|XP_006582215.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X2 [Glycine max]
Length=828

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  13   EIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPGFIF  192
            E++D+ L DS    E LRCIH+GLLC+Q  P+DRP M+ V+ MLS++ EL +PK PGF+ 
Sbjct  739  ELIDNCLQDSCIISEALRCIHIGLLCLQRQPNDRPNMASVVVMLSSDNELTQPKEPGFLI  798

Query  193  NQ  198
            ++
Sbjct  799  DR  800



>gb|ABK95123.1| unknown [Populus trichocarpa]
Length=452

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++++EIVD SL +  D R+ L+CI +GLLCVQ    DRP M  V+FMLSN  E+  PK P
Sbjct  358  DKALEIVDPSLTELYDPRDALKCIQIGLLCVQEDATDRPSMLAVVFMLSNETEIPSPKQP  417

Query  181  GFIFNQ  198
             F+F +
Sbjct  418  AFLFRK  423



>gb|KDO74340.1| hypothetical protein CISIN_1g003254mg [Citrus sinensis]
Length=836

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ER +E++D SL +S    E LRCI VGLLCVQ  P+DRP MS V+ MLS    L +P+ P
Sbjct  743  ERPLELIDQSLDNSCSFSEALRCIQVGLLCVQQRPEDRPNMSSVVLMLSGERSLPQPQQP  802

Query  181  GF  186
            GF
Sbjct  803  GF  804



>gb|EYU32848.1| hypothetical protein MIMGU_mgv1a022873mg [Erythranthe guttata]
Length=811

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            +S+E+VD ++ +S    E+LR  HVGLLCVQ  P+DRP MS V+FML N  ELA+PK PG
Sbjct  719  KSLELVDDNIVESSYVFEMLRIFHVGLLCVQYNPEDRPNMSSVVFMLENETELAQPKQPG  778

Query  184  FIFNQ  198
            F  ++
Sbjct  779  FFVHR  783



>gb|KHN11180.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Glycine soja]
Length=795

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ER++E++D  LG+  +  EV+RCI VGLLCVQ  P+DRP MS V+ +L+ +  L++PK P
Sbjct  701  ERALELLDEVLGEQCEPAEVIRCIQVGLLCVQQRPEDRPDMSSVVLLLNGDKLLSKPKVP  760

Query  181  GF  186
            GF
Sbjct  761  GF  762



>ref|XP_009397155.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
 ref|XP_009397156.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
 ref|XP_009397157.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Musa acuminata subsp. malaccensis]
Length=820

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            +  E+VD S+G S    EVLRCI VGLLCVQ  P+DRP MS V+ ML+++ EL +P+ PG
Sbjct  727  KGSELVDGSIGHSCSLAEVLRCITVGLLCVQERPEDRPTMSSVVIMLNSDGELPQPQQPG  786

Query  184  FI  189
            F+
Sbjct  787  FV  788



>ref|XP_004295400.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1-like [Fragaria vesca subsp. vesca]
Length=853

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            + ++EIVDS+LGDS    EVLRCI + LLCVQ +P +RP MS V+ MLSN+  L  P  P
Sbjct  768  DHALEIVDSTLGDSFQFDEVLRCIQIALLCVQDFPTERPTMSAVLGMLSNDAALPPPGKP  827

Query  181  GFIFNQ  198
             F+  +
Sbjct  828  AFLVKK  833



>ref|XP_006452072.1| hypothetical protein CICLE_v10007451mg [Citrus clementina]
 gb|ESR65312.1| hypothetical protein CICLE_v10007451mg [Citrus clementina]
Length=836

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ER +E++D SL +S    E LRCI VGLLCVQ  P+DRP MS V+ MLS    L +P+ P
Sbjct  743  ERPLELIDQSLDNSCSFSEALRCIQVGLLCVQQRPEDRPNMSSVVLMLSGERSLPQPQQP  802

Query  181  GF  186
            GF
Sbjct  803  GF  804



>ref|XP_010448734.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
16 isoform X1 [Camelina sativa]
Length=668

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPGF  186
            +E+VD ++G++ D  EV+RCIH+GLLCVQ  P DRP MS +  ML+N +I L  P+PPGF
Sbjct  569  LELVDPAMGENYDKYEVIRCIHIGLLCVQENPADRPAMSTIFQMLTNISITLPVPQPPGF  628

Query  187  IF  192
            +F
Sbjct  629  VF  630



>ref|XP_009800154.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nicotiana sylvestris]
Length=827

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R +E+VDS++ DS    EVLR IHVGLLCVQ  P+DRP MS VI MLSN   L  PK PG
Sbjct  735  RQLELVDSNMVDSCYVSEVLRSIHVGLLCVQQNPEDRPNMSTVIMMLSNESILPPPKHPG  794

Query  184  F  186
            F
Sbjct  795  F  795



>emb|CDY41241.1| BnaA01g12980D [Brassica napus]
Length=620

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPGF  186
            +E+VD  +GD+ D  EV+RC+H+GLLCVQ  P DRP M  +  ML+N +I L  P+PPGF
Sbjct  521  LELVDPVIGDNYDKYEVIRCVHIGLLCVQENPTDRPSMFTIFQMLTNTSITLPAPQPPGF  580

Query  187  IF  192
             F
Sbjct  581  FF  582



>gb|KDP38976.1| hypothetical protein JCGZ_00733 [Jatropha curcas]
Length=659

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPGFI  189
            +E++D ++ DSD+  E++RCI++ LLCVQ  P+DRP MS V+ MLS+N  LA PK PG+ 
Sbjct  569  LELIDENIRDSDNESEMVRCINLALLCVQRRPEDRPSMSSVVVMLSSNNPLAEPKQPGYF  628

Query  190  FNQ  198
              +
Sbjct  629  MER  631



>ref|XP_006285512.1| hypothetical protein CARUB_v10006953mg [Capsella rubella]
 gb|EOA18410.1| hypothetical protein CARUB_v10006953mg [Capsella rubella]
Length=347

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFML-SNNIELARPKPPGF  186
            +E+VD S GD+    E+ RCIH+ LLCVQ   DDRP MS ++ ML +N+I LA  +PPGF
Sbjct  253  LELVDPSFGDNYQTNEITRCIHIALLCVQEDADDRPTMSAIVQMLTTNSIALAVARPPGF  312

Query  187  IF  192
             F
Sbjct  313  FF  314



>emb|CAN70179.1| hypothetical protein VITISV_000004 [Vitis vinifera]
Length=776

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            RSME++DSS+GD  +  +VLR I+VGLLCVQ  PD+RP MS V+ MLS++  L +PK PG
Sbjct  687  RSMELIDSSVGDIHNLSQVLRLINVGLLCVQCGPDERPSMSSVVLMLSSDSTLPQPKEPG  746

Query  184  FI  189
            F 
Sbjct  747  FF  748



>ref|XP_009355686.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Pyrus x bretschneideri]
Length=825

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R  E++D+ LG S    EVLRCIHV LLCVQ +P+DRP M+ V+ ML   I LA PK PG
Sbjct  740  RHSELMDTCLGSSCVLSEVLRCIHVSLLCVQHHPEDRPGMASVVIMLGTEIALAPPKHPG  799

Query  184  FIFNQ  198
            F   +
Sbjct  800  FFMER  804



>ref|XP_003526125.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X1 [Glycine max]
Length=814

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            +RS++++D  LG+     EV+RCI VGLLCVQ  P+DRP MS V+ ML+ + EL +PK P
Sbjct  720  QRSLDLLDEVLGEPCTPFEVIRCIQVGLLCVQQRPEDRPDMSSVVLMLNCDKELPKPKVP  779

Query  181  GF  186
            GF
Sbjct  780  GF  781



>ref|XP_006582198.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X2 [Glycine max]
Length=777

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            +RS++++D  LG+     EV+RCI VGLLCVQ  P+DRP MS V+ ML+ + EL +PK P
Sbjct  683  QRSLDLLDEVLGEPCTPFEVIRCIQVGLLCVQQRPEDRPDMSSVVLMLNCDKELPKPKVP  742

Query  181  GF  186
            GF
Sbjct  743  GF  744



>ref|XP_007021209.1| S-locus-specific glycoprotein S6, putative isoform 2, partial 
[Theobroma cacao]
 gb|EOY12734.1| S-locus-specific glycoprotein S6, putative isoform 2, partial 
[Theobroma cacao]
Length=140

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ER++E +D++LGDS    EVLRCI+V LLCVQ +PDDR  MS V+ ML+ +  L +P  P
Sbjct  48   ERTVETIDTALGDSYIIAEVLRCINVALLCVQQHPDDRTNMSSVLSMLAGDSTLPQPNQP  107

Query  181  GFIFNQ  198
            G+   +
Sbjct  108  GYFIER  113



>ref|XP_011012090.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=824

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            ++++++DS   +S +  EV+RCIHV LLCVQ +PDDRP M+ V++ML     L +PK PG
Sbjct  732  KALDLIDSLRDESHNPSEVMRCIHVSLLCVQQHPDDRPCMASVVWMLGGERALPKPKEPG  791

Query  184  FI  189
            F+
Sbjct  792  FL  793



>gb|KHN38597.1| Receptor-like serine/threonine-protein kinase SD1-8 [Glycine 
soja]
Length=804

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFML-SNNIELARPKP  177
            + +++IVD ++ DS    EVLRCIH+GLLCVQ YP+DRP M+ V+ +L S+ ++L  PK 
Sbjct  714  DMALQIVDPNMEDSCIASEVLRCIHIGLLCVQQYPEDRPTMTSVVLLLGSDEVQLDEPKE  773

Query  178  PG  183
            PG
Sbjct  774  PG  775



>ref|XP_010060393.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 [Eucalyptus grandis]
Length=145

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIE-LARPKPP  180
            RS+E++  SL DS    +V RCIHVGLLCVQ  P DRP MS V+FML+N    L +PK P
Sbjct  57   RSLELLHESLCDSFIASQVERCIHVGLLCVQKLPGDRPTMSSVVFMLANEEAILPQPKQP  116

Query  181  GFIFNQ  198
            GF   +
Sbjct  117  GFFMER  122



>ref|XP_002316587.2| hypothetical protein POPTR_0011s021802g, partial [Populus trichocarpa]
 gb|EEE97199.2| hypothetical protein POPTR_0011s021802g, partial [Populus trichocarpa]
Length=389

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            E+++EIVD SL +  D RE L+C+ +GLLCVQ    DRP M  V+FMLS+  E+  PK P
Sbjct  295  EKALEIVDPSLTELYDPREALKCMQIGLLCVQEDATDRPSMLAVVFMLSSETEIPSPKQP  354

Query  181  GFIFNQ  198
             F+F +
Sbjct  355  AFLFRK  360



>ref|XP_008363596.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X1 [Malus domestica]
 ref|XP_008363597.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X1 [Malus domestica]
 ref|XP_008363598.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X1 [Malus domestica]
Length=598

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            RS+E++D  L DS    EVLRCIHV LLCVQ  P+DRP MS V+ ML     L +PK PG
Sbjct  496  RSLELIDEYLTDSCSLSEVLRCIHVSLLCVQHLPEDRPTMSSVVLMLGGESALPQPKKPG  555

Query  184  FIFNQ  198
            F   +
Sbjct  556  FFIGK  560



>ref|XP_006592524.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8-like 
[Glycine max]
Length=804

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFML-SNNIELARPKP  177
            + +++IVD ++ DS    EVLRCIH+GLLCVQ YP+DRP M+ V+ +L S+ ++L  PK 
Sbjct  714  DMALQIVDPNMEDSCIASEVLRCIHIGLLCVQQYPEDRPTMTSVVLLLGSDEVQLDEPKE  773

Query  178  PG  183
            PG
Sbjct  774  PG  775



>ref|XP_010647533.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Vitis vinifera]
Length=824

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            RS+E++D S+GD+ +  EVLR I++GLLCVQ +P+DRP M  V+ ML++   L RP+ P 
Sbjct  732  RSLELIDPSMGDTSNLSEVLRTINMGLLCVQRFPNDRPSMHSVVLMLASECALPRPREPC  791

Query  184  F  186
            F
Sbjct  792  F  792



>ref|XP_006449168.1| hypothetical protein CICLE_v10018293mg, partial [Citrus clementina]
 gb|ESR62408.1| hypothetical protein CICLE_v10018293mg, partial [Citrus clementina]
Length=370

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            ++++EIVDSS+ DS    E LRCI VGLLCVQ    DRP MS V+FMLSN   +  PK P
Sbjct  278  DKALEIVDSSMADSCPAPEALRCIQVGLLCVQDRTTDRPSMSTVVFMLSNETFVPSPKQP  337

Query  181  GF  186
             F
Sbjct  338  TF  339



>ref|XP_008225015.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Prunus mume]
Length=1616

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +1

Query  4     RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPP  180
             + +EIVDSSLG+S    EVLRCI VGLLCVQ +  DRP MS V+FMLS+ +  + +PK P
Sbjct  1521  KGLEIVDSSLGNSYCPSEVLRCIQVGLLCVQEHVVDRPTMSSVVFMLSSPDATMPQPKTP  1580

Query  181   GF  186
             GF
Sbjct  1581  GF  1582



>emb|CDY10924.1| BnaA03g45830D [Brassica napus]
Length=539

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKP  177
            E  +E+VD ++G++ D  EV RCIH+GLLCVQ  P DRP MS +  ML+N +I L  P+P
Sbjct  439  ESLLELVDPAVGENYDKHEVTRCIHIGLLCVQENPADRPTMSTIFQMLTNTSITLHVPQP  498

Query  178  PGFIF  192
            PGF F
Sbjct  499  PGFFF  503



>ref|XP_010247750.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Nelumbo nucifera]
Length=799

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +1

Query  4    RSMEIVDSSLGDS--DDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKP  177
            R+ME++D S+ DS   D  EVLRCIHVGLLCVQ   +DRP M+ V+ MLS+   LA+P+ 
Sbjct  705  RAMELIDPSMRDSCCGDEVEVLRCIHVGLLCVQQNTEDRPTMASVVLMLSSECALAKPQQ  764

Query  178  PGFI  189
            PGF 
Sbjct  765  PGFF  768



>gb|KCW76511.1| hypothetical protein EUGRSUZ_D00901 [Eucalyptus grandis]
Length=397

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = +1

Query  13   EIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPGFI  189
            +++D S+GDS    E LRCI +GLLCVQ + DDRP M+ V+FML+N ++ LA PK P ++
Sbjct  308  DVIDESMGDSCTKEEALRCIQIGLLCVQEFADDRPDMTAVVFMLANKDVVLASPKRPAYV  367

Query  190  FNQ  198
            F  
Sbjct  368  FKS  370



>ref|XP_010052484.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Eucalyptus grandis]
 gb|KCW76535.1| hypothetical protein EUGRSUZ_D00923 [Eucalyptus grandis]
Length=854

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPP  180
            + +E++D+++GD+    EVLRCI VGLLCVQ + DDRP+MS V+ MLS+ N  +  PK P
Sbjct  761  KGLELLDTAVGDAYSMNEVLRCIQVGLLCVQEHVDDRPVMSSVVLMLSSENPTMPHPKNP  820

Query  181  GF  186
            GF
Sbjct  821  GF  822



>ref|XP_009137329.1| PREDICTED: cysteine-rich receptor-like protein kinase 24 isoform 
X2 [Brassica rapa]
Length=682

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKP  177
            E  +E+VD ++G++ D  EV+RCIH+GLLCVQ  P DRP MS +  ML+N +I L  P+ 
Sbjct  580  ESFLELVDPAIGENYDKNEVIRCIHIGLLCVQESPADRPSMSTIFRMLTNTSITLPVPQQ  639

Query  178  PGFIF  192
            PGF F
Sbjct  640  PGFFF  644



>ref|XP_010530411.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
35 [Tarenaya hassleriana]
Length=660

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +1

Query  10   MEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFML-SNNIELARPKPPGF  186
            +E+VD ++G+S +  EV RCIH+ LLCVQ  P DRP MS +I ML SN I L  P+ PGF
Sbjct  561  LELVDPTIGESYESNEVTRCIHIALLCVQEDPADRPAMSTIILMLTSNTITLPVPRQPGF  620

Query  187  IF  192
            +F
Sbjct  621  LF  622



>ref|XP_007149662.1| hypothetical protein PHAVU_005G088700g [Phaseolus vulgaris]
 gb|ESW21656.1| hypothetical protein PHAVU_005G088700g [Phaseolus vulgaris]
Length=819

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPPG  183
            R ++++DS + +S    E LRCIH+ LLCVQ +P+DRP MS V+ MLS+   L +PK PG
Sbjct  726  RPLDLIDSCMENSSVLSEALRCIHISLLCVQQHPEDRPSMSTVVVMLSSESALPQPKEPG  785

Query  184  FIFNQ  198
            F+  +
Sbjct  786  FLMEK  790



>ref|XP_003541757.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8-like 
[Glycine max]
Length=850

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +1

Query  7    SMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSN-NIELARPKPPG  183
            ++E++DSS GDS    EVLRCIHVGLLCVQ   +DRP MS V+ MLS+ ++ + +P+ PG
Sbjct  757  ALELIDSSTGDSYSPSEVLRCIHVGLLCVQERAEDRPTMSSVLLMLSSESVLMPQPRNPG  816

Query  184  F  186
            F
Sbjct  817  F  817



>gb|KHN35775.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Glycine soja]
Length=774

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    ERSMEIVDSSLGDSDDGREVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            + +++++DSS+ D     E LRCIHV LLC+Q YP+DRP M+ VI ML + +EL  PK P
Sbjct  681  KNALQLIDSSIKDLCAIPEALRCIHVSLLCLQQYPEDRPTMTSVIQMLGSEMELVEPKEP  740

Query  181  GF  186
            GF
Sbjct  741  GF  742



>ref|XP_010247747.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Nelumbo nucifera]
Length=854

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +1

Query  4    RSMEIVDSSLGDSDDGR-EVLRCIHVGLLCVQLYPDDRPIMSEVIFMLSNNIELARPKPP  180
            R+ME++D S+G+      EV+RCIHVGLLCVQ   +DRP MS V+ MLS+   L +P+ P
Sbjct  760  RAMELIDPSMGELGSATDEVVRCIHVGLLCVQQNTEDRPTMSSVVLMLSSGCSLPKPQQP  819

Query  181  GF  186
            GF
Sbjct  820  GF  821



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519166692352