BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15893_g1_i1 len=650 path=[1:0-568 570:569-597 2284:598-649]

Length=650
                                                                      Score     E

gb|ABP35520.1|  tonoplast intrinsic protein                             278   2e-90   Ipomoea batatas [batate]
gb|KHG11211.1|  Aquaporin TIP1-3 -like protein                          258   9e-83   
ref|NP_001274695.1|  aquaporin TIP1-3-like                              258   9e-83   
ref|XP_006350747.1|  PREDICTED: aquaporin TIP1-3-like                   258   1e-82   
ref|XP_009624595.1|  PREDICTED: aquaporin TIP1-3                        257   2e-82   
ref|XP_009780564.1|  PREDICTED: aquaporin TIP1-3                        257   3e-82   
gb|KHG14163.1|  Aquaporin TIP1-3 -like protein                          254   3e-81   
ref|XP_006436063.1|  hypothetical protein CICLE_v10032534mg             254   3e-81   
ref|XP_002531978.1|  tonoplast intrinsic protein, putative              253   8e-81   Ricinus communis
gb|AIK66517.1|  putative aquaporin                                      253   1e-80   
emb|CBI31728.3|  unnamed protein product                                253   1e-80   
ref|XP_007016527.1|  Tonoplast intrinsic protein 1,3                    253   2e-80   
ref|XP_011022886.1|  PREDICTED: aquaporin TIP1-3                        252   2e-80   
ref|XP_002316308.1|  Gamma-tonoplast intrinsic protein 3                252   2e-80   Populus trichocarpa [western balsam poplar]
ref|XP_002531118.1|  tonoplast intrinsic protein, putative              252   3e-80   Ricinus communis
gb|AAF78757.1|AF271660_1  putative aquaporin TIP3                       252   3e-80   Vitis cinerea var. helleri x Vitis rupestris
ref|XP_011027129.1|  PREDICTED: aquaporin TIP1-3-like                   251   4e-80   
dbj|BAD90703.1|  tonoplast intrinsic protein 1;2                        251   5e-80   Mimosa pudica [sensitive-plant]
ref|XP_007009482.1|  Tonoplast intrinsic protein 1,3                    251   6e-80   
ref|NP_001267923.1|  aquaporin-like                                     251   6e-80   
emb|CDP08994.1|  unnamed protein product                                251   1e-79   
ref|XP_011000304.1|  PREDICTED: probable aquaporin TIP1-2               250   2e-79   
ref|XP_002284411.1|  PREDICTED: aquaporin TIP1-1                        250   2e-79   Vitis vinifera
ref|XP_002311146.1|  Gamma-tonoplast intrinsic protein 3                250   2e-79   Populus trichocarpa [western balsam poplar]
gb|KDP29873.1|  hypothetical protein JCGZ_18448                         249   2e-79   
emb|CAN74049.1|  hypothetical protein VITISV_007330                     249   3e-79   Vitis vinifera
gb|AGD98709.1|  aquaporin protein 6                                     249   3e-79   
ref|XP_004307558.1|  PREDICTED: aquaporin TIP1-3-like                   249   4e-79   
gb|ABB76813.1|  tonoplast intrinsic protein                             249   4e-79   Olea europaea
ref|XP_010096653.1|  Aquaporin TIP1-3                                   248   7e-79   
ref|NP_001238026.1|  nodulin-26                                         248   1e-78   
gb|KHN30200.1|  Aquaporin TIP1-3                                        248   1e-78   
gb|KHG06645.1|  putative aquaporin TIP1-2                               247   2e-78   
ref|XP_010253312.1|  PREDICTED: aquaporin TIP1-3-like                   247   2e-78   
ref|XP_006424746.1|  hypothetical protein CICLE_v10029134mg             247   3e-78   
ref|XP_006488253.1|  PREDICTED: aquaporin TIP1-3-like                   246   5e-78   
ref|XP_008343557.1|  PREDICTED: aquaporin TIP1-3                        246   6e-78   
ref|XP_010920700.1|  PREDICTED: probable aquaporin TIP1-2               246   6e-78   
ref|XP_010031004.1|  PREDICTED: aquaporin TIP1-3-like                   246   6e-78   
ref|XP_011089824.1|  PREDICTED: aquaporin TIP1-3-like                   246   7e-78   
gb|ABR68795.1|  aquaporin gamma-TIP                                     246   7e-78   Gossypium hirsutum [American cotton]
gb|ADE34283.1|  aquaporin TIP1;7                                        246   9e-78   
ref|XP_008794805.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    245   1e-77   
gb|AGG39699.1|  aquaporin protein AQU21                                 245   1e-77   
ref|XP_010043596.1|  PREDICTED: aquaporin TIP1-3-like                   245   1e-77   
dbj|BAD90702.1|  tonoplast intrinsic protein 1;1                        245   2e-77   Mimosa pudica [sensitive-plant]
ref|XP_002299893.1|  nodulin-26 family protein                          245   2e-77   Populus trichocarpa [western balsam poplar]
ref|XP_011089424.1|  PREDICTED: aquaporin TIP1-3-like                   244   3e-77   
gb|EYU18933.1|  hypothetical protein MIMGU_mgv1a012390mg                244   4e-77   
ref|XP_009337569.1|  PREDICTED: aquaporin TIP1-3                        244   5e-77   
gb|KHN21988.1|  Aquaporin TIP1-3                                        243   6e-77   
ref|NP_001242707.1|  uncharacterized protein LOC100777419               243   7e-77   
ref|XP_010554597.1|  PREDICTED: aquaporin TIP1-3                        243   8e-77   
gb|AGD98711.1|  aquaporin protein 8                                     243   9e-77   
gb|KHG16987.1|  Aquaporin TIP1-3 -like protein                          243   9e-77   
ref|XP_002314201.1|  nodulin-26 family protein                          243   1e-76   Populus trichocarpa [western balsam poplar]
ref|XP_008233574.1|  PREDICTED: aquaporin TIP1-3                        243   1e-76   
ref|XP_011041956.1|  PREDICTED: probable aquaporin TIP1-2               243   1e-76   
gb|KDP44188.1|  hypothetical protein JCGZ_05655                         242   2e-76   
ref|XP_010243206.1|  PREDICTED: aquaporin TIP1-1-like                   242   2e-76   
ref|XP_010033163.1|  PREDICTED: aquaporin TIP1-3-like                   242   2e-76   
gb|AGD98716.1|  aquaporin protein 13                                    242   3e-76   
tpg|DAA33867.1|  TPA: aquaporin TIP1;4                                  241   3e-76   
gb|KEH21895.1|  tonoplast intrinsic protein                             241   3e-76   
ref|XP_007218847.1|  hypothetical protein PRUPE_ppa010364mg             241   8e-76   
ref|XP_004492091.1|  PREDICTED: aquaporin TIP1-3-like                   240   1e-75   
ref|XP_003518658.1|  PREDICTED: aquaporin TIP1-3-like                   240   1e-75   
ref|XP_009141610.1|  PREDICTED: aquaporin TIP1-1                        240   2e-75   
gb|AAN05780.1|  tonoplast intrinsic protein bobTIP26-2                  239   2e-75   Brassica oleracea var. botrytis [cauliflower]
ref|XP_002519456.1|  tonoplast intrinsic protein, putative              239   2e-75   Ricinus communis
gb|ACB71282.1|  tonoplast intrinsic protein                             239   3e-75   Tamarix hispida
dbj|BAM44345.1|  vacuolar aluminum transporter                          239   3e-75   
ref|XP_002872891.1|  GAMMA-TIP3/TIP1_3                                  239   4e-75   
ref|XP_006286822.1|  hypothetical protein CARUB_v10003767mg             238   6e-75   
gb|KHN32099.1|  Aquaporin TIP1-1                                        238   8e-75   
ref|XP_010428353.1|  PREDICTED: aquaporin TIP1-3                        238   8e-75   
gb|AAB51393.2|  tonoplast intrinsic protein bobTIP26-1                  238   9e-75   Brassica oleracea var. botrytis [cauliflower]
ref|XP_010422715.1|  PREDICTED: aquaporin TIP1-3-like                   238   9e-75   
ref|XP_010098813.1|  Aquaporin TIP1-1                                   238   9e-75   
gb|ACI95283.1|  tonoplast intrinsic protein                             238   9e-75   Sinapis arvensis [charlock mustard]
gb|KFK30698.1|  hypothetical protein AALP_AA6G016000                    238   1e-74   
ref|XP_003552678.1|  PREDICTED: aquaporin TIP1-3-like                   237   1e-74   
emb|CDY53270.1|  BnaCnng24720D                                          237   1e-74   
tpg|DAA33869.1|  TPA: aquaporin TIP1;6                                  238   2e-74   
gb|ADO17795.1|  tonoplast intrinsic protein                             237   2e-74   
gb|ACP28878.1|  tonoplast intrinsic protein                             237   2e-74   Gossypium hirsutum [American cotton]
ref|XP_010267262.1|  PREDICTED: aquaporin TIP1-1                        237   2e-74   
gb|KHN13870.1|  Aquaporin TIP1-3                                        237   3e-74   
ref|XP_010922400.1|  PREDICTED: aquaporin TIP1-3-like                   237   3e-74   
gb|KDP29188.1|  hypothetical protein JCGZ_16577                         236   3e-74   
ref|XP_006396348.1|  hypothetical protein EUTSA_v10028907mg             236   4e-74   
ref|XP_007027468.1|  Aquaporin TIP1,6                                   236   4e-74   
ref|XP_006837956.1|  hypothetical protein AMTR_s00102p00061000          236   4e-74   
emb|CAE53881.1|  aquaporin                                              236   4e-74   Ricinus communis
ref|NP_192056.1|  aquaporin TIP1-3                                      236   5e-74   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93067.1|  aquaporin                                               236   5e-74   
tpg|DAA33868.1|  TPA: aquaporin TIP1;5                                  236   5e-74   
ref|XP_009358317.1|  PREDICTED: aquaporin TIP1-3-like                   236   5e-74   
gb|ABK28617.1|  unknown                                                 236   6e-74   Arabidopsis thaliana [mouse-ear cress]
gb|AAD31847.1|AF133531_1  water channel protein MipI                    236   6e-74   Mesembryanthemum crystallinum
ref|NP_181221.1|  aquaporin TIP1-1                                      235   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008788076.1|  PREDICTED: aquaporin TIP1-3-like                   235   1e-73   
gb|AAM65100.1|  putative aquaporin (tonoplast intrinsic protein g...    235   1e-73   Arabidopsis thaliana [mouse-ear cress]
gb|AAN40746.1|  tonoplast intrinsic protein                             235   1e-73   Kandelia candel
gb|KFK36559.1|  hypothetical protein AALP_AA4G139100                    235   1e-73   
ref|XP_006294859.1|  hypothetical protein CARUB_v10023912mg             235   1e-73   
ref|XP_010505228.1|  PREDICTED: aquaporin TIP1-1                        234   2e-73   
gb|ACX37451.1|  tonoplast intrinsic protein                             235   2e-73   Hevea brasiliensis [Para rubber tree]
ref|XP_007139266.1|  hypothetical protein PHAVU_008G014900g             235   2e-73   
ref|XP_011004488.1|  PREDICTED: aquaporin TIP1-1-like                   234   2e-73   
ref|XP_006410854.1|  hypothetical protein EUTSA_v10017134mg             234   2e-73   
tpg|DAA33870.1|  TPA: aquaporin TIP1;8                                  234   2e-73   
ref|XP_009404620.1|  PREDICTED: aquaporin TIP1-1-like                   234   2e-73   
ref|XP_008357781.1|  PREDICTED: aquaporin TIP1-3-like                   234   2e-73   
ref|XP_002879627.1|  tonoplast intrinsic protein gamma                  234   2e-73   
ref|XP_009338345.1|  PREDICTED: aquaporin TIP1-3-like                   234   3e-73   
ref|XP_002322910.1|  gamma-tonoplast intrinsic protein 2                233   4e-73   Populus trichocarpa [western balsam poplar]
ref|XP_007142715.1|  hypothetical protein PHAVU_007G010800g             233   5e-73   
ref|XP_009111380.1|  PREDICTED: aquaporin TIP1-3                        233   5e-73   
ref|XP_010112915.1|  Aquaporin TIP1-3                                   233   5e-73   
gb|AFH36344.1|  aquaporin TIP2;2                                        233   5e-73   
emb|CAA38633.1|  possible membrane channel protein                      233   5e-73   Arabidopsis thaliana [mouse-ear cress]
emb|CDX83623.1|  BnaC07g23630D                                          233   6e-73   
ref|XP_009421351.1|  PREDICTED: probable aquaporin TIP1-2               233   7e-73   
ref|XP_007205767.1|  hypothetical protein PRUPE_ppa010367mg             233   8e-73   
gb|ABK96489.1|  unknown                                                 233   9e-73   Populus trichocarpa x Populus deltoides
ref|XP_006381378.1|  gamma-tonoplast intrinsic protein 2                233   1e-72   
gb|ADU25490.1|  tonoplastic intrinsic protein                           233   1e-72   
ref|XP_010037134.1|  PREDICTED: aquaporin TIP1-1                        233   1e-72   
ref|XP_004497305.1|  PREDICTED: aquaporin TIP1-3-like                   232   2e-72   
ref|XP_011018806.1|  PREDICTED: aquaporin TIP1-1                        232   2e-72   
dbj|BAJ98454.1|  predicted protein                                      232   2e-72   
ref|XP_008366336.1|  PREDICTED: probable aquaporin TIP1-2               232   2e-72   
ref|XP_003536771.1|  PREDICTED: aquaporin TIP1-3-like                   232   2e-72   
emb|CAN69323.1|  hypothetical protein VITISV_032929                     232   2e-72   Vitis vinifera
dbj|BAI66439.1|  tonoplast intrinsic protein                            232   2e-72   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010556519.1|  PREDICTED: aquaporin TIP1-1                        231   3e-72   
gb|KEH44484.1|  tonoplast intrinsic protein                             231   4e-72   
ref|XP_009152050.1|  PREDICTED: aquaporin TIP1-2                        231   5e-72   
dbj|BAA12711.1|  VM23                                                   231   6e-72   Raphanus sativus
ref|XP_008222876.1|  PREDICTED: probable aquaporin TIP1-2               231   6e-72   
gb|AEW46425.1|  putative tonoplast intrinsic protein 1.1                229   7e-72   
ref|XP_010685836.1|  PREDICTED: aquaporin TIP1-3-like                   230   9e-72   
ref|XP_011077300.1|  PREDICTED: aquaporin TIP1-1                        230   1e-71   
gb|AEW46426.1|  putative tonoplast intrinsic protein 1.2                229   1e-71   
ref|NP_001267926.1|  aquaporin-like                                     230   1e-71   
gb|EAZ15017.1|  hypothetical protein OsJ_04959                          229   2e-71   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045562.1|  Os01g0975900                                       229   2e-71   Oryza sativa Japonica Group [Japonica rice]
gb|EMT32480.1|  Putative aquaporin TIP1-2                               229   2e-71   
gb|ABI96817.1|  tonoplast intrinsic protein                             229   2e-71   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010669827.1|  PREDICTED: aquaporin TIP1-3-like                   229   3e-71   
ref|XP_006428460.1|  hypothetical protein CICLE_v10012553mg             229   3e-71   
dbj|BAP33939.1|  tonoplast intrinsic protein                            228   4e-71   
gb|AJA04408.1|  tonoplast intrinsic protein                             228   5e-71   
ref|XP_004971442.1|  PREDICTED: probable aquaporin TIP1-2-like          228   5e-71   
ref|XP_003565186.1|  PREDICTED: probable aquaporin TIP1-2               228   5e-71   
gb|AHW81522.1|  ECFP-tagged gamma TIP                                   235   6e-71   
emb|CDP00041.1|  unnamed protein product                                228   7e-71   
gb|AAD39372.1|AF118381_1  tonoplast intrinsic protein                   228   8e-71   Brassica napus [oilseed rape]
gb|ACJ53708.1|  tonoplast intrinsic protein 1-1                         228   8e-71   Lolium perenne [perennial ryegrass]
ref|XP_006395549.1|  hypothetical protein EUTSA_v10004806mg             227   1e-70   
gb|AFQ98316.1|  MIP6                                                    227   2e-70   
ref|XP_009617954.1|  PREDICTED: aquaporin TIP1-1                        226   3e-70   
ref|XP_006339093.1|  PREDICTED: aquaporin TIP1-1-like                   226   4e-70   
gb|ADD59910.1|  aquaporin                                               226   5e-70   Chimonanthus praecox [wintersweet]
ref|XP_004249473.1|  PREDICTED: aquaporin TIP1-1                        225   6e-70   
ref|XP_009129499.1|  PREDICTED: aquaporin TIP1-2                        226   6e-70   
ref|XP_009382161.1|  PREDICTED: probable aquaporin TIP1-1               225   7e-70   
ref|XP_009411359.1|  PREDICTED: probable aquaporin TIP1-1               225   9e-70   
ref|XP_008463494.1|  PREDICTED: aquaporin TIP1-3-like isoform X2        223   1e-69   
ref|XP_009799741.1|  PREDICTED: aquaporin TIP1-1                        224   1e-69   
ref|XP_008463495.1|  PREDICTED: aquaporin TIP1-3-like isoform X3        223   1e-69   
gb|ACF78734.1|  unknown                                                 224   2e-69   Zea mays [maize]
gb|AFK34456.1|  unknown                                                 224   3e-69   
gb|ACG35910.1|  aquaporin TIP1.2                                        224   4e-69   Zea mays [maize]
ref|XP_009401846.1|  PREDICTED: probable aquaporin TIP1-1               223   4e-69   
ref|XP_010502579.1|  PREDICTED: aquaporin TIP1-2                        223   5e-69   
ref|NP_001105029.1|  aquaporin TIP1-2                                   223   5e-69   Zea mays [maize]
ref|XP_004505892.1|  PREDICTED: aquaporin TIP1-3-like                   223   6e-69   
ref|NP_001284655.1|  aquaporin TIP1-1                                   223   7e-69   
ref|XP_004143284.1|  PREDICTED: aquaporin TIP1-1-like                   223   7e-69   
ref|XP_006645407.1|  PREDICTED: probable aquaporin TIP1-2-like          223   7e-69   
ref|XP_008463493.1|  PREDICTED: aquaporin TIP1-3-like isoform X1        222   2e-68   
ref|XP_004304478.1|  PREDICTED: aquaporin TIP1-1-like                   222   2e-68   
ref|XP_010425366.1|  PREDICTED: aquaporin TIP1-2-like                   222   2e-68   
ref|XP_009613493.1|  PREDICTED: probable aquaporin TIP1-1               221   4e-68   
ref|XP_004168293.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    221   5e-68   
dbj|BAF95576.1|  tonoplast intrinsic protein                            220   6e-68   Nicotiana tabacum [American tobacco]
gb|EMS45815.1|  putative aquaporin TIP1-1                               218   9e-68   
gb|AFQ23566.1|  aquaporin TIP1                                          220   9e-68   
gb|KFK33580.1|  hypothetical protein AALP_AA5G032300                    219   1e-67   
ref|XP_008801219.1|  PREDICTED: probable aquaporin TIP1-1               219   2e-67   
ref|XP_003606614.1|  Aquaporin TIP1-1                                   219   2e-67   
ref|XP_010514297.1|  PREDICTED: aquaporin TIP1-2-like                   219   2e-67   
ref|NP_001048956.2|  Os03g0146100                                       217   3e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009397029.1|  PREDICTED: probable aquaporin TIP1-1               218   3e-67   
ref|XP_004149825.1|  PREDICTED: aquaporin TIP1-3-like                   218   4e-67   
ref|XP_009800738.1|  PREDICTED: probable aquaporin TIP1-1               218   4e-67   
gb|AEV54105.1|  putative tonoplast intrinsic protein 1.5                217   4e-67   
ref|NP_001234103.1|  aquaporin-like                                     218   5e-67   
ref|XP_006347203.1|  PREDICTED: aquaporin TIP1-1-like                   218   5e-67   
ref|XP_002465859.1|  hypothetical protein SORBIDRAFT_01g047140          218   5e-67   Sorghum bicolor [broomcorn]
gb|AAG44946.1|AF290619_1  putative gamma TIP                            218   6e-67   Nicotiana glauca [glaucous tobacco]
ref|XP_002876978.1|  hypothetical protein ARALYDRAFT_484417             218   7e-67   
gb|EMT13047.1|  Putative aquaporin TIP1-1                               216   8e-67   
ref|XP_006291577.1|  hypothetical protein CARUB_v10017730mg             219   9e-67   
gb|AAD10494.1|  gamma-type tonoplast intrinsic protein                  217   1e-66   Triticum aestivum [Canadian hard winter wheat]
gb|ABK23010.1|  unknown                                                 217   1e-66   Picea sitchensis
ref|NP_189283.1|  aquaporin TIP1-2                                      217   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010933183.1|  PREDICTED: probable aquaporin TIP1-1               216   2e-66   
ref|XP_010696310.1|  PREDICTED: probable aquaporin TIP1-2               216   3e-66   
ref|XP_002459183.1|  hypothetical protein SORBIDRAFT_03g047470          216   3e-66   Sorghum bicolor [broomcorn]
dbj|BAP33938.1|  aquaporin                                              216   3e-66   
ref|XP_003558815.1|  PREDICTED: aquaporin TIP1-1                        216   3e-66   
ref|XP_002274538.1|  PREDICTED: aquaporin TIP1-1                        216   4e-66   Vitis vinifera
gb|ACJ83265.1|  unknown                                                 214   5e-66   Medicago truncatula
sp|P50156.1|TIP11_ORYSJ  RecName: Full=Probable aquaporin TIP1-1;...    215   6e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008788358.1|  PREDICTED: probable aquaporin TIP1-1               220   8e-66   
ref|XP_011089965.1|  PREDICTED: aquaporin TIP1-1-like                   215   1e-65   
gb|AAC62397.1|  gamma tonoplast intrinsic protein 2                     214   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009592994.1|  PREDICTED: probable aquaporin TIP1-1               214   1e-65   
gb|AEV54104.1|  putative tonoplast intrinsic protein 1.6                213   2e-65   
ref|XP_006649396.1|  PREDICTED: probable aquaporin TIP1-1-like          214   2e-65   
emb|CAA56553.1|  gamma-TIP-like protein                                 214   2e-65   Hordeum vulgare [barley]
ref|XP_004294610.1|  PREDICTED: aquaporin TIP1-1-like                   213   3e-65   
ref|XP_010456993.1|  PREDICTED: aquaporin TIP1-3-like                   213   4e-65   
gb|KDP43963.1|  hypothetical protein JCGZ_05430                         213   6e-65   
ref|XP_010911210.1|  PREDICTED: probable aquaporin TIP1-1               213   7e-65   
gb|AGV54343.1|  tonoplast intrinsic protein                             211   1e-64   
ref|XP_004307108.1|  PREDICTED: aquaporin TIP1-1-like                   211   2e-64   
ref|NP_001104896.1|  aquaporin TIP1-1                                   211   2e-64   Zea mays [maize]
gb|AGV54720.1|  water-selective transport intrinsic membrane prot...    210   2e-64   
gb|AHI54565.1|  tonoplastic intrinsic protein                           211   3e-64   
ref|XP_007132109.1|  hypothetical protein PHAVU_011G067200g             211   3e-64   
ref|NP_001237062.1|  uncharacterized protein LOC100527509               211   4e-64   
dbj|BAB12722.1|  gamma tonoplast intrinsic protein                      210   6e-64   Pyrus communis
ref|XP_009349744.1|  PREDICTED: aquaporin TIP1-1-like                   210   6e-64   
gb|ABK25915.1|  unknown                                                 210   6e-64   Picea sitchensis
gb|AHJ09607.1|  aquaporin protein 26                                    210   7e-64   
ref|XP_004985722.1|  PREDICTED: aquaporin TIP1-1-like                   209   1e-63   
ref|XP_007162793.1|  hypothetical protein PHAVU_001G181100g             209   1e-63   
gb|AHA84270.1|  nodulin-26                                              209   1e-63   
gb|AAT65835.2|  tonoplast intrinsic protein gamma                       209   1e-63   Salicornia herbacea
ref|XP_003555811.1|  PREDICTED: aquaporin TIP1-3-like isoform X1        208   3e-63   
ref|NP_001241727.1|  aquaporin TIP1.1                                   208   3e-63   
ref|XP_011088796.1|  PREDICTED: aquaporin TIP1-1-like                   208   3e-63   
gb|ACU16456.1|  unknown                                                 208   4e-63   Glycine max [soybeans]
ref|XP_008350342.1|  PREDICTED: aquaporin TIP1-1-like                   207   5e-63   
ref|XP_008387528.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    207   6e-63   
emb|CAB61841.1|  putative gamma tonoplast intrinsic protein (TIP)       207   7e-63   Sporobolus stapfianus [resurrection grass]
ref|XP_002523724.1|  tonoplast intrinsic protein, putative              207   1e-62   Ricinus communis
gb|AAT08702.1|  mitochondrial tonoplast intrinsic protein               205   2e-62   Hyacinthus orientalis [common hyacinth]
ref|XP_007202475.1|  hypothetical protein PRUPE_ppa010365mg             206   2e-62   
gb|AAF82790.1|AF275315_1  water-selective transport intrinsic mem...    206   3e-62   Lotus japonicus
ref|XP_004494087.1|  PREDICTED: probable aquaporin TIP-type-like        206   4e-62   
gb|ADE34286.1|  aquaporin TIP1;11                                       203   5e-62   
emb|CAB45653.1|  putative tonoplast intrinsic protein                   205   7e-62   Pisum sativum [garden pea]
ref|XP_011010727.1|  PREDICTED: aquaporin TIP1-1-like                   205   8e-62   
gb|AAB17284.1|  tonoplast intrinsic protein                             204   9e-62   Mesembryanthemum crystallinum
ref|XP_006605823.1|  PREDICTED: aquaporin TIP1-3-like isoform X2        204   1e-61   
ref|XP_007150288.1|  hypothetical protein PHAVU_005G141100g             204   1e-61   
gb|AAB62692.1|  salt-stress induced tonoplast intrinsic protein         205   1e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AAL49753.1|AF452015_1  aquaporin-like protein                        204   2e-61   Petunia x hybrida [garden petunia]
ref|XP_008241379.1|  PREDICTED: aquaporin TIP1-1                        204   2e-61   
gb|ABB29477.1|  tonoplast intrinsic protein                             203   2e-61   Panax ginseng [Chinese ginseng]
gb|AEQ29861.1|  aquaporin TIP1                                          203   2e-61   
dbj|BAD04010.1|  tonoplast intrinsic protein                            203   3e-61   Prunus persica
ref|XP_010527951.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    202   5e-61   
emb|CDY67380.1|  BnaAnng24130D                                          201   5e-61   
gb|ADE76384.1|  unknown                                                 202   6e-61   
emb|CAC85291.1|  putative tonoplast intrinsic protein                   202   7e-61   Posidonia oceanica
gb|ADE34288.1|  aquaporin TIP1;13                                       200   7e-61   
emb|CAA64952.1|  tonoplast intrinsic protein                            202   1e-60   Tulipa gesneriana
sp|Q9FY14.1|TIP1_MEDTR  RecName: Full=Probable aquaporin TIP-type...    201   2e-60   Medicago truncatula
gb|ADE34285.1|  aquaporin TIP1;10                                       199   2e-60   
gb|AFK41698.1|  unknown                                                 201   3e-60   
emb|CAA82843.1|  gamma-TIP-like protein                                 200   3e-60   Trifolium repens [creeping white clover]
gb|AFS50011.1|  hypothetical protein                                    200   4e-60   
ref|XP_002314305.2|  nodulin-26 family protein                          200   4e-60   Populus trichocarpa [western balsam poplar]
gb|ACY74345.1|  aquaporin-like protein                                  200   4e-60   
ref|XP_008795635.1|  PREDICTED: probable aquaporin TIP1-1               200   5e-60   
gb|AEF59492.1|  aquaporin-like protein                                  199   1e-59   
gb|ACV52008.1|  tonoplast aquaporin 1;1                                 199   1e-59   
gb|ACJ53709.1|  tonoplast intrinsic protein 1-2                         199   2e-59   
gb|ADE34287.1|  aquaporin TIP1;12                                       196   2e-59   
gb|EPS60922.1|  hypothetical protein M569_13880                         198   3e-59   
emb|CAB39758.1|  major intrinsic protein                                197   7e-59   
ref|XP_006384960.1|  nodulin-26 family protein                          197   1e-58   
ref|XP_011028266.1|  PREDICTED: aquaporin TIP1-1-like                   197   1e-58   
gb|ADE34284.1|  aquaporin TIP1;9                                        194   1e-58   
emb|CAA06335.1|  aquaporin-like protein                                 196   2e-58   
ref|NP_001236728.1|  nodulin-26                                         196   3e-58   
emb|CDP07030.1|  unnamed protein product                                196   3e-58   
gb|AHA50083.1|  tonoplast intrinsic protein                             194   2e-57   
gb|ABK22410.1|  unknown                                                 193   2e-57   
sp|P42067.2|TIP1_MEDSA  RecName: Full=Probable aquaporin TIP-type...    193   3e-57   
gb|AEV54107.1|  putative tonoplast intrinsic protein 1.7                191   8e-57   
gb|AFU51578.1|  aquaporin                                               192   1e-56   
gb|EPS67611.1|  aquaporin-like protein                                  191   2e-56   
gb|KHN33410.1|  Aquaporin TIP1-3                                        187   4e-56   
gb|AEV54106.1|  putative tonoplast intrinsic protein 1.8                188   1e-55   
gb|EPS62187.1|  nodulin-26                                              188   2e-55   
gb|ADF32096.1|  aquaporin                                               188   3e-55   
gb|ACI95284.1|  tonoplast intrinsic protein                             188   3e-55   
dbj|BAL41683.1|  tonoplast intrinsic protein                            187   4e-55   
gb|AEW46427.1|  putative tonoplast intrinsic protein 1.3                182   6e-55   
ref|XP_008442728.1|  PREDICTED: aquaporin TIP1-1-like                   187   9e-55   
ref|XP_004137844.1|  PREDICTED: aquaporin TIP1-1-like                   186   9e-55   
gb|ABK22242.1|  unknown                                                 186   2e-54   
dbj|BAG15863.1|  aquaporin                                              184   3e-54   
dbj|BAL41684.1|  tonoplast intrinsic protein                            184   7e-54   
gb|AEW46428.1|  putative tonoplast intrinsic protein 1.4                179   9e-54   
ref|XP_003542571.1|  PREDICTED: aquaporin TIP1-1-like                   180   2e-52   
emb|CCI55669.1|  EaTIP1,1                                               177   5e-51   
gb|AAF78758.1|AF271661_1  putative aquaporin TIP1                       176   1e-50   
gb|ABH09331.1|  putative aquaporin                                      175   2e-50   
ref|NP_001267958.1|  aquaporin TIP2;1                                   175   2e-50   
gb|KDP37268.1|  hypothetical protein JCGZ_06324                         175   3e-50   
gb|ABX79969.1|  aquaporin                                               171   4e-50   
ref|XP_004516306.1|  PREDICTED: aquaporin TIP2-1-like                   174   5e-50   
ref|XP_009382435.1|  PREDICTED: probable aquaporin TIP2-1               174   5e-50   
ref|XP_010104889.1|  Aquaporin TIP2-3                                   174   8e-50   
gb|AFK47280.1|  unknown                                                 174   9e-50   
emb|CAB95746.2|  putative aquaporin                                     173   2e-49   
ref|XP_006356145.1|  PREDICTED: aquaporin TIP2-1-like                   172   2e-49   
gb|ABX79970.1|  aquaporin                                               169   2e-49   
ref|XP_010254028.1|  PREDICTED: aquaporin TIP2-1                        172   2e-49   
ref|XP_003626979.1|  Aquaporin TIP2-1                                   172   3e-49   
ref|XP_010322694.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    172   3e-49   
ref|XP_009772297.1|  PREDICTED: probable aquaporin TIP3-2               172   3e-49   
gb|AFK48554.1|  unknown                                                 172   3e-49   
ref|XP_009384464.1|  PREDICTED: probable aquaporin TIP2-1               172   4e-49   
ref|XP_009625471.1|  PREDICTED: probable aquaporin TIP3-2               172   5e-49   
ref|XP_008797218.1|  PREDICTED: aquaporin TIP3-1-like                   171   1e-48   
gb|AAB53329.1|  Rb7                                                     171   1e-48   
gb|KDP39884.1|  hypothetical protein JCGZ_03415                         171   1e-48   
ref|XP_010933649.1|  PREDICTED: probable aquaporin TIP2-1               171   1e-48   
gb|ABK22530.1|  unknown                                                 170   2e-48   
ref|XP_008796116.1|  PREDICTED: aquaporin TIP2-3                        170   2e-48   
gb|ABK21457.1|  unknown                                                 170   2e-48   
emb|CAB55837.1|  delta tonoplast intrinsic protein                      170   2e-48   
gb|ABK26146.1|  unknown                                                 170   2e-48   
dbj|BAP33940.1|  tonoplast intrinsic protein                            169   3e-48   
gb|AAD31848.1|AF133532_1  water channel protein MipK                    169   4e-48   
gb|AAG44945.1|AF290618_1  putative delta TIP                            169   4e-48   
ref|NP_001105031.1|  aquaporin TIP2-2                                   169   4e-48   
ref|XP_009615916.1|  PREDICTED: probable aquaporin TIP-type RB7-5A      169   4e-48   
gb|AFH36343.1|  aquaporin TIP2;1                                        169   4e-48   
ref|XP_008222886.1|  PREDICTED: aquaporin TIP1-1-like                   165   5e-48   
ref|NP_001274703.1|  TIP protein                                        169   5e-48   
gb|ACJ86062.1|  unknown                                                 169   5e-48   
ref|XP_007210530.1|  hypothetical protein PRUPE_ppa010285mg             169   6e-48   
ref|XP_008437066.1|  PREDICTED: probable aquaporin TIP2-2               169   6e-48   
ref|XP_004302879.1|  PREDICTED: aquaporin TIP2-1-like                   169   6e-48   
ref|XP_007215863.1|  hypothetical protein PRUPE_ppa010472mg             169   6e-48   
ref|XP_003597702.1|  Aquaporin                                          169   7e-48   
ref|XP_010521513.1|  PREDICTED: aquaporin TIP2-1-like                   169   7e-48   
gb|AAB67881.1|  membrane channel protein                                169   8e-48   
ref|XP_009758381.1|  PREDICTED: probable aquaporin TIP-type RB7-18C     169   8e-48   
ref|XP_004141759.1|  PREDICTED: aquaporin TIP2-1-like                   168   8e-48   
ref|XP_002298233.1|  delta-tonoplast intrinsic family protein           168   8e-48   
gb|EYU19323.1|  hypothetical protein MIMGU_mgv1a023438mg                168   9e-48   
gb|AFK49181.1|  unknown                                                 168   9e-48   
ref|XP_011014558.1|  PREDICTED: aquaporin TIP2-1-like                   167   1e-47   
ref|XP_008462177.1|  PREDICTED: aquaporin TIP2-1                        168   1e-47   
dbj|BAO18637.1|  tonoplast intrinsic protein 2;5                        168   1e-47   
ref|XP_010098111.1|  Aquaporin TIP2-1                                   168   1e-47   
dbj|BAA31516.1|  SAMIPB                                                 163   2e-47   
ref|XP_009614306.1|  PREDICTED: aquaporin TIP2-1-like                   167   2e-47   
ref|XP_002303300.1|  delta-tonoplast intrinsic family protein           167   2e-47   
gb|ABK94373.1|  unknown                                                 167   2e-47   
sp|P33560.1|TIP_ANTMA  RecName: Full=Probable aquaporin TIP-type;...    167   2e-47   
ref|XP_008228469.1|  PREDICTED: aquaporin TIP2-1                        167   2e-47   
emb|CAC39085.2|  putative aquaporin                                     166   2e-47   
ref|XP_008240429.1|  PREDICTED: probable aquaporin TIP3-2               167   2e-47   
ref|XP_011072095.1|  PREDICTED: probable aquaporin TIP3-2               167   3e-47   
ref|XP_009761134.1|  PREDICTED: probable aquaporin TIP-type RB7-18C     167   3e-47   
sp|P24422.2|TIP2_TOBAC  RecName: Full=Probable aquaporin TIP-type...    167   3e-47   
gb|ADE34289.1|  aquaporin TIP2;3                                        167   3e-47   
gb|ABR17761.1|  unknown                                                 167   4e-47   
ref|XP_003570028.1|  PREDICTED: probable aquaporin TIP2-1               167   4e-47   
ref|XP_008342659.1|  PREDICTED: aquaporin TIP2-1                        167   4e-47   
ref|XP_009377878.1|  PREDICTED: aquaporin TIP2-1                        166   5e-47   
gb|ABI96816.1|  tonoplast intrinsic protein                             166   5e-47   
gb|EYU24713.1|  hypothetical protein MIMGU_mgv1a012474mg                166   5e-47   
gb|KHG26174.1|  Aquaporin TIP2-1 -like protein                          166   6e-47   
gb|AAB04557.1|  delta-tonoplast intrinsic protein                       166   6e-47   
emb|CAA65185.1|  aquaporin                                              166   6e-47   
dbj|BAI66435.1|  tonoplast intrinsic protein                            166   6e-47   
gb|AEQ29859.1|  aquaporin TIP2                                          162   7e-47   
ref|NP_199556.1|  aquaporin TIP2-3                                      166   7e-47   
ref|XP_009786545.1|  PREDICTED: aquaporin TIP2-1-like                   166   7e-47   
ref|XP_009353577.1|  PREDICTED: aquaporin TIP2-1                        166   7e-47   
ref|XP_007099759.1|  Beta-tonoplast intrinsic protein                   166   8e-47   
ref|XP_006582836.1|  PREDICTED: uncharacterized protein LOC100306...    166   9e-47   
dbj|BAF01204.1|  membrane channel protein-like                          166   1e-46   
emb|CAA65187.1|  aquaporin                                              166   1e-46   
gb|KHG24233.1|  putative aquaporin TIP3-2 -like protein                 166   1e-46   
ref|XP_010248450.1|  PREDICTED: aquaporin TIP3-1-like                   166   1e-46   
gb|AGD98715.1|  aquaporin protein 12                                    166   1e-46   
ref|XP_007024239.1|  Delta tonoplast integral protein                   166   1e-46   
ref|XP_006478158.1|  PREDICTED: probable aquaporin TIP3-2-like          166   1e-46   
ref|XP_006441499.1|  hypothetical protein CICLE_v10021799mg             166   1e-46   
ref|XP_009604878.1|  PREDICTED: probable aquaporin TIP-type RB7-18C     165   1e-46   
ref|NP_001242116.1|  uncharacterized protein LOC100803901               165   1e-46   
ref|XP_010494978.1|  PREDICTED: aquaporin TIP2-3-like                   165   2e-46   
ref|XP_010441462.1|  PREDICTED: aquaporin TIP2-3-like                   165   2e-46   
ref|XP_006848638.1|  hypothetical protein AMTR_s00171p00047680          165   2e-46   
ref|XP_010481328.1|  PREDICTED: aquaporin TIP2-3                        165   2e-46   
ref|XP_002863344.1|  AtTIP2_3                                           165   2e-46   
ref|XP_006584589.1|  PREDICTED: uncharacterized protein LOC100803...    165   2e-46   
ref|XP_011004925.1|  PREDICTED: aquaporin TIP2-1                        165   2e-46   
ref|XP_006282082.1|  hypothetical protein CARUB_v10028328mg             165   2e-46   
emb|CAE53878.1|  putative aquaporin                                     161   2e-46   
gb|ABI84252.1|  tonoplast intrinsic protein alpha TIP                   163   2e-46   
dbj|BAD90704.1|  tonoplast intrinsic protein 2;1                        165   2e-46   
ref|XP_010102791.1|  putative aquaporin TIP3-2                          165   3e-46   
gb|ACN40807.1|  unknown                                                 164   3e-46   
ref|NP_001240119.1|  uncharacterized protein LOC100817754               164   3e-46   
ref|XP_002515999.1|  tonoplast intrinsic protein, putative              164   3e-46   
ref|XP_004976439.1|  PREDICTED: aquaporin TIP2-3-like                   164   3e-46   
emb|CDP09981.1|  unnamed protein product                                164   3e-46   
ref|XP_003543633.1|  PREDICTED: aquaporin TIP2-1                        164   3e-46   
ref|XP_009611581.1|  PREDICTED: aquaporin TIP2-1-like                   164   4e-46   
ref|NP_001047632.1|  Os02g0658100                                       164   4e-46   
gb|AEI83501.1|  Major intrinsic protein                                 164   4e-46   
ref|XP_007144382.1|  hypothetical protein PHAVU_007G151600g             164   4e-46   
tpg|DAA33871.1|  TPA: aquaporin TIP2;2                                  164   4e-46   
gb|EYU22320.1|  hypothetical protein MIMGU_mgv1a012158mg                164   4e-46   
gb|KHM98732.1|  Aquaporin TIP2-1                                        164   4e-46   
gb|ABD65010.1|  tonoplast intrinsic protein, putative                   164   5e-46   
ref|XP_009597545.1|  PREDICTED: probable aquaporin TIP3-2               164   5e-46   
ref|NP_001105030.1|  aquaporin TIP2-1                                   164   5e-46   
ref|XP_009767160.1|  PREDICTED: probable aquaporin TIP3-2               164   5e-46   
ref|XP_006647629.1|  PREDICTED: probable aquaporin TIP2-1-like          164   6e-46   
gb|KHG25791.1|  putative aquaporin TIP-type                             164   6e-46   
emb|CDX77768.1|  BnaC07g20220D                                          164   6e-46   
gb|ABD64981.1|  tonoplast intrinsic protein, putative                   164   6e-46   
gb|AGQ46837.1|  aquaporin-like protein                                  164   6e-46   
ref|XP_006369013.1|  aquaporin TIP2.3 family protein                    164   6e-46   
ref|XP_004299427.1|  PREDICTED: aquaporin TIP2-3-like                   164   6e-46   
ref|XP_006838208.1|  hypothetical protein AMTR_s00106p00151600          164   6e-46   
ref|XP_004299448.1|  PREDICTED: probable aquaporin TIP3-2-like          164   7e-46   
gb|ACG38813.1|  aquaporin TIP2.1                                        164   7e-46   
ref|XP_006833430.1|  hypothetical protein AMTR_s00109p00145780          163   7e-46   
ref|XP_010918027.1|  PREDICTED: aquaporin TIP3-1-like                   164   8e-46   
emb|CBI37360.3|  unnamed protein product                                162   8e-46   
ref|XP_008380900.1|  PREDICTED: aquaporin TIP2-1-like                   163   8e-46   
ref|XP_006833429.1|  hypothetical protein AMTR_s00109p00145020          163   9e-46   
emb|CDY59296.1|  BnaA06g40020D                                          163   1e-45   
ref|XP_010062508.1|  PREDICTED: aquaporin TIP2-1                        163   1e-45   
ref|XP_009617337.1|  PREDICTED: aquaporin TIP2-1                        163   1e-45   
gb|AFK35772.1|  unknown                                                 163   1e-45   
gb|AFK36325.1|  unknown                                                 163   1e-45   
gb|AEZ52401.1|  aquaporin                                               163   1e-45   
gb|ACU19274.1|  unknown                                                 163   1e-45   
gb|ABD65120.1|  Tonoplast intrinsic protein, putative                   163   1e-45   
ref|XP_009419322.1|  PREDICTED: probable aquaporin TIP2-2               162   1e-45   
ref|XP_008800430.1|  PREDICTED: aquaporin TIP3-1-like                   163   1e-45   
ref|XP_009144590.1|  PREDICTED: probable aquaporin TIP2-2               162   2e-45   
ref|XP_010691368.1|  PREDICTED: aquaporin TIP2-1                        162   2e-45   
ref|XP_011080630.1|  PREDICTED: aquaporin TIP2-1                        162   2e-45   
gb|AAC39480.1|  aquaporin                                               162   2e-45   
ref|XP_006426918.1|  hypothetical protein CICLE_v10026351mg             162   2e-45   
ref|NP_001289845.1|  aquaporin TIP2-1                                   162   2e-45   
emb|CAA88267.1|  putative membrane intrinsic protein                    162   2e-45   
ref|NP_001237401.1|  uncharacterized protein LOC100306092               162   2e-45   
ref|XP_004512692.1|  PREDICTED: probable aquaporin TIP-type alpha...    162   2e-45   
ref|XP_006351524.1|  PREDICTED: probable aquaporin TIP3-2-like          163   2e-45   
ref|NP_001274301.1|  probable aquaporin TIP3-2-like                     163   2e-45   
dbj|BAH56913.1|  AT3G16240                                              160   2e-45   
ref|XP_006398438.1|  hypothetical protein EUTSA_v10001007mg             162   2e-45   
ref|XP_009781180.1|  PREDICTED: aquaporin TIP2-1-like                   162   2e-45   
gb|KHG09483.1|  putative aquaporin TIP-type                             162   2e-45   
emb|CDX82410.1|  BnaA03g34110D                                          162   2e-45   
ref|XP_006465649.1|  PREDICTED: aquaporin TIP2-1-like                   162   2e-45   
gb|AHL24705.1|  tonoplastic intrinsic protein                           159   2e-45   
ref|XP_009135480.1|  PREDICTED: aquaporin TIP2-1-like                   162   2e-45   
ref|XP_003554937.1|  PREDICTED: aquaporin TIP2-1-like                   162   3e-45   
ref|XP_004953349.1|  PREDICTED: aquaporin TIP2-1-like                   162   3e-45   
gb|AAC49992.1|  delta tonoplast integral protein                        160   3e-45   
ref|XP_010504014.1|  PREDICTED: aquaporin TIP2-1-like                   162   3e-45   
ref|XP_002277904.2|  PREDICTED: probable aquaporin TIP-type             162   3e-45   
ref|XP_009397951.1|  PREDICTED: aquaporin TIP3-1-like                   162   4e-45   
ref|XP_006414242.1|  hypothetical protein EUTSA_v10026069mg             161   4e-45   
ref|XP_010465638.1|  PREDICTED: aquaporin TIP2-1                        161   4e-45   
gb|AAB51394.2|  tonoplast intrinsic protein bobTIP26-2                  159   4e-45   
ref|XP_007150651.1|  hypothetical protein PHAVU_005G170300g             161   5e-45   
gb|AFH36342.1|  aquaporin TIP1                                          161   5e-45   
ref|XP_004169489.1|  PREDICTED: aquaporin TIP1-3-like                   157   5e-45   
ref|XP_002448289.1|  hypothetical protein SORBIDRAFT_06g024590          161   5e-45   
ref|XP_004152399.1|  PREDICTED: aquaporin TIP2-3-like                   161   5e-45   
ref|XP_009146158.1|  PREDICTED: aquaporin TIP2-1                        162   6e-45   
gb|AIK66518.1|  putative aquaporin                                      161   6e-45   
ref|XP_007039804.1|  Tonoplast intrinsic protein 2,3                    161   6e-45   
ref|XP_010487476.1|  PREDICTED: aquaporin TIP2-1-like                   161   6e-45   
ref|XP_004241485.1|  PREDICTED: probable aquaporin TIP3-2               161   8e-45   
emb|CDY20190.1|  BnaA01g28120D                                          161   8e-45   
ref|XP_010687268.1|  PREDICTED: aquaporin TIP3-1-like                   161   8e-45   
ref|NP_001105032.1|  aquaporin TIP3-1                                   161   8e-45   



>gb|ABP35520.1| tonoplast intrinsic protein [Ipomoea batatas]
Length=251

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 166/170 (98%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MAVPRIAIGSVGEAT PDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPAGLIS
Sbjct  1    MAVPRIAIGSVGEATSPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGA+ISGGHVNPAVTFGAFVGGHITL RSV+YWIAQLLGSVVACLL
Sbjct  61   AAIAHAFALFVAVSVGADISGGHVNPAVTFGAFVGGHITLLRSVVYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLETPAFGLS GV PWNAVVFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGLETPAFGLS-GVGPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  169



>gb|KHG11211.1| Aquaporin TIP1-3 -like protein [Gossypium arboreum]
Length=252

 Score =   258 bits (660),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+GS  EA+Q DALKAA+AEFISMLIFVFAG GSGMAFNKLTDNG++TPAGL++
Sbjct  1    MPISRIAVGSPAEASQSDALKAALAEFISMLIFVFAGEGSGMAFNKLTDNGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRS+LYWIAQLLGSVVACLL
Sbjct  61   ASVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGL T AF LS+GV  WNAVVFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFSTGGLTTSAFSLSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|NP_001274695.1| aquaporin TIP1-3-like [Solanum lycopersicum]
 dbj|BAO18633.1| tonoplast intrinsic protein 1;2 [Solanum lycopersicum]
Length=253

 Score =   258 bits (660),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG++ EAT+PDALKAA AEF SMLIFVFAGSGSGMAF KLT+ GAATPAGLIS
Sbjct  1    MPISRIAIGNLAEATKPDALKAATAEFFSMLIFVFAGSGSGMAFGKLTNGGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVAC+L
Sbjct  61   ASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACVL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGLET AF LS+GV PWNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFSTGGLETSAFALSSGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_006350747.1| PREDICTED: aquaporin TIP1-3-like [Solanum tuberosum]
Length=253

 Score =   258 bits (659),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG++ EAT+PDALKAA AEF SMLIFVFAGSGSGMAF KLT+ GAATPAGLIS
Sbjct  1    MPISRIAIGNLAEATKPDALKAATAEFFSMLIFVFAGSGSGMAFGKLTNGGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVAC+L
Sbjct  61   ASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACVL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGLET AF LS+GV PWNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFSTGGLETSAFALSSGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_009624595.1| PREDICTED: aquaporin TIP1-3 [Nicotiana tomentosiformis]
Length=252

 Score =   257 bits (657),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +I++G++ EA+QPDALKAA+AEFISMLIFVFAG GSGMAF KLT+ GAATPAGLIS
Sbjct  1    MPISKISLGNLAEASQPDALKAALAEFISMLIFVFAGEGSGMAFGKLTNGGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVAC+L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACVL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS GV PWNAVVFEIVMTFGLVYTVYATA+DPK+GN
Sbjct  121  LKFATGGLETSAFALSTGVTPWNAVVFEIVMTFGLVYTVYATAIDPKRGN  170



>ref|XP_009780564.1| PREDICTED: aquaporin TIP1-3 [Nicotiana sylvestris]
Length=252

 Score =   257 bits (656),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +I +G++ EA+QPDALKAA+AEFISMLIFVFAG GSGMAF KLT+ GAATPAGLIS
Sbjct  1    MPISKITLGNLAEASQPDALKAALAEFISMLIFVFAGEGSGMAFGKLTNGGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVAC+L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACVL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS GV PWNAVVFEIVMTFGLVYTVYATAVDPK+GN
Sbjct  121  LKFATGGLETSAFALSTGVTPWNAVVFEIVMTFGLVYTVYATAVDPKRGN  170



>gb|KHG14163.1| Aquaporin TIP1-3 -like protein [Gossypium arboreum]
Length=252

 Score =   254 bits (650),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+GS  EA Q DALKAA+AEFISMLIFVFAG GSGMAFNKLTDNG+ TPAGL++
Sbjct  1    MPISRIAVGSAAEAGQADALKAALAEFISMLIFVFAGEGSGMAFNKLTDNGSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITL RS+LYWIAQLLGSVVACLL
Sbjct  61   ASVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLVRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGL T AF LS+GV  WNAVVFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFSTGGLTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_006436063.1| hypothetical protein CICLE_v10032534mg [Citrus clementina]
 ref|XP_006486051.1| PREDICTED: aquaporin TIP1-3-like [Citrus sinensis]
 gb|ESR49303.1| hypothetical protein CICLE_v10032534mg [Citrus clementina]
 gb|KDO67730.1| hypothetical protein CISIN_1g025464mg [Citrus sinensis]
Length=252

 Score =   254 bits (649),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+ GEA+ PDALKAA+AEF SM+IFVFAG GSGMAF+KLTD GA+TPAGLIS
Sbjct  1    MPIYRIAIGTPGEASHPDALKAALAEFFSMIIFVFAGQGSGMAFSKLTDGGASTPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITL RS+LYWIAQLLGSVVACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLLRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGLET AF LS+GV+ WNAVVFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFSTGGLETSAFALSSGVSSWNAVVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_002531978.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF30414.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=252

 Score =   253 bits (647),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+G+ GEA+QPDAL+AA+AEF SM+IFVFAG GSGMAFNKLTD G+ TP+GL++
Sbjct  1    MPISRIAVGNPGEASQPDALRAALAEFFSMIIFVFAGEGSGMAFNKLTDGGSTTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAF+GGHITL R +LYWIAQLLGSVVACLL
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGLET AF LS+GV+ WNAVVFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFSTGGLETSAFALSSGVSSWNAVVFEIVMTFGLVYTVYATAVDPKKGN  170



>gb|AIK66517.1| putative aquaporin [Vitis vinifera]
Length=251

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+ GEA+ PDALKAA+AEF SMLIFVFAG GSGMAFNKLTD+G++TPAGL++
Sbjct  1    MPINRIAIGTPGEASHPDALKAALAEFFSMLIFVFAGEGSGMAFNKLTDSGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AH FALFVAVSVGANISGGHVNPAVTFGAF+GGHITL R +LYWIAQLLGSVVACLL
Sbjct  61   AALAHGFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGLET AF LS+GV+ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFSTGGLETSAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>emb|CBI31728.3| unnamed protein product [Vitis vinifera]
Length=251

 Score =   253 bits (645),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+ GEA+ PDALKAA+AEF SMLIFVFAG GSGMAFNKLTD+G++TPAGL++
Sbjct  1    MPINRIAIGTPGEASHPDALKAALAEFFSMLIFVFAGEGSGMAFNKLTDSGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AH FALFVAVSVGANISGGHVNPAVTFGAF+GGHITL R +LYWIAQLLGSVVACLL
Sbjct  61   AALAHGFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGLET AF LS+GV+ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFSTGGLETSAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_007016527.1| Tonoplast intrinsic protein 1,3 [Theobroma cacao]
 gb|EOY34146.1| Tonoplast intrinsic protein 1,3 [Theobroma cacao]
Length=252

 Score =   253 bits (645),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+GS  EA Q DALKAA+AEFISMLIFVFAG GSGMAFNKLTDNG++TPAGL++
Sbjct  1    MPISRIAVGSPAEAGQADALKAALAEFISMLIFVFAGEGSGMAFNKLTDNGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHI+L RS+LYWIAQLLGSVVACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHISLVRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGL T AF LS+GV  WNAVVFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFSTGGLTTSAFSLSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_011022886.1| PREDICTED: aquaporin TIP1-3 [Populus euphratica]
Length=252

 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+G+ GEA+ PD+L+AA+AEFISMLIFVFAGSGSGMAFNKLTD+ + TPAGL++
Sbjct  1    MPINRIAVGTPGEASHPDSLRAALAEFISMLIFVFAGSGSGMAFNKLTDSASTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGA +GG+ITL RS+LYWIAQLLGSVVACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGALIGGNITLLRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGLETPAFGLS+GV  WNAVVFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFSTGGLETPAFGLSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_002316308.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
 gb|ABK94058.1| unknown [Populus trichocarpa]
 gb|EEF02479.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
Length=252

 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA G+  EA+ PDAL+AA+AEFISMLIFVFAGSGSGMAFNKLTDN + TP+GL++
Sbjct  1    MPINRIAFGTPREASHPDALRAALAEFISMLIFVFAGSGSGMAFNKLTDNASTTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGA +GG+ITL RS+LYWIAQLLGSVVACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGALIGGNITLLRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLETPAFGLS+GV  WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGLETPAFGLSSGVGAWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_002531118.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF31283.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=252

 Score =   252 bits (643),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+  IA GS  EA QPDALKAA+AEFISMLIFVFAG GSGMAFNKLT +GA TPAGL++
Sbjct  1    MAITSIAFGSPAEAGQPDALKAALAEFISMLIFVFAGEGSGMAFNKLTSDGATTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AH FALFVAVSVGANISGGHVNPAVTFGAFVGGHIT  RS+LYWIAQLLGSVVACLL
Sbjct  61   ASLAHGFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFIRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGLET AF LS+GV  WNAVVFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFSTGGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGN  170



>gb|AAF78757.1|AF271660_1 putative aquaporin TIP3 [Vitis cinerea var. helleri x Vitis rupestris]
Length=251

 Score =   252 bits (643),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+ GEA+ PDALKAA+AEF SMLIFVFAG GSGMAFNKLTD+G++TPAGL++
Sbjct  1    MPIYRIAIGTPGEASHPDALKAALAEFFSMLIFVFAGEGSGMAFNKLTDSGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AH FALFVAVSVGANISGGHVNPAVTFGAF+GGHITL R +LYWIAQLLGSVVACLL
Sbjct  61   AALAHGFALFVAVSVGANISGGHVNPAVTFGAFLGGHITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGLET AF LS+GV+ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFSTGGLETSAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_011027129.1| PREDICTED: aquaporin TIP1-3-like [Populus euphratica]
Length=252

 Score =   251 bits (642),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA G+  EA+ PDAL+AA+AEFISMLIFVFAGSGSGMAFNKLTDN + TP+GL++
Sbjct  1    MPINRIAFGTPREASHPDALRAALAEFISMLIFVFAGSGSGMAFNKLTDNASTTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGA +GG+ITL RS+LYWIAQLLGSVVACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGALMGGNITLLRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLETPAFGLS+GV  WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGLETPAFGLSSGVGAWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>dbj|BAD90703.1| tonoplast intrinsic protein 1;2 [Mimosa pudica]
Length=252

 Score =   251 bits (641),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+  E  Q DALKAA+AEFISMLIFVFAG GSGMA+NKLT+NGAATPAGL+S
Sbjct  1    MPISRIAIGNASEFQQADALKAALAEFISMLIFVFAGEGSGMAYNKLTNNGAATPAGLVS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHA ALFVAV+VGANISGGHVNPAVTFGAFVGGHI+L RS+LYWIAQLLG VVACLL
Sbjct  61   ASIAHALALFVAVAVGANISGGHVNPAVTFGAFVGGHISLLRSILYWIAQLLGCVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LSAGV  WNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFATGGLETSAFALSAGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_007009482.1| Tonoplast intrinsic protein 1,3 [Theobroma cacao]
 gb|EOY18292.1| Tonoplast intrinsic protein 1,3 [Theobroma cacao]
Length=252

 Score =   251 bits (641),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+ GEA+QPDALKAA AEF SMLIFVFAG GSGMAFNKLT+NG++TPAGL++
Sbjct  1    MPINRIAIGTPGEASQPDALKAAFAEFFSMLIFVFAGEGSGMAFNKLTNNGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS+ V+ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGLETSAFSLSSDVSAWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|NP_001267923.1| aquaporin-like [Vitis vinifera]
 gb|ABH09329.1| putative aquaporin [Vitis vinifera]
 gb|AAW02943.2| aquaporin [Vitis vinifera]
Length=251

 Score =   251 bits (641),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+ GEA+ P+ALKAA+AEF SMLIFVFAG GSGMAFNKLTD+G++TPAGL++
Sbjct  1    MPINRIAIGTPGEASHPEALKAALAEFFSMLIFVFAGEGSGMAFNKLTDSGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AH FALFVAVSVGANISGGHVNPAVTFGAF+GGHITL R +LYWIAQLLGSVVACLL
Sbjct  61   AALAHGFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGLET AF LS+GV+ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFSTGGLETSAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>emb|CDP08994.1| unnamed protein product [Coffea canephora]
Length=251

 Score =   251 bits (640),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+GS  EA+QPDALKAA+AEFISMLIFVFAG GSGMAF+KLTDNG+ TPAGL++
Sbjct  1    MPISRIAVGSPAEASQPDALKAALAEFISMLIFVFAGEGSGMAFSKLTDNGSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSV ANISGGHVNPAVTFGAF+GGHITL RSVLYWIAQLLG+VVACLL
Sbjct  61   AAIAHAFALFVAVSVAANISGGHVNPAVTFGAFLGGHITLLRSVLYWIAQLLGAVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGLET AF LS+GV+ WNA+VFEIVMTFGLVYTVYATA+DPKKG+
Sbjct  121  LKFSTGGLETAAFSLSSGVSVWNALVFEIVMTFGLVYTVYATALDPKKGD  170



>ref|XP_011000304.1| PREDICTED: probable aquaporin TIP1-2 [Populus euphratica]
Length=252

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+  IA GS  EA QPDALKAA+AEFISMLIFVFAG GSGMAFNKLTDNG++TPAGL++
Sbjct  1    MAITSIAFGSPAEAGQPDALKAALAEFISMLIFVFAGEGSGMAFNKLTDNGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGHIT FRS+LYW+AQ LGSVVACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHITFFRSLLYWVAQCLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG ET AF LS+GV  WNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKLATGGQETSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_002284411.1| PREDICTED: aquaporin TIP1-1 [Vitis vinifera]
 emb|CBI16192.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +PRIA+GS  EA Q DALKAA+AEFIS+LIFVFAG GSGMAFNKLTD+G++TPAGL++
Sbjct  1    MPIPRIALGSPAEAGQADALKAALAEFISVLIFVFAGEGSGMAFNKLTDDGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVS+ ANISGGHVNPAVTFGA VGGHITLFRS+LYWIAQLLGSVVACLL
Sbjct  61   AAVAHAFALFVAVSIAANISGGHVNPAVTFGALVGGHITLFRSLLYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL T AF LS+GV+ WNA+VFEIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LKFATGGLTTSAFSLSSGVSAWNALVFEIVMTFGLVYTVYATAIDPKKGN  170



>ref|XP_002311146.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
 gb|EEE88513.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
Length=252

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+G+ GEA+ PD+L+AA+AEFIS LIFVFAGSGSGMAFNKLTD+ + TPAGL++
Sbjct  1    MPINRIAVGTPGEASHPDSLRAALAEFISTLIFVFAGSGSGMAFNKLTDSASTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGA +GG+ITL RS+LYWIAQLLGSVVACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGALIGGNITLLRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGLETPAFGLS+GV  WNAVVFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFSTGGLETPAFGLSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGN  170



>gb|KDP29873.1| hypothetical protein JCGZ_18448 [Jatropha curcas]
Length=252

 Score =   249 bits (637),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+ GEA+QPDAL+AA+AEF SM+IFVFAG GSGMAFNKLT +G++TPAGL++
Sbjct  1    MPITRIAIGNPGEASQPDALRAALAEFFSMVIFVFAGEGSGMAFNKLTSDGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK+ATGGLET AF LS+GV+ WNAVVFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKYATGGLETSAFALSSGVSAWNAVVFEIVMTFGLVYTVYATAVDPKKGN  170



>emb|CAN74049.1| hypothetical protein VITISV_007330 [Vitis vinifera]
Length=251

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+ GEA+ P ALKAA+AEF SMLIFVFAG GSGMAFNKLTD+G++TPAGL++
Sbjct  1    MPIXRIAIGTPGEASHPXALKAALAEFFSMLIFVFAGEGSGMAFNKLTDSGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AH FALFVAVSVGANISGGHVNPAVTFGAF+GGHITL R +LYWIAQLLGSVVACLL
Sbjct  61   AALAHGFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGLET AF LS+GV+ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFSTGGLETSAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>gb|AGD98709.1| aquaporin protein 6 [Camellia sinensis]
Length=252

 Score =   249 bits (636),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+GS  EA+QPDALKAA+AEFISMLIFVFAG G+GMAF+KLTD G+ TPAGL++
Sbjct  1    MPISRIAVGSPAEASQPDALKAALAEFISMLIFVFAGEGAGMAFSKLTDGGSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGHITL RS+LYWIAQ LGSVVACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGHITLLRSILYWIAQCLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS+GV  WNA+VFEIVMTFGLVYTVYATA+DPKKG+
Sbjct  121  LKFATGGLETSAFSLSSGVTVWNALVFEIVMTFGLVYTVYATALDPKKGD  170



>ref|XP_004307558.1| PREDICTED: aquaporin TIP1-3-like [Fragaria vesca subsp. vesca]
Length=252

 Score =   249 bits (636),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAIG+ GEA+ PDA++AA AEF SMLIFVFAG GSGMA++KLTDNG+ATP+GLI+
Sbjct  1    MAISRIAIGAPGEASHPDAIRAAFAEFFSMLIFVFAGEGSGMAYSKLTDNGSATPSGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R+ LYWIAQLLGSVVACLL
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRASLYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS+GV+ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGLETAAFSLSSGVSIWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>gb|ABB76813.1| tonoplast intrinsic protein [Olea europaea]
Length=252

 Score =   249 bits (635),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + R+AIGS  E +Q DA+KAAVAEFISMLIFVFAG GSGMAF KLTDN + TPAGLI+
Sbjct  1    MPISRVAIGSPAEFSQLDAIKAAVAEFISMLIFVFAGQGSGMAFAKLTDNESTTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAFALFVAVSVGANISGGHVNPAVT GAFVGGHITLFRS++YWIAQLLGSV+ACLL
Sbjct  61   ASIAHAFALFVAVSVGANISGGHVNPAVTLGAFVGGHITLFRSIMYWIAQLLGSVIACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS+GV  WNAV+FEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGLETSAFALSSGVTVWNAVIFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_010096653.1| Aquaporin TIP1-3 [Morus notabilis]
 gb|EXB65321.1| Aquaporin TIP1-3 [Morus notabilis]
Length=252

 Score =   248 bits (634),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAIG+ GEA QPDA++AA AEF SMLIFVFAG GSGMAFNKLT+NGA+TP+GL++
Sbjct  1    MAIYRIAIGNPGEARQPDAIRAAFAEFFSMLIFVFAGEGSGMAFNKLTNNGASTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS+GV+ WNA++FEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFATGGLETSAFALSSGVSTWNALIFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|NP_001238026.1| nodulin-26 [Glycine max]
 gb|AAA02947.1| nodulin-26 [Glycine max]
Length=255

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+  E  Q DALKAA+AEFISMLIFVFAG GSGMA+NKLT+NG+ATPAGL++
Sbjct  1    MPISRIAIGNSSELNQSDALKAALAEFISMLIFVFAGEGSGMAYNKLTNNGSATPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRS+LYWIAQLLGSVVACLL
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS GV   NA+VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFATGGLETSAFALSPGVEAGNALVFEIVMTFGLVYTVYATAVDPKKGD  170



>gb|KHN30200.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+  E  Q DALKAA+AEFISMLIFVFAG GSGMA+NKLT+NG+ATPAGL++
Sbjct  1    MPISRIAIGNSSELNQSDALKAALAEFISMLIFVFAGEGSGMAYNKLTNNGSATPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRS+LYWIAQLLGSVVACLL
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS GV   NA+VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFATGGLETSAFALSPGVEAGNALVFEIVMTFGLVYTVYATAVDPKKGD  170



>gb|KHG06645.1| putative aquaporin TIP1-2 [Gossypium arboreum]
Length=252

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+GS  EA Q DALKAA+AEFIS+LIFVFAG GSGMAFNKLTD+G++TPAGL++
Sbjct  1    MPISRIAVGSPSEAGQADALKAALAEFISVLIFVFAGEGSGMAFNKLTDDGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHA ALFVAVS+GANISGGHVNPAVTFGAFVGGHITL RS+LYWIAQLLGSVVACLL
Sbjct  61   AALAHALALFVAVSIGANISGGHVNPAVTFGAFVGGHITLVRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGG+ T AF LS+GV  WNAVVFEIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LKFSTGGMTTSAFSLSSGVGAWNAVVFEIVMTFGLVYTVYATAIDPKKGN  170



>ref|XP_010253312.1| PREDICTED: aquaporin TIP1-3-like [Nelumbo nucifera]
Length=251

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+ GEA+QPDALKAA+AEFIS LIFVFAG GSGMAFNKLT NG++TPAGL+S
Sbjct  1    MPISRIAIGTPGEASQPDALKAALAEFISTLIFVFAGEGSGMAFNKLTSNGSSTPAGLVS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGS+VACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSIVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL T AF LS  V+ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGLTTSAFSLSTDVSVWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_006424746.1| hypothetical protein CICLE_v10029134mg [Citrus clementina]
 gb|ESR37986.1| hypothetical protein CICLE_v10029134mg [Citrus clementina]
Length=250

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  VPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglisaa  287
            +P IAIG+  E  QPDAL+AAVAEF SM+IFVFAG GSGMA++KLTDNGAATPAGL+SA+
Sbjct  1    MPGIAIGNPAEIGQPDALRAAVAEFFSMVIFVFAGQGSGMAYSKLTDNGAATPAGLVSAS  60

Query  288  iahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLLLK  467
            IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHIT  RS+LYWIAQLLGSVVACLLLK
Sbjct  61   IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFVRSILYWIAQLLGSVVACLLLK  120

Query  468  FATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            F+TGGLET AF LS+GV  WNAVVFEIVMTFGLVYTVYATAVDPK+GN
Sbjct  121  FSTGGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKRGN  168



>ref|XP_006488253.1| PREDICTED: aquaporin TIP1-3-like [Citrus sinensis]
 gb|KDO72973.1| hypothetical protein CISIN_1g025600mg [Citrus sinensis]
Length=250

 Score =   246 bits (628),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  108  VPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglisaa  287
            +P IAIG+  E  QPDAL+AAVAEF SM+IFVFAG GSGMA++KLTDNGAATPAGL+SA+
Sbjct  1    MPGIAIGNPAEIGQPDALRAAVAEFFSMVIFVFAGQGSGMAYSKLTDNGAATPAGLVSAS  60

Query  288  iahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLLLK  467
            IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHIT  RS+LYWIAQLLGSVVACLLLK
Sbjct  61   IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFVRSILYWIAQLLGSVVACLLLK  120

Query  468  FATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            F+TGGLET AF LS+GV  WNAVVFEIVMTFGLVYTVYATAVDPK+GN
Sbjct  121  FSTGGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKRGN  168



>ref|XP_008343557.1| PREDICTED: aquaporin TIP1-3 [Malus domestica]
Length=252

 Score =   246 bits (628),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+G+ GEA+QPDA++AA+AEF SMLIFVFAG GSGMAFNKLTDN + TP+GL++
Sbjct  1    MPINRIAVGTPGEASQPDAIRAALAEFFSMLIFVFAGEGSGMAFNKLTDNASTTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGG ET  F LS+GV+ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGWETAXFSLSSGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_010920700.1| PREDICTED: probable aquaporin TIP1-2 [Elaeis guineensis]
Length=253

 Score =   246 bits (628),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIGS GEA+QPD LKAA+AEFISMLIFVFAG GSGMAFNKLT++G+ TPAGL++
Sbjct  1    MPISRIAIGSPGEASQPDTLKAALAEFISMLIFVFAGEGSGMAFNKLTNDGSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL+T AF LS  V+ WNA+VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFATGGLKTAAFSLSTDVSAWNALVFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_010031004.1| PREDICTED: aquaporin TIP1-3-like [Eucalyptus grandis]
 gb|KCW50265.1| hypothetical protein EUGRSUZ_J00051 [Eucalyptus grandis]
Length=252

 Score =   246 bits (628),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ +IAIG+ GEA++PDA++AA+AEF SMLIFVFAG GSGMAFNKLTD+G+ TPAGL++
Sbjct  1    MAIYKIAIGTPGEASRPDAIRAALAEFFSMLIFVFAGEGSGMAFNKLTDDGSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS+ V+ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGLETSAFSLSSDVSVWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_011089824.1| PREDICTED: aquaporin TIP1-3-like [Sesamum indicum]
Length=252

 Score =   246 bits (628),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+GS  EA+QP+A+KAA+AEFISMLIFVFAG GSGMAF KLT+ GA+TPAGLI+
Sbjct  1    MPIARIAVGSPAEASQPEAVKAALAEFISMLIFVFAGEGSGMAFAKLTNGGASTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRS+LYWIAQLLGSVVACLL
Sbjct  61   ASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS+GV   NA+VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFATGGLETSAFALSSGVTVTNALVFEIVMTFGLVYTVYATAVDPKKGD  170



>gb|ABR68795.1| aquaporin gamma-TIP [Gossypium hirsutum]
Length=252

 Score =   246 bits (627),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+GS  EA Q DALKAA+AEFIS+LIFVFAG GSGMAFNKLTD+G++TPAGL++
Sbjct  1    MPISRIAVGSPAEAGQADALKAALAEFISVLIFVFAGEGSGMAFNKLTDDGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHA ALFVAVS+GANISGGHVNPAVTFGAFVGGHITL RS+LYWIAQLLGSVVAC L
Sbjct  61   AALAHALALFVAVSIGANISGGHVNPAVTFGAFVGGHITLVRSILYWIAQLLGSVVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGG+ T AF LS+GV  WNAVVFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFSTGGMTTSAFSLSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGN  170



>gb|ADE34283.1| aquaporin TIP1;7 [Gossypium hirsutum]
Length=252

 Score =   246 bits (627),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+GS  EA Q DALKAA+AEFIS+LIFVFAG GSGMAFNKLTD+ ++TPAGL++
Sbjct  1    MPISRIAVGSPAEAGQADALKAALAEFISVLIFVFAGEGSGMAFNKLTDDDSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHA ALFVAVSVGANISGGHVNPAVTFGAFVGGHITL RS+LYWIAQLLGSVVACLL
Sbjct  61   AALAHALALFVAVSVGANISGGHVNPAVTFGAFVGGHITLVRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGG+ T AF LS+GV  WNAVVFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFSTGGMTTSAFSLSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_008794805.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin TIP1-2 [Phoenix 
dactylifera]
Length=252

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIGS GEA+QPDALKAA+AEFIS+LIFVFAG GSGMAFNKLT++G+ TPAGL++
Sbjct  1    MPISRIAIGSPGEASQPDALKAALAEFISVLIFVFAGEGSGMAFNKLTNDGSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL+T AF LS  V+ WNA+VFEIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LKFATGGLKTSAFSLSTDVSVWNALVFEIVMTFGLVYTVYATALDPKKGN  170



>gb|AGG39699.1| aquaporin protein AQU21 [Camellia sinensis]
Length=252

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+G+  EA+ PDALKAA+AEFISMLIFVFAG GSGMAFNKLTDNG+ TPAGL++
Sbjct  1    MPIYRIAVGTPREASHPDALKAALAEFISMLIFVFAGEGSGMAFNKLTDNGSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQ LGS+VACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQCLGSIVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS GV+ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGLETSAFSLSIGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_010043596.1| PREDICTED: aquaporin TIP1-3-like [Eucalyptus grandis]
 ref|XP_010042712.1| PREDICTED: aquaporin TIP1-3-like [Eucalyptus grandis]
 gb|KCW85618.1| hypothetical protein EUGRSUZ_B02403 [Eucalyptus grandis]
Length=252

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIGS  E  Q DALKA +AEFISMLIFVFAG GSGMAFNKLTD+G+ TPAGL++
Sbjct  1    MPISRIAIGSPAEIGQVDALKAGLAEFISMLIFVFAGEGSGMAFNKLTDDGSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITL RSVLYW+AQLLGSVVACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLSRSVLYWVAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGG+ET AF LS+ V  WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFSTGGMETSAFSLSSDVTVWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>dbj|BAD90702.1| tonoplast intrinsic protein 1;1 [Mimosa pudica]
Length=251

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V  IAIG   EAT PD LKA +AEFIS LIFVFAGSGSGMAFNKLTDNGA TPAGLIS
Sbjct  1    MPVQNIAIGRPEEATHPDTLKAGLAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAV+VGANISGGHVNPAVTFGAF+GG+I+L R ++YWIAQLLGSVVACLL
Sbjct  61   AAIAHAFALFVAVAVGANISGGHVNPAVTFGAFIGGNISLLRGIVYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF TGGL TPAFGLS+GV  WNAVVFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFVTGGLTTPAFGLSSGVGVWNAVVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_002299893.1| nodulin-26 family protein [Populus trichocarpa]
 gb|EEE84698.1| nodulin-26 family protein [Populus trichocarpa]
Length=252

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA GS  EA QPDAL+AA+AEFISMLIFVFAG GSGMAFNKLTDNG++TPAGL++
Sbjct  1    MPITSIAFGSPAEAGQPDALRAALAEFISMLIFVFAGEGSGMAFNKLTDNGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGHIT  RS+LYW+AQ LGSVVACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHITFIRSLLYWVAQCLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG ET AF LS+GV  WNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKLATGGQETSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_011089424.1| PREDICTED: aquaporin TIP1-3-like [Sesamum indicum]
Length=254

 Score =   244 bits (624),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+G+  E TQPDA+KAAVAEFISMLIFVFAG GSGMAF +LT  G +TPAGLIS
Sbjct  1    MPISRIAVGTPAEFTQPDAVKAAVAEFISMLIFVFAGEGSGMAFAQLTAGGPSTPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAFALFVAVS+ ANISGGHVNPAVTFGAFVGGHI+LFRS+LYWIAQLLGSVVACLL
Sbjct  61   ASIAHAFALFVAVSIAANISGGHVNPAVTFGAFVGGHISLFRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS+GV  WNA+VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFATGGLETSAFALSSGVTEWNALVFEIVMTFGLVYTVYATAVDPKKGD  170



>gb|EYU18933.1| hypothetical protein MIMGU_mgv1a012390mg [Erythranthe guttata]
Length=252

 Score =   244 bits (622),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + R+A+G+  E  QP+A+KAAVAEFISMLIFVFAG GSGMAF KLT  GA+TPAG+ +
Sbjct  1    MPISRVAVGTPAEVRQPEAIKAAVAEFISMLIFVFAGEGSGMAFAKLTGGGASTPAGMTA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHI+LFRS+LYWIAQLLGSVVACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHISLFRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L FATGGLET AF LS+GV  WNA+VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LNFATGGLETSAFALSSGVTVWNALVFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_009337569.1| PREDICTED: aquaporin TIP1-3 [Pyrus x bretschneideri]
Length=252

 Score =   244 bits (622),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+G+ GEA+ PDA++AA+AEF SMLIFVFAG GSGMAFNKLTDN + TP+GL++
Sbjct  1    MPINRIAVGTPGEASHPDAIRAALAEFFSMLIFVFAGEGSGMAFNKLTDNASTTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGG ET  F LS+GV+ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGWETAGFSLSSGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>gb|KHN21988.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   243 bits (621),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+  E  Q DALKAA+AEFISMLIFVFAG GSGMA+NKLTDNG+ATPAG+++
Sbjct  1    MPISRIAIGNPSEFGQADALKAALAEFISMLIFVFAGEGSGMAYNKLTDNGSATPAGVVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAF+GGHI+L R +LYWIAQLLGSVVACLL
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHISLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS GV   NA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGLETSAFSLSPGVGAANALVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|NP_001242707.1| uncharacterized protein LOC100777419 [Glycine max]
 gb|ACU17836.1| unknown [Glycine max]
Length=252

 Score =   243 bits (621),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+  E  Q DALKAA+AEFISMLIFVFAG GSGMA+NKLTDNG+ATPAG+++
Sbjct  1    MPISRIAIGNPSEFGQADALKAALAEFISMLIFVFAGEGSGMAYNKLTDNGSATPAGVVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
             +++HAFALFVAVSVGANISGGHVNPAVTFGAF+GGHI+L R +LYWIAQLLGSVVACLL
Sbjct  61   TSLSHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHISLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS GV   NA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGLETSAFSLSPGVGAANALVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_010554597.1| PREDICTED: aquaporin TIP1-3 [Tarenaya hassleriana]
Length=253

 Score =   243 bits (620),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+ GEA+ PDA+KAA AEF SM+IFVFAG GSGMA+NKLT NG ATP+GL++
Sbjct  1    MPINRIAIGAPGEASHPDAIKAAFAEFFSMVIFVFAGEGSGMAYNKLTGNGPATPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAF L VAVSVGANISGGHVNPAVTFGAFVGG+ITL R++LYWIAQLLGSVVACLL
Sbjct  61   ASLSHAFGLVVAVSVGANISGGHVNPAVTFGAFVGGNITLLRAILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK  TGGLET AF LS+GV PWNAVV EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKIGTGGLETSAFALSSGVTPWNAVVLEIVMTFGLVYTVYATAVDPKKGD  170



>gb|AGD98711.1| aquaporin protein 8 [Camellia sinensis]
Length=252

 Score =   243 bits (620),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+G+  EA+ PDALKAA+AEFISMLIFVFAG GSGMAFNKLTDNG+ TPAGL++
Sbjct  1    MPIYRIAVGTPREASHPDALKAALAEFISMLIFVFAGEGSGMAFNKLTDNGSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQ LGS+VACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQCLGSIVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS GV+ W A+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGLETSAFSLSIGVSVWKALVFEIVMTFGLVYTVYATAVDPKKGN  170



>gb|KHG16987.1| Aquaporin TIP1-3 -like protein [Gossypium arboreum]
Length=252

 Score =   243 bits (620),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+G+ GEA+ P  +KAA+AEF SMLIFVFAG GSGMA+NKLT+NG++TPAGL++
Sbjct  1    MPMNRIAVGTAGEASHPTVIKAALAEFFSMLIFVFAGEGSGMAYNKLTNNGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAF+GGHITL RS  YWIAQLLGSVVACLL
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLLRSFWYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGG+ET AF LS+GV+ WNA++FEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFATGGMETSAFALSSGVSTWNALIFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_002314201.1| nodulin-26 family protein [Populus trichocarpa]
 gb|ABK92822.1| unknown [Populus trichocarpa]
 gb|EEE88156.1| nodulin-26 family protein [Populus trichocarpa]
Length=252

 Score =   243 bits (619),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+  IA GS  E  Q DALKAA+AEFISMLIFVFAG GSGMAFNKLTD+G++TPAGL++
Sbjct  1    MAITSIAFGSPAEVGQSDALKAALAEFISMLIFVFAGEGSGMAFNKLTDDGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGHIT  RS+LYW+AQ LGSVVACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGHITFIRSILYWVAQCLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGGLET AF LS+GV  WNAVVFEIVMTFGLVYTVYATAVDPK+G+
Sbjct  121  LKLATGGLETSAFSLSSGVGVWNAVVFEIVMTFGLVYTVYATAVDPKRGD  170



>ref|XP_008233574.1| PREDICTED: aquaporin TIP1-3 [Prunus mume]
Length=252

 Score =   243 bits (619),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +IA+G+ GEA+ PDA++AA AEF S LIFVFAG GSGMAFNKLTDNG+ TP+GL++
Sbjct  1    MPINKIAVGTPGEASHPDAIRAAFAEFFSTLIFVFAGEGSGMAFNKLTDNGSTTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGG ET AF LS+GV+ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGWETAAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_011041956.1| PREDICTED: probable aquaporin TIP1-2 [Populus euphratica]
Length=252

 Score =   243 bits (619),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+  IA GS  E  Q DALKAA+AEFISMLIFVFAG GSGMAFNKLTD+G++TPAGL++
Sbjct  1    MAITSIAFGSPAEVGQIDALKAALAEFISMLIFVFAGEGSGMAFNKLTDDGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGHIT  RS+LYW+AQ LGSVVACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGHITFIRSILYWVAQCLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGGLET AF LS+GV  WNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKLATGGLETSAFSLSSGVGVWNAVVFEIVMTFGLVYTVYATAVDPKKGD  170



>gb|KDP44188.1| hypothetical protein JCGZ_05655 [Jatropha curcas]
Length=252

 Score =   242 bits (618),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIGS  E  Q DALKAA+AEFIS LIFVFAG GSGMAFNKLT +G+ TPAGL++
Sbjct  1    MPITSIAIGSPAEVGQADALKAALAEFISTLIFVFAGEGSGMAFNKLTSDGSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AH FALFVAVSVGANISGGHVNPAVTFGAFVGGHITL RS+LYW+ QLLGSVVACLL
Sbjct  61   ASLAHGFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLMRSILYWVGQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS+GV+ WNA+VFEIVMTFGLVYTVYATAVDP+KGN
Sbjct  121  LKFATGGLETSAFALSSGVSSWNALVFEIVMTFGLVYTVYATAVDPRKGN  170



>ref|XP_010243206.1| PREDICTED: aquaporin TIP1-1-like [Nelumbo nucifera]
Length=251

 Score =   242 bits (618),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIA+G   EAT PDALKAA+AEF S LIFVFAG GSGMAFNKLT NG+ATPAGL++
Sbjct  1    MPVSRIAVGRPEEATHPDALKAALAEFFSTLIFVFAGEGSGMAFNKLTSNGSATPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA++HAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LYWIAQLLGS VACLL
Sbjct  61   AALSHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL T AF LS+GV  WNA VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFATGGLTTSAFSLSSGVTVWNAFVFEIVMTFGLVYTVYATAVDPKKGS  170



>ref|XP_010033163.1| PREDICTED: aquaporin TIP1-3-like [Eucalyptus grandis]
 gb|KCW52713.1| hypothetical protein EUGRSUZ_J02074 [Eucalyptus grandis]
Length=251

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+GS  E  Q D LKAA+AEFISMLIFVFAG G+GMAFNK+TD+G+ TPAGL+ 
Sbjct  1    MPISRIAVGSPAEVGQADTLKAALAEFISMLIFVFAGEGAGMAFNKVTDDGSTTPAGLVQ  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITL RSV+YWIAQ  GSVVACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLARSVMYWIAQCAGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS+GV  WNA+VFEIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LKFATGGLETSAFSLSSGVTVWNALVFEIVMTFGLVYTVYATAIDPKKGN  170



>gb|AGD98716.1| aquaporin protein 13 [Camellia sinensis]
 gb|AGD98717.1| aquaporin protein 14 [Camellia sinensis]
Length=251

 Score =   242 bits (617),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+G+  EAT PDALKAA+AEFIS LIFVFAG GSGMAFNKLT +GAATP+G+IS
Sbjct  1    MPINRIAVGTREEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTGDGAATPSGVIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVS+GANISGGHVNPAVTFGAF+GGHITL R +LYWIAQLLGS+VACLL
Sbjct  61   AAIAHAFALFVAVSIGANISGGHVNPAVTFGAFIGGHITLLRGILYWIAQLLGSIVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+T G+ T AF LS+GV+ WNA VFEIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LKFSTNGMSTSAFSLSSGVSVWNAFVFEIVMTFGLVYTVYATALDPKKGN  170



>tpg|DAA33867.1| TPA_inf: aquaporin TIP1;4 [Gossypium hirsutum]
 gb|KHG03043.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
Length=251

 Score =   241 bits (616),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EATQPDALKAA+AEFIS LIFVFAGSGSGMAFNKLTDNGA TPAGL++
Sbjct  1    MPIRNIAVGRPEEATQPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAH   LFVAVSVGANISGGHVNPAVTFGAFVGG+I+L R +LYWIAQLLGS VACLL
Sbjct  61   ASIAHGLGLFVAVSVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFAT  +  PAFGLS+GV  WNAVVFEIVMTFGLVYTVYATA+DPKKG+
Sbjct  121  LKFATSDMTVPAFGLSSGVGVWNAVVFEIVMTFGLVYTVYATAIDPKKGD  170



>gb|KEH21895.1| tonoplast intrinsic protein [Medicago truncatula]
Length=252

 Score =   241 bits (616),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAIGS GEA QPDA++AA AEF SMLIFVFAG GSGMA++KLT+NG ATPAGLI+
Sbjct  1    MAIHRIAIGSPGEAGQPDAIRAAFAEFFSMLIFVFAGQGSGMAYSKLTNNGPATPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL RS+LYWIAQLLGSVVAC+L
Sbjct  61   ASLSHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRSILYWIAQLLGSVVACIL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG+ET AF LS+ ++ WNA++FEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKSATGGMETSAFALSSDISVWNALLFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_007218847.1| hypothetical protein PRUPE_ppa010364mg [Prunus persica]
 gb|EMJ20046.1| hypothetical protein PRUPE_ppa010364mg [Prunus persica]
Length=252

 Score =   241 bits (614),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +IA+G+ GEA+ PDA++AA AEF S LIFVFAG GSGMAFNKLT+NG+ TP+GL++
Sbjct  1    MPINKIAVGTPGEASHPDAIRAAFAEFFSTLIFVFAGEGSGMAFNKLTNNGSTTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGG ET AF LS+GV+ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGWETAAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_004492091.1| PREDICTED: aquaporin TIP1-3-like [Cicer arietinum]
Length=250

 Score =   240 bits (612),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAIGS GEA QPDA++AA AEF SMLIFVFAG GSGMA+NKLT+NG ATPAGLI+
Sbjct  1    MAIYRIAIGSPGEAGQPDAIRAAFAEFFSMLIFVFAGEGSGMAYNKLTNNGPATPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAF LFVAVSVGAN SGGHVNPAVTFGAF+GG+ITL RS+LYWIAQLLGSVVAC+L
Sbjct  61   ASLSHAFGLFVAVSVGANASGGHVNPAVTFGAFMGGNITLLRSILYWIAQLLGSVVACIL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG+ET AF +S+ ++ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKSATGGMETSAFAISSDISVWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_003518658.1| PREDICTED: aquaporin TIP1-3-like [Glycine max]
 gb|KHN27207.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   240 bits (612),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAIG+ GEA QPDA++AA AEF SM+IFVFAG GSGMA++KLT+NG ATPAGLI+
Sbjct  1    MAIYRIAIGTPGEAGQPDAIRAAFAEFFSMIIFVFAGEGSGMAYSKLTNNGPATPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL RS+LYWIAQLLGSVVAC+L
Sbjct  61   ASLSHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRSILYWIAQLLGSVVACIL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG+ET  F LS GV+ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKSATGGMETTGFSLSPGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_009141610.1| PREDICTED: aquaporin TIP1-1 [Brassica rapa]
Length=251

 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+GS  EAT+PDALKAA+AEFIS +IFVFAGSGSGMAFNKLT+NGA TPAGL++
Sbjct  1    MPIRNIAVGSPNEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   ASLAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL  PAFGLSAGV   NA+VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LKFATGGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAVDPKNGS  170



>gb|AAN05780.1| tonoplast intrinsic protein bobTIP26-2 [Brassica oleracea var. 
botrytis]
Length=251

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EAT+PDALKAA+AEFIS +IFVFAGSGSGMAFNKLT+NGA TP+GL++
Sbjct  1    MPIRNIAVGRTDEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL  PAFGLSAGV   NA+VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LKFATGGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAVDPKNGS  170



>ref|XP_002519456.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF42870.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=251

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EATQPDALKAA+AEFIS LIFVFAG GSGMAFNKLT+NGAATP+GL++
Sbjct  1    MPIRNIAVGHPHEATQPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGAATPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGL T AF LS+GV  WNA VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFSTGGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAVDPKKGS  170



>gb|ACB71282.1| tonoplast intrinsic protein [Tamarix hispida]
Length=252

 Score =   239 bits (610),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+GS  +A  PDAL+AA+AEFIS+LIFVFAG GSGMAFNKLTD+G+ATPAGL++
Sbjct  1    MPIRNIAVGSPADARHPDALRAALAEFISVLIFVFAGEGSGMAFNKLTDDGSATPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AH FALFVAVSVGANISGGHVNPAVTFGAF+GGHI+L RS+LYWIAQ LGSVVACLL
Sbjct  61   AALAHGFALFVAVSVGANISGGHVNPAVTFGAFIGGHISLLRSILYWIAQCLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL T AF LS+ V  WNA+V EIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGLTTSAFALSSDVTVWNALVLEIVMTFGLVYTVYATAVDPKKGN  170



>dbj|BAM44345.1| vacuolar aluminum transporter [Hydrangea macrophylla]
Length=252

 Score =   239 bits (610),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +IAIG+ GEA+ PDAL+AA+AEF SMLIFVFAG GSGMAFNK+T+N + TP+GLI+
Sbjct  1    MPIYKIAIGTPGEASNPDALRAALAEFFSMLIFVFAGEGSGMAFNKITNNSSTTPSGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+IT  RS+LYWIAQLLGSVVACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITFLRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS+ V+ WNA+VFEIVMTFGLVYTVYA AVDPKKGN
Sbjct  121  LKFATGGLETSAFALSSNVSVWNALVFEIVMTFGLVYTVYALAVDPKKGN  170



>ref|XP_002872891.1| GAMMA-TIP3/TIP1_3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49150.1| GAMMA-TIP3/TIP1_3 [Arabidopsis lyrata subsp. lyrata]
Length=252

 Score =   239 bits (609),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAIG+ GEA++PDA++AA AEF SM+IFVFAG GSGMA+ KLT +G ATP+GL++
Sbjct  1    MAINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GG+ITL R+VLYWIAQLLG+VVACLL
Sbjct  61   ASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAVLYWIAQLLGAVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK +TGG+ET AF LS GV PWNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKVSTGGMETAAFSLSHGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_006286822.1| hypothetical protein CARUB_v10003767mg [Capsella rubella]
 gb|EOA19720.1| hypothetical protein CARUB_v10003767mg [Capsella rubella]
Length=252

 Score =   238 bits (608),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAIG+ GEA++PDA++AA AEF SM+IFVFAG GSGMA+ KLT +G ATP+GL++
Sbjct  1    MAINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GG+ITL R++LYWIAQLLG+VVACLL
Sbjct  61   ASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK +TGG+ET AF LS GV PWNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKVSTGGMETSAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGD  170



>gb|KHN32099.1| Aquaporin TIP1-1 [Glycine soja]
Length=252

 Score =   238 bits (607),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+  E  Q DALKAA+AEFISMLIFVFAG GSGMA+NKLTDNG+ATPAG+++
Sbjct  1    MPISRIAIGNPSEFGQADALKAALAEFISMLIFVFAGEGSGMAYNKLTDNGSATPAGVVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAF+GGHI+L R +LYWIAQLLGSVVACLL
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHISLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFAT GLET AF LS GV   NA+VFEIVMTFGLVYTVYATAVDPKKG 
Sbjct  121  LKFATVGLETSAFSLSPGVGAANALVFEIVMTFGLVYTVYATAVDPKKGK  170



>ref|XP_010428353.1| PREDICTED: aquaporin TIP1-3 [Camelina sativa]
Length=252

 Score =   238 bits (607),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAIG+ GEA++PDA++AA AEF SM+IFVFAG GSGMA+ KLT +G ATP+GL++
Sbjct  1    MAINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GG+ITL R++LYWIAQLLG+VVACLL
Sbjct  61   ASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK +TGG+ET AF LS GV PWNAV+FEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKVSTGGMETSAFSLSYGVTPWNAVIFEIVMTFGLVYTVYATAVDPKKGD  170



>gb|AAB51393.2| tonoplast intrinsic protein bobTIP26-1 [Brassica oleracea var. 
botrytis]
Length=251

 Score =   238 bits (607),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EAT+PDALKAA+AEFIS +IFVFAGSGSGMAFNKLT+NGA TPAGL++
Sbjct  1    MPIRNIAVGRPDEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   ASLAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL  PAFGLSAGV   NA+VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LKFATGGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAVDPKNGS  170



>ref|XP_010422715.1| PREDICTED: aquaporin TIP1-3-like [Camelina sativa]
Length=252

 Score =   238 bits (607),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAIG+ GEA++PDA++AA AEF SM+IFVFAG GSGMA+ KLT +G ATP+GL++
Sbjct  1    MAINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GG+ITL R++LYWIAQLLG+VVACLL
Sbjct  61   ASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK +TGG+ET AF LS GV PWNAV+FEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKVSTGGMETSAFSLSYGVTPWNAVIFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_010098813.1| Aquaporin TIP1-1 [Morus notabilis]
 gb|EXB75901.1| Aquaporin TIP1-1 [Morus notabilis]
Length=251

 Score =   238 bits (607),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIG   EAT PDALKAA+AEFIS LIFVFAGSGSG+AFNKLTDNGA TP+GLIS
Sbjct  1    MPIRNIAIGGREEATHPDALKAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGS VA LL
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVAALL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF TGGL  P F LSAGV  WNAVVFEIV+TFGLVYTVYATAVDPKKGN
Sbjct  121  LKFVTGGLAVPTFNLSAGVGVWNAVVFEIVITFGLVYTVYATAVDPKKGN  170



>gb|ACI95283.1| tonoplast intrinsic protein [Sinapis arvensis]
Length=251

 Score =   238 bits (607),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EAT+PDALKAA+AEFIS +IFVFAGSGSGMAFNKLT+NGA TPAGL++
Sbjct  1    MPIRNIAVGRPEEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   ASLAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL  PAFGLSAGV   NA+VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LKFATGGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAVDPKNGS  170



>gb|KFK30698.1| hypothetical protein AALP_AA6G016000 [Arabis alpina]
Length=252

 Score =   238 bits (606),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAIG+ GEA++PDA++AA AEF SM+IFVFAG GSGMA+ KLT +G ATP+GLI+
Sbjct  1    MAINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGKATPSGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GG+ITL R++LYWIAQLLG+VVACLL
Sbjct  61   ASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK +TGG+ET AF LS GV PWNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKVSTGGMETGAFSLSHGVEPWNAVVFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_003552678.1| PREDICTED: aquaporin TIP1-3-like [Glycine max]
Length=252

 Score =   237 bits (605),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAIG+ GEA QPDA++AA AEF  M+IFVFAG GSGMA++KLT+NG ATPAGLI+
Sbjct  1    MAMHRIAIGTPGEAAQPDAIRAAFAEFFCMIIFVFAGEGSGMAYSKLTNNGPATPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL RS+LYWIAQL GSVVAC+L
Sbjct  61   ASLSHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRSILYWIAQLFGSVVACIL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG+ET  F LS GV+ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKHATGGMETSGFSLSPGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>emb|CDY53270.1| BnaCnng24720D [Brassica napus]
Length=251

 Score =   237 bits (605),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EAT+PDALKAA+AEFIS +IFVFAGSGSGMAFNKLT+NG  TP+GL++
Sbjct  1    MPIRNIAVGRADEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGGTTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL  PAFGLSAGV   NA+VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LKFATGGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAVDPKNGS  170



>tpg|DAA33869.1| TPA_inf: aquaporin TIP1;6 [Gossypium hirsutum]
Length=284

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  114  RIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglisaaia  293
             IA+G   EATQPDALKAA+AEFIS LIFVFAGSGSGMAFNKLTDNGA TPAGL++A+IA
Sbjct  5    NIAVGRPEEATQPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLVAASIA  64

Query  294  hafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLLLKFA  473
            H   LFVAVSVGANISGGHVNPAVTFGAFVGG+I+L R +LYWIAQLLGS VACLLLKFA
Sbjct  65   HGLGLFVAVSVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFA  124

Query  474  TGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            T  +  PAFGLS+GV  WNAVVFEIVMTFGLVYTVYATA+DPKKG+
Sbjct  125  TSDMTVPAFGLSSGVGVWNAVVFEIVMTFGLVYTVYATAIDPKKGD  170



>gb|ADO17795.1| tonoplast intrinsic protein [Jatropha curcas]
Length=252

 Score =   237 bits (604),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIG   EAT PDALKAA+AEFIS LIFVFAG GSGMAFNKLT+NGA TPAGL++
Sbjct  1    MPIRNIAIGHPQEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGATTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AH F LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   ASLAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGL T AF LS+GV  WNA VFEIVMTFGLVYTVYATA+DPKKG+
Sbjct  121  LKFSTGGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGS  170



>gb|ACP28878.1| tonoplast intrinsic protein [Gossypium hirsutum]
 tpg|DAA33866.1| TPA_inf: aquaporin TIP1;3 [Gossypium hirsutum]
 gb|KHG01699.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
Length=251

 Score =   237 bits (604),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EAT PDALKAA+AEFIS LIFVFAGSGSGMAFNKLTDNGA TPAGL++
Sbjct  1    MPIRNIAVGRPEEATHPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AH F LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   AALAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATG L  PAFGLS+GV   NA+VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFATGDLAVPAFGLSSGVGVSNALVFEIVMTFGLVYTVYATAVDPKKGS  170



>ref|XP_010267262.1| PREDICTED: aquaporin TIP1-1 [Nelumbo nucifera]
Length=252

 Score =   237 bits (604),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+G   EAT PDAL+AA+AEFIS LIFVFAG GSGMAFNKLT NG++TPAGL++
Sbjct  1    MPINRIAVGRPEEATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTSNGSSTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL T AF LS+GV+ WNA V EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFATGGLTTSAFSLSSGVSVWNAFVLEIVMTFGLVYTVYATAVDPKKGS  170



>gb|KHN13870.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAIG+ GEA QPDA++AA AEF  M+IFVFAG GSGMA++KLT+NG ATPAGLI+
Sbjct  1    MAMHRIAIGTPGEAGQPDAIRAAFAEFFCMIIFVFAGEGSGMAYSKLTNNGPATPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL RS+LYWIAQL GSVVAC+L
Sbjct  61   ASLSHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRSILYWIAQLFGSVVACIL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG+ET  F LS GV+ WNA+VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKHATGGMETSGFSLSPGVSVWNALVFEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_010922400.1| PREDICTED: aquaporin TIP1-3-like [Elaeis guineensis]
Length=252

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG  GEA+QPDALKAAVAEF SMLIFVFAG GSGMAF+KLT +G ATP+GL++
Sbjct  1    MPLNRIAIGEPGEASQPDALKAAVAEFFSMLIFVFAGEGSGMAFSKLTGDGPATPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFAL VAVSVGANISGGHVNPAVTFGAFVGG++TL R++LYWIAQLLGSVVAC+L
Sbjct  61   AALAHAFALIVAVSVGANISGGHVNPAVTFGAFVGGNVTLLRAILYWIAQLLGSVVACIL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGG++T AF +SA V P NA V EIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGMKTAAFAVSADVTPMNAFVLEIVMTFGLVYTVYATAVDPKKGN  170



>gb|KDP29188.1| hypothetical protein JCGZ_16577 [Jatropha curcas]
Length=252

 Score =   236 bits (603),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIG   EAT PDALKAA+AEFIS LIFVFAG GSGMAFNKLT+NGA TPAGL++
Sbjct  1    MPIRNIAIGHPQEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGATTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AH F LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   ASLAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGL T AF LS+GV  WNA VFEIVMTFGLVYTVYATA+DPKKG+
Sbjct  121  LKFSTGGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGS  170



>ref|XP_006396348.1| hypothetical protein EUTSA_v10028907mg [Eutrema salsugineum]
 gb|ESQ37801.1| hypothetical protein EUTSA_v10028907mg [Eutrema salsugineum]
Length=252

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAIG+ GEA+ PDA++AA AEF SM+IFVFAG GSGMA+ KLT +G ATP+GL++
Sbjct  1    MAINRIAIGTPGEASGPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GG+ITL R++LYWIAQLLG+VVACLL
Sbjct  61   ASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLMRAILYWIAQLLGAVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK +TGG+ET AF LS GV PWNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKVSTGGMETAAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_007027468.1| Aquaporin TIP1,6 [Theobroma cacao]
 gb|EOY07970.1| Aquaporin TIP1,6 [Theobroma cacao]
Length=251

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M    IA+G   EA  PDALKAA+AEFIS LIFVFAGSGS MA+NKLTDNGA+TPAGL++
Sbjct  1    MPFRNIAVGRPEEAAHPDALKAALAEFISTLIFVFAGSGSSMAYNKLTDNGASTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++A+ FALFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   ASLAYGFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFAT GL  PAFGLS+GV  WNA VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFATNGLSIPAFGLSSGVGVWNAFVFEIVMTFGLVYTVYATAVDPKKGS  170



>ref|XP_006837956.1| hypothetical protein AMTR_s00102p00061000 [Amborella trichopoda]
 gb|ERN00525.1| hypothetical protein AMTR_s00102p00061000 [Amborella trichopoda]
Length=250

 Score =   236 bits (602),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 151/170 (89%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG   EAT PDALKAA+AEFIS LIFVFAG GSGMAFNKLTDN + TPAGL++
Sbjct  1    MPISRIAIGRAEEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTDNASTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLG+VVAC L
Sbjct  61   ASLAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGAVVACGL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL T AFGLS GV+ WNA VFEIVMTFGLVYTVYATA+DPKKG+
Sbjct  121  LKFATGGLTTSAFGLS-GVSVWNAFVFEIVMTFGLVYTVYATAIDPKKGS  169



>emb|CAE53881.1| aquaporin [Ricinus communis]
Length=251

 Score =   236 bits (602),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EATQPDALKAA+AEFIS LIFVFAG GSGMAFNKLT+NG ATP+GL++
Sbjct  1    MPIRNIAVGHPHEATQPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGVATPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYW AQLLGS VACLL
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWFAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGL T AF LS+GV  WNA VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFSTGGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAVDPKKGS  170



>ref|NP_192056.1| aquaporin TIP1-3 [Arabidopsis thaliana]
 sp|O82598.1|TIP13_ARATH RecName: Full=Aquaporin TIP1-3; AltName: Full=Gamma-tonoplast 
intrinsic protein 3; Short=Gamma-TIP3; AltName: Full=Tonoplast 
intrinsic protein 1-3; Short=AtTIP1;3; Contains: RecName: 
Full=Aquaporin TIP1-3, N-terminally processed [Arabidopsis 
thaliana]
 gb|AAC62778.1| F11O4.1 [Arabidopsis thaliana]
 emb|CAB77717.1| putative water channel protein [Arabidopsis thaliana]
 gb|ABE66039.1| major intrinsic family protein/MIP family protein [Arabidopsis 
thaliana]
 gb|AEE82031.1| aquaporin TIP1-3 [Arabidopsis thaliana]
Length=252

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+ GEA++PDA++AA AEF SM+IFVFAG GSGMA+ KLT +G ATPAGL++
Sbjct  1    MPINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GG+ITL R++LYWIAQLLG+VVACLL
Sbjct  61   ASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK +TGG+ET AF LS GV PWNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKVSTGGMETAAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGD  170



>gb|ADB93067.1| aquaporin [Jatropha curcas]
Length=252

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIG   EAT PDALKAA+AEFIS LIFVFAG GSGMAFNKLT+NGA TPAGL++
Sbjct  1    MPIRNIAIGHPQEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGATTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AH F LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   ASLAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGL T AF LS+GV  WNA VFEIVMTFGLVYTVYATA+DPKKG+
Sbjct  121  LKFSTGGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGS  170



>tpg|DAA33868.1| TPA_inf: aquaporin TIP1;5 [Gossypium hirsutum]
 gb|KHG18573.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
Length=249

 Score =   236 bits (601),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EAT PDALKAA+AEFIS LIFVFAGSGSGMAFNKLTD GA TPAGL++
Sbjct  1    MPIRNIAVGRPEEATHPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDGGATTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AH FALFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   ASLAHGFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFAT GL  PAFGLS+GV   NA VFEIVMTFGLVYTVYATAVDPK+GN
Sbjct  121  LKFATSGLGVPAFGLSSGVGALNAFVFEIVMTFGLVYTVYATAVDPKRGN  170



>ref|XP_009358317.1| PREDICTED: aquaporin TIP1-3-like [Pyrus x bretschneideri]
Length=252

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIA+GS  E  Q DALKAA+AEFIS+LIFVFAG GSGMAFNKLTDN + TPAGL++
Sbjct  1    MAINRIAVGSAAEFGQADALKAALAEFISVLIFVFAGEGSGMAFNKLTDNASTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVS+ ANISGGHVNPAVTFGAF+GGHIT  R++LYWI+QL+G+VVACLL
Sbjct  61   AALAHAFALFVAVSIAANISGGHVNPAVTFGAFIGGHITFVRTILYWISQLIGAVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS+GV+ WNA+V EIV+TFGLVYTVYATAVDPKKG+
Sbjct  121  LKFATGGLETSAFSLSSGVSVWNALVLEIVITFGLVYTVYATAVDPKKGS  170



>gb|ABK28617.1| unknown [Arabidopsis thaliana]
Length=253

 Score =   236 bits (601),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+ GEA++PDA++AA AEF SM+IFVFAG GSGMA+ KLT +G ATPAGL++
Sbjct  1    MPINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GG+ITL R++LYWIAQLLG+VVACLL
Sbjct  61   ASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK +TGG+ET AF LS GV PWNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKVSTGGMETAAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGD  170



>gb|AAD31847.1|AF133531_1 water channel protein MipI [Mesembryanthemum crystallinum]
Length=252

 Score =   236 bits (601),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+PRI +GS  E + P ALKAA+AEFISMLIFVFAG GSGMAF+KLTD+G+ATPAGL++
Sbjct  1    MAIPRIDLGSPAEVSHPSALKAALAEFISMLIFVFAGQGSGMAFSKLTDDGSATPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++H FALFVAVSVGANISGGHVNPAVTFGAF+GG I+L R++LYWIAQ LG+VVACLL
Sbjct  61   ASLSHGFALFVAVSVGANISGGHVNPAVTFGAFLGGKISLPRTILYWIAQCLGAVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L FATGGL T AF LS+G+  WNA+VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LSFATGGLPTSAFALSSGITVWNALVFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|NP_181221.1| aquaporin TIP1-1 [Arabidopsis thaliana]
 sp|P25818.1|TIP11_ARATH RecName: Full=Aquaporin TIP1-1; AltName: Full=Aquaporin TIP; 
AltName: Full=Gamma-tonoplast intrinsic protein; Short=Gamma-TIP; 
AltName: Full=Tonoplast intrinsic protein 1-1; Short=AtTIP1;1; 
AltName: Full=Tonoplast intrinsic protein, root-specific 
RB7; Contains: RecName: Full=Aquaporin TIP1-1, N-terminally 
processed [Arabidopsis thaliana]
 gb|AAK43987.1|AF370172_1 putative tonoplast intrinsic protein gamma, aquaporin [Arabidopsis 
thaliana]
 emb|CAA45115.1| tonoplast intrinsic protein, gamma-TIP(Ara) [Arabidopsis thaliana]
 gb|AAA32806.1| tonoplast intrinsic protein [Arabidopsis thaliana]
 gb|AAD31569.1| putative aquaporin (tonoplast intrinsic protein gamma) [Arabidopsis 
thaliana]
 gb|AAL15240.1| putative aquaporin [Arabidopsis thaliana]
 gb|AEC09303.1| aquaporin TIP1-1 [Arabidopsis thaliana]
 prf||1908432B tonoplast intrinsic protein gamma
Length=251

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIG   EAT+PDALKAA+AEFIS LIFV AGSGSGMAFNKLT+NGA TP+GL++
Sbjct  1    MPIRNIAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACL+
Sbjct  61   AAVAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLI  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL  PAFGLSAGV   NA VFEIVMTFGLVYTVYATA+DPK G+
Sbjct  121  LKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGS  170



>ref|XP_008788076.1| PREDICTED: aquaporin TIP1-3-like [Phoenix dactylifera]
Length=252

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG  GEA++PDALKAA+AEF SMLIFVFAG GSGMAF+KLT +G ATP+GLI+
Sbjct  1    MPMNRIAIGEPGEASRPDALKAALAEFFSMLIFVFAGEGSGMAFSKLTGDGPATPSGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA++HAFAL VAVSVGANISGGHVNPAVTFGAFVGG+ITL R++LYW+AQLLGSVVAC+L
Sbjct  61   AALSHAFALIVAVSVGANISGGHVNPAVTFGAFVGGNITLLRAILYWMAQLLGSVVACIL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF TGG++T AF +SA V P NA VFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFGTGGMKTAAFAVSADVTPMNAFVFEIVMTFGLVYTVYATAVDPKKGN  170



>gb|AAM65100.1| putative aquaporin (tonoplast intrinsic protein gamma) [Arabidopsis 
thaliana]
Length=251

 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIG   EAT+PDALKAA+AEFIS LIFV AGSGSGMAFNKLT+NGA TP+GL++
Sbjct  1    MPIRNIAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACL+
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLI  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL  PAFGLSAGV   NA VFEIVMTFGLVYTVYATA+DPK G+
Sbjct  121  LKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGS  170



>gb|AAN40746.1| tonoplast intrinsic protein [Kandelia candel]
Length=252

 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +IA+G   EAT+PD LKAA+AEFIS LIFVFAG GSGMAFNKLTDNG+ TPAGLI+
Sbjct  1    MPIRQIAVGHPHEATRPDVLKAALAEFISTLIFVFAGEGSGMAFNKLTDNGSTTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAF LFV VSV ANISGGHVNPAVTFGAF+GG+ITL R +LYWI QLLGS VACLL
Sbjct  61   ASIAHAFGLFVGVSVSANISGGHVNPAVTFGAFIGGNITLLRGILYWIGQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGL T AF LS+GV+ WNA VFEIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LKFSTGGLTTSAFSLSSGVSVWNAFVFEIVMTFGLVYTVYATAIDPKKGN  170



>gb|KFK36559.1| hypothetical protein AALP_AA4G139100 [Arabis alpina]
Length=251

 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EAT+PDAL+AA+AEFIS +IFVFAGSGSGMAFNKLTDNGA TP+GL++
Sbjct  1    MPIRNIAVGRPDEATRPDALRAALAEFISTMIFVFAGSGSGMAFNKLTDNGATTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGGL  PAFGLSAGV   NA VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LKVATGGLVVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAVDPKAGS  170



>ref|XP_006294859.1| hypothetical protein CARUB_v10023912mg [Capsella rubella]
 gb|EOA27757.1| hypothetical protein CARUB_v10023912mg [Capsella rubella]
Length=251

 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EAT+PDALKAA+AEFIS LIFV AGSGSGMAFNKLT+NGA TP+GL++
Sbjct  1    MPIRNIAVGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSVVACL+
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLI  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL  PAFGLSAGV   NA VFEIVMTFGLVYTVYATA+DPK G+
Sbjct  121  LKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGS  170



>ref|XP_010505228.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
 ref|XP_010509432.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
 ref|XP_010516909.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
Length=251

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EAT+PDALKAA+AEFIS LIFV AGSGSGMAFNKLT+NGA TP+GL++
Sbjct  1    MPIRNIAVGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSVVACL+
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLI  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL  PAFGLSAGV   NA VFEIVMTFGLVYTVYATA+DPK G+
Sbjct  121  LKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGS  170



>gb|ACX37451.1| tonoplast intrinsic protein [Hevea brasiliensis]
Length=252

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EAT PDALKAA+AEFIS LIFVFAG GSGMAF+KLT+NGA TPAGL++
Sbjct  1    MPIRNIAVGHPQEATHPDALKAALAEFISTLIFVFAGEGSGMAFSKLTNNGATTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   ASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGL T  F LS+GV  WNA VFEIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LKFSTGGLTTAGFALSSGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGN  170



>ref|XP_007139266.1| hypothetical protein PHAVU_008G014900g [Phaseolus vulgaris]
 gb|ESW11260.1| hypothetical protein PHAVU_008G014900g [Phaseolus vulgaris]
Length=252

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAIGS  EA QPDA++AA AEF SM+IFVFAG GSGMA++KLT+NG ATP GLI+
Sbjct  1    MAMYRIAIGSPAEAGQPDAIRAAFAEFFSMIIFVFAGEGSGMAYSKLTNNGPATPVGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAF LFVAVSVGAN SGGHVNPAVTFGAFVGG+ITL RS+LYWIAQLLGSVVAC+L
Sbjct  61   ASLSHAFGLFVAVSVGANHSGGHVNPAVTFGAFVGGNITLLRSILYWIAQLLGSVVACIL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG+ET  F LS GV+ WNA++FE+VMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKSATGGMETSGFSLSPGVSVWNALIFEVVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_011004488.1| PREDICTED: aquaporin TIP1-1-like [Populus euphratica]
Length=252

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   E TQPDALKAA+AEFIS LIFVFAG GSGMAF+KLTD  + TPAGLI+
Sbjct  1    MPIRNIAVGHYHETTQPDALKAALAEFISTLIFVFAGEGSGMAFSKLTDGASNTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITLFR VLYWIAQLLGS VACLL
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLFRGVLYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF TGGLET AF LS+GV  WNA V EIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LKFVTGGLETSAFALSSGVGVWNAFVLEIVMTFGLVYTVYATAIDPKKGN  170



>ref|XP_006410854.1| hypothetical protein EUTSA_v10017134mg [Eutrema salsugineum]
 gb|ESQ52307.1| hypothetical protein EUTSA_v10017134mg [Eutrema salsugineum]
Length=251

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EAT+PDALKAA+AEFIS +IFVFAGSGSGMAFNKLT+NGA TP+GL++
Sbjct  1    MPIRNIAVGRPEEATKPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQL GSVVACLL
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLAGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL  PAFGLSAGV   NA VFEIVMTFGLVYTVYATA+DPK G+
Sbjct  121  LKFATGGLVVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGS  170



>tpg|DAA33870.1| TPA_inf: aquaporin TIP1;8 [Gossypium hirsutum]
Length=251

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  I +G   EAT PDALKAA+AEFIS LIFVFAGSGSGMAFNKLTDNGA TPAGL++
Sbjct  1    MPIRNIPVGRPEEATHPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AH F LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   AALAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATG L  PAFGLS+GV   NA+VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFATGDLAVPAFGLSSGVGVSNALVFEIVMTFGLVYTVYATAVDPKKGS  170



>ref|XP_009404620.1| PREDICTED: aquaporin TIP1-1-like [Musa acuminata subsp. malaccensis]
Length=252

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RI IG+  EA  P ALKAA+AEFIS+LIFVFAG GSGMAFNKLTD+G+ TPAGL+S
Sbjct  1    MPILRITIGTPEEARHPTALKAALAEFISVLIFVFAGQGSGMAFNKLTDDGSTTPAGLVS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AH F L+VAV+VGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   ASLAHGFGLYVAVAVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET  F LS+ V  WNA+VFEIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LKFATGGLETTPFSLSSSVTVWNALVFEIVMTFGLVYTVYATAIDPKKGN  170



>ref|XP_008357781.1| PREDICTED: aquaporin TIP1-3-like [Malus domestica]
Length=252

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIA+GS  E  Q DALKAA+AEFIS+LIFVFAG GSGMAFNKLTD+ + TPAGL++
Sbjct  1    MAINRIAVGSSAEFGQADALKAALAEFISVLIFVFAGEGSGMAFNKLTDSASTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVS+ ANISGGHVNPAVTFGAF+GGHIT  R++LYWIAQL+G+VVACLL
Sbjct  61   AALAHAFALFVAVSIAANISGGHVNPAVTFGAFIGGHITFVRTILYWIAQLIGAVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS+GV+ WNA+V EIV+TFGLVYTVYATAVDPKKG+
Sbjct  121  LKFATGGLETSAFSLSSGVSVWNALVLEIVITFGLVYTVYATAVDPKKGS  170



>ref|XP_002879627.1| tonoplast intrinsic protein gamma [Arabidopsis lyrata subsp. 
lyrata]
 emb|CAA51171.1| tonoplast intrinsic protein gamma (gamma-TIP) [Arabidopsis thaliana]
 gb|EFH55886.1| tonoplast intrinsic protein gamma [Arabidopsis lyrata subsp. 
lyrata]
Length=251

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EAT+PDALKAA+AEFIS LIFV AGSGSGMAFNKLT+NGA TP+GL++
Sbjct  1    MPIRNIAVGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACL+
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLI  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL  PAFGLSAGV   NA VFEIVMTFGLVYTVYATA+DPK G+
Sbjct  121  LKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGS  170



>ref|XP_009338345.1| PREDICTED: aquaporin TIP1-3-like [Pyrus x bretschneideri]
Length=252

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIA+GS  E  Q  ALKAA+AEFIS+LIFVFAG GSGMAFNKLTD+ + TPAGL++
Sbjct  1    MAINRIALGSAAEFGQAHALKAALAEFISVLIFVFAGEGSGMAFNKLTDSASTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVS+ ANISGGHVNPAVTFGAF+GGHIT  R++LYWIAQL+G+V+ACLL
Sbjct  61   AALAHAFALFVAVSIAANISGGHVNPAVTFGAFIGGHITFVRTILYWIAQLIGAVIACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS+GV  WNAVV EIV+TFGLVYTVYATAVDPKKGN
Sbjct  121  LKFATGGLETSAFSLSSGVGVWNAVVLEIVITFGLVYTVYATAVDPKKGN  170



>ref|XP_002322910.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
 gb|ABK93416.1| unknown [Populus trichocarpa]
 gb|ABK93851.1| unknown [Populus trichocarpa]
 gb|EEF04671.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
Length=252

 Score =   233 bits (595),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   E TQPDALKAA+AEFIS LIFVFAG GSGMAF+KLTD  + TPAGLI+
Sbjct  1    MPIRNIAVGHYRETTQPDALKAALAEFISTLIFVFAGEGSGMAFSKLTDGASNTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITLFR +LYWIAQLLGS VACLL
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLFRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF TGGLET AF LS GV  WNA V EIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LKFVTGGLETSAFALSTGVGVWNAFVLEIVMTFGLVYTVYATAIDPKKGN  170



>ref|XP_007142715.1| hypothetical protein PHAVU_007G010800g [Phaseolus vulgaris]
 gb|ESW14709.1| hypothetical protein PHAVU_007G010800g [Phaseolus vulgaris]
Length=252

 Score =   233 bits (595),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MAV RIAIGS  EA+ P A+KAAVAEF SMLIFVFAG GSGMA++KLT NG ATP GL+ 
Sbjct  1    MAVYRIAIGSPREASNPAAIKAAVAEFFSMLIFVFAGQGSGMAYSKLTGNGPATPDGLVL  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL +S+LYWIAQLLGSVVAC L
Sbjct  61   ASLSHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLKSILYWIAQLLGSVVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L + TGG+ET  F LS+GV+ WNA+VFEIVMTFGLVYTVYATAVDPK+GN
Sbjct  121  LNYTTGGMETTGFSLSSGVSVWNALVFEIVMTFGLVYTVYATAVDPKRGN  170



>ref|XP_009111380.1| PREDICTED: aquaporin TIP1-3 [Brassica rapa]
 emb|CDY69446.1| BnaA09g51590D [Brassica napus]
 emb|CDY07142.1| BnaCnng01570D [Brassica napus]
Length=252

 Score =   233 bits (595),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAIG+ GEA+  DA++AA AEF SM+IFVFAG GSGMA+ KLT +G ATP+GL++
Sbjct  1    MAINRIAIGTPGEASGRDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GG+ITL R++LYWIAQLLG+VVACLL
Sbjct  61   ASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK +TGG+ET AF LS GV PWNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKVSTGGMETAAFSLSHGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_010112915.1| Aquaporin TIP1-3 [Morus notabilis]
 gb|EXC35064.1| Aquaporin TIP1-3 [Morus notabilis]
Length=252

 Score =   233 bits (595),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+G+  E  Q DALKAA AEF SMLIFVFAG GSGMAFNKLTDNGA+TPAGLIS
Sbjct  1    MPISRIAVGNPAEIGQADALKAAAAEFFSMLIFVFAGEGSGMAFNKLTDNGASTPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITL RS+LYWIAQLLGSVVACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLIRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK +TGGLET AF LS GV  WNAVVFEIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKISTGGLETSAFALSDGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGN  170



>gb|AFH36344.1| aquaporin TIP2;2 [Quercus petraea]
Length=251

 Score =   233 bits (595),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EAT PDALKAA+AEFIS LIFVFAG GSGMAFNKLTDNG+ TPAGL++
Sbjct  1    MPIRNIAVGRPAEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFAT G+ T AF LS+GV  WNA V EIVMTFGLVYTVYATA+DPKKG+
Sbjct  121  LKFATNGMTTSAFSLSSGVGVWNAFVLEIVMTFGLVYTVYATAIDPKKGS  170



>emb|CAA38633.1| possible membrane channel protein [Arabidopsis thaliana]
Length=253

 Score =   233 bits (595),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIG   EAT+PDALKAA+AEFIS LIFV AGSGSGMAFNKLT+NGA TP+GL++
Sbjct  1    MPIRNIAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACL+
Sbjct  61   AAVAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLI  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL  P FGLSAGV   NA VFEIVMTFGLVYTVYATA+DPK G+
Sbjct  121  LKFATGGLAVPPFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGS  170



>emb|CDX83623.1| BnaC07g23630D [Brassica napus]
Length=253

 Score =   233 bits (595),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = +3

Query  102  MAVPRIAIGSV-GEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPagli  278
            M +  IAIG V GE T P AL+AA+AEFIS LIFVFAGSGSG+AFNKLTDNGA TP+GL+
Sbjct  1    MPIRNIAIGGVQGEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  279  saaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACL  458
            +AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSVVACL
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACL  120

Query  459  LLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LLKFATGGL  PAFGLSAGV   N  VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LLKFATGGLAVPAFGLSAGVESLNGFVFEIVMTFGLVYTVYATAVDPKNGS  171



>ref|XP_009421351.1| PREDICTED: probable aquaporin TIP1-2 [Musa acuminata subsp. malaccensis]
Length=252

 Score =   233 bits (594),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIG+ GEA+ PD +KA++AEFIS LIFVFAG GSGMAFNKLT++G+ TPAGL++
Sbjct  1    MPIGSIAIGAPGEASHPDTIKASLAEFISTLIFVFAGEGSGMAFNKLTNDGSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AH FALFVAVSVGANISGGHVNPAVTFGAF+GG+I+L R +LYWIAQLLGSVVACLL
Sbjct  61   ASLAHGFALFVAVSVGANISGGHVNPAVTFGAFLGGNISLIRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGGLET AF LS+ V+ WNAVVFEIVMTFGLVYTVYATAVDP+KG+
Sbjct  121  LKLATGGLETSAFSLSSDVSVWNAVVFEIVMTFGLVYTVYATAVDPRKGD  170



>ref|XP_007205767.1| hypothetical protein PRUPE_ppa010367mg [Prunus persica]
 gb|EMJ06966.1| hypothetical protein PRUPE_ppa010367mg [Prunus persica]
Length=252

 Score =   233 bits (594),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIAIG+  E  QPDALKAA+AEFIS+LIFVFAG GSGMAF+KLTD  + TPAGLI+
Sbjct  1    MPVSRIAIGNPAEFGQPDALKAALAEFISVLIFVFAGEGSGMAFSKLTDGASTTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVS+ ANISGGHVNPAVTFGAF+GG+I+L RSVLYWIAQLLG+V+ACLL
Sbjct  61   AALAHAFALFVAVSIAANISGGHVNPAVTFGAFIGGNISLVRSVLYWIAQLLGAVIACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+FATGGLET AF LS+GV+ WNAVV EIV+TFGLVYTVYATA+DPKKGN
Sbjct  121  LRFATGGLETSAFSLSSGVSVWNAVVLEIVITFGLVYTVYATALDPKKGN  170



>gb|ABK96489.1| unknown [Populus trichocarpa x Populus deltoides]
Length=252

 Score =   233 bits (593),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EATQPDAL+AA+AEFIS LIFVFAG GSGMAF KLTD  A TPAGLI+
Sbjct  1    MPIRNIAVGHYHEATQPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDGAANTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF TGGLET AF LS+GV  WNA V EIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFTTGGLETSAFALSSGVGVWNAFVLEIVMTFGLVYTVYATAVDPKKGN  170



>ref|XP_006381378.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
 gb|ABK93036.1| unknown [Populus trichocarpa]
 gb|ABK93934.1| unknown [Populus trichocarpa]
 gb|ERP59175.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
Length=252

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EATQPDAL+AA+AEFIS LIFVFAG GSGMAF KLTD  A TPAGLI+
Sbjct  1    MPIRNIAVGHYHEATQPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDGAANTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF TGGLET AF LS+GV  WNA V EIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFTTGGLETSAFALSSGVGVWNAFVLEIVMTFGLVYTVYATAVDPKKGN  170



>gb|ADU25490.1| tonoplastic intrinsic protein [Helianthemum almeriense]
Length=252

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EAT PDALKAA+AEFIS LIFVFAG GSGMAFNKLTDNG+ TPAGL++
Sbjct  1    MPIRNIAVGGPSEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFAT G  T AF LS+GV  WNA V EIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LKFATNGQTTSAFALSSGVGVWNAFVLEIVMTFGLVYTVYATALDPKKGN  170



>ref|XP_010037134.1| PREDICTED: aquaporin TIP1-1 [Eucalyptus grandis]
 gb|KCW48797.1| hypothetical protein EUGRSUZ_K02438 [Eucalyptus grandis]
Length=252

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   E   PDALKAA+AEF S LIFVFAG GSGMAFNKLTDNG+ TPAGL++
Sbjct  1    MPIRNIAVGRPEETYHPDALKAALAEFFSTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AH F LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   AALAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL T AF LS+GV+ WNA V EIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LKFATGGLTTSAFSLSSGVSVWNAFVLEIVMTFGLVYTVYATAIDPKKGN  170



>ref|XP_004497305.1| PREDICTED: aquaporin TIP1-3-like [Cicer arietinum]
Length=252

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAIGS  EA+ P A++AA AEF SMLIFVFAG GSGMA++KLT+NGAATP GLI 
Sbjct  1    MAIYRIAIGSPREASNPAAIRAAFAEFFSMLIFVFAGQGSGMAYSKLTNNGAATPEGLIV  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAF LFVAVSVGANISGGHVNPAVTFGAF+GG+IT  RS+LYWIAQLLGSV AC++
Sbjct  61   ASLSHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITFLRSILYWIAQLLGSVAACII  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L   TGG+ET AF LS+GV+ WNA+VFEIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LNSCTGGMETSAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAIDPKKGN  170



>ref|XP_011018806.1| PREDICTED: aquaporin TIP1-1 [Populus euphratica]
Length=252

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EAT+PDAL+AA+AEFIS LIFVFAG GSGMAF KLTD  A TPAGLI+
Sbjct  1    MPIRNIAVGHYHEATRPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDGAANTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF TGGLET AF LS+GV+ WNA V EIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKFTTGGLETSAFALSSGVSVWNAFVLEIVMTFGLVYTVYATAVDPKKGN  170



>dbj|BAJ98454.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIAIG+ GE + PD  +A VAEFISMLIFVFAGSGSGMAF KLTD GAATPAGLIS
Sbjct  1    MPVSRIAIGAPGELSHPDTFRAGVAEFISMLIFVFAGSGSGMAFGKLTDGGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+I+L ++V+YW+AQLLGSVVACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNISLLKAVVYWVAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG    AF LSAGV  WNAVVFEIVMTFGLVYTVYATAVDPK+G+
Sbjct  121  LKIATGGEAVGAFSLSAGVGVWNAVVFEIVMTFGLVYTVYATAVDPKRGD  170



>ref|XP_008366336.1| PREDICTED: probable aquaporin TIP1-2 [Malus domestica]
Length=252

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIA+GS  E  Q DALKAA+AEFIS+LIFVFAG GSGMAFNKLTD  + TPAGL++
Sbjct  1    MAINRIALGSTAEFGQADALKAALAEFISVLIFVFAGEGSGMAFNKLTDGASTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVS+ ANISGGHVNPAVTFGAF+GGHIT  R++LYWIAQL+G+V+ACLL
Sbjct  61   AALAHAFALFVAVSIAANISGGHVNPAVTFGAFIGGHITFVRTILYWIAQLIGAVIACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGGLET AF LS+GV  WNAVV EIV+TFGLVYTVYATAVDPKKG+
Sbjct  121  LKLATGGLETSAFSLSSGVGVWNAVVLEIVITFGLVYTVYATAVDPKKGS  170



>ref|XP_003536771.1| PREDICTED: aquaporin TIP1-3-like [Glycine max]
 gb|KHN37323.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MAV RIAIGS  EA+ P A++AA AEF SMLIFVFAG GSGMA++KLT NG ATP GL+ 
Sbjct  1    MAVYRIAIGSPREASNPAAIRAAFAEFFSMLIFVFAGQGSGMAYSKLTGNGPATPGGLVV  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++H F LFVAV+VGANISGGHVNPAVTFGAF+GG+ITL RS+LYWIAQLLGSVVAC+L
Sbjct  61   ASLSHTFGLFVAVAVGANISGGHVNPAVTFGAFIGGNITLLRSILYWIAQLLGSVVACIL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG+ET AF LS+GV+ WNA+VFEIVMTFGLV+TVYAT VDPKKGN
Sbjct  121  LKVATGGMETSAFSLSSGVSVWNALVFEIVMTFGLVHTVYATTVDPKKGN  170



>emb|CAN69323.1| hypothetical protein VITISV_032929 [Vitis vinifera]
Length=251

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA G   EAT+PDALKAA AEFI  LIFVFAG GSGMAFNKLTDNG+ TPAGL++
Sbjct  1    MPIRNIAFGRPEEATRPDALKAAFAEFICTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISG HVNPAVTFGAFVGG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   ASLAHAFALFVAVSVGANISGXHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+T G+ T AF LS+GV  WNA VFEIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LKFSTNGMTTSAFSLSSGVTVWNAFVFEIVMTFGLVYTVYATAIDPKKGN  170



>dbj|BAI66439.1| tonoplast intrinsic protein [Hordeum vulgare subsp. vulgare]
 gb|ADW85674.1| tonoplast intrinsic protein TIP1;3 [Hordeum vulgare]
 dbj|BAJ87160.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03480.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIAIG+ GE + PD  +A VAEFISMLIFVFAGSGSGMAF KLTD GAATPAGLIS
Sbjct  1    MPVSRIAIGAPGELSHPDTFRAGVAEFISMLIFVFAGSGSGMAFGKLTDGGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+I+L ++V+YW+AQLLGSVVACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNISLLKAVVYWVAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG    AF LSAGV  WNAVVFEIVMTFGLVYTVYATAVDPK+G+
Sbjct  121  LKIATGGEAVGAFSLSAGVGVWNAVVFEIVMTFGLVYTVYATAVDPKRGD  170



>ref|XP_010556519.1| PREDICTED: aquaporin TIP1-1 [Tarenaya hassleriana]
Length=252

 Score =   231 bits (590),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  I++G   EAT PDAL+AA+AEFI  LIFVFAGSGSGMAFNKLT++GA TP+GL++
Sbjct  1    MPIRNISVGRPEEATHPDALRAALAEFICTLIFVFAGSGSGMAFNKLTNDGATTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF TGGL  PAF LSAGV   NA VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFTTGGLAVPAFSLSAGVGTLNAFVFEIVMTFGLVYTVYATAVDPKKGS  170



>gb|KEH44484.1| tonoplast intrinsic protein [Medicago truncatula]
Length=252

 Score =   231 bits (589),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAIGS  EA+ P A++AA AEF SMLIFVFAG GSGMA+NKLT+NGAATP GLI 
Sbjct  1    MAIYRIAIGSPREASNPAAIRAAFAEFFSMLIFVFAGQGSGMAYNKLTNNGAATPEGLIV  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAF LFVAVSVGANISGGHVNPAVTFGAF+GG+IT  RS+LYWIAQLLG+VVAC+L
Sbjct  61   ASLSHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITFLRSILYWIAQLLGAVVACIL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L   T G+ET  F LS+GV+ WNA+VFEIVMTFGLVYTVYATA+DPK+GN
Sbjct  121  LNSCTAGMETSGFALSSGVSVWNALVFEIVMTFGLVYTVYATAIDPKRGN  170



>ref|XP_009152050.1| PREDICTED: aquaporin TIP1-2 [Brassica rapa]
Length=253

 Score =   231 bits (588),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEA-TQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPagli  278
            M +  IAIG V E  T P AL+AA+AEFIS LIFVFAGSGSG+AFNKLTDNGA TP+GL+
Sbjct  1    MPIRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  279  saaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACL  458
            +AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSVVACL
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACL  120

Query  459  LLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LLKFATGGL  PAFGLSAGV   N  VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LLKFATGGLAVPAFGLSAGVESLNGFVFEIVMTFGLVYTVYATAVDPKNGS  171



>dbj|BAA12711.1| VM23 [Raphanus sativus]
 emb|CDY13639.1| BnaA06g32840D [Brassica napus]
Length=253

 Score =   231 bits (588),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEA-TQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPagli  278
            M +  IAIG V E  T P AL+AA+AEFIS LIFVFAGSGSG+AFNKLTDNGA TP+GL+
Sbjct  1    MPIRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  279  saaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACL  458
            +AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSVVACL
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACL  120

Query  459  LLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LLKFATGGL  PAFGLSAGV   N  VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LLKFATGGLAVPAFGLSAGVESLNGFVFEIVMTFGLVYTVYATAVDPKNGS  171



>ref|XP_008222876.1| PREDICTED: probable aquaporin TIP1-2 [Prunus mume]
Length=252

 Score =   231 bits (588),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIA+G+  E  QPDALKAA+AEFIS+LIFVFAG GSGMAF+KLTD  + TPAGLI+
Sbjct  1    MPVSRIAVGNPAEFGQPDALKAALAEFISVLIFVFAGEGSGMAFDKLTDGASTTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVS+ ANISGGHVNPAVTFGA +GG+ITL RS+LYWIAQLLG+VVACLL
Sbjct  61   AALAHAFALFVAVSIAANISGGHVNPAVTFGALIGGNITLIRSILYWIAQLLGAVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+FATGGL+T AF LS+GV+ WNAVV EIV+TFGLVYTVYATA+DPKKGN
Sbjct  121  LRFATGGLKTSAFSLSSGVSVWNAVVLEIVITFGLVYTVYATALDPKKGN  170



>gb|AEW46425.1| putative tonoplast intrinsic protein 1.1 [Populus deltoides x 
Populus x canadensis]
Length=227

 Score =   229 bits (585),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  153  DALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglisaaiahafalfvavSVGA  332
            DAL+AA+AEFISMLIFVFAG GSGMAFNKLTDNG++TPAGL++A++AHAFALFVAVSVGA
Sbjct  1    DALRAALAEFISMLIFVFAGEGSGMAFNKLTDNGSSTPAGLVAASLAHAFALFVAVSVGA  60

Query  333  NISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLLLKFATGGLETPAFGLSA  512
            NISGGHVNPAVTFGAF+GGHIT  RS+LYWIAQ LGSVVACLLLK ATGG ET AF LS+
Sbjct  61   NISGGHVNPAVTFGAFIGGHITFIRSLLYWIAQCLGSVVACLLLKLATGGQETSAFALSS  120

Query  513  GVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            GV  WNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  GVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGD  153



>ref|XP_010685836.1| PREDICTED: aquaporin TIP1-3-like [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   230 bits (587),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MAVPRI IGS  EATQP ALKAA+AEFISMLIFVFAG GSGMAF KLT +G A+PAGL++
Sbjct  1    MAVPRIDIGSPAEATQPAALKAALAEFISMLIFVFAGEGSGMAFGKLTGDGPASPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA++H FALFVAVSV AN+SGGHVNPAVT GAF+GG I+ FR++LYWIAQ LG+VVACLL
Sbjct  61   AALSHGFALFVAVSVAANVSGGHVNPAVTLGAFLGGKISFFRTILYWIAQCLGAVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L F+TGGL T AF LS+GV  WNA+VFEIVMTFGLVYTVYATAVDPK+G+
Sbjct  121  LSFSTGGLPTSAFALSSGVTVWNALVFEIVMTFGLVYTVYATAVDPKRGD  170



>ref|XP_011077300.1| PREDICTED: aquaporin TIP1-1 [Sesamum indicum]
Length=252

 Score =   230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RI +G   EAT+PDALKAA+AEFIS L+FV+AG GSGMAFNKLT +GAATPAGLI+
Sbjct  1    MPISRITVGRTEEATRPDALKAALAEFISTLLFVYAGEGSGMAFNKLTSDGAATPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVS+ ANISGGHVNPAVTFGAFVGG+I+L R +LYWIAQLLG+VVACLL
Sbjct  61   AAVAHAFALFVAVSIAANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGAVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF TGGL T AF LS+GV+ WNA +FE VMTFGLVYTVYATAVDPK+G+
Sbjct  121  LKFTTGGLTTSAFALSSGVSVWNAFIFETVMTFGLVYTVYATAVDPKRGS  170



>gb|AEW46426.1| putative tonoplast intrinsic protein 1.2 [Populus deltoides x 
Populus x canadensis]
Length=227

 Score =   229 bits (584),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +3

Query  153  DALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglisaaiahafalfvavSVGA  332
            DALKAA+AEFISMLIFVFAG GSGMAFNKLTD+G++TPAGL++A++AHAFALFVAVSVGA
Sbjct  1    DALKAALAEFISMLIFVFAGEGSGMAFNKLTDDGSSTPAGLVAASLAHAFALFVAVSVGA  60

Query  333  NISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLLLKFATGGLETPAFGLSA  512
            NISGGHVNPAVTFGAF+GGHIT  RS+LYW+AQ LGSVVACLLLK ATGGLET AF LS+
Sbjct  61   NISGGHVNPAVTFGAFLGGHITFIRSILYWVAQCLGSVVACLLLKLATGGLETSAFSLSS  120

Query  513  GVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            GV  WNAVVFEIVMTFGLVYTVYATAVDPK+G+
Sbjct  121  GVGVWNAVVFEIVMTFGLVYTVYATAVDPKRGD  153



>ref|NP_001267926.1| aquaporin-like [Vitis vinifera]
 gb|ABH09330.1| putative aquaporin [Vitis vinifera]
Length=251

 Score =   230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M    IAIG   EAT+PDALKAA AEFI  LIFVFAG GSGMAFNKLTDNG+ TPAGL++
Sbjct  1    MPTRNIAIGRPEEATRPDALKAAFAEFICTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGAN SGGHVNPAVT GAFVGG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   ASLAHAFALFVAVSVGANTSGGHVNPAVTSGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+T G+ T AF LS+GV  WNA VFEIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LKFSTNGMTTSAFSLSSGVTVWNAFVFEIVMTFGLVYTVYATAIDPKKGN  170



>gb|EAZ15017.1| hypothetical protein OsJ_04959 [Oryza sativa Japonica Group]
Length=252

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIA+G+ GE + PD  KAAVAEFISMLIFVFAGSGSGMAF+KLTD G  TP+GLI+
Sbjct  1    MPVSRIAVGAPGELSHPDTAKAAVAEFISMLIFVFAGSGSGMAFSKLTDGGGTTPSGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHA ALFVAV+VGANISGGHVNPAVTFGAFVGG+I+L ++V+YW+AQLLGSVVACLL
Sbjct  61   ASLAHALALFVAVAVGANISGGHVNPAVTFGAFVGGNISLVKAVVYWVAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG    AF LSAGV  WNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKIATGGAAVGAFSLSAGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|NP_001045562.1| Os01g0975900 [Oryza sativa Japonica Group]
 sp|Q94CS9.1|TIP12_ORYSJ RecName: Full=Probable aquaporin TIP1-2; AltName: Full=Tonoplast 
intrinsic protein 1-2; Short=OsTIP1;2 [Oryza sativa Japonica 
Group]
 dbj|BAB63833.1| tonoplast membrane integral protein [Oryza sativa Japonica Group]
 dbj|BAC79358.1| tonoplast intrinsic protein [Oryza sativa Japonica Group]
 dbj|BAF07476.1| Os01g0975900 [Oryza sativa Japonica Group]
 dbj|BAG99409.1| unnamed protein product [Oryza sativa Japonica Group]
Length=252

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIA+G+ GE + PD  KAAVAEFISMLIFVFAGSGSGMAF+KLTD G  TP+GLI+
Sbjct  1    MPVSRIAVGAPGELSHPDTAKAAVAEFISMLIFVFAGSGSGMAFSKLTDGGGTTPSGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHA ALFVAV+VGANISGGHVNPAVTFGAFVGG+I+L ++V+YW+AQLLGSVVACLL
Sbjct  61   ASLAHALALFVAVAVGANISGGHVNPAVTFGAFVGGNISLVKAVVYWVAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG    AF LSAGV  WNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKIATGGAAVGAFSLSAGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGD  170



>gb|EMT32480.1| Putative aquaporin TIP1-2 [Aegilops tauschii]
Length=252

 Score =   229 bits (584),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIAIG+ GE + PD  +A VAEFISMLIFVFAGSGSGMAF KLTD GA TPAGLI+
Sbjct  1    MPVSRIAIGAPGELSHPDTFRAGVAEFISMLIFVFAGSGSGMAFGKLTDGGATTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+I+L ++V+YW+AQLLGSVVACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNISLLKAVVYWVAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG    AF LSAGV  WNAVVFEIVMTFGLVYTVYATAVDPK+G+
Sbjct  121  LKIATGGEAVGAFSLSAGVGVWNAVVFEIVMTFGLVYTVYATAVDPKRGD  170



>gb|ABI96817.1| tonoplast intrinsic protein [Triticum aestivum]
Length=252

 Score =   229 bits (584),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIAIG+ GE + PD  +A VAEFISMLIFVFAGSGSGMAF KLTD GA TPAGLI+
Sbjct  1    MPVRRIAIGAPGELSHPDTFRAGVAEFISMLIFVFAGSGSGMAFGKLTDGGATTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+I+L ++V+YW+AQLLGSVVACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNISLLKAVVYWVAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG    AF LSAGV  WNAVVFEIVMTFGLVYTVYATAVDPK+G+
Sbjct  121  LKIATGGEAVGAFSLSAGVGVWNAVVFEIVMTFGLVYTVYATAVDPKRGD  170



>ref|XP_010669827.1| PREDICTED: aquaporin TIP1-3-like [Beta vulgaris subsp. vulgaris]
Length=252

 Score =   229 bits (584),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + R+A+GS GEA  PDALKAA+AEF SM+IFVFAG GSGMAF++L DNG +   G+I+
Sbjct  1    MPLYRMAMGSPGEAGHPDALKAALAEFFSMIIFVFAGQGSGMAFSRLKDNGTSPSTGVIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAF L VAVSVGANISGGHVNPAVTFGAFVGGHIT  R++LYWI QLLGSVVAC L
Sbjct  61   ASLAHAFGLIVAVSVGANISGGHVNPAVTFGAFVGGHITFLRAILYWIGQLLGSVVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L FATGG+E  AF LS GV  WNA+VFEIVMTFGLVYTVYA AVDPKKGN
Sbjct  121  LHFATGGMEVSAFALSGGVTSWNALVFEIVMTFGLVYTVYALAVDPKKGN  170



>ref|XP_006428460.1| hypothetical protein CICLE_v10012553mg [Citrus clementina]
 ref|XP_006493539.1| PREDICTED: aquaporin TIP1-1-like [Citrus sinensis]
 gb|ESR41700.1| hypothetical protein CICLE_v10012553mg [Citrus clementina]
 gb|KDO40803.1| hypothetical protein CISIN_1g025548mg [Citrus sinensis]
Length=251

 Score =   229 bits (583),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EAT PDAL+AA+AEFIS LIFVFAG GSGMAFNKLT NGA TP+GL++
Sbjct  1    MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAV+VGANISGGHVNPAVTFGAFVGG+I+L R +LYWIAQLLGS VACLL
Sbjct  61   ASVAHAFALFVAVAVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF T G  T AF LS+GV  WNAVVFEIVMTFGLVYTVYATA+DPKKG+
Sbjct  121  LKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGS  170



>dbj|BAP33939.1| tonoplast intrinsic protein [Triticum aestivum]
Length=252

 Score =   228 bits (582),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIAIG+ GE + PD  +A VAEFISMLIFVFAGSGSGMAF KLTD GA TPAGLI+
Sbjct  1    MPVSRIAIGAPGELSHPDTFRAGVAEFISMLIFVFAGSGSGMAFGKLTDGGATTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+I+L ++V+YW+AQLLGSVVACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNISLVKAVVYWVAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG    AF LS GV  WNAVVFEIVMTFGLVYTVYATAVDPK+G+
Sbjct  121  LKIATGGEAVGAFSLSVGVGVWNAVVFEIVMTFGLVYTVYATAVDPKRGD  170



>gb|AJA04408.1| tonoplast intrinsic protein [Chorispora bungeana]
Length=252

 Score =   228 bits (582),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 148/171 (87%), Gaps = 1/171 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEA-TQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPagli  278
            M +  IAIG V E  T P AL+AA+AEFIS LIFVFAGSGSG+AFNKLTDNGA TP+GL+
Sbjct  1    MPIRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  279  saaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACL  458
            +AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R VLYWIAQLLGSVVAC 
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGVLYWIAQLLGSVVACF  120

Query  459  LLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LL+FATGGL  PAFGLS GV   NA VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LLQFATGGLPVPAFGLSEGVGSLNAFVFEIVMTFGLVYTVYATAVDPKNGS  171



>ref|XP_004971442.1| PREDICTED: probable aquaporin TIP1-2-like [Setaria italica]
Length=252

 Score =   228 bits (582),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RI++G+ GE + PD  KAAVAEFISMLIFVFAGSGSGMAF+KLT  GA TP+GLI+
Sbjct  1    MPVSRISVGAPGELSHPDTAKAAVAEFISMLIFVFAGSGSGMAFSKLTAGGATTPSGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHA ALFVAV+VGANISGGHVNPAVTFGAFVGG+ITL ++V+YW+AQLLGSVVACLL
Sbjct  61   AALAHALALFVAVAVGANISGGHVNPAVTFGAFVGGNITLLKAVVYWVAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG    AF LSAGV  WNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKIATGGEAVGAFSLSAGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_003565186.1| PREDICTED: probable aquaporin TIP1-2 [Brachypodium distachyon]
Length=252

 Score =   228 bits (582),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIAIGS GE + PD  KAAVAEFISMLIFVFAGSGSGMAF KLTD GA TP+GLI+
Sbjct  1    MPVSRIAIGSPGELSHPDTFKAAVAEFISMLIFVFAGSGSGMAFGKLTDGGATTPSGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+I+L ++++YW+AQLLGS  ACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNISLLKAIVYWVAQLLGSTAACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+ +TGG    AF LSAGV  WNAVVFEIVMTFGLVYTVYATAVDPK+G+
Sbjct  121  LQISTGGASVGAFSLSAGVGVWNAVVFEIVMTFGLVYTVYATAVDPKRGD  170



>gb|AHW81522.1| ECFP-tagged gamma TIP [Cloning vector pBullet-vac-c]
 gb|AHW81534.1| ECFP-tagged gamma TIP [Cloning vector pBullet-vac-n]
Length=494

 Score =   235 bits (600),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIG   EAT+PDALKAA+AEFIS LIFV AGSGSGMAFNKLT+NGA TP+GL++
Sbjct  1    MPIRNIAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACL+
Sbjct  61   AAVAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLI  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL  PAFGLSAGV   NA VFEIVMTFGLVYTVYATA+DPK G+
Sbjct  121  LKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGS  170



>emb|CDP00041.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   228 bits (581),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+ GEA+ PDALKAA AEF S LIFVFAG GSGMA NKLT+NG  T +GLI+
Sbjct  1    MPIYRIAIGTPGEASHPDALKAAAAEFFSTLIFVFAGEGSGMALNKLTNNGPQTASGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAI+HA+ALFVAVS+GANISGGHVNPAVTFGA +GG+ITL RS+ YWIAQLLGS VACLL
Sbjct  61   AAISHAYALFVAVSIGANISGGHVNPAVTFGALIGGNITLLRSISYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGGLETPAF LS+GV+  NA+V E VMTFGLVYTVYATAVDPKKGN
Sbjct  121  LKLATGGLETPAFTLSSGVSVGNALVLEAVMTFGLVYTVYATAVDPKKGN  170



>gb|AAD39372.1|AF118381_1 tonoplast intrinsic protein [Brassica napus]
Length=253

 Score =   228 bits (581),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 148/171 (87%), Gaps = 1/171 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEA-TQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPagli  278
            M    IAIG V E  T P AL+AA+AEFIS LIFVFAGSGSG+AFNKLTDNGA TP+GL+
Sbjct  1    MPTRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  279  saaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACL  458
            +AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVACL
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGLLYWIAQLLGSVVACL  120

Query  459  LLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LLKFATGGL  PAFGLSAGV   N  VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LLKFATGGLAVPAFGLSAGVESLNGFVFEIVMTFGLVYTVYATAVDPKNGS  171



>gb|ACJ53708.1| tonoplast intrinsic protein 1-1 [Lolium perenne]
Length=252

 Score =   228 bits (581),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIAIGS GE + PD  +A VAEFISMLIFVFAGSGSGMAF KL+D G  TPAGLI+
Sbjct  1    MPVSRIAIGSPGELSHPDTFRAGVAEFISMLIFVFAGSGSGMAFAKLSDGGPTTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHA ALFVAVSVGANISGGHVNPAVTFGAFVGG+I+L ++V+YW+AQLLGSVVACLL
Sbjct  61   AALAHALALFVAVSVGANISGGHVNPAVTFGAFVGGNISLLKAVVYWVAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG    AF LSAGV  WNAVVFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKIATGGEAVGAFSLSAGVGVWNAVVFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_006395549.1| hypothetical protein EUTSA_v10004806mg [Eutrema salsugineum]
 gb|ESQ32835.1| hypothetical protein EUTSA_v10004806mg [Eutrema salsugineum]
Length=253

 Score =   227 bits (579),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 148/171 (87%), Gaps = 1/171 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEA-TQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPagli  278
            M +  IAIG V E  T P AL+AA+AEFIS LIFVFAGSGSG+AFNKLTDNGA TP+GL+
Sbjct  1    MPIRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  279  saaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACL  458
            +AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVAC 
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQLLGSVVACF  120

Query  459  LLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LL FATGGL  PAFGLSAGV   NA VFEIVMTFGLVYTVYATA+DPK G+
Sbjct  121  LLTFATGGLAVPAFGLSAGVGSLNAFVFEIVMTFGLVYTVYATAIDPKNGS  171



>gb|AFQ98316.1| MIP6 [Eutrema halophilum]
Length=253

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 148/171 (87%), Gaps = 1/171 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEA-TQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPagli  278
            M +  IAIG V E  T P AL+AA+AEFIS LIFVFAGSGSG+AFNKLTDNGA TP+GL+
Sbjct  1    MPIRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  279  saaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACL  458
            +AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVAC 
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQLLGSVVACF  120

Query  459  LLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LL FATGGL  PAFGLSAGV   NA VFEIVMTFGLVYTVYATA+DPK G+
Sbjct  121  LLTFATGGLAVPAFGLSAGVGSLNAFVFEIVMTFGLVYTVYATAIDPKNGS  171



>ref|XP_009617954.1| PREDICTED: aquaporin TIP1-1 [Nicotiana tomentosiformis]
Length=248

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG   EAT PDALKAA+AEFIS LIFVFAGSGSG+AF+KLT  GA TPAGLI+
Sbjct  1    MPISRIAIGRPEEATHPDALKAALAEFISTLIFVFAGSGSGVAFSKLTGGGANTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   AAIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF TGGLE  AFGLS GV   NA+V EIVMTFGLVYTVYATAVDP KG+
Sbjct  121  LKFTTGGLEIGAFGLSDGVGVGNALVLEIVMTFGLVYTVYATAVDPNKGS  170



>ref|XP_006339093.1| PREDICTED: aquaporin TIP1-1-like [Solanum tuberosum]
Length=248

 Score =   226 bits (575),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG   EAT PDALKAA+AEFIS LIFVFAGSGSG+AF+KLT  GA TP GLI+
Sbjct  1    MPISRIAIGRTEEATHPDALKAALAEFISTLIFVFAGSGSGVAFSKLTGGGANTPTGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   AAIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF TGG+E  AF LS GV   NA+V EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFTTGGMEIGAFSLSDGVGVGNALVLEIVMTFGLVYTVYATAVDPKKGS  170



>gb|ADD59910.1| aquaporin [Chimonanthus praecox]
Length=269

 Score =   226 bits (577),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+G   EATQPDAL+AA+AEFI  LIFVFAG GSGMAFNKLT++   TPAGLI+
Sbjct  1    MPISRIAVGRPEEATQPDALRAALAEFICTLIFVFAGEGSGMAFNKLTNDAPNTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+I+LFR +LYWIAQLLG+ VACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNISLFRGILYWIAQLLGATVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF T G+ T AF LSAG + WNA V EIVMTFGLVYTVYATA+DPKKG+
Sbjct  121  LKFCTRGMTTSAFSLSAGESVWNAFVMEIVMTFGLVYTVYATAIDPKKGS  170



>ref|XP_004249473.1| PREDICTED: aquaporin TIP1-1 [Solanum lycopersicum]
Length=248

 Score =   225 bits (574),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG   EAT PDALKAA+AEFIS LIFVFAGSGSG+AF+KLT  GA TP GLI+
Sbjct  1    MPISRIAIGRREEATHPDALKAALAEFISTLIFVFAGSGSGVAFSKLTGGGANTPTGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   AAIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF TGG+E  AF LS GV   NA+V EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFTTGGMEIGAFSLSNGVGVGNALVLEIVMTFGLVYTVYATAVDPKKGS  170



>ref|XP_009129499.1| PREDICTED: aquaporin TIP1-2 [Brassica rapa]
 emb|CDY48983.1| BnaA02g28130D [Brassica napus]
 emb|CDY28539.1| BnaC02g36210D [Brassica napus]
Length=253

 Score =   226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 148/171 (87%), Gaps = 1/171 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEA-TQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPagli  278
            M    IAIG V E  T P AL+AA+AEFIS LIFVFAGSGSG+AFNKLTDNGA TP+GL+
Sbjct  1    MPTRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  279  saaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACL  458
            +AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGSVVAC 
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGLLYWIAQLLGSVVACF  120

Query  459  LLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LL+FATGGL  PAFGLSAGV   N +VFEIVMTFGLVYTVYATA+DPK G+
Sbjct  121  LLQFATGGLAVPAFGLSAGVGTLNGLVFEIVMTFGLVYTVYATAIDPKNGS  171



>ref|XP_009382161.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=250

 Score =   225 bits (574),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +IAIG+  EAT P ALKAA+AEFI   IFVFAG GSGMA+NKLT +GAATP GLI+
Sbjct  1    MPITQIAIGTTAEATHPTALKAALAEFICTFIFVFAGQGSGMAYNKLTSDGAATPEGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AH FALFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   AALAHGFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F+TGGLET  FGL+ GV+ W A+V EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LRFSTGGLETGTFGLT-GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGS  169



>ref|XP_009411359.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=250

 Score =   225 bits (573),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M   +IAIG   EAT P ALKAA+AEFI  LIFVFAG GSGMA+NKLT +GAATPAGLI+
Sbjct  1    MPFSQIAIGRPEEATHPSALKAALAEFICTLIFVFAGQGSGMAYNKLTSDGAATPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AH FALFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   AALAHGFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F+TGGLET  FGLS GV+ W A+V EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LRFSTGGLETGTFGLS-GVSAWEALVLEIVMTFGLVYTVYATAVDPKKGS  169



>ref|XP_008463494.1| PREDICTED: aquaporin TIP1-3-like isoform X2 [Cucumis melo]
Length=212

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +   GS GEA+QPDA+KA+ AEF SM+IF+FAG GSG+AF+KLTD G+ T +GLI 
Sbjct  1    MPIHKFTFGSPGEASQPDAIKASFAEFFSMIIFIFAGQGSGLAFDKLTDGGSTTASGLIM  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGA VGG+I+ FRS++YWIAQLLGSVVAC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGALVGGNISFFRSIMYWIAQLLGSVVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGG  TPAFGLS+GV+ WN  + E VMTFGLVYTVYATA+DPK+ N
Sbjct  121  LKFATGGKVTPAFGLSSGVSVWNGFILEAVMTFGLVYTVYATAIDPKREN  170



>ref|XP_009799741.1| PREDICTED: aquaporin TIP1-1 [Nicotiana sylvestris]
 ref|XP_009765894.1| PREDICTED: aquaporin TIP1-1 [Nicotiana sylvestris]
Length=248

 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG   EAT PDALKAA+AEFIS LIFVFAGSGSG+AF+KLT  GA TPAGLI+
Sbjct  1    MPISRIAIGRPEEATHPDALKAALAEFISTLIFVFAGSGSGVAFSKLTGGGANTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSVVAC L
Sbjct  61   AAIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF TGGLE   FGLS GV   NA+V EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFTTGGLEIGTFGLSDGVGVGNALVLEIVMTFGLVYTVYATAVDPKKGS  170



>ref|XP_008463495.1| PREDICTED: aquaporin TIP1-3-like isoform X3 [Cucumis melo]
Length=211

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +   GS GEA+QPDA+KA+ AEF SM+IF+FAG GSG+AF+KLTD G+ T +GLI 
Sbjct  1    MPIHKFTFGSPGEASQPDAIKASFAEFFSMIIFIFAGQGSGLAFDKLTDGGSTTASGLIM  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGA VGG+I+ FRS++YWIAQLLGSVVAC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGALVGGNISFFRSIMYWIAQLLGSVVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGG  TPAFGLS+GV+ WN  + E VMTFGLVYTVYATA+DPK+ N
Sbjct  121  LKFATGGKVTPAFGLSSGVSVWNGFILEAVMTFGLVYTVYATAIDPKREN  170



>gb|ACF78734.1| unknown [Zea mays]
 gb|AFW83841.1| aquaporin TIP1-2 [Zea mays]
Length=254

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIA+G+ GE + PD  KAAVAEFISMLIFVFAGSGSGMAF+KLTD GA TPAGLI+
Sbjct  1    MPVSRIAVGAPGELSHPDTAKAAVAEFISMLIFVFAGSGSGMAFSKLTDGGATTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHA ALFVAVSVGANISGGHVNPAVTFGAFVGG+I+L ++++YW+AQLLGSVVACLL
Sbjct  61   ASLAHALALFVAVSVGANISGGHVNPAVTFGAFVGGNISLLKALVYWVAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG    AF LSAGV   NAVV E+VMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKIATGGAAIGAFSLSAGVGAMNAVVLEMVMTFGLVYTVYATAVDPKKGD  170



>gb|AFK34456.1| unknown [Lotus japonicus]
Length=252

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +IAIG+  E  + DALKAA+AEFISMLIFVFAG GSGMA+NKLTDNG+ATPAG+++
Sbjct  1    MPISKIAIGNPSEFGKADALKAALAEFISMLIFVFAGQGSGMAYNKLTDNGSATPAGVVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAF+GGHITL R +LYWIAQLLGSVVACLL
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLIRGLLYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF LS+GV   NA+VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFATGGLETSAFSLSSGVGASNALVFEIVMTFGLVYTVYATAVDPKKGD  170



>gb|ACG35910.1| aquaporin TIP1.2 [Zea mays]
Length=254

 Score =   224 bits (570),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIA+G  GE + PD  KAAVAEFISMLIFVFAGSGSGMAF+KLTD GA TPAGLI+
Sbjct  1    MPVSRIAVGPPGELSHPDTAKAAVAEFISMLIFVFAGSGSGMAFSKLTDGGATTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHA ALFVAVSVGANISGGHVNPAVTFGAFVGG+I+L ++++YW+AQLLGSVVACLL
Sbjct  61   ASLAHALALFVAVSVGANISGGHVNPAVTFGAFVGGNISLLKALVYWVAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG    AF LSAGV   NAVV E+VMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKIATGGAAIGAFSLSAGVGAMNAVVLEMVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_009401846.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+  EAT P ALKAA+AEFI   IFVFAG GSGMA++K+T  GAATP GLI 
Sbjct  1    MPISRIAIGTTEEATHPSALKAALAEFICTFIFVFAGQGSGMAYSKMTSGGAATPTGLIM  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R VLYW+AQLLGS  ACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGVLYWVAQLLGSTAACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L FATGGLET  FGLS+GV  W A+V E VMTFGLVYTVYATAVDP++G+
Sbjct  121  LHFATGGLETGTFGLSSGVGVWEALVLEAVMTFGLVYTVYATAVDPRRGS  170



>ref|XP_010502579.1| PREDICTED: aquaporin TIP1-2 [Camelina sativa]
Length=253

 Score =   223 bits (569),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 146/171 (85%), Gaps = 1/171 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVG-EATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPagli  278
            M    IAIG V  E T PDAL+AA+AEFIS LIFVFAGSGSG+AFNKLT+NGA TP+GL+
Sbjct  1    MPTRNIAIGGVQQEVTHPDALRAALAEFISTLIFVFAGSGSGIAFNKLTNNGATTPSGLV  60

Query  279  saaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACL  458
            +AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSV AC 
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVAACF  120

Query  459  LLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LL FATGG   PAFGLSAGV   N +VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LLSFATGGEAIPAFGLSAGVGSLNGLVFEIVMTFGLVYTVYATAVDPKNGS  171



>ref|NP_001105029.1| aquaporin TIP1-2 [Zea mays]
 sp|Q9ATM0.1|TIP12_MAIZE RecName: Full=Aquaporin TIP1-2; AltName: Full=Tonoplast intrinsic 
protein 1-2; AltName: Full=ZmTIP1-2; AltName: Full=ZmTIP1;2 
[Zea mays]
 gb|AAK26767.1| tonoplast membrane integral protein ZmTIP1-2 [Zea mays]
 gb|ACG36209.1| aquaporin TIP1.2 [Zea mays]
Length=254

 Score =   223 bits (569),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIA+G+ GE + PD  KAAVAEFIS LIFVFAGSGSGMAF+KLTD GAATPAGLI+
Sbjct  1    MPVSRIAVGAPGELSHPDTAKAAVAEFISTLIFVFAGSGSGMAFSKLTDGGAATPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHA ALFVAVSVGANISGGHVNPAVTFGAFVGG+I+L ++++YW+AQLLGSVVACLL
Sbjct  61   ASLAHALALFVAVSVGANISGGHVNPAVTFGAFVGGNISLLKALVYWVAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGG    AF LSAGV   NAVV E+VMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKIATGGAALGAFSLSAGVGAMNAVVLEMVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_004505892.1| PREDICTED: aquaporin TIP1-3-like [Cicer arietinum]
Length=252

 Score =   223 bits (568),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIGS  E  + DALKAA+AEFISMLIFVFAG GSGMA+NKLT+NGAATPAGL++
Sbjct  1    MPISRIAIGSPSEFGKADALKAALAEFISMLIFVFAGEGSGMAYNKLTNNGAATPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAF+GGHITL R +LYWIAQLLGSVVACLL
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLIRGLLYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGGLET AF LS+GV   NA+VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKIATGGLETSAFSLSSGVGATNALVFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|NP_001284655.1| aquaporin TIP1-1 [Cucumis melo]
 gb|AGW99230.1| aquaporin TIP1-1 [Cucumis melo]
Length=250

 Score =   223 bits (567),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 150/170 (88%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIG   EAT PDALKA +AEFIS LIFVFAG GSG+AF+KLT++GAATPAGLIS
Sbjct  1    MPIRNIAIGRPEEATHPDALKAGLAEFISTLIFVFAGQGSGIAFSKLTNDGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R ++YWIAQLLGSVVACLL
Sbjct  61   ASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGIIYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF T GL T +FGLSAGV   NA VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFVT-GLPTGSFGLSAGVGELNAFVFEIVMTFGLVYTVYATAVDPKKGS  169



>ref|XP_004143284.1| PREDICTED: aquaporin TIP1-1-like [Cucumis sativus]
 gb|KGN48203.1| hypothetical protein Csa_6G448110 [Cucumis sativus]
Length=250

 Score =   223 bits (567),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 149/170 (88%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIG   EAT PDALKA +AEFIS LIFVFAG GSG+AFNKLT++GAATPAGLIS
Sbjct  1    MPIRNIAIGRPEEATHPDALKAGLAEFISTLIFVFAGQGSGIAFNKLTNDGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R ++YWIAQLLGSVVACLL
Sbjct  61   ASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGIIYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF T GL T +F LSAGV   NA VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFVT-GLPTGSFALSAGVGELNAFVFEIVMTFGLVYTVYATAVDPKKGS  169



>ref|XP_006645407.1| PREDICTED: probable aquaporin TIP1-2-like [Oryza brachyantha]
Length=254

 Score =   223 bits (568),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIA+G+ GE + PD  KAAVAEFISMLIFVFAGSGSGMAF+KLTD GA TPAGLIS
Sbjct  1    MPVSRIAVGAPGELSHPDTAKAAVAEFISMLIFVFAGSGSGMAFSKLTDGGATTPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHA ALFVAV+VGANISGGHVNPAVTFGAFVGG+I+L ++V+YW+AQLLGSVVACLL
Sbjct  61   ASLAHALALFVAVAVGANISGGHVNPAVTFGAFVGGNISLLKAVVYWVAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATA--VDPKKGN  611
            LK ATGG    AF LSAGV  WNAVVFEIVMTFGLVYTVYATA    PKKG+
Sbjct  121  LKIATGGEAVGAFSLSAGVGAWNAVVFEIVMTFGLVYTVYATAGGPQPKKGD  172



>ref|XP_008463493.1| PREDICTED: aquaporin TIP1-3-like isoform X1 [Cucumis melo]
Length=253

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +   GS GEA+QPDA+KA+ AEF SM+IF+FAG GSG+AF+KLTD G+ T +GLI 
Sbjct  1    MPIHKFTFGSPGEASQPDAIKASFAEFFSMIIFIFAGQGSGLAFDKLTDGGSTTASGLIM  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGA VGG+I+ FRS++YWIAQLLGSVVAC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGALVGGNISFFRSIMYWIAQLLGSVVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGG  TPAFGLS+GV+ WN  + E VMTFGLVYTVYATA+DPK+ N
Sbjct  121  LKFATGGKVTPAFGLSSGVSVWNGFILEAVMTFGLVYTVYATAIDPKREN  170



>ref|XP_004304478.1| PREDICTED: aquaporin TIP1-1-like [Fragaria vesca subsp. vesca]
Length=253

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   +A  PDALKA +AEFIS LIFVFAG GSGMAFNKLTD+GA TPAGL++
Sbjct  1    MPIQNIAVGRPEDAYHPDALKAGLAEFISTLIFVFAGEGSGMAFNKLTDDGATTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSV ANISGGHVNPAVTFGAFVGG+I+L R +LYWIAQLLGS VACLL
Sbjct  61   AALAHAFGLFVAVSVAANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF T G  T AF LS+GV  WNA VFEIVMTFGLVYTVYATAVDPK+G+
Sbjct  121  LKFVTNGQTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAVDPKRGS  170



>ref|XP_010425366.1| PREDICTED: aquaporin TIP1-2-like [Camelina sativa]
Length=253

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 146/171 (85%), Gaps = 1/171 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVG-EATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPagli  278
            M    IAIG V  E T PDAL+AA+AEFIS LIFVFAGSGSG+AFNKLT+NGA TP+GL+
Sbjct  1    MPTRNIAIGGVQQEVTHPDALRAALAEFISTLIFVFAGSGSGIAFNKLTNNGATTPSGLV  60

Query  279  saaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACL  458
            +AA+AHAF LFVAV+VGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSV AC 
Sbjct  61   AAALAHAFGLFVAVAVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVAACF  120

Query  459  LLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LL FATGG   PAFGLSAGV   N +VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LLSFATGGEAIPAFGLSAGVGSLNGLVFEIVMTFGLVYTVYATAVDPKNGS  171



>ref|XP_009613493.1| PREDICTED: probable aquaporin TIP1-1 [Nicotiana tomentosiformis]
Length=251

 Score =   221 bits (562),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +IA+GS  E  QP  LKAA+AEFI  LIFVFAG GSGMAFNKL+ +G ATP+GLIS
Sbjct  1    MPIHQIAVGSHEELRQPGTLKAALAEFICTLIFVFAGQGSGMAFNKLSVDGTATPSGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LY IAQLLGS VAC L
Sbjct  61   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYIIAQLLGSTVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+FATGG+ T AF LSAGV+ WNA VFEIVMTFGLVYTVYATA+DPKKG+
Sbjct  121  LEFATGGMSTGAFALSAGVSVWNAFVFEIVMTFGLVYTVYATAIDPKKGD  170



>ref|XP_004168293.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin TIP1-1-like [Cucumis 
sativus]
Length=250

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIG   EAT PDALKA +AEFIS L FVFAG GSG+AFNKLT++GAATPAGLIS
Sbjct  1    MPIRNIAIGRPEEATHPDALKAGLAEFISTLXFVFAGQGSGIAFNKLTNDGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R ++YWIAQLLGSVVACLL
Sbjct  61   ASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGIIYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF T GL T +F LSAGV   NA VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LKFVT-GLPTGSFALSAGVGELNAFVFEIVMTFGLVYTVYATAVDPKKGS  169



>dbj|BAF95576.1| tonoplast intrinsic protein [Nicotiana tabacum]
Length=251

 Score =   220 bits (561),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +IA+GS  E  QP  LKAA+AEFI  LIFVFAG GSGMAFNKL+ +G ATP+GLIS
Sbjct  1    MPINQIAVGSHEELRQPGTLKAALAEFICTLIFVFAGQGSGMAFNKLSVDGTATPSGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LY IAQLLGS VAC L
Sbjct  61   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYIIAQLLGSTVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+FATGG+ T AF LSAGV+ WNA VFEIVMTFGLVYTVYATA+DPKKG+
Sbjct  121  LEFATGGMSTGAFALSAGVSVWNAFVFEIVMTFGLVYTVYATAIDPKKGD  170



>gb|EMS45815.1| putative aquaporin TIP1-1 [Triticum urartu]
Length=201

 Score =   218 bits (556),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIA+GS  E  +  ALKAA+AEFIS LIFVFAG GSGMAF+KL+ +GAATPAGLIS
Sbjct  1    MPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LYWIAQLLGS  AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTAACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F+TGGL T  FGLS G+  W AVV EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LRFSTGGLPTGTFGLS-GIGAWEAVVLEIVMTFGLVYTVYATAVDPKKGS  169



>gb|AFQ23566.1| aquaporin TIP1 [Hedychium coronarium]
Length=249

 Score =   220 bits (560),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+  E T P  LKAAVAEFIS LIFVFAG GSG+AFNKLT +GA TPAGL++
Sbjct  1    MPISRIAIGTTEEVTHPTTLKAAVAEFISTLIFVFAGQGSGIAFNKLTSDGATTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAH F LFVAV+VGANISGGHVNPAVTFG FVGG+ITLFR++ YWIAQLLGS VACLL
Sbjct  61   ASIAHGFGLFVAVAVGANISGGHVNPAVTFGVFVGGNITLFRAIWYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F T GL T  FGLS GV  W AVV EIVMTFGLVYTVYATAVDPKKG 
Sbjct  121  LRFTT-GLATGTFGLSTGVGVWQAVVLEIVMTFGLVYTVYATAVDPKKGT  169



>gb|KFK33580.1| hypothetical protein AALP_AA5G032300 [Arabis alpina]
Length=253

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 146/171 (85%), Gaps = 1/171 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEA-TQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPagli  278
            M    IAIG V E  T P AL+AA+AEFIS LIFVFAGSGSG+AFNKLT+NGA TP+GL+
Sbjct  1    MPTRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTENGATTPSGLV  60

Query  279  saaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACL  458
            +AA+AHAF LFVAVSVGANISGGHVNPAVTFGA +GG+ITL R +LYWIAQLLGSVVAC 
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGALLGGNITLLRGILYWIAQLLGSVVACF  120

Query  459  LLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LL+FATGGL  PAFGL AGV   NA+V EIVMTFGLVYTVYATA+DPK G+
Sbjct  121  LLQFATGGLPVPAFGLGAGVGSLNALVLEIVMTFGLVYTVYATAIDPKNGS  171



>ref|XP_008801219.1| PREDICTED: probable aquaporin TIP1-1 [Phoenix dactylifera]
Length=250

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+  EAT P ALKAA+AEFIS LIFVFAG GSGMAF+KLT  GA TPAGLI+
Sbjct  1    MPISRIAIGTREEATHPSALKAALAEFISTLIFVFAGQGSGMAFSKLTGGGATTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSV ANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   AALAHAFGLFVAVSVAANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F+TGGL T  FGL+ GV+ W A+V EIVMTFGLVYTVYATA+DPK+G+
Sbjct  121  LRFSTGGLSTGTFGLT-GVSVWEALVLEIVMTFGLVYTVYATALDPKRGS  169



>ref|XP_003606614.1| Aquaporin TIP1-1 [Medicago truncatula]
 gb|AES88811.1| tonoplast intrinsic protein [Medicago truncatula]
Length=252

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+  E  + DALKAA+AEFISMLIFVFAG GSGMA+NKLT+NGAATPAGL++
Sbjct  1    MPISRIAIGNPSEFGKADALKAALAEFISMLIFVFAGEGSGMAYNKLTNNGAATPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAF+GGHITL R +LYWIAQLLGSVVACLL
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLIRGLLYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGGLET AF LS+GV   NA+VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LKIATGGLETSAFSLSSGVGATNALVFEIVMTFGLVYTVYATAVDPKNGS  170



>ref|XP_010514297.1| PREDICTED: aquaporin TIP1-2-like [Camelina sativa]
Length=253

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 145/171 (85%), Gaps = 1/171 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVG-EATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPagli  278
            M    IAIG V  E T PDAL+AA+AEFIS LIFVFAGSGSG+A+NKLT+ GA TP+GL+
Sbjct  1    MPTRNIAIGGVQQEVTHPDALRAALAEFISTLIFVFAGSGSGIAYNKLTNYGATTPSGLV  60

Query  279  saaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACL  458
            +AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGSV AC 
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVAACF  120

Query  459  LLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LL FATGG   PAFGLSAGV   N +VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LLSFATGGEAIPAFGLSAGVGSLNGLVFEIVMTFGLVYTVYATAVDPKNGS  171



>ref|NP_001048956.2| Os03g0146100 [Oryza sativa Japonica Group]
 dbj|BAF10870.2| Os03g0146100 [Oryza sativa Japonica Group]
Length=196

 Score =   217 bits (552),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 146/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+GS  E   P ALKAA+AEFIS LIFVFAG GSGMAF+KLT  GA TPAGLI+
Sbjct  1    MPIRNIAVGSHQEVYHPGALKAALAEFISTLIFVFAGQGSGMAFSKLTGGGATTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LYWIAQLLGS VAC L
Sbjct  61   AAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F+TGGL T  FGL+ GV+ W A+V EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LRFSTGGLATGTFGLT-GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGS  169



>ref|XP_009397029.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=250

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +PRIA+G+  EAT P  LKAA+AEFIS LIFVFAG GSGMAF+KLT   A TPAGLI+
Sbjct  1    MPIPRIAVGTQEEATHPGTLKAALAEFISTLIFVFAGQGSGMAFSKLTGGAATTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFG F+GG+ITL RS++YWIAQLLGS VACLL
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGVFIGGNITLLRSIIYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+++TGGL T +F LS GV+ W A+V EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LRYSTGGLSTGSFALS-GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGS  169



>ref|XP_004149825.1| PREDICTED: aquaporin TIP1-3-like [Cucumis sativus]
 gb|KGN51269.1| hypothetical protein Csa_5G505790 [Cucumis sativus]
Length=254

 Score =   218 bits (556),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +  +GS GEA+QPDA+KA+ AEF SM+IFVFAG GSG+AF+K+ D G +T A  + 
Sbjct  1    MPIHKFTLGSPGEASQPDAIKASFAEFFSMIIFVFAGQGSGLAFDKVADGGGSTTASGLI  60

Query  282  aaia-hafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACL  458
             A   HAFALFVAVSVGANISGGHVNPAVTFGA VGG+I+LFRS++YWIAQLLGSVVAC 
Sbjct  61   IASLGHAFALFVAVSVGANISGGHVNPAVTFGALVGGNISLFRSIMYWIAQLLGSVVACF  120

Query  459  LLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LLKFATGG  TPAFGLS+GV+ WN  +FE VMTFGLVYTVYATA+DPK+ N
Sbjct  121  LLKFATGGKVTPAFGLSSGVSVWNGFIFEAVMTFGLVYTVYATAIDPKREN  171



>ref|XP_009800738.1| PREDICTED: probable aquaporin TIP1-1 [Nicotiana sylvestris]
 emb|CAA69353.1| aquaporin 1 [Nicotiana tabacum]
Length=251

 Score =   218 bits (556),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +IA+GS  E  Q   LKAA+AEFI  LIFVFAG GSGMAFNKL+ +G ATPAGLIS
Sbjct  1    MPIHQIAVGSHEELRQSGTLKAALAEFICTLIFVFAGQGSGMAFNKLSADGTATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LY +AQLLGS VAC L
Sbjct  61   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYIVAQLLGSTVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+FATGG+ T AF LSAGV+ WNA VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LEFATGGMSTGAFALSAGVSVWNAFVFEIVMTFGLVYTVYATAVDPKKGD  170



>gb|AEV54105.1| putative tonoplast intrinsic protein 1.5 [Populus deltoides x 
Populus x canadensis]
Length=216

 Score =   217 bits (552),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +3

Query  153  DALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglisaaiahafalfvavSVGA  332
            DALKAA+AEFIS LIFVFAG GSGMAF+KLTD  + TPAGLI+AAIAHAFALFVAVSVGA
Sbjct  1    DALKAALAEFISTLIFVFAGEGSGMAFSKLTDGASNTPAGLIAAAIAHAFALFVAVSVGA  60

Query  333  NISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLLLKFATGGLETPAFGLSA  512
            NISGGHVNPAVTFGAF+GG+ITLFR +LYWIAQLLGS VACLLLKF TGGLET AF LS 
Sbjct  61   NISGGHVNPAVTFGAFIGGNITLFRGILYWIAQLLGSTVACLLLKFVTGGLETSAFALST  120

Query  513  GVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            GV  WNA V EIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  GVGVWNAFVLEIVMTFGLVYTVYATAIDPKKGN  153



>ref|NP_001234103.1| aquaporin-like [Solanum lycopersicum]
 dbj|BAD95790.1| similar to aquaporin [Solanum lycopersicum]
 dbj|BAO18632.1| tonoplast intrinsic protein 1;1 [Solanum lycopersicum]
Length=250

 Score =   218 bits (555),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 146/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +I IGS  E   P ALKAA+AEFIS LIFVFAG GSGMAFNKLTD G ATPAGLIS
Sbjct  1    MPINQITIGSHEELRHPGALKAALAEFISTLIFVFAGQGSGMAFNKLTD-GVATPAGLIS  59

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LY IAQLLGS  AC L
Sbjct  60   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYIIAQLLGSTAACAL  119

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+FATGG+ T +F LSAGV+ WNA VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  120  LEFATGGMSTGSFALSAGVSVWNAFVFEIVMTFGLVYTVYATAVDPKKGD  169



>ref|XP_006347203.1| PREDICTED: aquaporin TIP1-1-like [Solanum tuberosum]
Length=250

 Score =   218 bits (555),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 146/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +I IGS  E   P ALKAA+AEFIS LIFVFAG GSGMAFNKLTD G ATPAGLIS
Sbjct  1    MPINQITIGSHEELRHPGALKAALAEFISTLIFVFAGQGSGMAFNKLTD-GVATPAGLIS  59

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LY IAQLLGS  AC L
Sbjct  60   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYIIAQLLGSTAACAL  119

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+FATGG+ T +F LSAGV+ WNA VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  120  LEFATGGMSTGSFALSAGVSVWNAFVFEIVMTFGLVYTVYATAVDPKKGD  169



>ref|XP_002465859.1| hypothetical protein SORBIDRAFT_01g047140 [Sorghum bicolor]
 gb|EER92857.1| hypothetical protein SORBIDRAFT_01g047140 [Sorghum bicolor]
Length=250

 Score =   218 bits (555),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+G+  E   P ALKAA+AEFIS LIFVFAG GSGMAF+KLT  GA TP+GLI+
Sbjct  1    MPISRIAVGTHHEVYHPGALKAALAEFISTLIFVFAGQGSGMAFSKLTSGGATTPSGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LYW+AQLLGS VAC L
Sbjct  61   AAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F+TGGL T  FGL+ GV+ W AVV EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LRFSTGGLATGTFGLT-GVSVWEAVVMEIVMTFGLVYTVYATAVDPKKGS  169



>gb|AAG44946.1|AF290619_1 putative gamma TIP [Nicotiana glauca]
Length=251

 Score =   218 bits (555),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +IA+GS  E  Q   LKAA+AEFI  LIFVFAG GSGMAFNKL+ +G ATPAGLIS
Sbjct  1    MPINQIAVGSHEELRQSGTLKAALAEFICTLIFVFAGQGSGMAFNKLSADGVATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LY +AQLLGS VAC L
Sbjct  61   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYIVAQLLGSTVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+FATGG+ T AF LSAGV+ WNA VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LEFATGGMSTGAFALSAGVSVWNAFVFEIVMTFGLVYTVYATAVDPKKGD  170



>ref|XP_002876978.1| hypothetical protein ARALYDRAFT_484417 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53237.1| hypothetical protein ARALYDRAFT_484417 [Arabidopsis lyrata subsp. 
lyrata]
Length=253

 Score =   218 bits (554),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEAT-QPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPagli  278
            M    IAIG V E    P+AL+AA+AEFIS LIFVFAGSGSG+AFNKLTDNGA TP+GL+
Sbjct  1    MPTRNIAIGGVQEEVYHPNALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  279  saaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACL  458
            +AA+AHAF LFVAVSVGANISGGHVNPAVTFG  +GG+ITL R +LYWIAQLLGSV AC 
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACF  120

Query  459  LLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LL FATGG   PAFGLSAGV   NA+VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LLSFATGGEPIPAFGLSAGVGSLNALVFEIVMTFGLVYTVYATAVDPKNGS  171



>gb|EMT13047.1| Putative aquaporin TIP1-1 [Aegilops tauschii]
Length=213

 Score =   216 bits (550),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIA+GS  E  +  ALKAA+AEFIS LIFVFAG GSGMAF+KL+ +GAATPAGLIS
Sbjct  1    MPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LYW+AQLLGS  AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTAACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F+TGGL T  FGL+ G+  W AVV EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LRFSTGGLPTGTFGLT-GIGAWEAVVLEIVMTFGLVYTVYATAVDPKKGS  169



>ref|XP_006291577.1| hypothetical protein CARUB_v10017730mg, partial [Capsella rubella]
 gb|EOA24475.1| hypothetical protein CARUB_v10017730mg, partial [Capsella rubella]
Length=298

 Score =   219 bits (557),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVG-EATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPagli  278
            M    IAIG V  E T P AL+AA+AEFIS LIFVFAGSGSG+AFNKLTDNGA TP+GL+
Sbjct  46   MPTRNIAIGGVQQEITHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  105

Query  279  saaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACL  458
            SAA+AHAF LFVAV+VGANISGGHVNPAVTFG F+GG+ITL R +LYWIAQLLGSV AC 
Sbjct  106  SAALAHAFGLFVAVAVGANISGGHVNPAVTFGVFIGGNITLLRGILYWIAQLLGSVAACF  165

Query  459  LLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LL FATGG   PAFGLSAGV   NA VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  166  LLSFATGGEPIPAFGLSAGVGSLNAFVFEIVMTFGLVYTVYATAVDPKNGS  216



>gb|AAD10494.1| gamma-type tonoplast intrinsic protein [Triticum aestivum]
Length=250

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIA+GS  E  +  ALKAA+AEFIS LIFVFAG GSGMAF+KL+ +GAATPAGLIS
Sbjct  1    MPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LYWIAQLLGS  AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTAACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F+TGGL T  FGLS G+  W AVV EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LRFSTGGLPTGTFGLS-GIGAWEAVVLEIVMTFGLVYTVYATAVDPKKGS  169



>gb|ABK23010.1| unknown [Picea sitchensis]
Length=253

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +3

Query  117  IAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglisaaiah  296
            IA+G   EAT PDALKAA+AE IS LIFVFAG GSGMAF+KLT++ + TPAGL++ A+AH
Sbjct  6    IAVGRPEEATHPDALKAALAEGISTLIFVFAGEGSGMAFDKLTNDASTTPAGLVAVALAH  65

Query  297  afalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLLLKFAT  476
            A  LFVAV+VGANISGGHVNPAVTFGAFVGGHITL R +LYW AQL+G+ VACLLLKF T
Sbjct  66   ALGLFVAVAVGANISGGHVNPAVTFGAFVGGHITLLRGILYWFAQLIGATVACLLLKFTT  125

Query  477  GGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            GGL T AF LS+GV   NAVVFEIVMTFGLVYTVYATA+DPKKG+
Sbjct  126  GGLSTSAFSLSSGVGVGNAVVFEIVMTFGLVYTVYATAIDPKKGS  170



>ref|NP_189283.1| aquaporin TIP1-2 [Arabidopsis thaliana]
 sp|Q41963.2|TIP12_ARATH RecName: Full=Aquaporin TIP1-2; AltName: Full=Gamma-tonoplast 
intrinsic protein 2; Short=Gamma-TIP2; AltName: Full=Salt stress-induced 
tonoplast intrinsic protein; AltName: Full=Tonoplast 
intrinsic protein 1-2; Short=AtTIP1;2; Contains: RecName: 
Full=Aquaporin TIP1-2, N-terminally processed [Arabidopsis 
thaliana]
 gb|AAL16271.1|AF428341_1 AT3g26520/MFE16_3 [Arabidopsis thaliana]
 gb|AAL31945.1|AF419613_1 AT3g26520/MFE16_3 [Arabidopsis thaliana]
 dbj|BAB01832.1| salt-stress induced tonoplast intrinsic protein [Arabidopsis 
thaliana]
 gb|AAL84998.1| AT3g26520/MFE16_3 [Arabidopsis thaliana]
 dbj|BAH30470.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77174.1| aquaporin TIP1-2 [Arabidopsis thaliana]
Length=253

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEAT-QPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPagli  278
            M    IAIG V E    P+AL+AA+AEFIS LIFVFAGSGSG+AFNK+TDNGA TP+GL+
Sbjct  1    MPTRNIAIGGVQEEVYHPNALRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTPSGLV  60

Query  279  saaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACL  458
            +AA+AHAF LFVAVSVGANISGGHVNPAVTFG  +GG+ITL R +LYWIAQLLGSV AC 
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACF  120

Query  459  LLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LL FATGG   PAFGLSAGV   NA+VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LLSFATGGEPIPAFGLSAGVGSLNALVFEIVMTFGLVYTVYATAVDPKNGS  171



>ref|XP_010933183.1| PREDICTED: probable aquaporin TIP1-1 [Elaeis guineensis]
Length=250

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+  EAT P ALKAA AEFIS LIFVFAG GSGMAF+KLT  G+ TPAGL++
Sbjct  1    MPISRIAIGTRDEATHPSALKAAFAEFISTLIFVFAGQGSGMAFSKLTGGGSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGS  ACLL
Sbjct  61   ASLAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTAACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F TGGL T  FGL+ GV  W A V EIVMTFGLVYTVYATAVDPK+G+
Sbjct  121  LRFCTGGLATGTFGLT-GVTVWEAFVLEIVMTFGLVYTVYATAVDPKRGS  169



>ref|XP_010696310.1| PREDICTED: probable aquaporin TIP1-2 [Beta vulgaris subsp. vulgaris]
Length=254

 Score =   216 bits (551),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RI++G+  EA  PD L++ +AEFIS LIFVFAG GSGMAF KLT+  A TPAGL++
Sbjct  1    MPISRISVGTPDEARHPDTLRSGLAEFISTLIFVFAGQGSGMAFAKLTEGAANTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAFALFVAV+VGANISGGHVNPAVTFGAFVGG+ITL   ++YWIAQLLGSV AC L
Sbjct  61   ASIAHAFALFVAVAVGANISGGHVNPAVTFGAFVGGNITLLNGIVYWIAQLLGSVAACAL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGLET AF  +  V+ WNA+V EIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LKFATGGLETAAFACATDVSAWNALVMEIVMTFGLVYTVYATAIDPKKGN  170



>ref|XP_002459183.1| hypothetical protein SORBIDRAFT_03g047470 [Sorghum bicolor]
 gb|EES04303.1| hypothetical protein SORBIDRAFT_03g047470 [Sorghum bicolor]
Length=258

 Score =   216 bits (551),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 147/172 (85%), Gaps = 2/172 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAA--TPagl  275
            M V RIA+G+ GE + PD  KAAVAEFISMLIFVFAGSGSGMAF+KLT +G A  TP GL
Sbjct  1    MPVSRIAVGAPGELSHPDTAKAAVAEFISMLIFVFAGSGSGMAFSKLTTDGGASGTPCGL  60

Query  276  isaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVAC  455
            I+A++AHA ALFVAVSVGANISGGHVNPAVTFGAFVGG+++L ++V+YW+AQLLGSVVAC
Sbjct  61   IAASLAHALALFVAVSVGANISGGHVNPAVTFGAFVGGNMSLVKAVVYWVAQLLGSVVAC  120

Query  456  LLLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            +LLK ATGG     F LSAGV  WNAVV E+VMTFGLVYTVYATAVDP KG+
Sbjct  121  ILLKMATGGAAVGGFSLSAGVGAWNAVVLEMVMTFGLVYTVYATAVDPNKGD  172



>dbj|BAP33938.1| aquaporin [Triticum aestivum]
Length=250

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIA+GS  E  +  ALKAA+AEFIS LIFVFAG GSGMAF+KL+ +GAATPAGLIS
Sbjct  1    MPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LYWIAQLLGS  AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTAACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F+TGGL T  FGL+ G+  W AVV EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LRFSTGGLPTGTFGLT-GIGAWEAVVLEIVMTFGLVYTVYATAVDPKKGS  169



>ref|XP_003558815.1| PREDICTED: aquaporin TIP1-1 [Brachypodium distachyon]
Length=250

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 146/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + R+A+GS  E  Q  ALKAAVAEFIS LIFVFAG GSGMAFNKL   GAATPAGLIS
Sbjct  1    MPISRVAVGSHHEVYQAGALKAAVAEFISTLIFVFAGQGSGMAFNKLNAGGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITLFR +LYW+AQLLGS  AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITLFRGLLYWVAQLLGSTAACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F+TGGL T  FGL+ GV+ W A+V EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LRFSTGGLPTGTFGLT-GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGS  169



>ref|XP_002274538.1| PREDICTED: aquaporin TIP1-1 [Vitis vinifera]
Length=251

 Score =   216 bits (549),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 137/170 (81%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M   RIAIG   E  QPDALKAA+AEF   LIFVFAG GSGMAF+KLTD+G+ TPAGLI+
Sbjct  1    MPFLRIAIGQPQETYQPDALKAALAEFFGTLIFVFAGEGSGMAFSKLTDDGSTTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
             A+ H   LFVAVS   NISGGH+NPAVTFGAFVGG+ITL R +LYWIAQLLGS VACLL
Sbjct  61   EALGHGLGLFVAVSGACNISGGHINPAVTFGAFVGGNITLLRGILYWIAQLLGSAVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF T G+ T AF +S+GV  WNA V EIVMTFGLVYTVYATA+DP+KGN
Sbjct  121  LKFCTHGMTTSAFAISSGVTVWNAFVLEIVMTFGLVYTVYATAIDPRKGN  170



>gb|ACJ83265.1| unknown [Medicago truncatula]
Length=223

 Score =   214 bits (546),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+  E  + DALKAA+AEFISMLIFVFAG GSGMA+NKLT+NGAATPAGL++
Sbjct  1    MPISRIAIGNPSEFGKADALKAALAEFISMLIFVFAGEGSGMAYNKLTNNGAATPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAF+GGHITL R +LY IAQLLGSVVACLL
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLIRGLLYCIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK ATGGLET AF LS+GV   NA+VFEIVMTFGLVYTVYATAVDPK G+
Sbjct  121  LKIATGGLETSAFSLSSGVGATNALVFEIVMTFGLVYTVYATAVDPKNGS  170



>sp|P50156.1|TIP11_ORYSJ RecName: Full=Probable aquaporin TIP1-1; AltName: Full=Tonoplast 
intrinsic protein 1-1; Short=OsTIP1;1; AltName: Full=rTIP1 
[Oryza sativa Japonica Group]
 gb|AAK98737.1|AC090485_16 Tonoplast intrinsic protein [Oryza sativa Japonica Group]
 dbj|BAA05017.1| gamma-Tip [Oryza sativa]
 gb|ABF93961.1| aquaporin TIP-type, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY88537.1| hypothetical protein OsI_10010 [Oryza sativa Indica Group]
 gb|EAZ25574.1| hypothetical protein OsJ_09399 [Oryza sativa Japonica Group]
 gb|ABP48112.1| water channel protein [Oryza sativa Japonica Group]
 dbj|BAG96434.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86661.1| unnamed protein product [Oryza sativa Japonica Group]
Length=250

 Score =   215 bits (548),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 146/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+GS  E   P ALKAA+AEFIS LIFVFAG GSGMAF+KLT  GA TPAGLI+
Sbjct  1    MPIRNIAVGSHQEVYHPGALKAALAEFISTLIFVFAGQGSGMAFSKLTGGGATTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LYWIAQLLGS VAC L
Sbjct  61   AAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F+TGGL T  FGL+ GV+ W A+V EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LRFSTGGLATGTFGLT-GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGS  169



>ref|XP_008788358.1| PREDICTED: probable aquaporin TIP1-1 [Phoenix dactylifera]
Length=414

 Score =   220 bits (560),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 150/178 (84%), Gaps = 6/178 (3%)
 Frame = +3

Query  78   KKFCKFLEMAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGA  257
            +K C+FL     RIAIG+  EAT P+ALKAA+AEFI  LIFVFAG GSGMAF+KLT   A
Sbjct  162  RKKCRFL-----RIAIGTREEATHPNALKAALAEFICTLIFVFAGQGSGMAFSKLTGGSA  216

Query  258  ATPaglisaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLL  437
             TPAGL++A++AHAF LFVAVSVGANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLL
Sbjct  217  TTPAGLVAASLAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLL  276

Query  438  GSVVACLLLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            GS +AC LL+F+TGGL T  FGL+ G++ W A+V EIVMTFGLVYTVYATA+DPKKG+
Sbjct  277  GSTIACFLLRFSTGGLSTGTFGLT-GISVWEALVLEIVMTFGLVYTVYATALDPKKGS  333



>ref|XP_011089965.1| PREDICTED: aquaporin TIP1-1-like [Sesamum indicum]
Length=259

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 147/174 (84%), Gaps = 1/174 (1%)
 Frame = +3

Query  90   KFLEMAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPa  269
            ++  + + R+AIG+  E  QP A+KAAVAEFIS L+FVFAGSGSGMA+NK+T N   +P 
Sbjct  6    EYFNVPLRRVAIGNTEEFRQPGAVKAAVAEFISTLVFVFAGSGSGMAYNKITGNAPNSPE  65

Query  270  glisaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVV  449
            GLI AA+AHAF LFVAV++ ANISGGHVNPAVTFG FVGG+ITLFR +LY IAQLLGSVV
Sbjct  66   GLIVAAVAHAFGLFVAVAIAANISGGHVNPAVTFGLFVGGNITLFRGILYIIAQLLGSVV  125

Query  450  ACLLLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            ACLLL F TGGLETPAF LS GV+ W+A VFEIVMTFGLVYTVYATAVDPKKG+
Sbjct  126  ACLLLTFTTGGLETPAFSLS-GVSVWSAFVFEIVMTFGLVYTVYATAVDPKKGD  178



>gb|AAC62397.1| gamma tonoplast intrinsic protein 2 [Arabidopsis thaliana]
Length=253

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 142/169 (84%), Gaps = 1/169 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEAT-QPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPagli  278
            M    IAIG V E    P+AL+AA+AEFIS LIFVFAGSGSG+AFNK+TDNGA TP+GL+
Sbjct  1    MPTRNIAIGGVQEEVYHPNALRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTPSGLV  60

Query  279  saaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACL  458
            +AA++HAF LFVAVSVGANISGGHVNPAVTFG  +GG+ITL R +LYWIAQLLGSV AC 
Sbjct  61   AAALSHAFGLFVAVSVGANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACF  120

Query  459  LLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKK  605
            LL FATGG   PAFGLSAGV   NA+VFEIVMTFGLVYTVYATAVDPK 
Sbjct  121  LLSFATGGEPIPAFGLSAGVRSLNALVFEIVMTFGLVYTVYATAVDPKN  169



>ref|XP_009592994.1| PREDICTED: probable aquaporin TIP1-1 [Nicotiana tomentosiformis]
Length=251

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + +I IG+  E  QP ALKAA+AEFIS LIFVFAG GSGMAFNKLT +   TPAGLI+
Sbjct  1    MPIHQITIGTHEELRQPGALKAALAEFISTLIFVFAGQGSGMAFNKLTSDSTNTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVSV  NISGGHVNPAVTFGAF+GG+IT FR +LY IAQLLGS VACLL
Sbjct  61   AAVAHAFGLFVAVSVSFNISGGHVNPAVTFGAFIGGNITFFRGILYIIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGGL T AF L +G++ WNA+VFEIVMTFGLVYTVYATA+DPKKG 
Sbjct  121  LKFATGGLSTGAFALCSGLSVWNALVFEIVMTFGLVYTVYATAIDPKKGE  170



>gb|AEV54104.1| putative tonoplast intrinsic protein 1.6 [Populus deltoides x 
Populus x canadensis]
Length=215

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  156  ALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglisaaiahafalfvavSVGAN  335
            AL+AA+AEFIS LIFVFAG GSGMAF KLTD  A TPAGLI+AAIAHAFALFVAVSVGAN
Sbjct  1    ALRAALAEFISTLIFVFAGEGSGMAFAKLTDGAANTPAGLIAAAIAHAFALFVAVSVGAN  60

Query  336  ISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLLLKFATGGLETPAFGLSAG  515
            ISGGHVNPAVTFGAF+GG+ITL R +LYWIAQLLGS VACLLLKF TGGLET AF LS+G
Sbjct  61   ISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTVACLLLKFTTGGLETSAFALSSG  120

Query  516  VAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            V  WNA V EIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  VGVWNAFVLEIVMTFGLVYTVYATAVDPKKGN  152



>ref|XP_006649396.1| PREDICTED: probable aquaporin TIP1-1-like [Oryza brachyantha]
Length=250

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+GS  E   P ALKAA AEFIS LIFVFAG GSGMAF+KLT  GA TP+GLI+
Sbjct  1    MPIRNIAVGSHQEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFSKLTGGGATTPSGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LYW+AQLLGS VAC L
Sbjct  61   AAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F+TGGL T  FGL+ GV+ W A+V EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LRFSTGGLATGTFGLT-GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGS  169



>emb|CAA56553.1| gamma-TIP-like protein [Hordeum vulgare subsp. vulgare]
 dbj|BAI66434.1| tonoplast intrinsic protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90879.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 146/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M V RIA+GS  E  +  ALKAA+AEFIS LIFVFAG GSGMAF+KL+ +G ATPAGLIS
Sbjct  1    MPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LYW+AQLLGS  AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTAACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F+TGGL T  FGL+ G+  W AVV EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LRFSTGGLPTGTFGLT-GIGAWEAVVLEIVMTFGLVYTVYATAVDPKKGS  169



>ref|XP_004294610.1| PREDICTED: aquaporin TIP1-1-like [Fragaria vesca subsp. vesca]
Length=254

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+GS  E    DAL+AA+AEFIS LIFVFAGSGSG+AF +LTDNGA TPAGL++
Sbjct  1    MPISSIAVGSPSEFGSVDALRAALAEFISTLIFVFAGSGSGVAFAELTDNGATTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAV++ ANISGGHVNPAVTFGAF+GG+ITL RS+LYWIAQLLGSVVACLL
Sbjct  61   AAIAHAFALFVAVAIAANISGGHVNPAVTFGAFLGGNITLVRSILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKK  605
            LKFATGG+   AF LS GV  WNAVVFEIVMTFGLVYTVYATA+D + 
Sbjct  121  LKFATGGMTISAFSLSTGVGVWNAVVFEIVMTFGLVYTVYATALDKRS  168



>ref|XP_010456993.1| PREDICTED: aquaporin TIP1-3-like [Camelina sativa]
Length=238

 Score =   213 bits (541),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  147  QPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglisaaiahafalfvavSV  326
            +   +KAA AEF SM+IFVFAG GSGMA+ KLT +G ATP+GL++A+++HAFALFVAVSV
Sbjct  2    EKKKIKAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPSGLVAASLSHAFALFVAVSV  61

Query  327  GANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLLLKFATGGLETPAFGL  506
            GAN+SGGHVNPAVTFGAF+GG+ITL R++LYWIAQLLG+VVACLLLK +TGG+ET AF L
Sbjct  62   GANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLLLKVSTGGMETSAFSL  121

Query  507  SAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            S GV PWNAV+FEIVMTFGLVYTVYATAVDPKKG+
Sbjct  122  SYGVTPWNAVIFEIVMTFGLVYTVYATAVDPKKGD  156



>gb|KDP43963.1| hypothetical protein JCGZ_05430 [Jatropha curcas]
Length=254

 Score =   213 bits (542),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +3

Query  114  RIAIGSVGEA-TQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglisaai  290
            RIA+G   E  T P A+KAA+AEFIS  IFVFAG GSGMAFNKLTD+G++TPAG+I A++
Sbjct  7    RIAVGLPHEDITHPGAIKAALAEFISTAIFVFAGEGSGMAFNKLTDDGSSTPAGIIMASL  66

Query  291  ahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLLLKF  470
            AHAF LF+ V+  ANISGGHVNPAVTFGAFVGG+ITL R +LYWIAQLLGS VACLLLKF
Sbjct  67   AHAFGLFIGVATAANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLLKF  126

Query  471  ATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            +T G+ T AF LS+GV  WNA+VFEIVMTFGLVYTVYATA+DP+KG 
Sbjct  127  STHGMTTSAFALSSGVNVWNALVFEIVMTFGLVYTVYATAIDPRKGQ  173



>ref|XP_010911210.1| PREDICTED: probable aquaporin TIP1-1 [Elaeis guineensis]
Length=250

 Score =   213 bits (541),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIAIG+  EAT P AL+AA+AE IS LIFVFAG GSGMAF+KLT   + TPAGL++
Sbjct  1    MPISRIAIGTREEATHPSALRAALAELISTLIFVFAGQGSGMAFSKLTGGSSTTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAF LFVAVSV ANISGGHVNPAVTFGAFVGG+ITL R +LYW AQLLGS +AC L
Sbjct  61   ASLAHAFGLFVAVSVAANISGGHVNPAVTFGAFVGGNITLLRGILYWFAQLLGSTIACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F+TGGL T  FGL+ GV+ W A+V EIVMTFGLVYTVYATAVDPK+GN
Sbjct  121  LRFSTGGLSTGTFGLT-GVSVWEALVLEIVMTFGLVYTVYATAVDPKRGN  169



>gb|AGV54343.1| tonoplast intrinsic protein [Phaseolus vulgaris]
Length=232

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIG   EAT PD LKA +AEFIS LIFVFAGSGSG+AFNKLTDNGAATPAGLIS
Sbjct  1    MPIRNIAIGRPEEATNPDTLKAGLAEFISTLIFVFAGSGSGIAFNKLTDNGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+IT  R V+Y IAQLLGSVVA LL
Sbjct  61   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITFLRGVVYIIAQLLGSVVASLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L F T     PAFGLSAGV   NA+V EIVMTFGLVYTVYATA+DPK+G+
Sbjct  121  LAFVTSS-TVPAFGLSAGVGVGNALVLEIVMTFGLVYTVYATAIDPKRGS  169



>ref|XP_004307108.1| PREDICTED: aquaporin TIP1-1-like [Fragaria vesca subsp. vesca]
Length=254

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+GS  E    DAL+AA+AEFIS LIFVFAGSGSG+AF +LTDNGA TPAGL++
Sbjct  1    MPISSIAVGSPSEFGSADALRAALAEFISTLIFVFAGSGSGVAFAELTDNGATTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAV++ ANISGGHVNPAVTFG F+GG+ITL R +LYWIAQLLGSVVACLL
Sbjct  61   AAVAHAFALFVAVAIAANISGGHVNPAVTFGLFLGGNITLIRGILYWIAQLLGSVVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKK  605
            LK ATGGL   AF LS GV  WNAVVFEIVMTFGLVYTVYATAVD + 
Sbjct  121  LKLATGGLTISAFSLSTGVGAWNAVVFEIVMTFGLVYTVYATAVDKRS  168



>ref|NP_001104896.1| aquaporin TIP1-1 [Zea mays]
 sp|O64964.1|TIP11_MAIZE RecName: Full=Aquaporin TIP1-1; AltName: Full=Tonoplast intrinsic 
protein 1-1; AltName: Full=ZmTIP1-1; AltName: Full=ZmTIP1;1; 
Short=ZmTIP1 [Zea mays]
 gb|AAC09245.1| tonoplast intrinsic protein [Zea mays]
 gb|AAO86709.1| tonoplast water channel [Zea mays]
 gb|ACF85770.1| unknown [Zea mays]
 gb|ACF85962.1| unknown [Zea mays]
 gb|ACG23904.1| aquaporin TIP1.1 [Zea mays]
 gb|ACG24935.1| aquaporin TIP1.1 [Zea mays]
 gb|ACN31200.1| unknown [Zea mays]
 gb|ACN33327.1| unknown [Zea mays]
Length=250

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+GS  E   P ALKAA AEFIS LIFVFAG GSGMAF+KLT  G  TPAGLI+
Sbjct  1    MPINRIALGSHQEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFSKLTGGGPTTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LYW+AQLLGS VAC L
Sbjct  61   AAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F+TGG  T  FGL+ GV+ W A+V EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LRFSTGGQATGTFGLT-GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGS  169



>gb|AGV54720.1| water-selective transport intrinsic membrane protein 1 [Phaseolus 
vulgaris]
Length=217

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIG   EAT PD LKA +AEFIS LIFVFAGSGSG+AFNKLTDNGAATPAGLIS
Sbjct  1    MPIRNIAIGRPEEATNPDTLKAGLAEFISTLIFVFAGSGSGIAFNKLTDNGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+IT  R V+Y IAQLLGSVVA LL
Sbjct  61   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITFLRGVVYIIAQLLGSVVASLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L F T     PAFGLSAGV   NA+V EIVMTFGLVYTVYATA+DPK+G+
Sbjct  121  LAFVTSS-TVPAFGLSAGVGVGNALVLEIVMTFGLVYTVYATAIDPKRGS  169



>gb|AHI54565.1| tonoplastic intrinsic protein [Camellia japonica]
Length=258

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  93   FLEMAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPag  272
            +++    RIA+G+  EAT P ALKAA+AEFIS LIFVFAG GSGMAFNK+T     TP+G
Sbjct  5    YVDRITRRIAVGNREEATHPAALKAALAEFISTLIFVFAGQGSGMAFNKITHTSFTTPSG  64

Query  273  lisaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVA  452
            LI+AAIAHAF LFVAV++ ANISGGHVNPAVTFGA +GGHIT+ R +LYWIAQLLGSVVA
Sbjct  65   LIAAAIAHAFGLFVAVAISANISGGHVNPAVTFGACLGGHITILRGLLYWIAQLLGSVVA  124

Query  453  CLLLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            CLLLKF T G+ T AFGLS+GV  WN  V EIV+TFGLVYTVYATA+D KKG 
Sbjct  125  CLLLKFVTNGMTTTAFGLSSGVNVWNGFVMEIVLTFGLVYTVYATALDSKKGE  177



>ref|XP_007132109.1| hypothetical protein PHAVU_011G067200g [Phaseolus vulgaris]
 gb|ESW04103.1| hypothetical protein PHAVU_011G067200g [Phaseolus vulgaris]
Length=252

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA  RI IG+  E  Q DAL+AA+AEFISMLIFVFAG GSGMAFNKLT+N  AT  G+++
Sbjct  1    MANSRITIGNPSEFGQADALQAALAEFISMLIFVFAGEGSGMAFNKLTNNSPATADGVVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA++HAFALFVAVSVGANISGGHVNPAVTFGAF+GGHITL R +LYWIAQLLGSVVAC L
Sbjct  61   AALSHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLLRGLLYWIAQLLGSVVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKFATGG ET AF LS GV   NA+VFEIVMTFGLVYTVYATAVDPKKG 
Sbjct  121  LKFATGGSETSAFSLSPGVGSANALVFEIVMTFGLVYTVYATAVDPKKGQ  170



>ref|NP_001237062.1| uncharacterized protein LOC100527509 [Glycine max]
 gb|ACU16605.1| unknown [Glycine max]
Length=249

 Score =   211 bits (536),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   EAT PD LKAA+AEFIS  IFVFAGSGSG+A+N+LTDNGAATPAGLIS
Sbjct  1    MPIRNIAVGRPEEATHPDTLKAALAEFISTFIFVFAGSGSGIAYNRLTDNGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+IT  R ++Y IAQLLGS+VA LL
Sbjct  61   ASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITFLRGIVYVIAQLLGSIVASLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L F T     PAFGLSAGV   NA+V EIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LAFVTAS-TVPAFGLSAGVGVGNALVLEIVMTFGLVYTVYATAIDPKKGN  169



>dbj|BAB12722.1| gamma tonoplast intrinsic protein [Pyrus communis]
Length=252

 Score =   210 bits (535),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   E   PDAL+AA+AEFIS LIFVFAG GSGMAF KLTD+ A TPAGL++
Sbjct  1    MPIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAANTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVS+ ANISGGHVNPAVTFGAF+GG+I+L R +LYWIAQLLG+ VAC L
Sbjct  61   AALAHAFGLFVAVSISANISGGHVNPAVTFGAFIGGNISLLRGILYWIAQLLGATVACGL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF T G  T AF LS+GV  WNA VFEIVMTFGLVYTVYATA+DPK G+
Sbjct  121  LKFVTNGQTTAAFSLSSGVGVWNAFVFEIVMTFGLVYTVYATAIDPKNGS  170



>ref|XP_009349744.1| PREDICTED: aquaporin TIP1-1-like [Pyrus x bretschneideri]
Length=252

 Score =   210 bits (535),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   E   PDAL+AA+AEFIS LIFVFAG GSGMAF KLTD+ A TPAGL++
Sbjct  1    MPIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAANTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAVS+ ANISGGHVNPAVTFGAF+GG+I+L R +LYWIAQLLG+ VAC L
Sbjct  61   AALAHAFGLFVAVSISANISGGHVNPAVTFGAFIGGNISLLRGILYWIAQLLGATVACGL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF T G  T AF LS+GV  WNA VFEIVMTFGLVYTVYATA+DPK G+
Sbjct  121  LKFVTNGQTTAAFSLSSGVGVWNAFVFEIVMTFGLVYTVYATAIDPKNGS  170



>gb|ABK25915.1| unknown [Picea sitchensis]
Length=253

 Score =   210 bits (535),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  117  IAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglisaaiah  296
            +AIG   E T P ALKAA+AE IS LIFVFAG GSGMAF KLT + + TPAGL++ A+AH
Sbjct  6    VAIGRPEEVTHPTALKAALAELISTLIFVFAGEGSGMAFAKLTSDASTTPAGLVAVALAH  65

Query  297  afalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLLLKFAT  476
               LFVAV+VGANISGGHVNPAVTFGA VGGHITL R +LYWIAQL+G+ VACLLLK+ T
Sbjct  66   GLGLFVAVAVGANISGGHVNPAVTFGALVGGHITLLRGILYWIAQLIGATVACLLLKYTT  125

Query  477  GGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            GGL T AF LS+GV   NA+VFEIVMTFGLVYTVYATA+DPKKG 
Sbjct  126  GGLSTSAFSLSSGVGVGNALVFEIVMTFGLVYTVYATAIDPKKGT  170



>gb|AHJ09607.1| aquaporin protein 26 [Camellia sinensis]
Length=258

 Score =   210 bits (535),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  93   FLEMAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPag  272
            +++    RIA+G+  EAT P ALKAA+AEFIS LIFVFAG GSGMAFNK+T +   TP+G
Sbjct  5    YVDRITRRIAVGNREEATHPAALKAALAEFISTLIFVFAGQGSGMAFNKITHSSFTTPSG  64

Query  273  lisaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVA  452
            LI+AAIAHAF LFVAV++ ANISGGHVNPAVTFGA +GGHIT+ R +LYWIAQLLGSVVA
Sbjct  65   LIAAAIAHAFGLFVAVAISANISGGHVNPAVTFGACLGGHITILRGLLYWIAQLLGSVVA  124

Query  453  CLLLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            CLLLKF T G+ T AFGLS+G+  WN  V EIV+TFGLVYTVYATA+D KKG 
Sbjct  125  CLLLKFVTNGMTTTAFGLSSGLNVWNGFVMEIVLTFGLVYTVYATALDSKKGE  177



>ref|XP_004985722.1| PREDICTED: aquaporin TIP1-1-like [Setaria italica]
Length=249

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 145/170 (85%), Gaps = 2/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+GS  E   P ALKAA AEFIS LIFVFAG GSGMAF+KL+  G+ TP GLI+
Sbjct  1    MPINRIAVGSHEEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFSKLSPGGS-TPTGLIA  59

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITLFR +LYWIAQLLGS VAC L
Sbjct  60   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYWIAQLLGSTVACFL  119

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F+TGGL T  FGL+ G++ W A+V EIVMTFGLVYTVYATAVDPKKG+
Sbjct  120  LRFSTGGLPTGTFGLT-GISVWEALVLEIVMTFGLVYTVYATAVDPKKGS  168



>ref|XP_007162793.1| hypothetical protein PHAVU_001G181100g [Phaseolus vulgaris]
 gb|AFW90515.1| water-selective transport intrinsic membrane protein 1 [Phaseolus 
vulgaris]
 gb|AGV54305.1| water-selective transport intrinsic membrane protein 1 [Phaseolus 
vulgaris]
 gb|AGV54392.1| nodulin-26 [Phaseolus vulgaris]
 gb|AGV54457.1| tonoplast intrinsic protein [Phaseolus vulgaris]
 gb|AHA84233.1| tonoplast intrinsic protein [Phaseolus vulgaris]
 gb|ESW34787.1| hypothetical protein PHAVU_001G181100g [Phaseolus vulgaris]
Length=250

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIG   EAT PD LKA +AEFIS LIFVFAGSGSG+AFNKLTDNGAATPAGLIS
Sbjct  1    MPIRNIAIGRPEEATNPDTLKAGLAEFISTLIFVFAGSGSGIAFNKLTDNGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+IT  R V+Y IAQLLGSVVA LL
Sbjct  61   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITFLRGVVYIIAQLLGSVVASLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L F T     PAFGLSAGV   NA+V EIVMTFGLVYTVYATA+DPK+G+
Sbjct  121  LAFVTSS-TVPAFGLSAGVGVGNALVLEIVMTFGLVYTVYATAIDPKRGS  169



>gb|AHA84270.1| nodulin-26 [Phaseolus vulgaris]
Length=250

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIG   EAT PD LKA +AEFIS LIFVFAGSGSG+AFNKLTDNGAATPAGLIS
Sbjct  1    MPIRNIAIGRPEEATNPDTLKAGLAEFISTLIFVFAGSGSGIAFNKLTDNGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAF+GG+IT  R V+Y IAQLLGSVVA LL
Sbjct  61   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITFLRGVVYIIAQLLGSVVASLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L F T     PAFGLSAGV   NA+V EIVMTFGLVYTVYATA+DPK+G+
Sbjct  121  LAFVTSS-TVPAFGLSAGVGVGNALVLEIVMTFGLVYTVYATAIDPKRGS  169



>gb|AAT65835.2| tonoplast intrinsic protein gamma [Salicornia herbacea]
Length=254

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+G+  +A  P+ LKA +AEFIS LIFV+AG GSGMAF KLT   A TPAGL++
Sbjct  1    MPINRIAVGTTEDARHPNTLKAGLAEFISTLIFVYAGQGSGMAFAKLTAGAANTPAGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AAI+H FALFVAV+VGANISGGHVNPAVTFGAF+GG+ITL   ++YWIAQLLGS VACLL
Sbjct  61   AAISHGFALFVAVAVGANISGGHVNPAVTFGAFIGGNITLLNGIVYWIAQLLGSTVACLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LKF+TGGL+T AF L  G   W A V EIVMTFGLVYTVYATA+DPKKGN
Sbjct  121  LKFSTGGLQTSAFALCEGETVWGAFVMEIVMTFGLVYTVYATALDPKKGN  170



>ref|XP_003555811.1| PREDICTED: aquaporin TIP1-3-like isoform X1 [Glycine max]
Length=252

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 141/170 (83%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            MA+ RIAI S  EA+ P A++AA AE  SMLIFVFAG GSGMA++KL  NG ATP GL+ 
Sbjct  1    MAIDRIAIVSPREASNPAAIRAAFAELFSMLIFVFAGQGSGMAYSKLIGNGPATPGGLLV  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A+++HA+ LFVAV+VGANI GGH+NPAVTFGAF+GG+ITL RS+ YWIA L+GSVVAC+L
Sbjct  61   ASLSHAYGLFVAVAVGANIYGGHINPAVTFGAFIGGNITLLRSIFYWIAHLVGSVVACIL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L F++GG+      LS+GV+ WNA++FEIVMTFGLVYTVYAT VDPKKGN
Sbjct  121  LNFSSGGMPKKHLSLSSGVSVWNALIFEIVMTFGLVYTVYATRVDPKKGN  170



>ref|NP_001241727.1| aquaporin TIP1.1 [Zea mays]
 gb|ACG25449.1| aquaporin TIP1.1 [Zea mays]
Length=250

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M + RIA+GS  E   P ALKAA AEFIS LIFVFAG GSGMAF+KLT  G  TPAGLI+
Sbjct  1    MPINRIALGSHQEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFSKLTGGGPTTPAGLIA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSVGANISG HVNPAVTFGAFVGG+ITLFR +LYW+AQLLGS VAC L
Sbjct  61   AAVAHAFALFVAVSVGANISGRHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTVACFL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F+TGG  T  FGL+ GV+ W A+V EIVMTFGLVYTVYATAVDPKKG+
Sbjct  121  LRFSTGGQATGTFGLT-GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGS  169



>ref|XP_011088796.1| PREDICTED: aquaporin TIP1-1-like [Sesamum indicum]
Length=255

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 146/174 (84%), Gaps = 1/174 (1%)
 Frame = +3

Query  90   KFLEMAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPa  269
            ++  + + R+AIGS  E  QP A+KAAVAEFIS L+FVFAGSGSG+A+NKLT N   TPA
Sbjct  4    EYFNVPLRRVAIGSHDEFRQPGAVKAAVAEFISTLVFVFAGSGSGIAYNKLTGNAPNTPA  63

Query  270  glisaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVV  449
            GLI+A++AHAF LFVAV++GANISGGHVNPAVTFG FVGG+ITLFR +LY IAQLLGS+V
Sbjct  64   GLIAASVAHAFGLFVAVAIGANISGGHVNPAVTFGLFVGGNITLFRGILYIIAQLLGSIV  123

Query  450  ACLLLKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            ACLLL F TGG   PAF +S GV+ W+A VFEIVMTFGLVYTVYATAVDPKKG 
Sbjct  124  ACLLLSFTTGGWAIPAFTVS-GVSVWSAFVFEIVMTFGLVYTVYATAVDPKKGE  176



>gb|ACU16456.1| unknown [Glycine max]
Length=247

 Score =   208 bits (529),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IAIG   EAT PD LKA +AEFIS LIFVFAGSGSG+A+NKLTDNGAATPAGLIS
Sbjct  1    MPIRNIAIGRPEEATHPDTLKAGLAEFISTLIFVFAGSGSGIAYNKLTDNGAATPAGLIS  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            A++AHAFALFVAVSVGANISGGHVNPAVTFGA VGG+ITL R ++Y IAQLLGS+VA LL
Sbjct  61   ASVAHAFALFVAVSVGANISGGHVNPAVTFGASVGGNITLLRGIVYVIAQLLGSIVASLL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
              F T     PAFGLSAGV   NA+V EIVMTFGLVYTVYATAVDPKKGN
Sbjct  121  PAFVTAS-PVPAFGLSAGVGVGNALVLEIVMTFGLVYTVYATAVDPKKGN  169



>ref|XP_008350342.1| PREDICTED: aquaporin TIP1-1-like [Malus domestica]
Length=252

 Score =   207 bits (528),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   E   PDAL+AA+AEFIS LIFVFAG GSGMAF KLTD+ A TP+GL++
Sbjct  1    MPIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAATTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAV++ ANISGGHVNPAVTFGAF+GG+I+L R +LYWIAQLLG+ VAC L
Sbjct  61   AALAHAFGLFVAVTISANISGGHVNPAVTFGAFIGGNISLLRGLLYWIAQLLGATVACGL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK  T G  T AF LS GV  WNA VFEIVMTFGLVYTVYATA+DPKKG+
Sbjct  121  LKLVTNGQTTAAFSLSPGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGS  170



>ref|XP_008387528.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin TIP1-1 [Malus domestica]
Length=252

 Score =   207 bits (528),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G   E   PDAL+AA+AEFIS LIFVFAG GSGMAF KLTD+ A TP+GL++
Sbjct  1    MPIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAATTPSGLVA  60

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAF LFVAV++ ANISGGHVNPAVTFGAF+GG+I+L R +LYWIAQLLG+ VAC L
Sbjct  61   AALAHAFGLFVAVTISANISGGHVNPAVTFGAFIGGNISLLRGLLYWIAQLLGATVACGL  120

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            LK  T G  T AF LS GV  WNA VFEIVMTFGLVYTVYATA+DPKKG+
Sbjct  121  LKLVTNGQTTAAFSLSPGVGVWNAFVFEIVMTFGLVYTVYATAIDPKKGS  170



>emb|CAB61841.1| putative gamma tonoplast intrinsic protein (TIP) [Sporobolus 
stapfianus]
Length=250

 Score =   207 bits (527),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 146/170 (86%), Gaps = 2/170 (1%)
 Frame = +3

Query  102  MAVPRIAIGSVGEATQPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPaglis  281
            M +  IA+G+  E T P ALKAA+AEFIS LIFVFAG GSG+A++KL+  G  TP+ LIS
Sbjct  1    MPMRNIAVGNTQEVTHPGALKAALAEFISTLIFVFAGQGSGVAYSKLS-GGITTPSSLIS  59

Query  282  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACLL  461
            AA+AHAFALFVAVSV ANISGGHVNPAVTFGAF+GG+I+LFRS+LYWIAQLLGS+VACLL
Sbjct  60   AAVAHAFALFVAVSVSANISGGHVNPAVTFGAFLGGNISLFRSILYWIAQLLGSIVACLL  119

Query  462  LKFATGGLETPAFGLSAGVAPWNAVVFEIVMTFGLVYTVYATAVDPKKGN  611
            L+F TGGL T  FGL+ G++ W A+V EIVMTFGLVYTVYATAVDPKKG+
Sbjct  120  LRFVTGGLPTGTFGLT-GISVWEALVLEIVMTFGLVYTVYATAVDPKKGS  168



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 910113435382