BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15885_g1_i1 len=631 path=[1:0-419 421:420-630]

Length=631
                                                                      Score     E

ref|XP_009791012.1|  PREDICTED: heavy metal-associated isoprenyla...    227   4e-72   
ref|XP_004237014.1|  PREDICTED: heavy metal-associated isoprenyla...    223   1e-70   
ref|XP_006360417.1|  PREDICTED: heavy metal-associated isoprenyla...    223   2e-70   
ref|XP_009610148.1|  PREDICTED: heavy metal-associated isoprenyla...    221   1e-69   
ref|XP_010066640.1|  PREDICTED: heavy metal-associated isoprenyla...    217   4e-68   
ref|XP_004297353.1|  PREDICTED: heavy metal-associated isoprenyla...    217   5e-68   
ref|XP_010096770.1|  hypothetical protein L484_025888                   214   4e-67   
ref|XP_006448293.1|  hypothetical protein CICLE_v10017086mg             212   3e-66   
gb|KDO64716.1|  hypothetical protein CISIN_1g032170mg                   212   3e-66   
ref|XP_008243341.1|  PREDICTED: heavy metal-associated isoprenyla...    211   9e-66   
ref|XP_010042028.1|  PREDICTED: heavy metal-associated isoprenyla...    211   1e-65   
ref|XP_011038679.1|  PREDICTED: heavy metal-associated isoprenyla...    210   2e-65   
ref|XP_011070641.1|  PREDICTED: heavy metal-associated isoprenyla...    209   4e-65   
ref|XP_004297355.1|  PREDICTED: heavy metal-associated isoprenyla...    209   5e-65   
ref|XP_006448292.1|  hypothetical protein CICLE_v10017849mg             209   5e-65   
ref|XP_002315894.1|  heavy-metal-associated domain-containing fam...    208   9e-65   Populus trichocarpa [western balsam poplar]
ref|XP_009357754.1|  PREDICTED: heavy metal-associated isoprenyla...    208   9e-65   
ref|XP_007226004.1|  hypothetical protein PRUPE_ppa012978mg             208   1e-64   
ref|XP_008339571.1|  PREDICTED: heavy metal-associated isoprenyla...    206   6e-64   
gb|KDP38035.1|  hypothetical protein JCGZ_04678                         206   1e-63   
ref|XP_009775115.1|  PREDICTED: heavy metal-associated isoprenyla...    204   3e-63   
ref|XP_002284123.1|  PREDICTED: heavy metal-associated isoprenyla...    204   7e-63   Vitis vinifera
ref|XP_007045081.1|  Heavy metal transport/detoxification superfa...    204   8e-63   
ref|XP_008389229.1|  PREDICTED: heavy metal-associated isoprenyla...    203   1e-62   
emb|CAN63279.1|  hypothetical protein VITISV_023249                     203   2e-62   Vitis vinifera
ref|XP_009622066.1|  PREDICTED: heavy metal-associated isoprenyla...    202   3e-62   
ref|XP_009356157.1|  PREDICTED: heavy metal-associated isoprenyla...    201   9e-62   
ref|XP_003555948.1|  PREDICTED: heavy metal-associated isoprenyla...    199   3e-61   
ref|XP_006378456.1|  hypothetical protein POPTR_0010s12480g             199   4e-61   
ref|XP_007153287.1|  hypothetical protein PHAVU_003G022700g             199   5e-61   
gb|AFK39599.1|  unknown                                                 199   7e-61   
ref|XP_003533947.1|  PREDICTED: heavy metal-associated isoprenyla...    198   1e-60   
ref|XP_010044169.1|  PREDICTED: heavy metal-associated isoprenyla...    197   1e-60   
emb|CDP00747.1|  unnamed protein product                                198   1e-60   
ref|XP_010243803.1|  PREDICTED: heavy metal-associated isoprenyla...    197   2e-60   
ref|XP_009389530.1|  PREDICTED: heavy metal-associated isoprenyla...    197   2e-60   
ref|XP_003536626.1|  PREDICTED: heavy metal-associated isoprenyla...    197   4e-60   
ref|XP_004498327.1|  PREDICTED: heavy metal-associated isoprenyla...    197   4e-60   
ref|XP_002272293.1|  PREDICTED: heavy metal-associated isoprenyla...    195   2e-59   Vitis vinifera
ref|XP_002531065.1|  metal ion binding protein, putative                195   2e-59   Ricinus communis
ref|XP_010906975.1|  PREDICTED: heavy metal-associated isoprenyla...    194   4e-59   
ref|XP_009403879.1|  PREDICTED: heavy metal-associated isoprenyla...    193   9e-59   
gb|KGN52144.1|  hypothetical protein Csa_5G611750                       193   1e-58   
ref|XP_010257308.1|  PREDICTED: heavy metal-associated isoprenyla...    193   3e-58   
gb|AFK36881.1|  unknown                                                 192   3e-58   
ref|XP_009773515.1|  PREDICTED: heavy metal-associated isoprenyla...    191   4e-58   
ref|XP_006430657.1|  hypothetical protein CICLE_v10013659mg             191   5e-58   
gb|KEH40541.1|  heavy metal transport/detoxification superfamily ...    191   6e-58   
gb|KHG01622.1|  Copper-exporting P-type ATPase A                        191   6e-58   
emb|CAN63619.1|  hypothetical protein VITISV_017617                     189   1e-57   Vitis vinifera
ref|XP_006357789.1|  PREDICTED: heavy metal-associated isoprenyla...    190   1e-57   
ref|XP_004512304.1|  PREDICTED: heavy metal-associated isoprenyla...    190   2e-57   
ref|XP_007143033.1|  hypothetical protein PHAVU_007G037900g             189   2e-57   
ref|XP_002888817.1|  hypothetical protein ARALYDRAFT_894936             190   2e-57   
ref|XP_004232003.1|  PREDICTED: heavy metal-associated isoprenyla...    189   3e-57   
ref|XP_010471111.1|  PREDICTED: heavy metal-associated isoprenyla...    190   3e-57   
ref|XP_008811964.1|  PREDICTED: heavy metal-associated isoprenyla...    189   4e-57   
ref|NP_177261.1|  heavy-metal-associated domain-containing protein      189   4e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009608111.1|  PREDICTED: heavy metal-associated isoprenyla...    189   5e-57   
ref|XP_010427920.1|  PREDICTED: heavy metal-associated isoprenyla...    188   7e-57   
ref|XP_006416133.1|  hypothetical protein EUTSA_v10008952mg             189   9e-57   
ref|XP_006302959.1|  hypothetical protein CARUB_v10021096mg             188   1e-56   
ref|XP_010415801.1|  PREDICTED: heavy metal-associated isoprenyla...    188   1e-56   
ref|XP_010670695.1|  PREDICTED: heavy metal-associated isoprenyla...    187   1e-56   
ref|XP_010922550.1|  PREDICTED: heavy metal-associated isoprenyla...    187   1e-56   
ref|XP_011075734.1|  PREDICTED: heavy metal-associated isoprenyla...    187   2e-56   
ref|XP_008457089.1|  PREDICTED: heavy metal-associated isoprenyla...    187   3e-56   
ref|XP_011099491.1|  PREDICTED: heavy metal-associated isoprenyla...    187   3e-56   
ref|XP_010477581.1|  PREDICTED: heavy metal-associated isoprenyla...    186   4e-56   
ref|XP_009592412.1|  PREDICTED: heavy metal-associated isoprenyla...    186   4e-56   
ref|XP_006390811.1|  hypothetical protein EUTSA_v10019290mg             186   6e-56   
ref|XP_002890547.1|  hypothetical protein ARALYDRAFT_472550             186   6e-56   
emb|CDP02719.1|  unnamed protein product                                186   6e-56   
ref|XP_006305742.1|  hypothetical protein CARUB_v10010550mg             186   7e-56   
gb|KFK41529.1|  hypothetical protein AALP_AA2G141400                    186   7e-56   
ref|XP_009103208.1|  PREDICTED: heavy metal-associated isoprenyla...    186   1e-55   
ref|XP_010916340.1|  PREDICTED: heavy metal-associated isoprenyla...    185   1e-55   
ref|XP_009115570.1|  PREDICTED: heavy metal-associated isoprenyla...    185   1e-55   
ref|XP_010460075.1|  PREDICTED: heavy metal-associated isoprenyla...    185   2e-55   
ref|XP_006845276.1|  hypothetical protein AMTR_s00005p00265500          184   2e-55   
ref|XP_007216858.1|  hypothetical protein PRUPE_ppa021641mg             184   2e-55   
gb|EYU44589.1|  hypothetical protein MIMGU_mgv1a018204mg                184   3e-55   
ref|XP_008467147.1|  PREDICTED: heavy metal-associated isoprenyla...    184   3e-55   
ref|XP_004150477.1|  PREDICTED: heavy metal-associated isoprenyla...    184   3e-55   
ref|XP_010498791.1|  PREDICTED: heavy metal-associated isoprenyla...    184   4e-55   
ref|XP_006827006.1|  hypothetical protein AMTR_s00010p00214870          184   5e-55   
emb|CDY04750.1|  BnaC05g18390D                                          183   7e-55   
ref|XP_004140740.1|  PREDICTED: heavy metal-associated isoprenyla...    183   9e-55   
ref|XP_004157176.1|  PREDICTED: heavy metal-associated isoprenyla...    182   1e-54   
ref|XP_004234634.1|  PREDICTED: heavy metal-associated isoprenyla...    182   1e-54   
ref|XP_007150871.1|  hypothetical protein PHAVU_004G001200g             182   2e-54   
ref|NP_173712.1|  heavy-metal-associated domain-containing protein      182   2e-54   Arabidopsis thaliana [mouse-ear cress]
gb|KDO64717.1|  hypothetical protein CISIN_1g032170mg                   181   3e-54   
ref|XP_009622067.1|  PREDICTED: heavy metal-associated isoprenyla...    181   3e-54   
ref|XP_009790755.1|  PREDICTED: heavy metal-associated isoprenyla...    181   3e-54   
ref|XP_010533407.1|  PREDICTED: heavy metal-associated isoprenyla...    181   5e-54   
emb|CDY25762.1|  BnaA07g10200D                                          181   6e-54   
ref|XP_007033097.1|  Heavy metal transport/detoxification superfa...    181   8e-54   
emb|CDY12499.1|  BnaC07g13390D                                          181   9e-54   
emb|CDY21408.1|  BnaA09g30190D                                          181   1e-53   
gb|KDP22659.1|  hypothetical protein JCGZ_02501                         180   1e-53   
ref|XP_009394956.1|  PREDICTED: heavy metal-associated isoprenyla...    180   1e-53   
ref|XP_008812723.1|  PREDICTED: heavy metal-associated isoprenyla...    180   2e-53   
ref|XP_010265998.1|  PREDICTED: heavy metal-associated isoprenyla...    180   2e-53   
ref|XP_009105774.1|  PREDICTED: heavy metal-associated isoprenyla...    179   2e-53   
ref|XP_004135057.1|  PREDICTED: heavy metal-associated isoprenyla...    179   4e-53   
ref|XP_008381309.1|  PREDICTED: heavy metal-associated isoprenyla...    179   4e-53   
ref|XP_009783112.1|  PREDICTED: heavy metal-associated isoprenyla...    177   1e-52   
ref|XP_010905918.1|  PREDICTED: heavy metal-associated isoprenyla...    177   1e-52   
ref|XP_009371810.1|  PREDICTED: heavy metal-associated isoprenyla...    177   1e-52   
gb|AFK45838.1|  unknown                                                 177   2e-52   
gb|KHG02911.1|  superoxide dismutase 1 copper chaperone                 177   2e-52   
ref|XP_010261203.1|  PREDICTED: heavy metal-associated isoprenyla...    177   2e-52   
ref|XP_010269164.1|  PREDICTED: heavy metal-associated isoprenyla...    177   2e-52   
ref|XP_002307111.1|  heavy-metal-associated domain-containing fam...    177   2e-52   Populus trichocarpa [western balsam poplar]
gb|KHG07180.1|  Superoxide dismutase 1 copper chaperone                 177   2e-52   
ref|XP_010939612.1|  PREDICTED: heavy metal-associated isoprenyla...    176   3e-52   
ref|XP_010266835.1|  PREDICTED: heavy metal-associated isoprenyla...    177   3e-52   
ref|XP_011021358.1|  PREDICTED: heavy metal-associated isoprenyla...    176   3e-52   
ref|XP_010916917.1|  PREDICTED: heavy metal-associated isoprenyla...    176   4e-52   
ref|NP_001239806.1|  uncharacterized protein LOC100815905               176   5e-52   
ref|XP_008440632.1|  PREDICTED: heavy metal-associated isoprenyla...    176   5e-52   
ref|NP_001148035.1|  LOC100281644                                       176   5e-52   Zea mays [maize]
ref|XP_010108935.1|  hypothetical protein L484_027130                   176   6e-52   
ref|XP_003612452.1|  hypothetical protein MTR_5g025150                  176   7e-52   
gb|ABK23213.1|  unknown                                                 176   7e-52   Picea sitchensis
gb|ACG27273.1|  farnesylated protein 2                                  176   8e-52   Zea mays [maize]
ref|XP_011039548.1|  PREDICTED: heavy metal-associated isoprenyla...    175   9e-52   
ref|XP_004143484.1|  PREDICTED: heavy metal-associated isoprenyla...    175   1e-51   
gb|KHG07179.1|  Superoxide dismutase 1 copper chaperone                 175   1e-51   
ref|XP_002444859.1|  hypothetical protein SORBIDRAFT_07g000380          175   1e-51   Sorghum bicolor [broomcorn]
ref|XP_006644215.1|  PREDICTED: heavy metal-associated isoprenyla...    175   2e-51   
ref|XP_004968816.1|  PREDICTED: heavy metal-associated isoprenyla...    174   2e-51   
ref|XP_006577898.1|  PREDICTED: heavy metal-associated isoprenyla...    174   2e-51   
ref|XP_006383348.1|  heavy-metal-associated domain-containing fam...    174   2e-51   
ref|XP_010062228.1|  PREDICTED: heavy metal-associated isoprenyla...    174   3e-51   
gb|ACU21394.1|  unknown                                                 174   3e-51   Glycine max [soybeans]
ref|XP_010693750.1|  PREDICTED: heavy metal-associated isoprenyla...    174   3e-51   
ref|XP_008798426.1|  PREDICTED: heavy metal-associated isoprenyla...    174   3e-51   
ref|NP_001152036.1|  metal ion binding protein                          174   4e-51   Zea mays [maize]
ref|XP_006428133.1|  hypothetical protein CICLE_v10026695mg             173   6e-51   
ref|XP_011021357.1|  PREDICTED: heavy metal-associated isoprenyla...    172   6e-51   
ref|NP_001043154.1|  Os01g0507700                                       173   6e-51   Oryza sativa Japonica Group [Japonica rice]
gb|KEH24715.1|  heavy metal transport/detoxification superfamily ...    173   6e-51   
ref|XP_002281217.1|  PREDICTED: heavy metal-associated isoprenyla...    173   8e-51   Vitis vinifera
ref|XP_011097135.1|  PREDICTED: heavy metal-associated isoprenyla...    172   1e-50   
ref|XP_007048040.1|  Heavy metal transport/detoxification domain-...    172   2e-50   
gb|KHN33671.1|  hypothetical protein glysoja_013677                     172   2e-50   
gb|ACN27116.1|  unknown                                                 172   2e-50   Zea mays [maize]
ref|XP_009403887.1|  PREDICTED: heavy metal-associated isoprenyla...    171   2e-50   
ref|XP_004162724.1|  PREDICTED: heavy metal-associated isoprenyla...    171   2e-50   
ref|XP_002285811.1|  PREDICTED: heavy metal-associated isoprenyla...    171   3e-50   Vitis vinifera
gb|KHG30573.1|  Copper chaperone for superoxide dismutase               171   3e-50   
ref|XP_008232814.1|  PREDICTED: heavy metal-associated isoprenyla...    172   3e-50   
ref|XP_009369898.1|  PREDICTED: heavy metal-associated isoprenyla...    171   3e-50   
gb|EMT26095.1|  Superoxide dismutase 1 copper chaperone                 171   5e-50   
ref|XP_007159730.1|  hypothetical protein PHAVU_002G262500g             171   6e-50   
ref|XP_011046678.1|  PREDICTED: heavy metal-associated isoprenyla...    171   7e-50   
ref|XP_002460130.1|  hypothetical protein SORBIDRAFT_02g023130          171   7e-50   Sorghum bicolor [broomcorn]
ref|XP_008365962.1|  PREDICTED: heavy metal-associated isoprenyla...    171   7e-50   
ref|XP_006380445.1|  hypothetical protein POPTR_0007s06000g             171   7e-50   
ref|XP_006366527.1|  PREDICTED: heavy metal-associated isoprenyla...    170   9e-50   
ref|XP_004956674.1|  PREDICTED: heavy metal-associated isoprenyla...    170   1e-49   
ref|XP_008790801.1|  PREDICTED: heavy metal-associated isoprenyla...    170   1e-49   
gb|EYU41325.1|  hypothetical protein MIMGU_mgv1a026598mg                169   1e-49   
ref|XP_003578035.1|  PREDICTED: heavy metal-associated isoprenyla...    170   1e-49   
ref|XP_009378545.1|  PREDICTED: heavy metal-associated isoprenyla...    170   1e-49   
ref|XP_004492985.1|  PREDICTED: heavy metal-associated isoprenyla...    169   1e-49   
ref|XP_007041823.1|  Farnesylated protein 6 isoform 1                   170   2e-49   
ref|XP_004144847.1|  PREDICTED: heavy metal-associated isoprenyla...    169   2e-49   
ref|XP_011005631.1|  PREDICTED: heavy metal-associated isoprenyla...    169   2e-49   
ref|XP_002534419.1|  metal ion binding protein, putative                169   2e-49   Ricinus communis
ref|XP_007137345.1|  hypothetical protein PHAVU_009G119300g             169   2e-49   
ref|XP_003602005.1|  hypothetical protein MTR_3g087770                  169   2e-49   
ref|XP_008374328.1|  PREDICTED: heavy metal-associated isoprenyla...    169   2e-49   
gb|KDP46890.1|  hypothetical protein JCGZ_24099                         169   2e-49   
ref|XP_007206070.1|  hypothetical protein PRUPE_ppa012771mg             169   2e-49   
ref|XP_004502447.1|  PREDICTED: heavy metal-associated isoprenyla...    169   3e-49   
ref|XP_002528981.1|  metal ion binding protein, putative                169   3e-49   Ricinus communis
ref|XP_011090461.1|  PREDICTED: heavy metal-associated isoprenyla...    168   5e-49   
ref|XP_008447957.1|  PREDICTED: heavy metal-associated isoprenyla...    168   5e-49   
ref|XP_004302198.1|  PREDICTED: heavy metal-associated isoprenyla...    168   6e-49   
ref|XP_002306185.1|  GMFP7 family protein                               168   6e-49   Populus trichocarpa [western balsam poplar]
ref|NP_001238649.1|  uncharacterized protein LOC100500473               168   6e-49   
emb|CAD70173.1|  farnesylated protein 3                                 168   7e-49   Hordeum vulgare subsp. vulgare [barley]
ref|XP_011088612.1|  PREDICTED: heavy metal-associated isoprenyla...    167   9e-49   
ref|XP_010558674.1|  PREDICTED: heavy metal-associated isoprenyla...    167   1e-48   
ref|XP_007139206.1|  hypothetical protein PHAVU_008G010200g             167   1e-48   
gb|AIE40061.1|  heavy metal-associated isoprenylated protein 3          167   2e-48   
emb|CAD70172.1|  farnesylated protein 2                                 167   2e-48   Hordeum vulgare subsp. vulgare [barley]
gb|EAZ44469.1|  hypothetical protein OsJ_29086                          167   2e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011092975.1|  PREDICTED: heavy metal-associated isoprenyla...    167   2e-48   
gb|KDP29662.1|  hypothetical protein JCGZ_18824                         167   2e-48   
gb|AFK40125.1|  unknown                                                 167   2e-48   
ref|XP_009381902.1|  PREDICTED: heavy metal-associated isoprenyla...    166   2e-48   
gb|AGW45453.1|  metal ion binding                                       167   2e-48   
ref|XP_009390577.1|  PREDICTED: heavy metal-associated isoprenyla...    166   3e-48   
ref|XP_003518642.1|  PREDICTED: heavy metal-associated isoprenyla...    166   3e-48   
gb|EAZ08809.1|  hypothetical protein OsI_31075                          167   3e-48   Oryza sativa Indica Group [Indian rice]
gb|KDP32706.1|  hypothetical protein JCGZ_11998                         166   4e-48   
ref|XP_009391452.1|  PREDICTED: heavy metal-associated isoprenyla...    166   5e-48   
ref|XP_004239997.1|  PREDICTED: heavy metal-associated isoprenyla...    166   5e-48   
ref|XP_003604043.1|  Farnesylated protein (ATFP6)                       166   5e-48   
gb|KDO42373.1|  hypothetical protein CISIN_1g036289mg                   166   6e-48   
ref|XP_004500726.1|  PREDICTED: heavy metal-associated isoprenyla...    166   6e-48   
ref|XP_010549763.1|  PREDICTED: heavy metal-associated isoprenyla...    166   6e-48   
gb|AFK33831.1|  unknown                                                 166   7e-48   
ref|XP_003531366.1|  PREDICTED: heavy metal-associated isoprenyla...    166   7e-48   
gb|ABK96034.1|  unknown                                                 166   7e-48   Populus trichocarpa [western balsam poplar]
ref|NP_001168502.1|  metal ion binding protein                          166   7e-48   Zea mays [maize]
ref|NP_001288682.1|  heavy metal-associated isoprenylated plant p...    165   8e-48   
gb|EMS58641.1|  hypothetical protein TRIUR3_09648                       169   1e-47   
gb|ABR17552.1|  unknown                                                 164   1e-47   Picea sitchensis
ref|XP_009397973.1|  PREDICTED: heavy metal-associated isoprenyla...    165   1e-47   
ref|XP_007201826.1|  hypothetical protein PRUPE_ppa012801mg             164   2e-47   
ref|XP_004237423.1|  PREDICTED: heavy metal-associated isoprenyla...    164   2e-47   
ref|XP_008357285.1|  PREDICTED: heavy metal-associated isoprenyla...    164   2e-47   
ref|XP_010926254.1|  PREDICTED: heavy metal-associated isoprenyla...    164   2e-47   
ref|XP_008377735.1|  PREDICTED: heavy metal-associated isoprenyla...    164   2e-47   
ref|XP_006660571.1|  PREDICTED: heavy metal-associated isoprenyla...    164   2e-47   
ref|XP_004289875.1|  PREDICTED: heavy metal-associated isoprenyla...    164   2e-47   
ref|XP_009355667.1|  PREDICTED: heavy metal-associated isoprenyla...    164   2e-47   
ref|XP_007131717.1|  hypothetical protein PHAVU_011G035900g             164   2e-47   
gb|KHN13913.1|  hypothetical protein glysoja_016197                     164   3e-47   
ref|XP_008236023.1|  PREDICTED: heavy metal-associated isoprenyla...    164   3e-47   
ref|XP_006579369.1|  PREDICTED: uncharacterized protein LOC100500...    164   3e-47   
ref|XP_011046131.1|  PREDICTED: heavy metal-associated isoprenyla...    164   3e-47   
ref|XP_002307397.1|  hypothetical protein POPTR_0005s16490g             163   4e-47   Populus trichocarpa [western balsam poplar]
ref|XP_006422591.1|  hypothetical protein CICLE_v10029481mg             163   5e-47   
ref|XP_002278879.1|  PREDICTED: heavy metal-associated isoprenyla...    163   6e-47   Vitis vinifera
gb|KHN44322.1|  hypothetical protein glysoja_014363                     163   6e-47   
ref|XP_011097602.1|  PREDICTED: heavy metal-associated isoprenyla...    163   6e-47   
ref|XP_004513852.1|  PREDICTED: heavy metal-associated isoprenyla...    162   7e-47   
ref|XP_008233984.1|  PREDICTED: heavy metal-associated isoprenyla...    162   7e-47   
ref|XP_004504043.1|  PREDICTED: heavy metal-associated isoprenyla...    163   8e-47   
ref|XP_007163627.1|  hypothetical protein PHAVU_001G250300g             163   8e-47   
ref|XP_010028730.1|  PREDICTED: heavy metal-associated isoprenyla...    162   8e-47   
ref|NP_001236151.1|  uncharacterized protein LOC100527442               162   1e-46   
ref|XP_010933357.1|  PREDICTED: heavy metal-associated isoprenyla...    162   1e-46   
ref|XP_006359700.1|  PREDICTED: heavy metal-associated isoprenyla...    162   2e-46   
ref|XP_009413013.1|  PREDICTED: heavy metal-associated isoprenyla...    162   2e-46   
ref|XP_003607174.1|  Farnesylated protein (ATFP6)                       162   2e-46   
ref|NP_001050249.1|  Os03g0383900                                       162   2e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004231044.1|  PREDICTED: heavy metal-associated isoprenyla...    162   2e-46   
ref|XP_004958383.1|  PREDICTED: heavy metal-associated isoprenyla...    162   2e-46   
gb|EPS65925.1|  hypothetical protein M569_08856                         162   2e-46   
dbj|BAJ91258.1|  predicted protein                                      161   2e-46   
emb|CDY38431.1|  BnaA10g17270D                                          161   2e-46   
gb|KHN29092.1|  hypothetical protein glysoja_008427                     161   2e-46   
ref|XP_006363944.1|  PREDICTED: heavy metal-associated isoprenyla...    161   3e-46   
emb|CDP01410.1|  unnamed protein product                                161   3e-46   
emb|CDY55938.1|  BnaC02g44160D                                          161   3e-46   
ref|NP_001236173.1|  uncharacterized protein LOC100306004               161   3e-46   
ref|XP_010531538.1|  PREDICTED: heavy metal-associated isoprenyla...    161   4e-46   
gb|AFK43755.1|  unknown                                                 161   4e-46   
ref|XP_006354021.1|  PREDICTED: heavy metal-associated isoprenyla...    160   4e-46   
ref|XP_011013863.1|  PREDICTED: heavy metal-associated isoprenyla...    160   4e-46   
ref|XP_004300657.1|  PREDICTED: heavy metal-associated isoprenyla...    160   4e-46   
ref|NP_001151667.1|  metal ion binding protein                          161   5e-46   Zea mays [maize]
emb|CDY16919.1|  BnaC09g40460D                                          160   6e-46   
ref|XP_009599463.1|  PREDICTED: heavy metal-associated isoprenyla...    160   7e-46   
gb|EEC75375.1|  hypothetical protein OsI_11838                          160   7e-46   Oryza sativa Indica Group [Indian rice]
gb|EYU37957.1|  hypothetical protein MIMGU_mgv1a015538mg                160   7e-46   
gb|KHN38201.1|  hypothetical protein glysoja_003866                     160   7e-46   
emb|CDY42647.1|  BnaC01g00590D                                          160   7e-46   
ref|NP_001241088.1|  uncharacterized protein LOC100778653               160   7e-46   
ref|XP_003574995.1|  PREDICTED: heavy metal-associated isoprenyla...    160   8e-46   
ref|XP_003581604.1|  PREDICTED: heavy metal-associated isoprenyla...    160   8e-46   
ref|XP_009126827.1|  PREDICTED: heavy metal-associated isoprenyla...    160   9e-46   
ref|XP_009107517.1|  PREDICTED: heavy metal-associated isoprenyla...    160   9e-46   
ref|XP_009791644.1|  PREDICTED: heavy metal-associated isoprenyla...    160   9e-46   
ref|XP_003630071.1|  hypothetical protein MTR_8g091420                  159   1e-45   
ref|XP_002463215.1|  hypothetical protein SORBIDRAFT_02g039890          160   1e-45   Sorghum bicolor [broomcorn]
emb|CDP21685.1|  unnamed protein product                                160   1e-45   
ref|XP_009605894.1|  PREDICTED: heavy metal-associated isoprenyla...    159   1e-45   
ref|NP_001052304.1|  Os04g0244800                                       159   2e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003537715.1|  PREDICTED: heavy metal-associated isoprenyla...    159   2e-45   
ref|NP_001151691.1|  LOC100285326                                       159   2e-45   Zea mays [maize]
gb|ACG43933.1|  farnesylated protein 1                                  159   2e-45   Zea mays [maize]
ref|XP_010105872.1|  hypothetical protein L484_021527                   159   2e-45   
gb|EYU36526.1|  hypothetical protein MIMGU_mgv1a020859mg                159   2e-45   
ref|XP_007223670.1|  hypothetical protein PRUPE_ppa012855mg             159   2e-45   
gb|ABK24206.1|  unknown                                                 159   3e-45   
ref|XP_008357284.1|  PREDICTED: heavy metal-associated isoprenyla...    163   3e-45   
ref|XP_010690364.1|  PREDICTED: heavy metal-associated isoprenyla...    159   3e-45   
ref|XP_006282751.1|  hypothetical protein CARUB_v10005941mg             159   3e-45   
ref|XP_009788334.1|  PREDICTED: heavy metal-associated isoprenyla...    159   3e-45   
ref|XP_009109542.1|  PREDICTED: heavy metal-associated isoprenyla...    159   3e-45   
ref|XP_010027813.1|  PREDICTED: heavy metal-associated isoprenyla...    159   3e-45   
gb|EMT21257.1|  hypothetical protein F775_28702                         158   3e-45   
ref|XP_009101937.1|  PREDICTED: heavy metal-associated isoprenyla...    158   4e-45   
gb|KHF99345.1|  Superoxide dismutase 1 copper chaperone                 158   4e-45   
ref|XP_008442145.1|  PREDICTED: heavy metal-associated isoprenyla...    158   4e-45   
ref|XP_003624424.1|  Metal ion binding protein                          158   4e-45   
ref|XP_002866809.1|  hypothetical protein ARALYDRAFT_490624             158   5e-45   
ref|XP_003562643.1|  PREDICTED: heavy metal-associated isoprenyla...    158   5e-45   
ref|XP_010107664.1|  hypothetical protein L484_008381                   158   5e-45   
ref|XP_008809430.1|  PREDICTED: heavy metal-associated isoprenyla...    158   5e-45   
ref|NP_001149664.1|  farnesylated protein 1                             158   5e-45   
emb|CBI21468.3|  unnamed protein product                                157   6e-45   
ref|XP_009606650.1|  PREDICTED: heavy metal-associated isoprenyla...    158   6e-45   
ref|XP_010320148.1|  PREDICTED: heavy metal-associated isoprenyla...    158   6e-45   
emb|CDY12089.1|  BnaC03g60050D                                          158   6e-45   
ref|XP_003552099.1|  PREDICTED: heavy metal-associated isoprenyla...    158   7e-45   
ref|XP_004968520.1|  PREDICTED: heavy metal-associated isoprenyla...    157   8e-45   
ref|XP_003612216.1|  Atfp6-like protein                                 157   8e-45   
emb|CAD48128.1|  farnesylated protein 1                                 157   9e-45   
gb|EMT23051.1|  hypothetical protein F775_43162                         157   9e-45   
ref|XP_004505822.1|  PREDICTED: heavy metal-associated isoprenyla...    157   9e-45   
ref|XP_006652131.1|  PREDICTED: heavy metal-associated isoprenyla...    157   1e-44   
gb|EMS55854.1|  hypothetical protein TRIUR3_04753                       157   1e-44   
ref|XP_008381310.1|  PREDICTED: heavy metal-associated isoprenyla...    156   1e-44   
ref|XP_010446365.1|  PREDICTED: heavy metal-associated isoprenyla...    157   1e-44   
gb|ACJ86072.1|  unknown                                                 157   1e-44   
ref|XP_006411650.1|  hypothetical protein EUTSA_v10026471mg             157   1e-44   
ref|XP_010436952.1|  PREDICTED: heavy metal-associated isoprenyla...    157   1e-44   
ref|XP_011046114.1|  PREDICTED: heavy metal-associated isoprenyla...    157   1e-44   
ref|XP_009782213.1|  PREDICTED: heavy metal-associated isoprenyla...    157   1e-44   
ref|XP_004238514.1|  PREDICTED: heavy metal-associated isoprenyla...    157   2e-44   
ref|NP_195570.1|  farnesylated protein 6                                157   2e-44   
ref|XP_008346878.1|  PREDICTED: heavy metal-associated isoprenyla...    157   2e-44   
gb|ABK22742.1|  unknown                                                 156   2e-44   
ref|XP_009376948.1|  PREDICTED: heavy metal-associated isoprenyla...    156   2e-44   
gb|KEH24716.1|  heavy metal transport/detoxification superfamily ...    155   2e-44   
emb|CDX72748.1|  BnaC07g47700D                                          156   3e-44   
ref|XP_011027672.1|  PREDICTED: heavy metal-associated isoprenyla...    156   3e-44   
gb|EMS48252.1|  hypothetical protein TRIUR3_33177                       156   3e-44   
ref|XP_004146413.1|  PREDICTED: heavy metal-associated isoprenyla...    156   3e-44   
ref|XP_002301034.1|  hypothetical protein POPTR_0002s09280g             156   3e-44   
ref|XP_007046632.1|  Farnesylated protein 6                             156   3e-44   
ref|XP_004979813.1|  PREDICTED: heavy metal-associated isoprenyla...    156   3e-44   
gb|EYU40439.1|  hypothetical protein MIMGU_mgv1a019014mg                156   4e-44   
gb|ABK95274.1|  unknown                                                 156   4e-44   
ref|XP_006650141.1|  PREDICTED: heavy metal-associated isoprenyla...    156   5e-44   
gb|KFK30460.1|  hypothetical protein AALP_AA7G264000                    155   5e-44   
ref|XP_007018869.1|  Heavy metal transport/detoxification superfa...    155   6e-44   
ref|XP_009347206.1|  PREDICTED: heavy metal-associated isoprenyla...    155   6e-44   
gb|AAM60879.1|  farnesylated protein (ATFP6)                            155   7e-44   
ref|XP_006354022.1|  PREDICTED: heavy metal-associated isoprenyla...    155   8e-44   
ref|XP_006466995.1|  PREDICTED: heavy metal-associated isoprenyla...    155   8e-44   
ref|XP_009781991.1|  PREDICTED: heavy metal-associated isoprenyla...    155   9e-44   
ref|XP_006340767.1|  PREDICTED: heavy metal-associated isoprenyla...    155   1e-43   
ref|XP_009345527.1|  PREDICTED: heavy metal-associated isoprenyla...    154   1e-43   
ref|XP_002447552.1|  hypothetical protein SORBIDRAFT_06g003280          155   1e-43   
gb|AIE40060.1|  heavy metal-associated isoprenylated protein 1          154   1e-43   
ref|XP_007041824.1|  Farnesylated protein 6 isoform 2                   155   1e-43   
ref|XP_003574446.1|  PREDICTED: heavy metal-associated isoprenyla...    154   2e-43   
ref|XP_010920102.1|  PREDICTED: heavy metal-associated isoprenyla...    154   2e-43   
gb|KDO37877.1|  hypothetical protein CISIN_1g039645mg                   155   2e-43   
gb|EMT10052.1|  hypothetical protein F775_28446                         154   2e-43   
ref|XP_007136210.1|  hypothetical protein PHAVU_009G027600g             154   2e-43   
ref|XP_009409154.1|  PREDICTED: heavy metal-associated isoprenyla...    154   2e-43   
gb|EYU43598.1|  hypothetical protein MIMGU_mgv1a015689mg                154   2e-43   
gb|KCW69323.1|  hypothetical protein EUGRSUZ_F02815                     152   3e-43   
gb|ADE76654.1|  unknown                                                 153   4e-43   
ref|XP_004287788.1|  PREDICTED: heavy metal-associated isoprenyla...    153   4e-43   
ref|XP_010431798.1|  PREDICTED: heavy metal-associated isoprenyla...    153   4e-43   
ref|XP_011039025.1|  PREDICTED: heavy metal-associated isoprenyla...    152   7e-43   
gb|KFK25957.1|  hypothetical protein AALP_AA8G184700                    152   8e-43   
ref|XP_006649426.1|  PREDICTED: heavy metal-associated isoprenyla...    152   9e-43   
gb|EPS58116.1|  hypothetical protein M569_16700                         152   1e-42   
ref|XP_009379348.1|  PREDICTED: heavy metal-associated isoprenyla...    152   1e-42   
ref|XP_010680588.1|  PREDICTED: heavy metal-associated isoprenyla...    152   1e-42   
gb|KDO71301.1|  hypothetical protein CISIN_1g045611mg                   153   1e-42   
ref|XP_006382273.1|  hypothetical protein POPTR_0005s00570g             152   1e-42   
gb|KHN24785.1|  hypothetical protein glysoja_037127                     152   1e-42   
ref|XP_011004609.1|  PREDICTED: heavy metal-associated isoprenyla...    153   2e-42   
ref|XP_010530914.1|  PREDICTED: heavy metal-associated isoprenyla...    152   2e-42   
ref|XP_003522815.1|  PREDICTED: heavy metal-associated isoprenyla...    151   2e-42   
ref|XP_004297354.1|  PREDICTED: heavy metal-associated isoprenyla...    150   2e-42   
ref|XP_008346877.1|  PREDICTED: heavy metal-associated isoprenyla...    151   2e-42   
ref|XP_011098106.1|  PREDICTED: heavy metal-associated isoprenyla...    151   2e-42   
ref|XP_010029655.1|  PREDICTED: heavy metal-associated isoprenyla...    151   2e-42   
ref|NP_197247.1|  heavy metal transport/detoxification domain-con...    151   2e-42   
ref|XP_010432344.1|  PREDICTED: heavy metal-associated isoprenyla...    151   2e-42   
ref|XP_008440847.1|  PREDICTED: heavy metal-associated isoprenyla...    151   3e-42   
ref|XP_010108382.1|  hypothetical protein L484_010390                   151   3e-42   
gb|EMT25393.1|  hypothetical protein F775_27945                         150   3e-42   
ref|XP_010447003.1|  PREDICTED: heavy metal-associated isoprenyla...    151   3e-42   
ref|XP_008378054.1|  PREDICTED: heavy metal-associated isoprenyla...    150   3e-42   
gb|EMS63565.1|  hypothetical protein TRIUR3_29878                       151   3e-42   
ref|XP_008344223.1|  PREDICTED: heavy metal-associated isoprenyla...    150   4e-42   
ref|XP_003614523.1|  hypothetical protein MTR_5g055020                  150   4e-42   
ref|XP_010437530.1|  PREDICTED: heavy metal-associated isoprenyla...    150   5e-42   
ref|XP_009607089.1|  PREDICTED: heavy metal-associated isoprenyla...    150   5e-42   
ref|NP_001049010.1|  Os03g0156600                                       150   6e-42   
ref|XP_002866773.1|  metal ion binding protein                          150   6e-42   
ref|XP_004134849.1|  PREDICTED: heavy metal-associated isoprenyla...    150   6e-42   
ref|XP_008807137.1|  PREDICTED: heavy metal-associated isoprenyla...    150   7e-42   
ref|XP_010444836.1|  PREDICTED: heavy metal-associated isoprenyla...    150   8e-42   
gb|KFK30144.1|  farnesylated protein                                    150   8e-42   
ref|XP_010420469.1|  PREDICTED: heavy metal-associated isoprenyla...    150   8e-42   
ref|XP_006601735.1|  PREDICTED: uncharacterized protein LOC100306...    149   8e-42   
ref|XP_004515645.1|  PREDICTED: heavy metal-associated isoprenyla...    150   9e-42   
ref|XP_006284680.1|  hypothetical protein CARUB_v10005938mg             150   9e-42   
ref|XP_010544234.1|  PREDICTED: heavy metal-associated isoprenyla...    149   1e-41   
emb|CDP01864.1|  unnamed protein product                                150   1e-41   
ref|XP_007153284.1|  hypothetical protein PHAVU_003G022400g             149   1e-41   
ref|XP_002465836.1|  hypothetical protein SORBIDRAFT_01g046650          149   1e-41   
ref|XP_003558539.1|  PREDICTED: heavy metal-associated isoprenyla...    149   2e-41   
ref|XP_009150857.1|  PREDICTED: heavy metal-associated isoprenyla...    149   2e-41   
gb|KDP23989.1|  hypothetical protein JCGZ_25377                         149   2e-41   
ref|NP_201412.2|  heavy metal associated isoprenylated plant prot...    148   3e-41   
ref|XP_006412158.1|  hypothetical protein EUTSA_v10026474mg             149   3e-41   
gb|ADE77428.1|  unknown                                                 148   3e-41   
emb|CDX88005.1|  BnaA06g25960D                                          148   3e-41   
ref|XP_006281271.1|  hypothetical protein CARUB_v10027319mg             148   3e-41   
ref|XP_010465932.1|  PREDICTED: heavy metal-associated isoprenyla...    148   3e-41   
ref|XP_002272585.1|  PREDICTED: heavy metal-associated isoprenyla...    148   4e-41   
emb|CDY07874.1|  BnaC03g47480D                                          148   4e-41   
ref|XP_009804016.1|  PREDICTED: heavy metal-associated isoprenyla...    148   5e-41   
gb|AFK38176.1|  unknown                                                 147   5e-41   
gb|EPS58148.1|  hypothetical protein M569_16668                         147   5e-41   
ref|XP_009126185.1|  PREDICTED: heavy metal-associated isoprenyla...    147   5e-41   
ref|NP_567975.1|  heavy metal transport/detoxification domain-con...    147   5e-41   
gb|KHN09147.1|  hypothetical protein glysoja_025608                     147   5e-41   
ref|NP_001061762.1|  Os08g0403300                                       147   6e-41   
gb|EAY88605.1|  hypothetical protein OsI_10080                          147   8e-41   
ref|XP_002312958.2|  hypothetical protein POPTR_0009s13760g             147   8e-41   
ref|XP_010692589.1|  PREDICTED: heavy metal-associated isoprenyla...    147   8e-41   
ref|XP_008393893.1|  PREDICTED: heavy metal-associated isoprenyla...    147   8e-41   
ref|XP_004232511.2|  PREDICTED: heavy metal-associated isoprenyla...    147   1e-40   
gb|KFK28270.1|  hypothetical protein AALP_AA8G494900                    147   1e-40   
ref|NP_001147129.1|  metal ion binding protein                          147   1e-40   
ref|XP_007202938.1|  hypothetical protein PRUPE_ppa016811mg             147   1e-40   
ref|XP_009106425.1|  PREDICTED: heavy metal-associated isoprenyla...    147   1e-40   
ref|XP_008651178.1|  PREDICTED: heavy metal-associated isoprenyla...    147   1e-40   
tpg|DAA49093.1|  TPA: hypothetical protein ZEAMMB73_689973              146   1e-40   
ref|XP_009107518.1|  PREDICTED: heavy metal-associated isoprenyla...    145   1e-40   
gb|ACG36377.1|  metal ion binding protein                               146   2e-40   
emb|CDP21674.1|  unnamed protein product                                146   2e-40   
ref|XP_008242048.1|  PREDICTED: heavy metal-associated isoprenyla...    146   2e-40   
ref|XP_002444313.1|  hypothetical protein SORBIDRAFT_07g020020          146   2e-40   
gb|AAD09511.1|  ATFP7                                                   145   2e-40   
dbj|BAF00942.1|  hypothetical protein                                   146   2e-40   
gb|AAD09515.1|  GMFP7                                                   145   3e-40   
ref|XP_010550479.1|  PREDICTED: heavy metal-associated isoprenyla...    145   4e-40   
ref|XP_003557809.1|  PREDICTED: heavy metal-associated isoprenyla...    145   5e-40   
gb|EMT29574.1|  hypothetical protein F775_21124                         144   5e-40   
ref|XP_011074143.1|  PREDICTED: heavy metal-associated isoprenyla...    145   5e-40   
ref|XP_002867093.1|  predicted protein                                  145   5e-40   
ref|XP_010555349.1|  PREDICTED: heavy metal-associated isoprenyla...    145   6e-40   
ref|XP_002272623.1|  PREDICTED: heavy metal-associated isoprenyla...    145   6e-40   
ref|XP_009613481.1|  PREDICTED: heavy metal-associated isoprenyla...    145   7e-40   
emb|CDX69108.1|  BnaC01g03450D                                          145   7e-40   
ref|NP_001242585.1|  uncharacterized protein LOC100805807               144   7e-40   
ref|XP_002513871.1|  metal ion binding protein, putative                143   2e-39   
dbj|BAJ89496.1|  predicted protein                                      144   2e-39   
ref|XP_010550480.1|  PREDICTED: heavy metal-associated isoprenyla...    143   2e-39   
ref|XP_006425400.1|  hypothetical protein CICLE_v10027274mg             145   2e-39   
ref|XP_006659384.1|  PREDICTED: heavy metal-associated isoprenyla...    143   4e-39   
ref|XP_004985648.1|  PREDICTED: heavy metal-associated isoprenyla...    143   4e-39   
gb|KFK30539.1|  hypothetical protein AALP_AA7G275500                    143   4e-39   
ref|XP_006472653.1|  PREDICTED: heavy metal-associated isoprenyla...    142   5e-39   
emb|CDY17504.1|  BnaC03g65590D                                          142   7e-39   
gb|EMS52209.1|  hypothetical protein TRIUR3_10047                       142   9e-39   
ref|XP_002531159.1|  metal ion binding protein, putative                141   1e-38   
ref|XP_006434045.1|  hypothetical protein CICLE_v10002768mg             141   1e-38   
ref|XP_004973389.1|  PREDICTED: heavy metal-associated isoprenyla...    141   2e-38   
ref|NP_192597.1|  heavy-metal-associated domain-containing protein      141   2e-38   
ref|XP_006411764.1|  hypothetical protein EUTSA_v10026454mg             141   2e-38   
ref|XP_009379349.1|  PREDICTED: heavy metal-associated isoprenyla...    140   2e-38   
emb|CAN71845.1|  hypothetical protein VITISV_036265                     140   2e-38   
ref|XP_002866879.1|  predicted protein                                  141   2e-38   
ref|XP_009108689.1|  PREDICTED: heavy metal-associated isoprenyla...    140   3e-38   
ref|XP_006383068.1|  hypothetical protein POPTR_0005s11250g             140   5e-38   
ref|XP_011043158.1|  PREDICTED: heavy metal-associated isoprenyla...    140   5e-38   
ref|XP_010446527.1|  PREDICTED: heavy metal-associated isoprenyla...    140   6e-38   
ref|XP_010437096.1|  PREDICTED: heavy metal-associated isoprenyla...    140   6e-38   
ref|XP_006282486.1|  hypothetical protein CARUB_v10006258mg             140   7e-38   
ref|XP_010431947.1|  PREDICTED: heavy metal-associated isoprenyla...    140   8e-38   
dbj|BAB10416.1|  atfp6-like protein                                     138   1e-37   
ref|NP_195680.1|  heavy metal transport/detoxification domain-con...    139   1e-37   
ref|XP_002872408.1|  predicted protein                                  139   1e-37   
ref|XP_011043157.1|  PREDICTED: heavy metal-associated isoprenyla...    139   2e-37   
ref|XP_006289069.1|  hypothetical protein CARUB_v10002466mg             138   3e-37   
ref|XP_008460493.1|  PREDICTED: heavy metal-associated isoprenyla...    137   6e-37   
ref|XP_008792882.1|  PREDICTED: heavy metal-associated isoprenyla...    135   6e-37   
dbj|BAJ97551.1|  predicted protein                                      137   8e-37   
ref|XP_004140315.1|  PREDICTED: heavy metal-associated isoprenyla...    137   9e-37   
ref|NP_974795.1|  heavy metal transport/detoxification domain-con...    135   2e-36   
ref|XP_010421776.1|  PREDICTED: heavy metal-associated isoprenyla...    135   2e-36   
ref|XP_010069775.1|  PREDICTED: heavy metal-associated isoprenyla...    135   3e-36   
ref|XP_010679885.1|  PREDICTED: LOW QUALITY PROTEIN: heavy metal-...    135   6e-36   
ref|XP_010496704.1|  PREDICTED: heavy metal-associated isoprenyla...    135   2e-35   
emb|CBI17327.3|  unnamed protein product                                130   1e-34   
ref|XP_006397275.1|  hypothetical protein EUTSA_v10029043mg             131   1e-34   
ref|XP_006651448.1|  PREDICTED: heavy metal-associated isoprenyla...    131   1e-34   
gb|ACR36984.1|  unknown                                                 125   4e-33   
gb|AFG49647.1|  hypothetical protein 0_13209_02                         124   1e-32   
gb|AFG49660.1|  hypothetical protein 0_13209_02                         123   3e-32   
gb|EMT00914.1|  hypothetical protein F775_21792                         124   1e-31   
gb|AAD09510.1|  ATFP6                                                   122   1e-31   
ref|XP_008358160.1|  PREDICTED: heavy metal-associated isoprenyla...    122   2e-31   
ref|XP_009113496.1|  PREDICTED: heavy metal-associated isoprenyla...    123   2e-31   
emb|CDY36193.1|  BnaAnng04390D                                          121   7e-31   
ref|XP_003555053.1|  PREDICTED: heavy metal-associated isoprenyla...    118   3e-30   
ref|XP_008779763.1|  PREDICTED: heavy metal-associated isoprenyla...    119   4e-30   
gb|EMS46269.1|  hypothetical protein TRIUR3_22437                       117   5e-30   
ref|XP_006400284.1|  hypothetical protein EUTSA_v10015578mg             116   2e-29   



>ref|XP_009791012.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nicotiana sylvestris]
Length=148

 Score =   227 bits (579),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 130/148 (88%), Gaps = 2/148 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MGI+DH+SD+FEV   RK KRK MQTV+I+VKMDCDGCER+V NAVSSMKG KSVD++RK
Sbjct  1    MGIIDHISDMFEVTSTRKSKRKPMQTVEIKVKMDCDGCERKVTNAVSSMKGVKSVDVSRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTVSG VE KKVLKKV++TGKKAE WPYV+Y+LVSYPYAPG YDKKAPSGYVR+VPQ
Sbjct  61   QSRVTVSGNVEPKKVLKKVQNTGKKAEFWPYVEYNLVSYPYAPGVYDKKAPSGYVRDVPQ  120

Query  136  A--IIPSPNTERFTSMFSDENPNACSLM  59
            A  I+P+  T   TSMFSDENPNACS+M
Sbjct  121  AFQIVPNTPTHTLTSMFSDENPNACSIM  148



>ref|XP_004237014.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum lycopersicum]
Length=147

 Score =   223 bits (569),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MGI+DH+SD+FEV   RK KRK MQTV+I+VKMDCDGCER+V NAVSS+KG KSVD++RK
Sbjct  1    MGIIDHISDMFEVTSTRKSKRKPMQTVEIKVKMDCDGCERKVTNAVSSIKGVKSVDVSRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q++VTVSGY+E KKVLK+V++TGKKAE WPYV+Y+LVSYPYA GAYDKKAPSGYVR+VPQ
Sbjct  61   QSKVTVSGYIEPKKVLKRVQNTGKKAEFWPYVEYNLVSYPYAIGAYDKKAPSGYVRDVPQ  120

Query  136  AI-IPSPNTERFTSMFSDENPNACSLM  59
            A   P+  T+R TSMFSDENPNAC +M
Sbjct  121  AFQTPNTPTQRLTSMFSDENPNACQIM  147



>ref|XP_006360417.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum tuberosum]
Length=147

 Score =   223 bits (568),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MGI+DH+SD+FE+   RK KRK MQTV+I+VKMDCDGCER+V NAVSS+KG KSVD++RK
Sbjct  1    MGIIDHISDMFEITSTRKSKRKPMQTVEIKVKMDCDGCERKVTNAVSSIKGVKSVDVSRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q++VTVSGY+E KKVLK+V++TGKKAE WPYV+Y+LVSYPYA GAYDKKAPSGYVR+VPQ
Sbjct  61   QSKVTVSGYIEPKKVLKRVQNTGKKAEFWPYVEYNLVSYPYAIGAYDKKAPSGYVRDVPQ  120

Query  136  AI-IPSPNTERFTSMFSDENPNACSLM  59
            A   P+  T+R TSMFSDENPNAC +M
Sbjct  121  AFQTPNTPTQRLTSMFSDENPNACQIM  147



>ref|XP_009610148.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nicotiana tomentosiformis]
Length=148

 Score =   221 bits (563),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MGI+DH+SD+FEV   RK KRK MQTV+I+VKMDCDGCER+V NAVSS+KG KSVD++RK
Sbjct  1    MGIIDHISDMFEVASTRKSKRKPMQTVEIKVKMDCDGCERKVTNAVSSIKGVKSVDVSRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTV G VE  KVLKKV++TGKKAE WPYV+Y+LVSYPYAPG YDKKAPSGYVR+VPQ
Sbjct  61   QSRVTVIGNVEPNKVLKKVQNTGKKAEFWPYVEYNLVSYPYAPGVYDKKAPSGYVRDVPQ  120

Query  136  A--IIPSPNTERFTSMFSDENPNACSLM  59
            A  I+P+  T   TSMFSDENPNACS+M
Sbjct  121  AFQIVPNTPTHTLTSMFSDENPNACSIM  148



>ref|XP_010066640.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Eucalyptus grandis]
 gb|KCW64610.1| hypothetical protein EUGRSUZ_G02198 [Eucalyptus grandis]
 gb|KCW64611.1| hypothetical protein EUGRSUZ_G02198 [Eucalyptus grandis]
Length=148

 Score =   217 bits (552),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 131/149 (88%), Gaps = 4/149 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrr-kkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINR  320
            MG+LD  SD+F+ +  + +KKRK MQTVDI+VKMDCDGCERRVRNA SSMKGAKSV++NR
Sbjct  1    MGVLDRFSDMFDFELSKPRKKRKPMQTVDIKVKMDCDGCERRVRNAFSSMKGAKSVEVNR  60

Query  319  KQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            KQ++V+V+GYVE+ KVL KV STGKKAELWPYV Y+LV+YPYAP AYDKKAPSGYV+NVP
Sbjct  61   KQSKVSVTGYVESGKVLNKVRSTGKKAELWPYVPYNLVAYPYAPQAYDKKAPSGYVKNVP  120

Query  139  QAIIPSPNT--ERFTSMFSDENPNACSLM  59
            QA +PSPN   E FT++FSDENPNACS+M
Sbjct  121  QA-LPSPNAPGEHFTTLFSDENPNACSIM  148



>ref|XP_004297353.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform 1 [Fragaria vesca subsp. vesca]
Length=145

 Score =   217 bits (552),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+LD+LSD F +  + KKKRK +QTVDI+VKMDCDGCERRV++AVS+MKGAK V++NRK
Sbjct  1    MGMLDNLSDYFTISSKPKKKRKALQTVDIKVKMDCDGCERRVKSAVSNMKGAKQVEVNRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTV+GYVEAKKVLK+V+STGK+AE+WPYV Y+LV+YPY  GAYDKKAPSGYVRNVPQ
Sbjct  61   QSRVTVTGYVEAKKVLKRVKSTGKRAEIWPYVPYNLVAYPYVAGAYDKKAPSGYVRNVPQ  120

Query  136  AIIPSPNTERFTSMFSDENPNACSLM  59
            A   +P+ +++TSMFSDENP+AC++M
Sbjct  121  AFALAPD-DQYTSMFSDENPHACAIM  145



>ref|XP_010096770.1| hypothetical protein L484_025888 [Morus notabilis]
 gb|EXB65622.1| hypothetical protein L484_025888 [Morus notabilis]
Length=146

 Score =   214 bits (546),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 129/148 (87%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+LD LSD F + R RKK++  MQTV+I+VKMDCDGCERRVRNAV+SM+GAKSVD+NRK
Sbjct  1    MGVLDKLSDYFTIDRPRKKRKA-MQTVEIKVKMDCDGCERRVRNAVTSMRGAKSVDVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTV+GYVE  KVLKKV+STGK+AE WPYV Y+LV+YPY   AYDKKAPSGYV+NV Q
Sbjct  60   QSRVTVTGYVEPNKVLKKVKSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGYVKNVVQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +PSPN   E+FTSMFSDENPNACS+M
Sbjct  120  A-LPSPNAPDEKFTSMFSDENPNACSIM  146



>ref|XP_006448293.1| hypothetical protein CICLE_v10017086mg [Citrus clementina]
 ref|XP_006468829.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Citrus sinensis]
 gb|ESR61533.1| hypothetical protein CICLE_v10017086mg [Citrus clementina]
Length=146

 Score =   212 bits (540),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 128/148 (86%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+LDHL DLFE   R KK++  MQTVDI+VKMDCDGCER+VRNAVSS++GAKSV++NRK
Sbjct  1    MGVLDHLLDLFETTPRGKKRKP-MQTVDIKVKMDCDGCERKVRNAVSSIRGAKSVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTV+GYV+  KVLKKV+STGK+AE WPYV Y+LV+YPY   AYDKKAPSGYV+NV Q
Sbjct  60   QSRVTVTGYVDPNKVLKKVKSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGYVKNVVQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +PSPN   ER T++FSDENPNACS+M
Sbjct  120  A-LPSPNATDERLTTLFSDENPNACSIM  146



>gb|KDO64716.1| hypothetical protein CISIN_1g032170mg [Citrus sinensis]
Length=146

 Score =   212 bits (540),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 128/148 (86%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+LDHL DLFE   R KK++  MQTVDI+VKMDCDGCER+VRNAVSS++GAKSV++NRK
Sbjct  1    MGVLDHLFDLFETTPRGKKRKP-MQTVDIKVKMDCDGCERKVRNAVSSIRGAKSVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTV+GYV+  KVLKKV+STGK+AE WPYV Y+LV+YPY   AYDKKAPSGYV+NV Q
Sbjct  60   QSRVTVTGYVDPNKVLKKVKSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGYVKNVVQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +PSPN   ER T++FSDENPNACS+M
Sbjct  120  A-LPSPNATDERLTTLFSDENPNACSIM  146



>ref|XP_008243341.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Prunus mume]
Length=146

 Score =   211 bits (537),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 129/148 (87%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD LSD F + + +KK++  MQTV+I+VKMDCDGCERRV+NAVS+MKGAK V++NRK
Sbjct  1    MGALDALSDYFTISKPKKKRKP-MQTVEIKVKMDCDGCERRVKNAVSNMKGAKQVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTV+GYVE  KVLKKV+STGKKAELWPYV Y+LV+YPYA GAYDKKAPSGYVRNV Q
Sbjct  60   QSRVTVTGYVEPNKVLKKVKSTGKKAELWPYVPYNLVAYPYATGAYDKKAPSGYVRNVAQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +P+P    +++T+MFSDENPNACS+M
Sbjct  120  A-LPTPGAPDDKYTTMFSDENPNACSIM  146



>ref|XP_010042028.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Eucalyptus grandis]
Length=148

 Score =   211 bits (536),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 130/149 (87%), Gaps = 4/149 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrr-kkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINR  320
            MG+LD  SD+F+ +  + +KKRK MQTVDI+VKMDC+GCERRVR+AVS  KGAKSV++NR
Sbjct  1    MGVLDRFSDMFDFELSKPRKKRKPMQTVDIKVKMDCEGCERRVRDAVSPKKGAKSVEVNR  60

Query  319  KQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            KQ++V+V+GYVE+ KVL KV STGKKAELWPYV Y+LV+YPYAP AYDKKAPSGYV+NVP
Sbjct  61   KQSKVSVTGYVESGKVLNKVRSTGKKAELWPYVPYNLVAYPYAPQAYDKKAPSGYVKNVP  120

Query  139  QAIIPSPNT--ERFTSMFSDENPNACSLM  59
            QA +PSPN   E FT++FSDENPNACS+M
Sbjct  121  QA-LPSPNAPGEHFTTLFSDENPNACSIM  148



>ref|XP_011038679.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Populus euphratica]
Length=150

 Score =   210 bits (535),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 131/152 (86%), Gaps = 8/152 (5%)
 Frame = -1

Query  496  MGILD----HLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD    +LSDLF V R+++K++  MQTVDI+VKMDCDGCERRV+N+VSSMKG KSV+
Sbjct  1    MGALDDLSDYLSDLFTVSRKKRKRKP-MQTVDIKVKMDCDGCERRVKNSVSSMKGVKSVE  59

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +NRKQ+RVTVSG+VE  KVLKKV+STGK+AE WPYV Y+LV+YPYA  AYDKKAP+GYV+
Sbjct  60   VNRKQSRVTVSGHVEPNKVLKKVKSTGKRAEFWPYVPYNLVAYPYAAQAYDKKAPAGYVK  119

Query  148  NVPQAIIPSPNT--ERFTSMFSDENPNACSLM  59
            NV QA +PSPN   ERFTSMFSDENPNACS+M
Sbjct  120  NVVQA-LPSPNATDERFTSMFSDENPNACSIM  150



>ref|XP_011070641.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Sesamum indicum]
Length=147

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 126/148 (85%), Gaps = 3/148 (2%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LDH+SD+  V   RK KRK MQTV+I+VKMDC+GCERRVRNAVSSMKG KSVD++RK
Sbjct  1    MGFLDHISDVCAVTSTRKSKRKPMQTVEIKVKMDCEGCERRVRNAVSSMKGVKSVDVSRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTVSGYVE  KVL +V+STGKKAE+WPYV+Y+L  YPYAP AYDKKAPSG+VRNV Q
Sbjct  61   QSRVTVSGYVEPNKVLNRVKSTGKKAEIWPYVQYNLAYYPYAPQAYDKKAPSGFVRNVAQ  120

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A  PSPN   E++T++FSD+N NACS+M
Sbjct  121  A-FPSPNAPVEKYTTLFSDDNVNACSIM  147



>ref|XP_004297355.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Fragaria vesca subsp. vesca]
Length=145

 Score =   209 bits (532),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 127/146 (87%), Gaps = 1/146 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+LD LSD F +  + KKKRK MQTV+I+VKMDCDGCERRV++AVS+MKGA+ V++NRK
Sbjct  1    MGVLDSLSDYFTMSSKPKKKRKAMQTVEIKVKMDCDGCERRVKSAVSNMKGARQVEVNRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RV V+GYVE  KVLKKV+STGKKAE+WPYV Y+LV+YPY  GAYDKKAPSGYVRNV Q
Sbjct  61   QSRVKVTGYVEPNKVLKKVKSTGKKAEIWPYVPYNLVAYPYVAGAYDKKAPSGYVRNVAQ  120

Query  136  AIIPSPNTERFTSMFSDENPNACSLM  59
            A+  +P  +++TSMFSDENP+AC++M
Sbjct  121  AVTSAPE-DQYTSMFSDENPHACAIM  145



>ref|XP_006448292.1| hypothetical protein CICLE_v10017849mg [Citrus clementina]
 ref|XP_006468830.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Citrus sinensis]
 gb|ESR61532.1| hypothetical protein CICLE_v10017849mg [Citrus clementina]
 gb|KDO64715.1| hypothetical protein CISIN_1g032167mg [Citrus sinensis]
Length=146

 Score =   209 bits (532),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 127/148 (86%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+LDHL DLFE+  RRK+++   QTV+I+VKMDCDGCERRVR+AVSSMKGAKSV++NRK
Sbjct  1    MGVLDHLFDLFEITPRRKRRKPW-QTVEIKVKMDCDGCERRVRHAVSSMKGAKSVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTV+G+V+  KVLKKV STGK+AE WPYV Y+LV+YPY   AYDKKAPSGYVRNV Q
Sbjct  60   QSRVTVTGHVDPNKVLKKVRSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGYVRNVAQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +PSPN   E+  S+FSDENPNACS+M
Sbjct  120  A-LPSPNAADEKLVSLFSDENPNACSIM  146



>ref|XP_002315894.1| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
 gb|EEF02065.1| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
Length=150

 Score =   208 bits (530),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 8/152 (5%)
 Frame = -1

Query  496  MGILD----HLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD    +LSDLF V R+++K++  MQTVDI+VKMDCDGCERRV+N+VSSMKG KSV+
Sbjct  1    MGALDDLSDYLSDLFTVARKKRKRKP-MQTVDIKVKMDCDGCERRVKNSVSSMKGVKSVE  59

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +NRKQ+RVTVSG VE  KVLKKV+STGK+AE WPYV Y+LV+YPYA  AYDKKAP+GYV+
Sbjct  60   VNRKQSRVTVSGNVEPNKVLKKVKSTGKRAEFWPYVPYNLVAYPYAAQAYDKKAPAGYVK  119

Query  148  NVPQAIIPSPNT--ERFTSMFSDENPNACSLM  59
            NV QA +PSPN   ERFTSMFSDENPNACS+M
Sbjct  120  NVVQA-LPSPNATDERFTSMFSDENPNACSIM  150



>ref|XP_009357754.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Pyrus x bretschneideri]
Length=146

 Score =   208 bits (530),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 128/148 (86%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD LSD F + R RKK++  MQTV+I+VKMDCDGCERRV+NAVS+MKGAK V++NRK
Sbjct  1    MGALDALSDYFTISRPRKKRKP-MQTVEIKVKMDCDGCERRVKNAVSNMKGAKQVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTV+GYVE  KVLKKV+STGKKAE+WPYV Y+LV+YPY  GAYDKKAPSGYVRNV Q
Sbjct  60   QSRVTVTGYVEPNKVLKKVKSTGKKAEIWPYVPYNLVAYPYVAGAYDKKAPSGYVRNVTQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +P PN   +++TSMFSDENP+ACS+M
Sbjct  120  A-LPGPNAPDDKYTSMFSDENPHACSIM  146



>ref|XP_007226004.1| hypothetical protein PRUPE_ppa012978mg [Prunus persica]
 gb|EMJ27203.1| hypothetical protein PRUPE_ppa012978mg [Prunus persica]
Length=146

 Score =   208 bits (530),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 128/148 (86%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD LSD F + + R+K++  MQTV+I+VKMDCDGCER+V+NAVS+MKGAK V++NRK
Sbjct  1    MGALDALSDYFTISKPRRKRKP-MQTVEIKVKMDCDGCERKVKNAVSNMKGAKQVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTV+GYVE  KVLKKV+STGKKAELWPYV Y+LV+YPY  GAYDKKAPSGYVRNV Q
Sbjct  60   QSRVTVTGYVEPNKVLKKVKSTGKKAELWPYVPYNLVAYPYVTGAYDKKAPSGYVRNVAQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +PSP    +++T+MFSDENPNACS+M
Sbjct  120  A-LPSPGAPDDKYTTMFSDENPNACSIM  146



>ref|XP_008339571.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Malus domestica]
 ref|XP_008352914.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform X1 [Malus domestica]
 ref|XP_008352915.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform X1 [Malus domestica]
 ref|XP_008352916.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform X2 [Malus domestica]
Length=146

 Score =   206 bits (525),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 128/148 (86%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD LSD F + + RKK++  MQTV+I+VKMDCDGCERRV+NAV++MKGAK V++NRK
Sbjct  1    MGALDALSDYFTISKPRKKRKP-MQTVEIKVKMDCDGCERRVKNAVTNMKGAKQVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q++VTV+GYVE  KVLKKV+STGKKAE+WPYV Y+LV+YPY  GAYDKKAPSGYVRNV Q
Sbjct  60   QSKVTVTGYVEPNKVLKKVKSTGKKAEIWPYVPYNLVAYPYVAGAYDKKAPSGYVRNVTQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +P PN   +++TSMFSDENP+ACS+M
Sbjct  120  A-LPGPNAPDDKYTSMFSDENPHACSIM  146



>gb|KDP38035.1| hypothetical protein JCGZ_04678 [Jatropha curcas]
Length=150

 Score =   206 bits (523),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 127/152 (84%), Gaps = 8/152 (5%)
 Frame = -1

Query  496  MGILD----HLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD    +LSDLF +  +++K++  MQTVDI+VKMDCDGCERRVRN+VS MKG KSV+
Sbjct  1    MGALDSLSDYLSDLFTITSKKRKRKP-MQTVDIKVKMDCDGCERRVRNSVSHMKGVKSVE  59

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +NRKQ+RVTVSGYVE  KVLKKV+STGK+AE WPYV Y+LV+YPY   AYDKKAPSGYV+
Sbjct  60   VNRKQSRVTVSGYVEPSKVLKKVKSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGYVK  119

Query  148  NVPQAIIPSPNT--ERFTSMFSDENPNACSLM  59
            NV QA +PSPN   ER TS+FSDENP+ACS+M
Sbjct  120  NVVQA-LPSPNATDERLTSLFSDENPHACSIM  150



>ref|XP_009775115.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nicotiana sylvestris]
Length=148

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 124/148 (84%), Gaps = 2/148 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrK-LMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINR  320
            MG + H+S++ EV  +RK K+   MQTV+I+VKMDCDGCER+VRNAVSSMKG KSV+INR
Sbjct  1    MGFMYHISEICEVSSKRKSKKHKTMQTVEIKVKMDCDGCERKVRNAVSSMKGVKSVEINR  60

Query  319  KQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            K +RVTVSGYVE  KVLKKVE TGKKAE+WPYVKY+LVS PYA G YDKKAPSGYV+  P
Sbjct  61   KDSRVTVSGYVEKSKVLKKVEKTGKKAEIWPYVKYNLVSNPYAVGVYDKKAPSGYVKIDP  120

Query  139  QAI-IPSPNTERFTSMFSDENPNACSLM  59
            Q + IP+  +E FTSMFSDENPNACS+M
Sbjct  121  QVLQIPNTPSEIFTSMFSDENPNACSIM  148



>ref|XP_002284123.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Vitis vinifera]
 emb|CBI26923.3| unnamed protein product [Vitis vinifera]
Length=147

 Score =   204 bits (518),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+ S+L  V   RK KRK MQTVDI+VKMDCDGCERRV+NAVSSMKG K+VDINRK
Sbjct  1    MGALDYFSNLCTVTSTRKSKRKPMQTVDIKVKMDCDGCERRVKNAVSSMKGVKTVDINRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTVSG+V+  KVLK+V+STGK+AE WPYV Y+LV YPY   AYDKKAPSGYV+NV Q
Sbjct  61   QSRVTVSGFVDPNKVLKRVKSTGKRAEFWPYVPYNLVYYPYIKEAYDKKAPSGYVKNVVQ  120

Query  136  AI-IPSPNTERFTSMFSDENPNACSLM  59
            A+  PS   ER T++FSD+NPNACS+M
Sbjct  121  ALPSPSATDERLTTLFSDDNPNACSIM  147



>ref|XP_007045081.1| Heavy metal transport/detoxification superfamily protein [Theobroma 
cacao]
 gb|EOY00913.1| Heavy metal transport/detoxification superfamily protein [Theobroma 
cacao]
Length=150

 Score =   204 bits (518),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 125/151 (83%), Gaps = 6/151 (4%)
 Frame = -1

Query  496  MGILDHLSDLFE---VkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            MG LD LSD          ++KKRK+MQTV+I+VKMDCDGCERRV+NAVSSMKGAKSV++
Sbjct  1    MGALDSLSDYISDLITVHTKRKKRKVMQTVEIKVKMDCDGCERRVKNAVSSMKGAKSVNV  60

Query  325  NRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            NRKQ+RVTV+GYVE  KVLKKV+STGK+AE WPYV Y+LV+YPY   AYDKKAPSGYV+N
Sbjct  61   NRKQSRVTVTGYVEPNKVLKKVKSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGYVKN  120

Query  145  VPQAIIPSPNT--ERFTSMFSDENPNACSLM  59
              QA +PSPN   E+F ++FSDENPNACS+M
Sbjct  121  AVQA-LPSPNAADEKFITLFSDENPNACSVM  150



>ref|XP_008389229.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Malus domestica]
Length=146

 Score =   203 bits (516),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 127/148 (86%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+LD +SD F + + RKK++  MQTV+I+VKMDCDGCERRV+NAVS MKGAK V+++RK
Sbjct  1    MGVLDAVSDYFTISKPRKKRKP-MQTVEIKVKMDCDGCERRVKNAVSHMKGAKQVEVDRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTV+GYVE  KVLK+V+ TGKKAE+WPYV Y+LV+YPY  GAYDKKAPSGYVRNV Q
Sbjct  60   QSRVTVTGYVEPNKVLKRVKRTGKKAEIWPYVPYNLVAYPYVAGAYDKKAPSGYVRNVAQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +P P+   E++TSMFSDENP+ACS+M
Sbjct  120  A-LPPPDAPDEKYTSMFSDENPHACSIM  146



>emb|CAN63279.1| hypothetical protein VITISV_023249 [Vitis vinifera]
Length=170

 Score =   203 bits (516),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+ S+L  V   RK KRK MQTVDI+VKMDCDGCERRV+NAVSSMKG K+VDINRK
Sbjct  1    MGALDYFSNLCTVTSTRKSKRKPMQTVDIKVKMDCDGCERRVKNAVSSMKGVKTVDINRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTVSG+V+  KVLK+V+STGK+AE WPYV Y+LV YPY   AYDKKAPSGYV+NV Q
Sbjct  61   QSRVTVSGFVDPNKVLKRVKSTGKRAEFWPYVPYNLVYYPYIKEAYDKKAPSGYVKNVVQ  120

Query  136  AI-IPSPNTERFTSMFSDENPNACSLM  59
            A+  PS   ER T++FSD+NPNACS+M
Sbjct  121  ALPSPSATDERLTTLFSDDNPNACSIM  147



>ref|XP_009622066.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 isoform X1 [Nicotiana tomentosiformis]
Length=148

 Score =   202 bits (514),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 125/148 (84%), Gaps = 2/148 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrK-LMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINR  320
            MG + H+S++ EV  +RK K+   MQTV+I+VKMDCDGCER+VRNAVSS+KG KSV+INR
Sbjct  1    MGFMYHISEICEVSSKRKSKKHKTMQTVEIKVKMDCDGCERKVRNAVSSIKGVKSVEINR  60

Query  319  KQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            K +RVTV+GYVE  KVLKKV+ TGKKAE+WPY+KY+LVS PYA G YDKKAPSGYV+  P
Sbjct  61   KDSRVTVTGYVEKSKVLKKVQKTGKKAEIWPYIKYNLVSNPYAVGVYDKKAPSGYVKIDP  120

Query  139  QAI-IPSPNTERFTSMFSDENPNACSLM  59
            QA+ IP+  +E FTSMFSDENPNACS+M
Sbjct  121  QALQIPNTPSEIFTSMFSDENPNACSIM  148



>ref|XP_009356157.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Pyrus x bretschneideri]
Length=146

 Score =   201 bits (510),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 126/148 (85%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+LD +SD F + + RKK++  MQTV+I+VKMDCDGCERRV+NAVS MKGAK V+++RK
Sbjct  1    MGVLDAVSDYFTISKPRKKRKP-MQTVEIKVKMDCDGCERRVKNAVSHMKGAKQVEVDRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RV V+GYVE  KVLK+V+ TGKKAE+WPYV Y+LV+YPY  GAYDKKAPSGYVRNV Q
Sbjct  60   QSRVKVTGYVEPNKVLKRVKRTGKKAEIWPYVPYNLVAYPYVAGAYDKKAPSGYVRNVAQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +P P+   E++TSMFSDENP+ACS+M
Sbjct  120  A-LPPPDAPDEKYTSMFSDENPHACSIM  146



>ref|XP_003555948.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Glycine max]
 gb|KHN42382.1| hypothetical protein glysoja_020094 [Glycine soja]
Length=146

 Score =   199 bits (507),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 124/148 (84%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD LSD F +  ++KK++  MQTV+I+VKMDCDGCERRVRN+VS+M G K V++NRK
Sbjct  1    MGALDFLSDYFSISTQKKKRKP-MQTVEIKVKMDCDGCERRVRNSVSNMSGVKQVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTV+GYV+  KVLKKV+STGK+AE WPY++Y+LV+YPY   AYDKKAPSGYV+N  Q
Sbjct  60   QSRVTVTGYVDRNKVLKKVQSTGKRAEFWPYIQYNLVAYPYVAQAYDKKAPSGYVKNTEQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +P+PN   E+ TS+FSD+NPNACS+M
Sbjct  120  A-LPNPNAPDEKLTSLFSDDNPNACSIM  146



>ref|XP_006378456.1| hypothetical protein POPTR_0010s12480g [Populus trichocarpa]
 gb|ERP56253.1| hypothetical protein POPTR_0010s12480g [Populus trichocarpa]
Length=130

 Score =   199 bits (505),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 111/125 (89%), Gaps = 3/125 (2%)
 Frame = -1

Query  427  MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTG  248
             QTVDI+VKMDCDGCERRV+N+VSSMKG KSV++NRKQ+RVTVSG VE  KVLKKV+STG
Sbjct  7    FQTVDIKVKMDCDGCERRVKNSVSSMKGVKSVEVNRKQSRVTVSGNVEPNKVLKKVKSTG  66

Query  247  KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQAIIPSPNT--ERFTSMFSDENPN  74
            K+AE WPYV Y+LV+YPYA  AYDKKAP+GYV+NV QA +PSPN   ERFTSMFSDENPN
Sbjct  67   KRAEFWPYVPYNLVAYPYAAQAYDKKAPAGYVKNVVQA-LPSPNATDERFTSMFSDENPN  125

Query  73   ACSLM  59
            ACS+M
Sbjct  126  ACSIM  130



>ref|XP_007153287.1| hypothetical protein PHAVU_003G022700g [Phaseolus vulgaris]
 gb|ESW25281.1| hypothetical protein PHAVU_003G022700g [Phaseolus vulgaris]
Length=147

 Score =   199 bits (505),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+ D++SD F V     KKRK MQTV+I+VKMDCDGCERRVRN+V  MKG K V++NRK
Sbjct  1    MGVFDYISDFFSVAPTTGKKRKPMQTVEIKVKMDCDGCERRVRNSVVHMKGVKQVEVNRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q++VTV+GYV+  +VLKKV+STGK+A+ WPY+ Y+LV+YPY   AYDKKAPSGYV+N  Q
Sbjct  61   QSKVTVTGYVDRNRVLKKVQSTGKRADFWPYIPYNLVAYPYVAQAYDKKAPSGYVKNSVQ  120

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +P+PN+  E+ TS+FSDENPNACS+M
Sbjct  121  A-LPAPNSLDEKLTSLFSDENPNACSIM  147



>gb|AFK39599.1| unknown [Lotus japonicus]
Length=147

 Score =   199 bits (505),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+LD+LSD F V     KKRK MQTV+I+VKMDCDGCERRVRN+V+ MKG +SV+INRK
Sbjct  1    MGVLDYLSDYFSVSPSTGKKRKPMQTVEIKVKMDCDGCERRVRNSVAHMKGVRSVEINRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q++VTVSGYV+  +VLKKV+STGK+AE WPY+ Y+LV+YPY    YDKKAP GYV+N  Q
Sbjct  61   QSKVTVSGYVDRNRVLKKVQSTGKRAEFWPYIPYNLVAYPYVAQVYDKKAPPGYVKNSVQ  120

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +PSPN   ++ T++FSDENPNACS+M
Sbjct  121  A-LPSPNALDDKLTNLFSDENPNACSIM  147



>ref|XP_003533947.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Glycine max]
 gb|KHN36417.1| hypothetical protein glysoja_036964 [Glycine soja]
Length=147

 Score =   198 bits (503),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+LD++S+ F V     KKRK MQTV+I+VKMDCDGCERRVRN+V  MKG K V++NRK
Sbjct  1    MGVLDYISEFFSVSPATGKKRKAMQTVEIKVKMDCDGCERRVRNSVVHMKGVKQVEVNRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q++VTV+GYV+  +VLKKV+STGK+A+ WPY+ Y+LV+YPY   AYDKKAPSGYV+N  Q
Sbjct  61   QSKVTVTGYVDRNRVLKKVQSTGKRADFWPYIPYNLVAYPYVAQAYDKKAPSGYVKNAAQ  120

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +P+ N+  E+ TS+FSDENPNACS+M
Sbjct  121  A-LPASNSLDEKLTSLFSDENPNACSIM  147



>ref|XP_010044169.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Eucalyptus grandis]
 gb|KCW86205.1| hypothetical protein EUGRSUZ_B02894 [Eucalyptus grandis]
Length=146

 Score =   197 bits (502),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 123/148 (83%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD LSD   +   RKK++  MQTV+I+VKMDCDGCERRV++ VSSMKG KSV++NRK
Sbjct  1    MGALDFLSDFCTISTPRKKRKP-MQTVEIKVKMDCDGCERRVKSVVSSMKGVKSVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTV G+VE  KVL++V+STGKKAELWPY+ Y+LV+YPY   AYDKKAP+GYV+NV Q
Sbjct  60   QSRVTVRGHVEPNKVLQRVKSTGKKAELWPYIPYNLVAYPYVAQAYDKKAPAGYVKNVAQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +PSP T  ERF ++FSDENPNACS+M
Sbjct  120  A-LPSPTTPGERFVTLFSDENPNACSIM  146



>emb|CDP00747.1| unnamed protein product [Coffea canephora]
Length=152

 Score =   198 bits (503),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 124/153 (81%), Gaps = 8/153 (5%)
 Frame = -1

Query  496  MGILDHLSDLF-----EVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSV  332
            MG LDH++D+      +V    K+KR+ +QTV+I+VKMDCDGCERRV+NAVS MKG KSV
Sbjct  1    MGFLDHIADVCSDAADDVSHNVKRKRRPLQTVEIKVKMDCDGCERRVKNAVSHMKGVKSV  60

Query  331  DINRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYV  152
            D++RK +RVTV+G VE  KVL KV+ TGKKAE WPYV+Y+LVSYPY P AYDKKAP+GYV
Sbjct  61   DVSRKDSRVTVTGNVEPSKVLSKVKGTGKKAEFWPYVRYNLVSYPYVPQAYDKKAPTGYV  120

Query  151  RNVPQAIIPSPN--TERFTSMFSDENPNACSLM  59
            RN  QA +PSPN  TER+ S+FSD+NPNACS+M
Sbjct  121  RNAVQA-MPSPNTPTERYASLFSDDNPNACSIM  152



>ref|XP_010243803.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Nelumbo nucifera]
Length=146

 Score =   197 bits (501),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 121/148 (82%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LDHL +   V  ++ K++  MQTV+I+VKMDCDGCERRVR+AVSSMKG +SV++NRK
Sbjct  1    MGFLDHLPNFCTVSSKKSKRKP-MQTVEIKVKMDCDGCERRVRHAVSSMKGVRSVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTV+GYVE  KVLKKV+ TGKKAE WPYV Y+LV+YPYA  AYDKKAP+GYV+NV Q
Sbjct  60   QSRVTVAGYVEPNKVLKKVQGTGKKAEFWPYVPYNLVAYPYATQAYDKKAPAGYVKNVVQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A  P+PN   E   ++FSDENPNACS+M
Sbjct  120  A-NPAPNATDENLMTLFSDENPNACSIM  146



>ref|XP_009389530.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
Length=151

 Score =   197 bits (502),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 126/152 (83%), Gaps = 7/152 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL----MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LDHLSD+  V   ++  +      +QTVD++VKMDCDGCERRV++AVSS++G  +V+
Sbjct  1    MGALDHLSDMCSVTETKRTLQIRKRRPLQTVDLKVKMDCDGCERRVKHAVSSIRGVTNVN  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +NRKQ+RVTV+G++EAK+VL++++STGK+AELWPYV Y+LV+YPY  GAYDKKAPSG+VR
Sbjct  61   VNRKQSRVTVTGHIEAKQVLERIKSTGKRAELWPYVPYNLVAYPYVAGAYDKKAPSGFVR  120

Query  148  NVPQAIIPSPNT--ERFTSMFSDENPNACSLM  59
            N  QA +P+PN   E++ S+FSD+NPNACS+M
Sbjct  121  NAAQA-VPNPNAPEEQYMSLFSDDNPNACSIM  151



>ref|XP_003536626.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Glycine max]
 gb|KHN06752.1| hypothetical protein glysoja_021298 [Glycine soja]
Length=146

 Score =   197 bits (500),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 123/148 (83%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD LSD F V   +KK++  MQTV+I+VKMDCDGCERRVRN+VS+M G K V++NRK
Sbjct  1    MGALDFLSDYFSVSTPKKKRKP-MQTVEIKVKMDCDGCERRVRNSVSNMSGVKQVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q++VTV+GYV+  KVLKKV+STGK+AE WPY++Y+LV+YPY   AYDKKAPSGYV+N  Q
Sbjct  60   QSKVTVTGYVDRNKVLKKVQSTGKRAEFWPYIQYNLVAYPYVVQAYDKKAPSGYVKNTEQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +P+PN   E+ TS+FSD+NPNACS+M
Sbjct  120  A-LPNPNAPDEKLTSLFSDDNPNACSIM  146



>ref|XP_004498327.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cicer arietinum]
Length=147

 Score =   197 bits (500),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+LD LSD F V    +KKRK MQTV+I+VKMDCDGCERRVRN+V+ MKG K V++NRK
Sbjct  1    MGVLDKLSDYFSVSPITRKKRKPMQTVEIKVKMDCDGCERRVRNSVAYMKGVKQVEVNRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            +++V+VSGYV+  +VLKK++STGK+AE WPY+ Y+LV+YPY   AYDKKAP GYV+N  Q
Sbjct  61   ESKVSVSGYVDGNRVLKKIQSTGKRAEFWPYIPYNLVAYPYIAQAYDKKAPPGYVKNTMQ  120

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +PSPN   E+ T++FSDENPNACS+M
Sbjct  121  A-LPSPNAMDEKLTNLFSDENPNACSIM  147



>ref|XP_002272293.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Vitis vinifera]
 emb|CBI33560.3| unnamed protein product [Vitis vinifera]
Length=146

 Score =   195 bits (495),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 123/147 (84%), Gaps = 2/147 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+ S+   V   + K++  MQTV+I+VKMDCDGCERRV+NAV+SM+G KSV++ RK
Sbjct  1    MGALDYFSNFCTVTSTKGKRKP-MQTVEIKVKMDCDGCERRVKNAVTSMRGVKSVEVIRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTV+GYV+A KVLK+V+STGK+AE WPY+ Y+LVSYPYA  AYDK+AP+GYVRNV Q
Sbjct  60   QSRVTVTGYVDANKVLKRVKSTGKRAEFWPYIPYNLVSYPYATQAYDKRAPAGYVRNVVQ  119

Query  136  AI-IPSPNTERFTSMFSDENPNACSLM  59
            A+ +P+   +R TS+FSD+NPNACS+M
Sbjct  120  AVAVPNDPEDRITSLFSDDNPNACSIM  146



>ref|XP_002531065.1| metal ion binding protein, putative [Ricinus communis]
 gb|EEF31326.1| metal ion binding protein, putative [Ricinus communis]
Length=150

 Score =   195 bits (495),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 127/152 (84%), Gaps = 8/152 (5%)
 Frame = -1

Query  496  MGILD----HLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD    +LSDLF   R+++K++  MQTV+I+VKMDCDGCERRV++AVS++KG KSV+
Sbjct  1    MGALDDLSDYLSDLFTYARKKRKRKP-MQTVEIKVKMDCDGCERRVKHAVSNIKGVKSVE  59

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +NRKQ+RV VSGY+E  KVLKKV STGK+AE WPYV Y+LV+YPY   AYDKKAPSGYV+
Sbjct  60   VNRKQSRVVVSGYIEPNKVLKKVRSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGYVK  119

Query  148  NVPQAIIPSPNT--ERFTSMFSDENPNACSLM  59
            NV QA +PSPN   E++T+MFSDENP+ACS+M
Sbjct  120  NVFQA-LPSPNAPDEKYTTMFSDENPHACSIM  150



>ref|XP_010906975.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Elaeis guineensis]
Length=151

 Score =   194 bits (493),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 122/152 (80%), Gaps = 7/152 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL----MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD+LS+ F V   R+  ++     +QTV+IRVKMDCDGCERRV++AV S+KG  SV+
Sbjct  1    MGALDYLSNFFSVTNTRRALKRRKRKPLQTVEIRVKMDCDGCERRVKHAVQSLKGVTSVN  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            ++RKQ+RVTV+G+VE  KVLKKV+STGK AE WPYV Y+LV+YPY  GAYDK+APSG+VR
Sbjct  61   VSRKQSRVTVTGHVEPNKVLKKVKSTGKVAEFWPYVPYNLVAYPYVAGAYDKRAPSGFVR  120

Query  148  NVPQAIIPSPNT--ERFTSMFSDENPNACSLM  59
            NV QA +PSP    E++ S+FSDENPNACS+M
Sbjct  121  NVAQA-LPSPQAHDEQYMSLFSDENPNACSIM  151



>ref|XP_009403879.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=151

 Score =   193 bits (491),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 121/151 (80%), Gaps = 5/151 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL----MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG  DHLSD   V   R+  +      +QTVD++VKMDCDGCERRV++AVSS++G  +V+
Sbjct  1    MGAFDHLSDFCSVTETRRALQIRKRKPLQTVDLKVKMDCDGCERRVKHAVSSIRGVTNVN  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +NRKQ+RVTV+G++EAK+V++K++STGK+AE WPYV Y LV+YPY  GAYDKKAP+G+VR
Sbjct  61   VNRKQSRVTVTGHIEAKEVVRKIKSTGKRAEAWPYVPYSLVAYPYVAGAYDKKAPAGFVR  120

Query  148  NVPQAII-PSPNTERFTSMFSDENPNACSLM  59
            NV QA+  PS   E+ +S+FSDENPNAC++M
Sbjct  121  NVAQAVASPSAPEEKISSLFSDENPNACTVM  151



>gb|KGN52144.1| hypothetical protein Csa_5G611750 [Cucumis sativus]
Length=149

 Score =   193 bits (490),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 124/150 (83%), Gaps = 5/150 (3%)
 Frame = -1

Query  496  MGILDHLSDLFE--VkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MGI D +SDL    V   R++K+K +QTV+I+VKMDCDGCERRV+NAV+ MKGAK+V++N
Sbjct  1    MGIFDSVSDLISDYVATSRQRKKKPLQTVEIKVKMDCDGCERRVKNAVTKMKGAKTVEVN  60

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ++VTV+G+VEA +VLKKV  TGK+AELWPYV Y++V+YPY   AYDK+AP+G+V+N 
Sbjct  61   RKQSKVTVTGFVEANRVLKKVRRTGKRAELWPYVPYNVVAYPYVTQAYDKRAPAGFVKNA  120

Query  142  PQAIIPSPNT--ERFTSMFSDENPNACSLM  59
             QA IPSPN   E+ T+MFSD+NPN CS+M
Sbjct  121  VQA-IPSPNAVDEKLTTMFSDDNPNGCSVM  149



>ref|XP_010257308.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Nelumbo nucifera]
Length=182

 Score =   193 bits (491),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 123/152 (81%), Gaps = 4/152 (3%)
 Frame = -1

Query  508  KAGRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            +  +MG+LDHL +   V   R K++  MQTV+I+VKMDCDGCERRVR+AV SMKG +SV+
Sbjct  33   RRSKMGVLDHLPNFCTVTSTRSKRKP-MQTVEIKVKMDCDGCERRVRHAVCSMKGVRSVE  91

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +NRKQ+RVTV+GYVE  KVLK+V+STGK+AE WPYV Y+LV+YPY   AYDKKAP+G+V+
Sbjct  92   VNRKQSRVTVTGYVEPNKVLKRVKSTGKRAEFWPYVPYNLVAYPYVVQAYDKKAPAGFVK  151

Query  148  NVPQAIIPSPNT--ERFTSMFSDENPNACSLM  59
            NV QA  PSPN   E+  ++FSD+NPNACS+M
Sbjct  152  NVVQA-NPSPNATDEKIMTLFSDDNPNACSIM  182



>gb|AFK36881.1| unknown [Lotus japonicus]
Length=146

 Score =   192 bits (487),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 122/148 (82%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG  D LSD F V   RKK++  MQTV+I+VKMDCDGCERRVRN+VS+MKG K V++NRK
Sbjct  1    MGAFDFLSDYFSVSTPRKKRKP-MQTVEIKVKMDCDGCERRVRNSVSNMKGVKEVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q++V+V+GYV+  KVLKKV+STGK+AE WPY++Y+LV+YPY   AYDKKAPSGYV+N   
Sbjct  60   QSKVSVTGYVDRNKVLKKVQSTGKRAEFWPYIQYNLVAYPYVAQAYDKKAPSGYVKNTDL  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +P+PN   E+ T++FSD+NPNACS+M
Sbjct  120  A-LPNPNAPDEKLTTLFSDDNPNACSIM  146



>ref|XP_009773515.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nicotiana sylvestris]
Length=147

 Score =   191 bits (486),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+LD+ S+       R+ KRK +QTV+I+VKMDCDGCERRV+NAV  MKG K+V++ RK
Sbjct  1    MGVLDYFSNFCYDTSIRRNKRKPLQTVEIKVKMDCDGCERRVKNAVKRMKGVKTVEVIRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            QNRV VSGY+EA++VL +V+STGK+AE+WPYV Y+LVSYPY   AYDKKAPSG+V+NVPQ
Sbjct  61   QNRVIVSGYIEAQRVLNRVKSTGKRAEMWPYVPYNLVSYPYVAQAYDKKAPSGFVKNVPQ  120

Query  136  A-IIPSPNTERFTSMFSDENPNACSLM  59
            A + P+   E+ T +FSD+NPNACS+M
Sbjct  121  ARLTPNDTEEKITYLFSDDNPNACSIM  147



>ref|XP_006430657.1| hypothetical protein CICLE_v10013659mg [Citrus clementina]
 ref|XP_006482156.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Citrus sinensis]
 gb|ESR43897.1| hypothetical protein CICLE_v10013659mg [Citrus clementina]
 gb|KDO36137.1| hypothetical protein CISIN_1g032155mg [Citrus sinensis]
Length=146

 Score =   191 bits (485),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+LS+   V   R K++  MQTV+I+VKMDCDGCERRV+NAV+SMKG KSV++NRK
Sbjct  1    MGALDYLSNFCTVTSTRSKRKA-MQTVEIKVKMDCDGCERRVKNAVNSMKGVKSVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTVSGYVE  KVLK+V+STGK+AE WPY+   LV YPYAPGAYDK+AP+GYVRNV Q
Sbjct  60   QSRVTVSGYVEPNKVLKRVKSTGKRAEFWPYIPQHLVHYPYAPGAYDKRAPAGYVRNVVQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A  P+ N   +   S+FSD+N NACS+M
Sbjct  120  A-FPATNAPEDNLVSIFSDDNVNACSIM  146



>gb|KEH40541.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=147

 Score =   191 bits (485),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 118/148 (80%), Gaps = 3/148 (2%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+LD LSD F       KK K MQTV+I+VKMDCDGCERRVRN+V+ MKG K V++NRK
Sbjct  1    MGVLDKLSDYFPEYSSTGKKHKPMQTVEIKVKMDCDGCERRVRNSVAYMKGVKQVEVNRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q++VTVSG V+  +VLKK+++TGK+AE WPY+ Y+LV+YPY   AYDKKAPSGYV+N  Q
Sbjct  61   QSKVTVSGNVDRNRVLKKIQNTGKRAEFWPYIPYNLVAYPYISQAYDKKAPSGYVKNSIQ  120

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A + SPN   E+ T+MFSDENPNACS+M
Sbjct  121  A-LSSPNAMDEKLTNMFSDENPNACSIM  147



>gb|KHG01622.1| Copper-exporting P-type ATPase A [Gossypium arboreum]
Length=150

 Score =   191 bits (485),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 120/151 (79%), Gaps = 6/151 (4%)
 Frame = -1

Query  496  MGILDHLSDLFE---VkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            MG LD LSD          ++KKRK+MQTV+I+VKMDCDGCERRV+NAVSSMKG KSV++
Sbjct  1    MGALDSLSDYISDLVTVHGKRKKRKVMQTVEIKVKMDCDGCERRVKNAVSSMKGVKSVEV  60

Query  325  NRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            NRK++ V+VSGYVE  KVL KV+STGK+AE WPYV Y+LV+YPY   AYDKKAPSGYV+ 
Sbjct  61   NRKKSYVSVSGYVEPNKVLNKVKSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGYVKE  120

Query  145  VPQAIIPSPNT--ERFTSMFSDENPNACSLM  59
              QA +PSPN   E+F + FSDENPNACS+M
Sbjct  121  AVQA-LPSPNAVDEKFVTFFSDENPNACSIM  150



>emb|CAN63619.1| hypothetical protein VITISV_017617 [Vitis vinifera]
Length=124

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 111/124 (90%), Gaps = 1/124 (1%)
 Frame = -1

Query  427  MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTG  248
            MQTV+I+VKMDCDGCERRV+NAV+SM+G KSV++ RKQ+RVTV+GYV+A KVLK+V+STG
Sbjct  1    MQTVEIKVKMDCDGCERRVKNAVTSMRGVKSVEVIRKQSRVTVTGYVDANKVLKRVKSTG  60

Query  247  KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQAI-IPSPNTERFTSMFSDENPNA  71
            K+AE WPY+ Y+LVSYPYA  AYDK+AP+GYVRNV QA+ +P+   +R TS+FSD+NPNA
Sbjct  61   KRAEFWPYIPYNLVSYPYATQAYDKRAPAGYVRNVVQAVAVPNDPEDRITSLFSDDNPNA  120

Query  70   CSLM  59
            CS+M
Sbjct  121  CSIM  124



>ref|XP_006357789.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum tuberosum]
Length=148

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 122/148 (82%), Gaps = 2/148 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL-MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINR  320
            MG+LD+LS    V  RR++ ++  +QTV+I+VKMDCDGCERRV+NAV+ MKG K+V++ R
Sbjct  1    MGVLDYLSIFCTVTSRRRRTKRRPLQTVEIKVKMDCDGCERRVKNAVTRMKGVKTVEVIR  60

Query  319  KQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            KQ+RV VSGYV+  +VL +++STGK+AE+WPYV Y+LVSYPY   AYDKKAPSG+V+NVP
Sbjct  61   KQHRVIVSGYVDPARVLNRIKSTGKRAEMWPYVPYNLVSYPYVAQAYDKKAPSGFVKNVP  120

Query  139  QAII-PSPNTERFTSMFSDENPNACSLM  59
            QA+I P+   ER T +FSD+NPNACS+M
Sbjct  121  QALITPNATEERITHLFSDDNPNACSIM  148



>ref|XP_004512304.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cicer arietinum]
Length=145

 Score =   190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 122/148 (82%), Gaps = 5/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD LSD F V  ++K+K   MQTV+I+VKMDCDGCERRVRN+V++MKG K VD+NR+
Sbjct  1    MGALDFLSDYFSVTPKKKRKP--MQTVEIKVKMDCDGCERRVRNSVTNMKGVKEVDVNRE  58

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q++VTV+GYVEA KVLKKV+STGK+A+ WPYV+Y+LV+YPY   AY KKAPSG+V+N   
Sbjct  59   QSKVTVTGYVEANKVLKKVQSTGKRAKFWPYVEYNLVAYPYIAQAYAKKAPSGFVKNTEL  118

Query  136  AIIPSPN--TERFTSMFSDENPNACSLM  59
            A +P+PN   ++ TS FSD+NPNACS+M
Sbjct  119  A-LPNPNGHDDKITSFFSDDNPNACSIM  145



>ref|XP_007143033.1| hypothetical protein PHAVU_007G037900g [Phaseolus vulgaris]
 gb|ESW15027.1| hypothetical protein PHAVU_007G037900g [Phaseolus vulgaris]
Length=146

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 121/148 (82%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD LSD F V   +KK++  MQTV+I VKMDCDGCERRVRN+VS++ G K V+++RK
Sbjct  1    MGALDFLSDYFSVSTPKKKRKP-MQTVEIMVKMDCDGCERRVRNSVSNISGVKEVEVSRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q++VTV+GYV+  KVLKKV+STGK+AE WPY++Y+LV+YPY   AYDKKAPSGYV+N  Q
Sbjct  60   QSKVTVTGYVDRNKVLKKVQSTGKRAEFWPYIQYNLVAYPYVAQAYDKKAPSGYVKNTEQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A +P+PN   E+ TS+FSD+NPNAC +M
Sbjct  120  A-LPNPNAPDEKLTSLFSDDNPNACLIM  146



>ref|XP_002888817.1| hypothetical protein ARALYDRAFT_894936 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65076.1| hypothetical protein ARALYDRAFT_894936 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score =   190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 124/153 (81%), Gaps = 8/153 (5%)
 Frame = -1

Query  496  MGILD----HLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD    ++SD F V R R+K++ +MQTV+I+VKMDCDGCERRV+NAVSSMKG +SV+
Sbjct  1    MGALDSLSEYISDYFRVSRNRRKRK-VMQTVNIKVKMDCDGCERRVKNAVSSMKGVRSVE  59

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +NRK ++VTVSGYVE KKVLK+VE TGKKAE+WPYV Y++V+YPYA G YDKKAP+GYVR
Sbjct  60   VNRKIHKVTVSGYVEPKKVLKRVERTGKKAEIWPYVPYNMVAYPYAVGTYDKKAPAGYVR  119

Query  148  NVPQA---IIPSPNTERFTSMFSDENPNACSLM  59
               Q+   ++P    + F S+FSDENPNAC++M
Sbjct  120  KSEQSQLQLLPGAPDDNFVSLFSDENPNACTVM  152



>ref|XP_004232003.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum lycopersicum]
Length=148

 Score =   189 bits (481),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 121/148 (82%), Gaps = 2/148 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL-MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINR  320
            MG+LD+LS    V   R++ ++  +QTV+I+VKMDCDGCERRV+NAV  MKG K+V++ R
Sbjct  1    MGVLDYLSIFCTVTSTRRRSKRRPLQTVEIKVKMDCDGCERRVKNAVRRMKGVKTVEVIR  60

Query  319  KQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            KQ+RV VSGYV+ ++VL +++STGK+AE+WPYV Y+LVSYPY   AYDKKAPSG+V+NVP
Sbjct  61   KQHRVIVSGYVDPQRVLNRIKSTGKRAEMWPYVPYNLVSYPYVAQAYDKKAPSGFVKNVP  120

Query  139  QAII-PSPNTERFTSMFSDENPNACSLM  59
            QA+I P+   ER T +FSD+NPNACS+M
Sbjct  121  QALITPNATEERITHLFSDDNPNACSIM  148



>ref|XP_010471111.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Camelina sativa]
Length=170

 Score =   190 bits (482),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 126/153 (82%), Gaps = 8/153 (5%)
 Frame = -1

Query  496  MGILD----HLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD    ++SD F+V +R++K++ +MQTV+I+VKMDCDGCERRV+NAVSSMKGAKSV+
Sbjct  19   MGALDSLSDYISDYFQVTKRKRKRK-VMQTVNIKVKMDCDGCERRVKNAVSSMKGAKSVE  77

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +NRK ++VTVSGYVE KKVLK+VE TGKKAE+WPYV Y++V+YPYA G YDKKAP+G+VR
Sbjct  78   VNRKIHKVTVSGYVEPKKVLKRVERTGKKAEIWPYVPYNMVAYPYAVGTYDKKAPAGFVR  137

Query  148  NVPQAI---IPSPNTERFTSMFSDENPNACSLM  59
               Q+    +P    + F S+FSDENPNAC++M
Sbjct  138  KSEQSQLQPLPGAPDDNFISIFSDENPNACTVM  170



>ref|XP_008811964.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Phoenix dactylifera]
Length=150

 Score =   189 bits (480),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 124/151 (82%), Gaps = 6/151 (4%)
 Frame = -1

Query  496  MGILDHLSDL---FEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            MG LD+LS+     E +R  +KKRK +QTV+++VKMDCDGCERRV++AV+S+KG   VD+
Sbjct  1    MGALDYLSNFCSVTETRRSLRKKRKPLQTVELKVKMDCDGCERRVKHAVTSLKGVTMVDV  60

Query  325  NRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            NRKQ+RVTV+G+VE KKVL KV+STGK+ E WPYV Y+LV YPYA  AYDK+APSG+VRN
Sbjct  61   NRKQSRVTVTGHVEPKKVLNKVKSTGKRVEFWPYVPYNLVYYPYAAQAYDKRAPSGFVRN  120

Query  145  VPQAIIPSPNT--ERFTSMFSDENPNACSLM  59
            V QA +PSP    E+FTS+FSD+NPNACS+M
Sbjct  121  VDQA-VPSPGAPEEQFTSLFSDDNPNACSIM  150



>ref|NP_177261.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
 gb|AAG51694.1|AC016972_13 putative isoprenylated protein; 28702-28078 [Arabidopsis thaliana]
 gb|AAM65427.1| putative isoprenylated protein [Arabidopsis thaliana]
 dbj|BAC42520.1| putative isoprenylated protein [Arabidopsis thaliana]
 gb|AAO39894.1| At1g71050 [Arabidopsis thaliana]
 gb|AEE35156.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
Length=152

 Score =   189 bits (480),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 124/153 (81%), Gaps = 8/153 (5%)
 Frame = -1

Query  496  MGILD----HLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD    ++SD F V R+R+K++ +MQTV+I+VKMDCDGCERRV+NAVSSMKG KSV+
Sbjct  1    MGALDSLSEYISDYFRVTRKRRKRK-VMQTVNIKVKMDCDGCERRVKNAVSSMKGVKSVE  59

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +NRK ++VTVSGYVE KKVLK++E TGKKAE+WPYV Y++V+YPYA G YDKKAP+GYVR
Sbjct  60   VNRKIHKVTVSGYVEPKKVLKRIERTGKKAEIWPYVPYNMVAYPYAVGTYDKKAPAGYVR  119

Query  148  NVPQA---IIPSPNTERFTSMFSDENPNACSLM  59
               Q+   ++P      + S+FSDENPNAC++M
Sbjct  120  KSEQSQLQLLPGAPENHYISLFSDENPNACTVM  152



>ref|XP_009608111.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Nicotiana tomentosiformis]
Length=147

 Score =   189 bits (479),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+LD+ S+     R R+ KRK +QTV+I+VKMDCDGCERRV+NAV  MKG K+V++ RK
Sbjct  1    MGVLDYFSNFCYDTRIRRTKRKPLQTVEIKVKMDCDGCERRVKNAVKRMKGVKTVEVIRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            QNRV VSGY+E ++VL +V+STGK+AE+WPYV Y+LVSYPY   AYDKKAP+G+V+NVPQ
Sbjct  61   QNRVIVSGYIEPQRVLNRVKSTGKRAEMWPYVPYNLVSYPYVAQAYDKKAPAGFVKNVPQ  120

Query  136  A-IIPSPNTERFTSMFSDENPNACSLM  59
            A + P+   E+ T +FSD+NPNACS+M
Sbjct  121  ARLAPNATEEKITYLFSDDNPNACSIM  147



>ref|XP_010427920.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Camelina sativa]
Length=152

 Score =   188 bits (478),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 126/153 (82%), Gaps = 8/153 (5%)
 Frame = -1

Query  496  MGILD----HLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD    ++SD F+V +RR+K++ +MQTV+I+VKMDCDGCERRV+NAVSSMKGAK+V+
Sbjct  1    MGALDSLSDYISDYFQVSKRRRKRK-VMQTVNIKVKMDCDGCERRVKNAVSSMKGAKAVE  59

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +NRK ++VTVSGYVE KKVLK+VE TGKKAE+WPYV Y++V+YPYA G YDKKAP+G+VR
Sbjct  60   VNRKIHKVTVSGYVEPKKVLKRVERTGKKAEIWPYVPYNVVAYPYAVGTYDKKAPAGFVR  119

Query  148  NVPQAI---IPSPNTERFTSMFSDENPNACSLM  59
               Q+    +P    + F S+FSDENPNAC++M
Sbjct  120  KSEQSQLQPLPGAPDDNFISIFSDENPNACTVM  152



>ref|XP_006416133.1| hypothetical protein EUTSA_v10008952mg [Eutrema salsugineum]
 gb|ESQ34486.1| hypothetical protein EUTSA_v10008952mg [Eutrema salsugineum]
Length=164

 Score =   189 bits (479),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 123/152 (81%), Gaps = 6/152 (4%)
 Frame = -1

Query  496  MGILD----HLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD    +LSD F V  R++KK K+MQTV+I+VK+DCDGCER+++NAVSSMKGAKSV+
Sbjct  13   MGALDFLSDYLSDHFYVSIRKRKKHKVMQTVNIKVKIDCDGCERKIKNAVSSMKGAKSVE  72

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTG-KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYV  152
            +NRK N+VTVSGYV+ KKVLK+V+STG KKAELWPYV Y +V+YPYA GAYDK+AP G+V
Sbjct  73   VNRKMNKVTVSGYVDPKKVLKRVQSTGKKKAELWPYVPYTMVAYPYAAGAYDKRAPPGFV  132

Query  151  RNVPQA-IIPSPNTERFTSMFSDENPNACSLM  59
            R   QA   P    ++  S+FSDENPNAC++M
Sbjct  133  RKSEQAQAQPGGTDDKLMSLFSDENPNACTVM  164



>ref|XP_006302959.1| hypothetical protein CARUB_v10021096mg [Capsella rubella]
 gb|EOA35857.1| hypothetical protein CARUB_v10021096mg [Capsella rubella]
Length=152

 Score =   188 bits (477),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 122/152 (80%), Gaps = 6/152 (4%)
 Frame = -1

Query  496  MGILDHLSDL---FEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            MG LD LSD    +    +R++KRK+MQTV+I+VKMDCDGCERRV+NAVSSMKG KSV++
Sbjct  1    MGALDSLSDYISDYFYVSKRRRKRKVMQTVNIKVKMDCDGCERRVKNAVSSMKGVKSVEM  60

Query  325  NRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            NRK N+VTVSGYVE KKVLK+VE TGKKAE+WPYV Y++V+YPYA G YDKKAP+G+VR 
Sbjct  61   NRKINKVTVSGYVEPKKVLKRVEGTGKKAEIWPYVPYNVVAYPYAVGTYDKKAPAGFVRK  120

Query  145  VPQAI---IPSPNTERFTSMFSDENPNACSLM  59
              Q+    +P    + F S+FSDENPNAC++M
Sbjct  121  SEQSQLQPLPGAPDDNFISLFSDENPNACTVM  152



>ref|XP_010415801.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Camelina sativa]
Length=169

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 124/153 (81%), Gaps = 9/153 (6%)
 Frame = -1

Query  496  MGILD----HLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD    ++SD F+V RRRK+K  +MQTV+I+VKMDCDGCERRV+NAVSSMKGAKSV+
Sbjct  19   MGALDSLSDYISDYFQVTRRRKRK--VMQTVNIKVKMDCDGCERRVKNAVSSMKGAKSVE  76

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +NRK ++VTVSGYVE KKVLK+VE TGKKAE+WPYV Y++V+YPYA G YDKKAP G+VR
Sbjct  77   VNRKIHKVTVSGYVEPKKVLKRVERTGKKAEIWPYVPYNMVAYPYAVGTYDKKAPVGFVR  136

Query  148  NVPQAI---IPSPNTERFTSMFSDENPNACSLM  59
               Q+    +P    E F S++SDENPNAC++M
Sbjct  137  KSEQSQLQPLPGAPDENFISIYSDENPNACTVM  169



>ref|XP_010670695.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Beta vulgaris subsp. vulgaris]
Length=149

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 118/149 (79%), Gaps = 3/149 (2%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+LDH+ DL +    ++K RK +QTV+I+VKMDCDGCERRVRN+V  +KG KSVD+NRK
Sbjct  1    MGMLDHILDLCDTTVVKRKNRKPLQTVEIKVKMDCDGCERRVRNSVIHIKGVKSVDVNRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q++VTV+G VE  +VL KV+STGK+AE WPYV Y++VSYPYA   YDKKAPSGYV+N PQ
Sbjct  61   QSKVTVTGNVEPNRVLNKVKSTGKRAEFWPYVPYNVVSYPYAAQVYDKKAPSGYVKNAPQ  120

Query  136  AIIPSPNT--ERFTSMFSDENPNA-CSLM  59
            A   + +   E++  MFSDENPNA CS+M
Sbjct  121  AFATTSDATQEKYIQMFSDENPNASCSIM  149



>ref|XP_010922550.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Elaeis guineensis]
Length=151

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 118/151 (78%), Gaps = 5/151 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkk----krKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD++S+ F     R+     KRK +QTV+I+VKMDCDGCERRV++AV S+KG  SV+
Sbjct  1    MGALDYISNFFSFTNTRRALKWKKRKPLQTVNIKVKMDCDGCERRVKHAVRSLKGVTSVN  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +NRK +RVTVSG+VE  KVLKKV+STGK AE WPYV Y+LV YPY  GAYDKKAPSG+VR
Sbjct  61   VNRKDSRVTVSGHVEPNKVLKKVKSTGKVAEFWPYVPYNLVVYPYVGGAYDKKAPSGFVR  120

Query  148  NVPQAII-PSPNTERFTSMFSDENPNACSLM  59
            NVPQA   P    E++ S+FSDENPNACS+M
Sbjct  121  NVPQAQSKPDATEEKYMSVFSDENPNACSIM  151



>ref|XP_011075734.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Sesamum indicum]
Length=153

 Score =   187 bits (476),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 117/153 (76%), Gaps = 7/153 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG +DH+SD+  V   R   RK MQTV+I+VKMDC+GCERRVRNAVSS+ G + V+INRK
Sbjct  1    MGFVDHMSDVCAVTSTRNSIRKPMQTVEIKVKMDCEGCERRVRNAVSSINGVRCVEINRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RV VSGYVE  KVL +V+STGKKAE WPYV+Y+L  YPYA  AYDKKAPSGYVRNV +
Sbjct  61   QSRVRVSGYVEPNKVLNRVKSTGKKAEFWPYVQYNLTYYPYALEAYDKKAPSGYVRNVAE  120

Query  136  AI---IPSPNT----ERFTSMFSDENPNACSLM  59
            A    +P+ N       +T++FSDEN +ACS+M
Sbjct  121  AFPDPLPTSNAPHTLHNYTTLFSDENVDACSIM  153



>ref|XP_008457089.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Cucumis melo]
Length=144

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 117/146 (80%), Gaps = 2/146 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+LS+ F +    + K K MQTV+I+VKMDCDGCERRVRNAV+SMKG +SV++ RK
Sbjct  1    MGALDYLSN-FCIVTPTRTKHKPMQTVEIKVKMDCDGCERRVRNAVTSMKGVQSVEVMRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RV V GYV+A KVLK+V+STGK+AE WPY+   LV +PYA GAYDKKAPSG+VRNV Q
Sbjct  60   QHRVRVIGYVDANKVLKRVKSTGKRAEFWPYIPQHLVHHPYAFGAYDKKAPSGFVRNVVQ  119

Query  136  AIIPSPNTERFTSMFSDENPNACSLM  59
            A  P+P+ E + S FSD+N +ACS+M
Sbjct  120  A-FPTPHEENYVSFFSDDNVHACSIM  144



>ref|XP_011099491.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Sesamum indicum]
Length=146

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 118/147 (80%), Gaps = 2/147 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+LS+   V   R +++  MQTV+IRVKMDCDGCERRV+NAV +MKG ++V++NRK
Sbjct  1    MGALDYLSNFCTVTSTRGRRKP-MQTVEIRVKMDCDGCERRVKNAVKNMKGVRTVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTVSG+V+  KVLK+V++TGK+AE WPY+ Y+LV YPY    YDK+AP+G+VRN  Q
Sbjct  60   QHRVTVSGFVDPNKVLKRVKNTGKRAEFWPYIPYNLVQYPYVAQVYDKRAPAGFVRNATQ  119

Query  136  AI-IPSPNTERFTSMFSDENPNACSLM  59
            A+ +P+   ER T +FSD+NPNACS+M
Sbjct  120  AVPMPNATDERITYLFSDDNPNACSIM  146



>ref|XP_010477581.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Camelina sativa]
Length=152

 Score =   186 bits (473),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 123/152 (81%), Gaps = 6/152 (4%)
 Frame = -1

Query  496  MGILDHLSDLF----EVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD LS+ F    +V  R++KKRK+MQTV+I+VKMDCDGCER+++NAVSSMKGAKSV+
Sbjct  1    MGALDSLSEYFSNHFDVSIRKRKKRKVMQTVNIKVKMDCDGCERKIKNAVSSMKGAKSVE  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTG-KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYV  152
            +NRK ++VTVSGYV+ KKVLK V+STG KKAELWPYV Y +V+YPYA GAYDK+AP G+V
Sbjct  61   VNRKMHKVTVSGYVDPKKVLKTVQSTGKKKAELWPYVPYTMVAYPYAAGAYDKRAPPGFV  120

Query  151  RNVPQA-IIPSPNTERFTSMFSDENPNACSLM  59
            R   QA   P    ++  S+FSDENPNAC++M
Sbjct  121  RKSEQAQAQPGGTDDKLMSLFSDENPNACTVM  152



>ref|XP_009592412.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nicotiana tomentosiformis]
Length=148

 Score =   186 bits (473),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 119/149 (80%), Gaps = 4/149 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG++DH+ + F +      K+K MQTV+I+VKMDCDGCERRV+N+V  MKG K+V++NRK
Sbjct  1    MGVMDHIVNFFTITTNTNNKKKSMQTVEIKVKMDCDGCERRVKNSVKYMKGVKTVEVNRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q++VTV+GYV+  +VL +++STGK+AE WPYV Y++V YP+AP AYDK+AP+G V+NV Q
Sbjct  61   QSKVTVNGYVDPNRVLNRIKSTGKRAEFWPYVPYNVVYYPHAPQAYDKRAPAGMVKNVAQ  120

Query  136  AIIPSPNT---ERFTSMFSDENPNACSLM  59
            A +P PN    E+F  +FSD+NP+ACS+M
Sbjct  121  AQLP-PNATEEEKFAYLFSDDNPSACSIM  148



>ref|XP_006390811.1| hypothetical protein EUTSA_v10019290mg [Eutrema salsugineum]
 gb|ESQ28097.1| hypothetical protein EUTSA_v10019290mg [Eutrema salsugineum]
Length=150

 Score =   186 bits (472),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 124/151 (82%), Gaps = 6/151 (4%)
 Frame = -1

Query  496  MGILD----HLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG+LD    ++SD F V R+R+K++ +MQTV+I+VKMDCDGCERRV+NAVSSMKG KSV+
Sbjct  1    MGVLDSLCDYISDYFHVSRKRRKRK-VMQTVNIKVKMDCDGCERRVKNAVSSMKGVKSVE  59

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +NRK ++VTVSGYVE KKVLK+VE TGKKAE+WPYV Y++V+YPYA G YDKKAP+G+VR
Sbjct  60   MNRKIHKVTVSGYVEPKKVLKRVERTGKKAEIWPYVPYNVVAYPYAVGVYDKKAPAGFVR  119

Query  148  NVPQAI-IPSPNTERFTSMFSDENPNACSLM  59
               Q+   P    ++  S+FSDENPNAC++M
Sbjct  120  KSEQSQPFPGAPDDKIMSLFSDENPNACTVM  150



>ref|XP_002890547.1| hypothetical protein ARALYDRAFT_472550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66806.1| hypothetical protein ARALYDRAFT_472550 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score =   186 bits (472),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 122/152 (80%), Gaps = 6/152 (4%)
 Frame = -1

Query  496  MGILDHLSDLFE----VkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD LS+ F     V  R+++KRKLMQTV+I+VK+DCDGCER+++NAVSSMKGAKSV+
Sbjct  1    MGALDSLSEYFSNHFYVSIRKRRKRKLMQTVNIKVKIDCDGCERKIKNAVSSMKGAKSVE  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTG-KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYV  152
            +NRK ++VTVSGYV+ KKVLK+V+STG KKAELWPYV Y +V+YPYA GAYDKKAP G+V
Sbjct  61   VNRKMHKVTVSGYVDPKKVLKRVQSTGKKKAELWPYVPYTMVAYPYAAGAYDKKAPPGFV  120

Query  151  RNVPQA-IIPSPNTERFTSMFSDENPNACSLM  59
            R    A   P    ++  S+FSDENPNAC++M
Sbjct  121  RKSEHAQAQPGSTDDKLMSLFSDENPNACTVM  152



>emb|CDP02719.1| unnamed protein product [Coffea canephora]
Length=147

 Score =   186 bits (472),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 118/148 (80%), Gaps = 3/148 (2%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+LS+   V   R+ KRK MQTV+I+VKMDCDGCERRV+NAV  MKG K+++++RK
Sbjct  1    MGALDYLSNFCTVTSTRRSKRKPMQTVEIKVKMDCDGCERRVKNAVKDMKGLKTLEVDRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RV VSGYV+  KVLK+++ TGK+AE WPYV ++LV YPY  GAYDK+AP+G+VRNV Q
Sbjct  61   QSRVKVSGYVDPNKVLKRIKDTGKRAEFWPYVPHNLVFYPYVTGAYDKRAPAGFVRNVVQ  120

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A  P PN   ER T +FSD+NPNACS+M
Sbjct  121  A-APPPNATEERITYLFSDDNPNACSIM  147



>ref|XP_006305742.1| hypothetical protein CARUB_v10010550mg [Capsella rubella]
 gb|EOA38640.1| hypothetical protein CARUB_v10010550mg [Capsella rubella]
Length=152

 Score =   186 bits (472),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 124/152 (82%), Gaps = 6/152 (4%)
 Frame = -1

Query  496  MGILDHLSDLF----EVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD LS+ F    +V  R++KKRK+MQTV+I+VK+DCDGCER+++NAVSSMKGAKSV+
Sbjct  1    MGALDSLSEYFSNHFDVSIRKRKKRKVMQTVNIKVKIDCDGCERKIKNAVSSMKGAKSVE  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTG-KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYV  152
            +NRK ++VTVSGYV+ KKVLK+V+STG KKAELWPYV Y +V+YPYA GAYDKKAP G+V
Sbjct  61   VNRKIHKVTVSGYVDPKKVLKRVQSTGKKKAELWPYVPYTMVAYPYAAGAYDKKAPPGFV  120

Query  151  RNVPQA-IIPSPNTERFTSMFSDENPNACSLM  59
            R   QA   P    ++  S+FSDENPNAC++M
Sbjct  121  RKSEQAQAQPGGTDDKLMSLFSDENPNACTVM  152



>gb|KFK41529.1| hypothetical protein AALP_AA2G141400 [Arabis alpina]
Length=150

 Score =   186 bits (472),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 124/151 (82%), Gaps = 6/151 (4%)
 Frame = -1

Query  496  MGILD----HLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD    ++SD F V ++R+K+  +MQTV+++VKMDCDGCERRV+NAVSSM+G KSV+
Sbjct  1    MGALDSLSEYISDYFRVAKKRRKRN-VMQTVNVKVKMDCDGCERRVKNAVSSMRGVKSVE  59

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +NRK ++VTVSGYVE KKVLK++E TGKKAE+WPYV Y++V+YPYA GAYDKKAP+G+VR
Sbjct  60   VNRKIHKVTVSGYVEPKKVLKRIERTGKKAEIWPYVPYNMVAYPYAVGAYDKKAPTGFVR  119

Query  148  NVPQAI-IPSPNTERFTSMFSDENPNACSLM  59
               Q+  +P    ++  SMFSD+NPNAC++M
Sbjct  120  KSEQSQPLPGAPDDKIMSMFSDDNPNACTVM  150



>ref|XP_009103208.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Brassica rapa]
Length=152

 Score =   186 bits (471),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = -1

Query  490  ILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQN  311
            + D+ S+ F+V  R++KK K+MQTV+I+VK+DCDGCER+++NAVSSMKGAKSV++NRK +
Sbjct  7    LFDYFSNSFDVSIRKRKKHKVMQTVNIKVKIDCDGCERKIKNAVSSMKGAKSVEVNRKMH  66

Query  310  RVTVSGYVEAKKVLKKVESTG-KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQA  134
            +VTVSGYV+ KKVLK+V+STG KKAELWPYV Y +V+YPYA GAYDK+AP+G+VR   QA
Sbjct  67   KVTVSGYVDPKKVLKRVQSTGKKKAELWPYVPYTMVAYPYAAGAYDKRAPAGFVRKSEQA  126

Query  133  -IIPSPNTERFTSMFSDENPNACSLM  59
               P    ++  S+FSDENPNAC +M
Sbjct  127  QAQPGGTDDKLMSLFSDENPNACIVM  152



>ref|XP_010916340.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Elaeis guineensis]
Length=150

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 122/151 (81%), Gaps = 6/151 (4%)
 Frame = -1

Query  496  MGILDHLSDL---FEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            MG LD+LS+     E +R  +KKRK +QTV+++VKMDCDGCERRV++AV+S+KG   VD+
Sbjct  1    MGALDYLSNFCSVTETRRSLRKKRKPLQTVELKVKMDCDGCERRVKHAVTSLKGVTMVDV  60

Query  325  NRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            NRKQ+RVTV+G+VE KKVL KV+STGK+ E WPYV Y+LV YPYA  AYDK+APSGYVRN
Sbjct  61   NRKQSRVTVTGHVEPKKVLNKVKSTGKRVEFWPYVPYNLVYYPYAAQAYDKRAPSGYVRN  120

Query  145  VPQAIIPSPNT--ERFTSMFSDENPNACSLM  59
            V QA  PSP    E+F S+FSD+NPNACS+M
Sbjct  121  VVQA-EPSPGAPEEQFISLFSDDNPNACSIM  150



>ref|XP_009115570.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Brassica rapa]
 gb|AAN23108.2| putative farnesylated protein [Brassica rapa subsp. pekinensis]
Length=152

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 123/152 (81%), Gaps = 6/152 (4%)
 Frame = -1

Query  496  MGILDHLS----DLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG L+ LS    D F V  R++KKRK+MQTV+I+VK+DCDGCER+++NAVSSMKGAKSV+
Sbjct  1    MGALNFLSGYFSDHFYVSIRKRKKRKVMQTVNIKVKIDCDGCERKIKNAVSSMKGAKSVE  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTG-KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYV  152
            +NRK ++VTVSGYV+ KKVLKKV+STG KKAELWPYV Y +V+YPYA GAYDK+AP G+V
Sbjct  61   VNRKMHKVTVSGYVDPKKVLKKVQSTGKKKAELWPYVPYTMVAYPYAAGAYDKRAPPGFV  120

Query  151  RNVPQA-IIPSPNTERFTSMFSDENPNACSLM  59
            R   QA   P    ++  S+FSDENPNAC++M
Sbjct  121  RKSEQAQAQPGGTDDKLMSLFSDENPNACTIM  152



>ref|XP_010460075.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Camelina sativa]
Length=152

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 123/152 (81%), Gaps = 6/152 (4%)
 Frame = -1

Query  496  MGILDHLSDLF----EVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD LS+ F    +V  R++KKRK+MQTV+I+VK+DCDGCER+++NAVSSMKGAKSV+
Sbjct  1    MGALDSLSEYFSNHFDVSIRKRKKRKVMQTVNIKVKIDCDGCERKIKNAVSSMKGAKSVE  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTG-KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYV  152
            +NRK ++VTVSGYV+ KKVLK V+STG KKAELWPYV Y +V+YPYA GAYDK+AP G+V
Sbjct  61   VNRKMHKVTVSGYVDPKKVLKTVQSTGKKKAELWPYVPYTMVAYPYAAGAYDKRAPPGFV  120

Query  151  RNVPQA-IIPSPNTERFTSMFSDENPNACSLM  59
            R   QA   P    ++  S+FSDENPNAC++M
Sbjct  121  RKSEQAQAQPGGTDDKLMSLFSDENPNACTVM  152



>ref|XP_006845276.1| hypothetical protein AMTR_s00005p00265500 [Amborella trichopoda]
 gb|ERN06951.1| hypothetical protein AMTR_s00005p00265500 [Amborella trichopoda]
Length=147

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 124/149 (83%), Gaps = 5/149 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+LS+   +   RKK++ L QTV+I+VKMDC+GCE++V++AVSSMKG + V++NRK
Sbjct  1    MGALDYLSNFITISGSRKKRKPL-QTVEIKVKMDCEGCEKKVKDAVSSMKGVRKVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTG-KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            Q++VTVSGYVEA KVLKKV+STG KKAE WPYV Y+LV YPYAP +YDKKAP+G+V+ + 
Sbjct  60   QHKVTVSGYVEANKVLKKVQSTGKKKAEFWPYVPYNLVYYPYAPQSYDKKAPAGHVKKLD  119

Query  139  QAIIPSPNT--ERFTSMFSDENPNACSLM  59
               +PSP T  ER+TS+FSD+NP+AC++M
Sbjct  120  YG-LPSPTTTQERYTSLFSDDNPHACTIM  147



>ref|XP_007216858.1| hypothetical protein PRUPE_ppa021641mg [Prunus persica]
 ref|XP_008229335.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Prunus mume]
 gb|EMJ18057.1| hypothetical protein PRUPE_ppa021641mg [Prunus persica]
Length=147

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 115/148 (78%), Gaps = 3/148 (2%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+LS+   V   R K++  MQTV+I+VKMDCDGCERRV+NAV+SMKG K+V++NRK
Sbjct  1    MGALDYLSNFCTVTSTRSKRKA-MQTVEIKVKMDCDGCERRVKNAVTSMKGVKAVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RV VSGYVE  KVLK+V+STGK+AE WPY+   LV YPYA G YD++AP+GYVRNV Q
Sbjct  60   QSRVIVSGYVEPNKVLKRVKSTGKRAEFWPYIPQHLVHYPYASGVYDRRAPNGYVRNVVQ  119

Query  136  AIIPSPN--TERFTSMFSDENPNACSLM  59
            A   S N   E   S+FSD+N NACS+M
Sbjct  120  AFPASMNGPEENMVSLFSDDNVNACSIM  147



>gb|EYU44589.1| hypothetical protein MIMGU_mgv1a018204mg [Erythranthe guttata]
Length=150

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 118/151 (78%), Gaps = 6/151 (4%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+ S+   V   R K++  MQTV+I+VKMDCDGCERRV+NA  +MKG +SVD+NRK
Sbjct  1    MGALDYFSNFCTVTSTRGKRKP-MQTVEIKVKMDCDGCERRVKNACKNMKGVRSVDVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGK-KAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            Q+RVTVSG+V+  KVLK+V++TGK +AE WPY+ Y+LV YPYA  AYDK+APSG+VRNV 
Sbjct  60   QHRVTVSGFVDPNKVLKRVKNTGKTRAEFWPYIPYNLVQYPYASQAYDKRAPSGFVRNVA  119

Query  139  QAIIP-SPNT---ERFTSMFSDENPNACSLM  59
            QA  P  PN    ER T +FSD+NPNACS+M
Sbjct  120  QANFPLMPNAAEEERITHLFSDDNPNACSIM  150



>ref|XP_008467147.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis melo]
Length=148

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 119/148 (80%), Gaps = 2/148 (1%)
 Frame = -1

Query  496  MGILDHLSD-LFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINR  320
            MGI+  +SD + +    RKKKRK  QTV+I+VKMDCDGCERR++NAVSS+KG KSV ++R
Sbjct  1    MGIVGFVSDYVTDNFGSRKKKRKPNQTVEIKVKMDCDGCERRIKNAVSSVKGVKSVKVDR  60

Query  319  KQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            KQ++VTV+GY EA KVLKKVESTGKKAELWPYV Y+ V+YPY P AYDKKAP GYV+  P
Sbjct  61   KQSKVTVNGYAEATKVLKKVESTGKKAELWPYVPYNSVAYPYVPQAYDKKAPPGYVKKAP  120

Query  139  QAI-IPSPNTERFTSMFSDENPNACSLM  59
            QA+ +     +R T MFSDENPNACS+M
Sbjct  121  QALPVDEALDQRLTMMFSDENPNACSIM  148



>ref|XP_004150477.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
 ref|XP_004161986.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
 gb|KGN51508.1| hypothetical protein Csa_5G571510 [Cucumis sativus]
Length=148

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 119/148 (80%), Gaps = 2/148 (1%)
 Frame = -1

Query  496  MGILDHLSD-LFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINR  320
            MGI+  +SD + +    RKKKRK  QTV+I+VKMDCDGCERR++NAVSS+KG KSV ++R
Sbjct  1    MGIVGFVSDYVTDNLGSRKKKRKPNQTVEIKVKMDCDGCERRIKNAVSSVKGVKSVKVDR  60

Query  319  KQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            KQ++VTV+GY EA KVLKKVESTGKKAELWPYV Y+ V+YPY P AYDKKAP GYV+  P
Sbjct  61   KQSKVTVNGYAEATKVLKKVESTGKKAELWPYVPYNSVAYPYVPQAYDKKAPPGYVKKAP  120

Query  139  QAI-IPSPNTERFTSMFSDENPNACSLM  59
            QA+ +     +R T MFSDENPNACS+M
Sbjct  121  QALPVDEALDQRLTMMFSDENPNACSIM  148



>ref|XP_010498791.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Camelina sativa]
Length=152

 Score =   184 bits (467),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 123/152 (81%), Gaps = 6/152 (4%)
 Frame = -1

Query  496  MGILDHLSDLF----EVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD LS+ F    +V  R++KKRK+MQTV+I+VK+DCDGCER+++NAVSSMKGAKSV+
Sbjct  1    MGALDSLSEYFSNHFDVSIRKRKKRKVMQTVNIKVKIDCDGCERKIKNAVSSMKGAKSVE  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTG-KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYV  152
            +NRK ++VTVSGYV+ KKVLK V+STG KKAELWPYV Y +V+YPYA GAYDK+AP G+V
Sbjct  61   VNRKIHKVTVSGYVDPKKVLKTVQSTGKKKAELWPYVPYTMVAYPYAAGAYDKRAPPGFV  120

Query  151  RNVPQA-IIPSPNTERFTSMFSDENPNACSLM  59
            R   QA   P    ++  S+FSDENPNAC++M
Sbjct  121  RKSEQAQAQPGGTDDKLMSLFSDENPNACTVM  152



>ref|XP_006827006.1| hypothetical protein AMTR_s00010p00214870 [Amborella trichopoda]
 gb|ERM94243.1| hypothetical protein AMTR_s00010p00214870 [Amborella trichopoda]
Length=154

 Score =   184 bits (466),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 121/149 (81%), Gaps = 6/149 (4%)
 Frame = -1

Query  493  GILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQ  314
            G L++ SDL    +++KKK++  QTVD++V MDC+GCE +VR AVSS+KG KSV+ +RK 
Sbjct  8    GTLEYFSDLLSRTQKKKKKKQF-QTVDLKVTMDCEGCENKVRKAVSSLKGVKSVETSRKD  66

Query  313  NRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQA  134
             RV+V+GYVEAKKVLKKV+ TGKKAE WPYV Y+LV++PYAP AYDKKAP+GYVRNV ++
Sbjct  67   KRVSVTGYVEAKKVLKKVQDTGKKAEFWPYVPYNLVAHPYAPQAYDKKAPAGYVRNV-ES  125

Query  133  IIPS----PNTERFTSMFSDENPNACSLM  59
            I+P+       E+ TSMFSD+NPNACS+M
Sbjct  126  IVPTNSDDKQEEKMTSMFSDDNPNACSIM  154



>emb|CDY04750.1| BnaC05g18390D [Brassica napus]
Length=153

 Score =   183 bits (465),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 123/153 (80%), Gaps = 7/153 (5%)
 Frame = -1

Query  496  MGIL----DHLSDLFEVkrrrkkkrKLMQ-TVDIRVKMDCDGCERRVRNAVSSMKGAKSV  332
            MG L    D+LSD F V  R++KKRK+MQ TV+I+VK+DCDGCER+++NAVSSMKGAKSV
Sbjct  1    MGALNFLSDYLSDHFYVSIRKRKKRKIMQQTVNIKVKIDCDGCERKIKNAVSSMKGAKSV  60

Query  331  DINRKQNRVTVSGYVEAKKVLKKVESTG-KKAELWPYVKYDLVSYPYAPGAYDKKAPSGY  155
            ++NRK ++VTVSGYV+ KKVLKKV STG KKAELWPYV Y +V+YPYA GAYDK+AP G+
Sbjct  61   EVNRKMHKVTVSGYVDPKKVLKKVHSTGKKKAELWPYVPYTMVAYPYAAGAYDKRAPPGF  120

Query  154  VRNVPQA-IIPSPNTERFTSMFSDENPNACSLM  59
            VR   QA   P    ++  S+FSDENPNAC++M
Sbjct  121  VRKSEQAQAQPGGTDDKLMSLFSDENPNACTIM  153



>ref|XP_004140740.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
 gb|KGN57435.1| hypothetical protein Csa_3G185150 [Cucumis sativus]
Length=144

 Score =   183 bits (464),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 115/146 (79%), Gaps = 2/146 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+ S+ F +    + K K MQTV+I+VKMDCDGCERRVRNAV+SMKG KSV++ RK
Sbjct  1    MGALDYFSN-FCIVTPTRTKHKPMQTVEIKVKMDCDGCERRVRNAVTSMKGVKSVEVMRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RV V G V+A KVLK+V+STGK+AE WPY+   LV +PYA GAYDKKAPSG+VRNV Q
Sbjct  60   QHRVRVIGNVDANKVLKRVKSTGKRAEFWPYIPQHLVHHPYAFGAYDKKAPSGFVRNVVQ  119

Query  136  AIIPSPNTERFTSMFSDENPNACSLM  59
            A  P+P+ E + S FSD+N +ACS+M
Sbjct  120  A-FPTPHEENYVSFFSDDNVHACSIM  144



>ref|XP_004157176.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
Length=144

 Score =   182 bits (463),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 115/146 (79%), Gaps = 2/146 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+ S+ F +    + K K MQTV+I+VKMDCDGCERRVRNAV+SMKG KSV++ RK
Sbjct  1    MGALDYFSN-FCIVTPTRTKHKPMQTVEIKVKMDCDGCERRVRNAVTSMKGVKSVEVMRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RV V G V+A KVLK+V+STGK+AE WPY+   LV +PYA GAYDKKAPSG+VRNV Q
Sbjct  60   QHRVRVIGNVDANKVLKRVKSTGKRAEFWPYIPQHLVHHPYAFGAYDKKAPSGFVRNVVQ  119

Query  136  AIIPSPNTERFTSMFSDENPNACSLM  59
            A  P+P+ E + S FSD+N +ACS+M
Sbjct  120  A-FPTPHEENYISFFSDDNVHACSIM  144



>ref|XP_004234634.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum lycopersicum]
 ref|XP_006364017.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum tuberosum]
Length=147

 Score =   182 bits (463),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 118/147 (80%), Gaps = 1/147 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+L++++    +      K+K MQTV+I+VKMDCDGCERR++N+V  MKG KSV++ RK
Sbjct  1    MGVLEYIASFCTITTSTNNKKKSMQTVEIKVKMDCDGCERRIKNSVKHMKGVKSVEVIRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q++V ++GYV+  +VLKK++STGK+AE WPYV Y++V YP+AP AYDK+AP+G V+NVPQ
Sbjct  61   QSKVIINGYVDPNRVLKKIKSTGKRAEFWPYVPYNVVYYPHAPQAYDKRAPAGMVKNVPQ  120

Query  136  AII-PSPNTERFTSMFSDENPNACSLM  59
            A++ P+   E+F  +FSD+NP+ACS+M
Sbjct  121  ALLAPNATEEKFAYLFSDDNPSACSIM  147



>ref|XP_007150871.1| hypothetical protein PHAVU_004G001200g [Phaseolus vulgaris]
 gb|ESW22865.1| hypothetical protein PHAVU_004G001200g [Phaseolus vulgaris]
Length=150

 Score =   182 bits (462),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 116/151 (77%), Gaps = 6/151 (4%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+LS+   V   R K +  MQTV+I+V+MDCDGCERRVRNAV+S+KG KSV++NRK
Sbjct  1    MGALDYLSNFCTVTTTRTKHKA-MQTVEIKVRMDCDGCERRVRNAVTSLKGVKSVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGK-KAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            Q+RV VSGYV+  KVLK+V STGK +A+ WPYV+  LV YPYAPGAYD++APSGYVRNV 
Sbjct  60   QSRVVVSGYVDPNKVLKRVRSTGKVRAKFWPYVEQHLVYYPYAPGAYDRRAPSGYVRNVV  119

Query  139  QAI----IPSPNTERFTSMFSDENPNACSLM  59
            QA       +P  E F S FSD+N +ACS+M
Sbjct  120  QAFPDHSSNAPPQENFLSFFSDDNVHACSIM  150



>ref|NP_173712.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
 gb|AAK48953.1|AF370526_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL38620.1|AF446887_1 At1g22990/F19G10_22 [Arabidopsis thaliana]
 gb|AAK96563.1| At1g22990/F19G10_22 [Arabidopsis thaliana]
 gb|AAL66889.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30319.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
Length=152

 Score =   182 bits (462),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 123/152 (81%), Gaps = 6/152 (4%)
 Frame = -1

Query  496  MGILDHLSDLFE----VkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG L++LS+ F     V  R++KKRK+MQTV+I+VK+DCDGCER+++NAVSS+KGAKSV+
Sbjct  1    MGALNYLSEYFSNHFYVSIRKRKKRKVMQTVNIKVKIDCDGCERKIKNAVSSIKGAKSVE  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTG-KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYV  152
            +NRK ++VTVSGYV+ KKVLK V+STG KKAELWPYV Y +V+YPYA GAYDK+AP G+V
Sbjct  61   VNRKMHKVTVSGYVDPKKVLKTVQSTGKKKAELWPYVPYTMVAYPYAAGAYDKRAPPGFV  120

Query  151  RNVPQA-IIPSPNTERFTSMFSDENPNACSLM  59
            R   QA   P    ++  S+FSDENPNAC++M
Sbjct  121  RKSEQAQAQPGSTDDKLMSLFSDENPNACTVM  152



>gb|KDO64717.1| hypothetical protein CISIN_1g032170mg [Citrus sinensis]
Length=115

 Score =   181 bits (458),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 103/116 (89%), Gaps = 3/116 (3%)
 Frame = -1

Query  400  MDCDGCERRVRNAVSSMKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYV  221
            MDCDGCER+VRNAVSS++GAKSV++NRKQ+RVTV+GYV+  KVLKKV+STGK+AE WPYV
Sbjct  1    MDCDGCERKVRNAVSSIRGAKSVEVNRKQSRVTVTGYVDPNKVLKKVKSTGKRAEFWPYV  60

Query  220  KYDLVSYPYAPGAYDKKAPSGYVRNVPQAIIPSPNT--ERFTSMFSDENPNACSLM  59
             Y+LV+YPY   AYDKKAPSGYV+NV QA +PSPN   ER T++FSDENPNACS+M
Sbjct  61   PYNLVAYPYVAQAYDKKAPSGYVKNVVQA-LPSPNATDERLTTLFSDENPNACSIM  115



>ref|XP_009622067.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 isoform X2 [Nicotiana tomentosiformis]
Length=115

 Score =   181 bits (458),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 101/115 (88%), Gaps = 1/115 (1%)
 Frame = -1

Query  400  MDCDGCERRVRNAVSSMKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYV  221
            MDCDGCER+VRNAVSS+KG KSV+INRK +RVTV+GYVE  KVLKKV+ TGKKAE+WPY+
Sbjct  1    MDCDGCERKVRNAVSSIKGVKSVEINRKDSRVTVTGYVEKSKVLKKVQKTGKKAEIWPYI  60

Query  220  KYDLVSYPYAPGAYDKKAPSGYVRNVPQAI-IPSPNTERFTSMFSDENPNACSLM  59
            KY+LVS PYA G YDKKAPSGYV+  PQA+ IP+  +E FTSMFSDENPNACS+M
Sbjct  61   KYNLVSNPYAVGVYDKKAPSGYVKIDPQALQIPNTPSEIFTSMFSDENPNACSIM  115



>ref|XP_009790755.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nicotiana sylvestris]
Length=148

 Score =   181 bits (460),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 120/149 (81%), Gaps = 4/149 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG+LDH+ + F +      K+K MQTV+I+VKMDCDGCERRV+N+V  MKG K+V++NRK
Sbjct  1    MGVLDHIINFFTITTNTTHKKKSMQTVEIKVKMDCDGCERRVKNSVKYMKGVKTVEVNRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q++VTV+GYV+  +VL +++STGK+AE WPYV Y++V YP+AP AYDK+AP+G V+NVPQ
Sbjct  61   QSKVTVNGYVDPNRVLNRIKSTGKRAEFWPYVPYNVVYYPHAPQAYDKRAPAGMVKNVPQ  120

Query  136  AIIPSPNT---ERFTSMFSDENPNACSLM  59
            A +P PN    E+F  +FSD+NP+ACS+M
Sbjct  121  AQLP-PNATEEEKFAYLFSDDNPSACSIM  148



>ref|XP_010533407.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Tarenaya hassleriana]
Length=151

 Score =   181 bits (460),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 123/152 (81%), Gaps = 7/152 (5%)
 Frame = -1

Query  496  MGILD----HLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD    +LSD F V R+R+K++ +MQTV+I+VKMDCDGCER+V+NAVSSMKG KSV+
Sbjct  1    MGALDSLSDYLSDYFSVSRKRRKRK-VMQTVNIKVKMDCDGCERKVKNAVSSMKGVKSVE  59

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +NRK ++VTVSGYV+ KKVLK+V+ TGKKAE+WPYV Y+LV+YPY  GAYDKKAP+G+VR
Sbjct  60   VNRKMSKVTVSGYVDGKKVLKRVQRTGKKAEMWPYVPYNLVAYPYVAGAYDKKAPAGFVR  119

Query  148  NVPQAIIPSPNT--ERFTSMFSDENPNACSLM  59
             V  A+ P      E   S+FSD+NPNACS++
Sbjct  120  RVEAAMPPPDAPPHENLVSLFSDDNPNACSIV  151



>emb|CDY25762.1| BnaA07g10200D [Brassica napus]
Length=153

 Score =   181 bits (459),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 123/153 (80%), Gaps = 7/153 (5%)
 Frame = -1

Query  496  MGILDHLSDLF----EVkrrrkkkrKLMQ-TVDIRVKMDCDGCERRVRNAVSSMKGAKSV  332
            MG LD LSD F    +V  R++KK K+MQ TV+I+VK+DCDGCER+++NAVSS+KGAKSV
Sbjct  1    MGALDFLSDYFSNNFDVSIRKRKKHKVMQQTVNIKVKIDCDGCERKIKNAVSSIKGAKSV  60

Query  331  DINRKQNRVTVSGYVEAKKVLKKVESTG-KKAELWPYVKYDLVSYPYAPGAYDKKAPSGY  155
            ++NRK ++VTVSGYV+ KKVLK+V+STG KKAELWPYV Y +V+YPYA GAYDK+AP+G+
Sbjct  61   EVNRKMHKVTVSGYVDPKKVLKRVQSTGKKKAELWPYVPYTMVAYPYAAGAYDKRAPAGF  120

Query  154  VRNVPQA-IIPSPNTERFTSMFSDENPNACSLM  59
            VR   QA   P    ++  S+FSDENPNAC +M
Sbjct  121  VRKSEQAQAQPGGTDDKLMSLFSDENPNACIVM  153



>ref|XP_007033097.1| Heavy metal transport/detoxification superfamily protein [Theobroma 
cacao]
 gb|EOY04023.1| Heavy metal transport/detoxification superfamily protein [Theobroma 
cacao]
Length=155

 Score =   181 bits (458),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 117/150 (78%), Gaps = 5/150 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+LS+   V   R K++  MQTV+I+VKMDCDGCERRV+NAV+SMKG K+V++NRK
Sbjct  1    MGALDYLSNFCTVTSTRSKRKP-MQTVEIKVKMDCDGCERRVKNAVTSMKGVKTVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTVSGYV+  KVLK+V+STGK+AE WPY+   LV YPY  GAYDK+APSG+VRNV Q
Sbjct  60   QSRVTVSGYVDPNKVLKRVKSTGKRAEFWPYIPQHLVYYPYVSGAYDKRAPSGFVRNVVQ  119

Query  136  AIIPSPNT----ERFTSMFSDENPNACSLM  59
            A   + ++    E F S FSD+N +ACS++
Sbjct  120  AFPATSSSNAPEENFVSFFSDDNVHACSII  149



>emb|CDY12499.1| BnaC07g13390D [Brassica napus]
Length=153

 Score =   181 bits (458),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 119/153 (78%), Gaps = 7/153 (5%)
 Frame = -1

Query  496  MGILDHLSDLFE-----VkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSV  332
            MG LD LSD F        R+RKK +   QTV+I+VK+DCDGCER+++NAVSSMKGAKSV
Sbjct  1    MGALDFLSDYFSNNFDVSIRKRKKHKVWQQTVNIKVKIDCDGCERKIKNAVSSMKGAKSV  60

Query  331  DINRKQNRVTVSGYVEAKKVLKKVESTG-KKAELWPYVKYDLVSYPYAPGAYDKKAPSGY  155
            ++NRK ++VTVSGYV+ KKVLK+V+STG KKAELWPYV Y +V+YPYA GAYDK+AP+G+
Sbjct  61   EVNRKMHKVTVSGYVDPKKVLKRVQSTGKKKAELWPYVPYTMVAYPYAAGAYDKRAPAGF  120

Query  154  VRNVPQA-IIPSPNTERFTSMFSDENPNACSLM  59
            VR   QA   P    ++  S+FSDENPNAC +M
Sbjct  121  VRKSEQAQAQPGGTDDKLMSLFSDENPNACIVM  153



>emb|CDY21408.1| BnaA09g30190D [Brassica napus]
Length=153

 Score =   181 bits (458),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 123/153 (80%), Gaps = 7/153 (5%)
 Frame = -1

Query  496  MGILDHLS----DLFEVkrrrkkkrKLMQ-TVDIRVKMDCDGCERRVRNAVSSMKGAKSV  332
            MG L+ LS    D F V  R++KKRK+MQ TV+I+VK+DCDGCER+++NAVSSMKGAKSV
Sbjct  1    MGALNFLSGYFSDHFYVSIRKRKKRKVMQQTVNIKVKIDCDGCERKIKNAVSSMKGAKSV  60

Query  331  DINRKQNRVTVSGYVEAKKVLKKVESTG-KKAELWPYVKYDLVSYPYAPGAYDKKAPSGY  155
            ++NRK ++VTVSGYV+ KKVLKKV+STG KKAELWPYV Y +V+YPYA GAYDK+AP G+
Sbjct  61   EVNRKMHKVTVSGYVDPKKVLKKVQSTGKKKAELWPYVPYTMVAYPYAAGAYDKRAPPGF  120

Query  154  VRNVPQA-IIPSPNTERFTSMFSDENPNACSLM  59
            VR   QA   P    ++  S+FSDENPNAC++M
Sbjct  121  VRKSEQAQAQPGGTDDKLMSLFSDENPNACTIM  153



>gb|KDP22659.1| hypothetical protein JCGZ_02501 [Jatropha curcas]
Length=146

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 115/147 (78%), Gaps = 2/147 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG +D+LS+   V   R K++  MQTV+I+VKMDCDGCERRV+NAVSSM+G K+V++NRK
Sbjct  1    MGAIDYLSNFCTVTSTRSKRKP-MQTVEIKVKMDCDGCERRVKNAVSSMRGVKTVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RV VSGYV+  KVLK+V+STGK+AE WPY+   LV YPYA GAYDK+AP+GYVRNV Q
Sbjct  60   QSRVVVSGYVDPNKVLKRVKSTGKRAEFWPYIPQHLVHYPYASGAYDKRAPAGYVRNVVQ  119

Query  136  AIIPSPNTE-RFTSMFSDENPNACSLM  59
            A   S   E    S+FSD+N +ACS+M
Sbjct  120  AFPASTAPEDNIASIFSDDNVHACSIM  146



>ref|XP_009394956.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
 ref|XP_009394957.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
 ref|XP_009394958.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
 ref|XP_009394959.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
 ref|XP_009394960.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
Length=149

 Score =   180 bits (457),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 119/151 (79%), Gaps = 10/151 (7%)
 Frame = -1

Query  493  GILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQ  314
            G +D+LS L     + +K+++  QTV+++V+MDCDGCE +VRNA+SSMKG +SVDINRKQ
Sbjct  3    GTMDYLSSLLGSGHKYRKRKQF-QTVELKVRMDCDGCELKVRNALSSMKGVQSVDINRKQ  61

Query  313  NRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV---  143
             +VTV+GYVE  KVLKKV+STGKKAE+WPYV Y+LV++PYA   YDKKAP GYVRNV   
Sbjct  62   YKVTVTGYVEPHKVLKKVQSTGKKAEIWPYVPYNLVAHPYAAQTYDKKAPPGYVRNVEVI  121

Query  142  ---PQAIIPSPNTERFTSMFSDENPNACSLM  59
                QA+ P    ++FT++FSD+NPNACS+M
Sbjct  122  KVSSQAVRPE---DQFTTLFSDDNPNACSIM  149



>ref|XP_008812723.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Phoenix dactylifera]
Length=149

 Score =   180 bits (456),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 116/148 (78%), Gaps = 4/148 (3%)
 Frame = -1

Query  493  GILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQ  314
            G L++ S LF   RR +K+++  QTV+++V+MDCDGCE +V+NA+SSMKG KSVDINRKQ
Sbjct  3    GTLEYFSGLFGSSRRHRKRKQF-QTVELKVRMDCDGCELKVKNALSSMKGVKSVDINRKQ  61

Query  313  NRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQA  134
             +VTVSGYVE  KVLKK +STGKKAE+WPYV Y+LV +PYA  AYDKKAP GYVRNV   
Sbjct  62   QKVTVSGYVEQHKVLKKAQSTGKKAEIWPYVPYNLVMHPYAAHAYDKKAPPGYVRNVEAI  121

Query  133  II---PSPNTERFTSMFSDENPNACSLM  59
             I   P    ++ T++F+D+NPNACS+M
Sbjct  122  TISSQPFRQEDQLTNLFNDDNPNACSIM  149



>ref|XP_010265998.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nelumbo nucifera]
Length=155

 Score =   180 bits (456),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 117/155 (75%), Gaps = 9/155 (6%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkk---rKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            MG LDHLSDLF    R KKK   RK +QTV+I+VKMDC+GCER+V+ AV  MKG   V++
Sbjct  1    MGALDHLSDLFYCTSRSKKKFKNRKQLQTVEIKVKMDCEGCERKVKKAVEGMKGVTQVEV  60

Query  325  NRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
              KQ++VTV GYVE KKVLK++++TGKKAE WPYV YD+V +PYAPGAYDKKAP GYVRN
Sbjct  61   EPKQSKVTVIGYVEPKKVLKRIQATGKKAEFWPYVPYDVVPHPYAPGAYDKKAPPGYVRN  120

Query  145  VPQAII------PSPNTERFTSMFSDENPNACSLM  59
            V Q  +       S   ER++S FSD+NPN+C++M
Sbjct  121  VLQDPVASKLARASTMEERYSSAFSDDNPNSCAVM  155



>ref|XP_009105774.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Brassica rapa]
 emb|CDX96299.1| BnaA07g29100D [Brassica napus]
 emb|CDX72773.1| BnaC06g32210D [Brassica napus]
Length=150

 Score =   179 bits (455),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 122/151 (81%), Gaps = 6/151 (4%)
 Frame = -1

Query  496  MGILD----HLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LD    ++SD F V R+R+K++ + QTV+I+VKMDCDGCERRV+NAVSSMKG ++V+
Sbjct  1    MGALDSLSEYISDYFHVSRKRRKRK-VKQTVNIKVKMDCDGCERRVKNAVSSMKGVETVE  59

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +NRK ++VTVSGYVE KKVLK+VE TGKKAE+WPYV Y++V+YPYA G YDKKAP+GYVR
Sbjct  60   LNRKIHKVTVSGYVEPKKVLKRVERTGKKAEMWPYVPYNVVAYPYAVGVYDKKAPAGYVR  119

Query  148  NVPQAI-IPSPNTERFTSMFSDENPNACSLM  59
               Q+  +P    +   S+FSDENPNAC++M
Sbjct  120  KSEQSQPLPGAPDDVIMSLFSDENPNACTVM  150



>ref|XP_004135057.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
Length=144

 Score =   179 bits (453),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 119/150 (79%), Gaps = 10/150 (7%)
 Frame = -1

Query  496  MGILDHLSDLFE--VkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MGI D +SDL    V   R++K+K +QTV+I+VKMDCDGCERRV+NAV+ MK     ++N
Sbjct  1    MGIFDSVSDLISDYVATSRQRKKKPLQTVEIKVKMDCDGCERRVKNAVTKMK-----EVN  55

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ++VTV+G+VEA +VLKKV  TGK+AELWPYV Y++V+YPY   AYDK+AP+G+V+N 
Sbjct  56   RKQSKVTVTGFVEANRVLKKVRRTGKRAELWPYVPYNVVAYPYVTQAYDKRAPAGFVKNA  115

Query  142  PQAIIPSPNT--ERFTSMFSDENPNACSLM  59
             QA IPSPN   E+ T+MFSD+NPN CS+M
Sbjct  116  VQA-IPSPNAVDEKLTTMFSDDNPNGCSVM  144



>ref|XP_008381309.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 isoform X1 [Malus domestica]
Length=148

 Score =   179 bits (453),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 114/149 (77%), Gaps = 4/149 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+LS+   V   R K++  MQTV+I+VKMDCDGCERRV++AV+SMKG K+V++NRK
Sbjct  1    MGALDYLSNFCTVTSTRSKRKA-MQTVEIKVKMDCDGCERRVKHAVTSMKGVKTVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKK-AELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            Q+RVTVSGYVE  KVLK+V+STGKK AE WPY+   LV YPYA G YD +AP GYVRNV 
Sbjct  60   QSRVTVSGYVEPNKVLKRVKSTGKKRAEFWPYIDQHLVRYPYASGVYDWRAPKGYVRNVV  119

Query  139  QAIIPSPNT--ERFTSMFSDENPNACSLM  59
            QA   S N   E   ++FSD+N NACS+M
Sbjct  120  QAFPASINAPEENMVTLFSDDNVNACSIM  148



>ref|XP_009783112.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nicotiana sylvestris]
Length=142

 Score =   177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 112/146 (77%), Gaps = 4/146 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG L +LS+   V   R  ++  MQTV+I+VKMDCDGCER+V+NAV+SMKG K+V++NRK
Sbjct  1    MGALHYLSNCCIVTSTRTNRKP-MQTVEIKVKMDCDGCERKVKNAVNSMKGVKTVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            QNRVTVSGY++  KVLK V+STGK A  WPYV YDLVSYPY   AYDKKAP G+V+NV Q
Sbjct  60   QNRVTVSGYIDPNKVLKSVKSTGKMAIFWPYVPYDLVSYPYVAQAYDKKAPPGFVKNVRQ  119

Query  136  AIIPSPNTERFTSMFSDENPNACSLM  59
            A   + +    T +FSD+NPNACS+M
Sbjct  120  A---NADEHTITYLFSDDNPNACSIM  142



>ref|XP_010905918.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Elaeis guineensis]
Length=149

 Score =   177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 115/148 (78%), Gaps = 4/148 (3%)
 Frame = -1

Query  493  GILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQ  314
            G L++ S LF    RRKK+++  QTV+++V+MDCDGCE +V+NA+SSMKG KSVDINRKQ
Sbjct  3    GTLEYFSGLFGSSHRRKKRKQF-QTVELKVRMDCDGCELKVKNALSSMKGVKSVDINRKQ  61

Query  313  NRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQA  134
             +VTV+GYVE  KVLKK +STGKKAE+WPYV Y+LV +PYA   YDKKAP GYVRNV   
Sbjct  62   QKVTVTGYVEQHKVLKKAQSTGKKAEIWPYVPYNLVMHPYAANTYDKKAPPGYVRNVEAI  121

Query  133  II---PSPNTERFTSMFSDENPNACSLM  59
             I   P    ++ T++F+D+NPNACS+M
Sbjct  122  TISSQPFRQEDQLTNLFNDDNPNACSIM  149



>ref|XP_009371810.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Pyrus x bretschneideri]
Length=148

 Score =   177 bits (449),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 113/149 (76%), Gaps = 4/149 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+LS+   V   R K++  MQTV+I+VKMDCDGCERRV++AV+SMKG KSV++NRK
Sbjct  1    MGALDYLSNFCTVTSTRSKRKA-MQTVEIKVKMDCDGCERRVKHAVTSMKGVKSVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKK-AELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            Q+RV VSGYVE  KVLK+V+STGKK AE WPY+   LV YPYA G YD +AP GYVRNV 
Sbjct  60   QSRVIVSGYVEPNKVLKRVKSTGKKRAEFWPYIDQHLVRYPYASGVYDWRAPKGYVRNVV  119

Query  139  QAIIPSPNT--ERFTSMFSDENPNACSLM  59
            QA   S N   E   ++FSD+N NACS+M
Sbjct  120  QAFPASINAPEENMVTLFSDDNVNACSIM  148



>gb|AFK45838.1| unknown [Lotus japonicus]
Length=153

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 115/153 (75%), Gaps = 7/153 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkr-rrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINR  320
            MG LDH+SDLF+       KKRK +QTV+++VKMDCDGCER+VR AV  MKG  SVDI R
Sbjct  1    MGALDHISDLFDCSSGSSHKKRKQLQTVEVKVKMDCDGCERKVRKAVEGMKGVNSVDIER  60

Query  319  KQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            K ++VTV+GYVE  KV+ ++   TGKKAE+WPYV YD+V++PYAPG YDK+APSGYVR+ 
Sbjct  61   KASKVTVTGYVEPNKVVSRIAHHTGKKAEIWPYVPYDVVTHPYAPGVYDKRAPSGYVRDA  120

Query  142  PQA----IIPSPNTE-RFTSMFSDENPNACSLM  59
             Q     +  + +TE R+T+ FSDENP AC +M
Sbjct  121  EQTQYSQLTRASSTEVRYTTAFSDENPTACVVM  153



>gb|KHG02911.1| superoxide dismutase 1 copper chaperone [Gossypium arboreum]
Length=153

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++LSDL      + KKRK +QTV+++V+MDCDGCE +V+ A+SS+ G KSV+IN
Sbjct  2    GVSGTLEYLSDLMSSSGHKHKKRKQLQTVELKVRMDCDGCELKVKKALSSLNGVKSVNIN  61

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ +VTV+GYVEA KVLKK +STGKKAE+WPYV Y+LV+ PYA  AYDKKAP GYVR V
Sbjct  62   RKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAVTAYDKKAPPGYVRKV  121

Query  142  PQAIIPSPNTER----FTSMFSDENPNACSLM  59
               +  +    R    + +MFSDENPNACS+M
Sbjct  122  DNNVSSTATVTRYEDPYITMFSDENPNACSVM  153



>ref|XP_010261203.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Nelumbo nucifera]
Length=151

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 115/151 (76%), Gaps = 4/151 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++ S L     + KKK++L QTV+++V+MDC+GCE +VR A+SS+KG KSVD+N
Sbjct  2    GVGGTLEYFSGLMSSGHKHKKKKQL-QTVELKVRMDCEGCELKVRKALSSLKGVKSVDMN  60

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
             KQ +VTV+GYV+ KKVLKK +STGKKAE+WPYV Y+LV++PY   AYDKKAP GYVRNV
Sbjct  61   MKQQKVTVTGYVDEKKVLKKAQSTGKKAEIWPYVPYNLVAHPYTAQAYDKKAPPGYVRNV  120

Query  142  PQAIIPS---PNTERFTSMFSDENPNACSLM  59
                  +      ER+TSMFSDENPNACS+M
Sbjct  121  ETITATATVHTQEERYTSMFSDENPNACSIM  151



>ref|XP_010269164.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nelumbo nucifera]
Length=150

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 117/150 (78%), Gaps = 3/150 (2%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++ S L     ++KKK++L QTV+++V+MDC+GCE +VR A+SS+KG KSVDIN
Sbjct  2    GVGGTLEYFSGLLSSGHKQKKKKQL-QTVELKVRMDCEGCELKVRKALSSLKGVKSVDIN  60

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
             KQ + TV+GYV+AKKVLKK +STGKKAE+WPYV Y+LV++PY   AYDKKAP GYVRNV
Sbjct  61   MKQQKATVTGYVDAKKVLKKAQSTGKKAEIWPYVPYNLVAHPYTAQAYDKKAPPGYVRNV  120

Query  142  PQAIIPSPNT--ERFTSMFSDENPNACSLM  59
                    +T  E++T++FSDENPNACS+M
Sbjct  121  ETTATSMVHTQEEKYTTIFSDENPNACSIM  150



>ref|XP_002307111.1| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
 gb|EEE94107.1| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
Length=153

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 115/152 (76%), Gaps = 4/152 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++LSDL      + KK+K +QTV+++V+MDCDGCE +V+ A+SS+ G K V+IN
Sbjct  2    GVSGTLEYLSDLVGSGGHKHKKKKQLQTVELKVRMDCDGCELKVKKAISSLSGVKKVEIN  61

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ RVTV+GYV++ KVLKK +STGKKAE+WPYV Y+LV+ PYA  AYDKKAP GYVRNV
Sbjct  62   RKQQRVTVTGYVDSSKVLKKAKSTGKKAEIWPYVPYNLVAQPYAVQAYDKKAPPGYVRNV  121

Query  142  PQAIIPSPNT----ERFTSMFSDENPNACSLM  59
               +     T    + +TSMFSD+NPNACS+M
Sbjct  122  ENTVTTGTVTRYDQDPYTSMFSDDNPNACSIM  153



>gb|KHG07180.1| Superoxide dismutase 1 copper chaperone [Gossypium arboreum]
Length=148

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 118/149 (79%), Gaps = 4/149 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD++S+   V RRR K++  MQTV+I+VKMDCDGCERRV+NAV++MKG KSV++NRK
Sbjct  1    MGALDYISNFCTVSRRRTKRKP-MQTVEIKVKMDCDGCERRVKNAVTNMKGVKSVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RVTV+G VE  +VLK+V+STGK+AE WPY+   +V YPYA GAYDKKAP+G+VRNV Q
Sbjct  60   QSRVTVTGNVEPNRVLKRVKSTGKRAEFWPYIPQHVVYYPYASGAYDKKAPAGFVRNVVQ  119

Query  136  AIIPSPNT---ERFTSMFSDENPNACSLM  59
            A   S +    E F S FSD+N +ACS+M
Sbjct  120  AYPGSSSNAPEENFVSFFSDDNVHACSIM  148



>ref|XP_010939612.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Elaeis guineensis]
Length=149

 Score =   176 bits (447),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 115/148 (78%), Gaps = 4/148 (3%)
 Frame = -1

Query  493  GILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQ  314
            G L++ + L     RR+KKRK  QTV+++V+MDC+GCER+V+ A+SSMKG +SVD+NRKQ
Sbjct  3    GALEYFAGLL-AGSRRRKKRKQFQTVELKVRMDCEGCERKVKKALSSMKGVQSVDVNRKQ  61

Query  313  NRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQA  134
            N+VTV+GYVE  KVLKK  STGKKAE+WPY+ Y+LV +PYA  AYDKKAP GYVRNV   
Sbjct  62   NKVTVTGYVEQHKVLKKARSTGKKAEIWPYIPYNLVMHPYAAQAYDKKAPPGYVRNVEAI  121

Query  133  II---PSPNTERFTSMFSDENPNACSLM  59
             I   P    ++ T++FSDENPNACS+M
Sbjct  122  TISSQPYRQEDQLTNLFSDENPNACSIM  149



>ref|XP_010266835.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nelumbo nucifera]
Length=154

 Score =   177 bits (448),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 118/154 (77%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFE--VkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG+ +HLSDLF+  ++ ++ KKRK +QTV+I+VKMDC+GCER+V+ AV  MKG   VDI 
Sbjct  1    MGVFNHLSDLFDCTLRTKKFKKRKQLQTVEIKVKMDCEGCERKVKKAVEGMKGVNEVDIE  60

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
             KQ++V V GYVE +KVL+++ +TGKKAE WPYV+YD+V +PYAPG YDKKAP GYVRNV
Sbjct  61   AKQSKVVVIGYVEPRKVLQRIRATGKKAEFWPYVRYDVVPHPYAPGTYDKKAPPGYVRNV  120

Query  142  PQ----AIIPSPNT--ERFTSMFSDENPNACSLM  59
             Q    + +   N+  ERF   FSD+NPN+CS+M
Sbjct  121  LQDPEASALARANSMEERFYMAFSDDNPNSCSIM  154



>ref|XP_011021358.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 isoform X2 [Populus euphratica]
Length=146

 Score =   176 bits (447),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 114/148 (77%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+LS+ F      + KRKL  TV+I+VKMDCDGCERRV+NAV+SMKG K+V++NRK
Sbjct  1    MGALDYLSN-FCTVTSTRSKRKLCCTVEIKVKMDCDGCERRVKNAVTSMKGVKTVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RV VSGYV+  KVL++V+STGK AE WPY+   LV YPY  GAYDK+AP+GYVRNV Q
Sbjct  60   QSRVVVSGYVDPNKVLRRVKSTGKVAEFWPYIPQHLVYYPYVSGAYDKRAPAGYVRNVVQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A  P+ N   E   S+FSD+N NACS+M
Sbjct  120  A-YPASNAPEENIVSLFSDDNVNACSIM  146



>ref|XP_010916917.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Elaeis guineensis]
Length=150

 Score =   176 bits (446),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 116/149 (78%), Gaps = 5/149 (3%)
 Frame = -1

Query  493  GILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQ  314
            G L++ S L     + KKK++L QTV+++V+MDC+GCE +V+ A+SSMKG +SVDINRKQ
Sbjct  3    GTLEYFSGLLGSGHKHKKKKQL-QTVELKVRMDCEGCELKVKKALSSMKGVQSVDINRKQ  61

Query  313  NRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQA  134
            ++VTV GYVE  KVLKK +STGKKAE+WPYV Y+LV++PYA GAYDKKAP GYVRNV   
Sbjct  62   HKVTVVGYVEPNKVLKKAQSTGKKAEIWPYVPYNLVTHPYAAGAYDKKAPPGYVRNVESV  121

Query  133  IIPSPNT----ERFTSMFSDENPNACSLM  59
             I S       ++ T+MFSD+NPN+CS+M
Sbjct  122  AISSSQASKQDDQITNMFSDDNPNSCSIM  150



>ref|NP_001239806.1| uncharacterized protein LOC100815905 [Glycine max]
 gb|ACU16792.1| unknown [Glycine max]
 gb|KHN19704.1| hypothetical protein glysoja_037206 [Glycine soja]
Length=144

 Score =   176 bits (445),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 115/148 (78%), Gaps = 6/148 (4%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+LS+   V   R K++  MQT +I+V+MDCDGCERRVRNAVSS+KG KSV++NRK
Sbjct  1    MGALDYLSNFCTVTSTRTKQKA-MQTAEIKVRMDCDGCERRVRNAVSSIKGVKSVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGK-KAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            ++RV V GYV+ KKVLK+V STGK +A+ WPYV+  LV +PYAPG YD++APSGYVRNV 
Sbjct  60   ESRVVVRGYVDPKKVLKRVRSTGKVRAQFWPYVEQHLVYHPYAPGVYDRRAPSGYVRNVF  119

Query  139  QAIIPSPNTE-RFTSMFSDENPNACSLM  59
            Q   PS + +  F S FSD+N NACS+M
Sbjct  120  Q---PSSHAQDNFLSFFSDDNVNACSIM  144



>ref|XP_008440632.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Cucumis melo]
Length=151

 Score =   176 bits (446),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 116/151 (77%), Gaps = 4/151 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++LSDL     + KKK++L QTV+++V+MDCDGCE +V+NA+SS+ G KSV+IN
Sbjct  2    GVGGTLEYLSDLVGNTHKHKKKKQL-QTVELKVRMDCDGCELKVKNALSSLSGVKSVEIN  60

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ +VTV+GYVEA KVLKK +STGKKAE+WPYV Y LVS PY   AYDKKAP GYVRNV
Sbjct  61   RKQQKVTVTGYVEASKVLKKAKSTGKKAEIWPYVPYSLVSQPYIAQAYDKKAPPGYVRNV  120

Query  142  PQAIIPSPNT---ERFTSMFSDENPNACSLM  59
             Q    +  T   + + +MFSD+NPNACS+M
Sbjct  121  EQTATTASVTKYEDPYINMFSDDNPNACSIM  151



>ref|NP_001148035.1| LOC100281644 [Zea mays]
 gb|ACG29534.1| farnesylated protein 2 [Zea mays]
 gb|AFW74202.1| farnesylated protein 2 [Zea mays]
Length=151

 Score =   176 bits (446),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 114/151 (75%), Gaps = 5/151 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL----MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MGILDH+S +  +   ++  +      +QTV+I+VKMDC+GCERRV++AV SM+G  SV 
Sbjct  1    MGILDHMSHVCSITETKEALKLRKKRPLQTVNIKVKMDCEGCERRVKSAVKSMRGVTSVT  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +N KQ++ TV+GYVE  KVL++V++TGK AE+WPYV Y L +YPY  GAYDKKAP+G+VR
Sbjct  61   VNAKQSKCTVTGYVEPAKVLERVKATGKNAEMWPYVPYTLTTYPYVGGAYDKKAPAGFVR  120

Query  148  NVPQAII-PSPNTERFTSMFSDENPNACSLM  59
            + PQA+  PS    ++ SMFSDEN NAC++M
Sbjct  121  SAPQAMADPSAPEVKYMSMFSDENVNACTIM  151



>ref|XP_010108935.1| hypothetical protein L484_027130 [Morus notabilis]
 gb|EXC20575.1| hypothetical protein L484_027130 [Morus notabilis]
Length=146

 Score =   176 bits (445),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 114/148 (77%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+L +   V   R+K++  MQTV+I+VKMDCDGCER+++NAV SM+G KSV++NRK
Sbjct  1    MGALDYLPNFCTVISTRRKRKP-MQTVEIKVKMDCDGCERKIKNAVKSMRGVKSVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q++VTVSG+VEA KVLK+V  TGKKAE WPY+   LV YP+  GAYDK+AP+G+VRNV  
Sbjct  60   QSKVTVSGFVEANKVLKRVNRTGKKAEFWPYIPQHLVHYPFVSGAYDKRAPAGHVRNVVH  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A  P+ N   E   S+FSD+N NACS+M
Sbjct  120  A-FPAANVAEENMASLFSDDNVNACSIM  146



>ref|XP_003612452.1| hypothetical protein MTR_5g025150 [Medicago truncatula]
 gb|AES95410.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=145

 Score =   176 bits (445),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 116/148 (78%), Gaps = 5/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD LSD F V  ++K K   MQTV+I+VKMDCDGCERRVRN+V++M G K V++NR+
Sbjct  1    MGALDFLSDYFTVTPKKKHKP--MQTVEIKVKMDCDGCERRVRNSVTNMSGVKEVEVNRE  58

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q++VTV+G V+  KVL+KV+STGK+A+ WPYV+ +LV+YPY   AY K APSGYV+N   
Sbjct  59   QSKVTVTGNVDRNKVLRKVQSTGKRAKFWPYVEANLVAYPYITQAYAKNAPSGYVKNTEL  118

Query  136  AIIPSPN--TERFTSMFSDENPNACSLM  59
            A IP+PN   ++ TS FSD+NPNACS+M
Sbjct  119  A-IPNPNGTDDKITSFFSDDNPNACSIM  145



>gb|ABK23213.1| unknown [Picea sitchensis]
Length=150

 Score =   176 bits (445),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 118/148 (80%), Gaps = 3/148 (2%)
 Frame = -1

Query  493  GILDHLSDLFEVkrrrkkkrKL-MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            G LD++SDL      +K K+   +QTV+++V+MDCDGCER+V+NA+SSMKG KSVD++RK
Sbjct  3    GPLDYVSDLLGGGGSKKHKKMKQLQTVELKVRMDCDGCERKVKNAISSMKGVKSVDVSRK  62

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            + +VTV+GYV+A KVLKKV++TGK+AE+WPYV Y LV+ PY   AYDKKAP+GYVR V  
Sbjct  63   EQKVTVTGYVDANKVLKKVKATGKRAEVWPYVPYSLVAQPYTAQAYDKKAPAGYVRKVES  122

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
               P+ N+  E++T++FS++N NAC++M
Sbjct  123  HTFPNLNSTDEQYTTLFSEDNTNACTIM  150



>gb|ACG27273.1| farnesylated protein 2 [Zea mays]
Length=151

 Score =   176 bits (445),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 114/151 (75%), Gaps = 5/151 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL----MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MGILDH+S +  +   ++  +      +QTV+I+VKMDC+GCERRV++AV SM+G  SV 
Sbjct  1    MGILDHMSHVCSITETKEALKLRKKRPLQTVNIKVKMDCEGCERRVKSAVKSMRGVTSVT  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +N KQ++ TV+GYVE  KVL++V++TGK AE+WPYV Y L +YPY  GAYDKKAP+G+VR
Sbjct  61   VNAKQSKCTVTGYVEPAKVLERVKATGKNAEMWPYVPYTLTTYPYVGGAYDKKAPAGFVR  120

Query  148  NVPQAII-PSPNTERFTSMFSDENPNACSLM  59
            + PQA+  PS    ++ SMFSDEN NAC++M
Sbjct  121  SAPQAMADPSAPEVKYMSMFSDENVNACTVM  151



>ref|XP_011039548.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Populus euphratica]
 ref|XP_011015668.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Populus euphratica]
Length=151

 Score =   175 bits (444),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 116/151 (77%), Gaps = 4/151 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++LSDL      + KK++L QTV+++V+MDCDGCE +V+NA+SS+ G K V+IN
Sbjct  2    GVSGTLEYLSDLVGSGGHKNKKKQL-QTVELKVRMDCDGCELKVKNAISSLSGVKKVEIN  60

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ RVTV+GYV++ KVLKK +STGKKAE+WPYV Y+LV+ PYA  AYDKKAP GYVRNV
Sbjct  61   RKQQRVTVTGYVDSNKVLKKAKSTGKKAEIWPYVPYNLVAQPYAVQAYDKKAPPGYVRNV  120

Query  142  PQAIIPSPNT---ERFTSMFSDENPNACSLM  59
               +     T   + +TS+FSD+NPNACS+M
Sbjct  121  ENTVTTGTVTRYEDPYTSIFSDDNPNACSIM  151



>ref|XP_004143484.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
 ref|XP_004162311.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
 gb|KGN48774.1| hypothetical protein Csa_6G500660 [Cucumis sativus]
Length=151

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 116/151 (77%), Gaps = 4/151 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++LSDL     + KKK++L QTV+++V+MDCDGCE +V+NA+SS+ G KSV+IN
Sbjct  2    GVGGTLEYLSDLVGNTHKHKKKKQL-QTVELKVRMDCDGCELKVKNALSSLSGVKSVEIN  60

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ +VTV+GYVEA K+LKK +STGKKAE+WPYV Y LVS PY   AYDKKAP GYVRNV
Sbjct  61   RKQQKVTVTGYVEASKILKKAKSTGKKAEIWPYVPYSLVSQPYIAQAYDKKAPPGYVRNV  120

Query  142  PQAIIPSPNT---ERFTSMFSDENPNACSLM  59
             Q    +  T   + + +MFSD+NPNACS+M
Sbjct  121  EQTATTASVTKYEDPYINMFSDDNPNACSVM  151



>gb|KHG07179.1| Superoxide dismutase 1 copper chaperone [Gossypium arboreum]
Length=149

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 116/150 (77%), Gaps = 5/150 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG  D++S    V   +  KRK MQTV+I+VKMDCDGCERRVRN+V +M+G K+VDINRK
Sbjct  1    MGAFDYISSFCSVTSTKTSKRKQMQTVEIKVKMDCDGCERRVRNSVINMRGVKTVDINRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+R+TV+G V+  +VLK+V++TGK+AE WPY+   +V YPYA GAYDK+AP+G VRNV Q
Sbjct  61   QSRLTVTGNVDPNRVLKRVKNTGKRAEFWPYIPQHVVYYPYASGAYDKRAPAGLVRNVAQ  120

Query  136  AIIPSPNT----ERFTSMFSDENPNACSLM  59
            A  P+ ++    E+F S+FSD+N +ACS+M
Sbjct  121  A-YPTASSNAPEEKFASLFSDDNVHACSIM  149



>ref|XP_002444859.1| hypothetical protein SORBIDRAFT_07g000380 [Sorghum bicolor]
 gb|EES14354.1| hypothetical protein SORBIDRAFT_07g000380 [Sorghum bicolor]
Length=151

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 114/151 (75%), Gaps = 5/151 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL----MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MGILDHLS L  +   ++  +      +QTV+I+VKMDC+GCERRV++AV SM+G  SV 
Sbjct  1    MGILDHLSHLCSLTETKEALKLRKKRPLQTVNIKVKMDCEGCERRVKSAVKSMRGVTSVA  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +N KQ++ TV+GYVE  KVL++V++TGK AE+WPYV Y L +YPY  GAYDKKAP+G+VR
Sbjct  61   VNPKQSKCTVTGYVEPAKVLQRVKATGKNAEMWPYVPYALTTYPYVGGAYDKKAPAGFVR  120

Query  148  NVPQAII-PSPNTERFTSMFSDENPNACSLM  59
            + PQA+  PS    ++ +MFSDEN NAC++M
Sbjct  121  SAPQAMAEPSAPELKYMNMFSDENVNACTVM  151



>ref|XP_006644215.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Oryza brachyantha]
Length=151

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 112/151 (74%), Gaps = 5/151 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL----MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG+LD LSD+  +   ++  +      +QTV+I+VKMDC+GCERRV+NAV SM+G  SV 
Sbjct  1    MGVLDSLSDMCSLTETKEALKLRKKRPLQTVNIKVKMDCEGCERRVKNAVRSMRGVTSVA  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
             N KQ+R TV+GYVEA KVL++V STGK AE+WPYV Y + +YPY  GAYDKKAP+G+VR
Sbjct  61   GNAKQSRCTVTGYVEASKVLERVRSTGKAAEMWPYVPYTMATYPYVGGAYDKKAPAGFVR  120

Query  148  NVPQAII-PSPNTERFTSMFSDENPNACSLM  59
              PQA+  PS    R+ +MFSD+N N+CS+M
Sbjct  121  AAPQAMADPSAPEVRYMTMFSDDNVNSCSIM  151



>ref|XP_004968816.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Setaria italica]
Length=151

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 113/151 (75%), Gaps = 5/151 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL----MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MGILDH SDL  +   ++  +      +QTV+I+VKMDC+GCERRV++AV SM+G   V 
Sbjct  1    MGILDHFSDLCSITETKEALKLRKKRPLQTVNIKVKMDCEGCERRVKSAVKSMRGVTRVV  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +N KQ++ TV+GYVE  KVL++V+STGK AE+WPYV Y + +YPY  GAYDKKAP+G+VR
Sbjct  61   VNPKQSKCTVTGYVEPAKVLERVKSTGKAAEMWPYVPYTMTTYPYVGGAYDKKAPAGFVR  120

Query  148  NVPQAII-PSPNTERFTSMFSDENPNACSLM  59
            + PQA+  PS    R+ +MFSDEN N+C++M
Sbjct  121  SAPQAMADPSAPEVRYMTMFSDENVNSCTIM  151



>ref|XP_006577898.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Glycine max]
Length=154

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 113/154 (73%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrK--LMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG LDH+S+LF+      K +K   +QTV+++VKMDC+GCER+VR AV  MKG   VD+ 
Sbjct  1    MGALDHISELFDCSSGSSKHKKRKQLQTVEVKVKMDCEGCERKVRKAVEGMKGVNQVDVE  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            RK N+VTV GYVEA KV+ ++   TGKKAELWPYV YD+V++PYAPG YDKKAPSGYVRN
Sbjct  61   RKANKVTVVGYVEASKVVARIAHRTGKKAELWPYVPYDVVAHPYAPGVYDKKAPSGYVRN  120

Query  145  VP----QAIIPSPNTE-RFTSMFSDENPNACSLM  59
                    +  + +TE R+T+ FSDENP+AC +M
Sbjct  121  TDDPHYSHLARASSTEVRYTTAFSDENPSACVVM  154



>ref|XP_006383348.1| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
 gb|ERP61145.1| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
Length=146

 Score =   174 bits (441),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 114/148 (77%), Gaps = 4/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+LS+   V   R K++  MQTV+I+VKMDCDGCERRV+NAV+SMKG K+V++ RK
Sbjct  1    MGALDYLSNFCTVTSTRSKRKP-MQTVEIKVKMDCDGCERRVKNAVTSMKGVKTVEVIRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RV VSGYV+  KVL++V+STGK AE WPY+   LV YPY  GAYDK+AP+GYVRNV Q
Sbjct  60   QSRVVVSGYVDPNKVLRRVKSTGKVAEFWPYIPQHLVYYPYVSGAYDKRAPAGYVRNVVQ  119

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A  P+ N   +   S+FSD+N NACS+M
Sbjct  120  A-YPASNAPEDNIVSLFSDDNVNACSIM  146



>ref|XP_010062228.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Eucalyptus grandis]
Length=148

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 112/149 (75%), Gaps = 4/149 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+LS+   V   R K+R  MQTV+I+VKMDCDGCERRV+NAV++M+G KSV++NRK
Sbjct  1    MGALDYLSNFCTVTSTRSKRRP-MQTVEIKVKMDCDGCERRVKNAVNTMRGVKSVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+RV VSGYV+  KVLK+++ TGK AE WPY+   LV YPYA   YDK+AP+GYVRN  Q
Sbjct  60   QSRVKVSGYVDPNKVLKRIKRTGKVAEFWPYIPQHLVYYPYADKVYDKRAPAGYVRNTVQ  119

Query  136  AIIPSPNT---ERFTSMFSDENPNACSLM  59
            A   S +    ER  SMFSD+N NACS+M
Sbjct  120  AFPSSTSAAPEERIISMFSDDNVNACSIM  148



>gb|ACU21394.1| unknown [Glycine max]
Length=144

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 114/148 (77%), Gaps = 6/148 (4%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+LS+   V   R K++  MQT +I+V+MDCDGCERRVRNAVSS+KG KSV++NRK
Sbjct  1    MGALDYLSNFCTVTSTRTKQKA-MQTAEIKVRMDCDGCERRVRNAVSSIKGVKSVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGK-KAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            ++RV V GYV+ KKVLK+V STGK + + WPYV+  LV +PYAPG YD++APSGYVRNV 
Sbjct  60   ESRVVVRGYVDPKKVLKRVRSTGKVRVQFWPYVEQHLVYHPYAPGVYDRRAPSGYVRNVF  119

Query  139  QAIIPSPNTE-RFTSMFSDENPNACSLM  59
            Q   PS + +  F S FSD+N NACS+M
Sbjct  120  Q---PSSHAQDNFLSFFSDDNVNACSIM  144



>ref|XP_010693750.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Beta vulgaris subsp. vulgaris]
Length=147

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 119/148 (80%), Gaps = 3/148 (2%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+ +D   V   R +++ L QTV+I+VKMDCDGCERRV+NAV+++KG KSV+I+RK
Sbjct  1    MGALDYFADFCTVTSTRTRRKPL-QTVEIKVKMDCDGCERRVKNAVTNLKGVKSVEISRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKK-AELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            Q++VTV+G+V+  KVL KV++TGKK AE WPY++++LV+YPY  GAYDK+AP+GY ++VP
Sbjct  60   QSKVTVTGHVDPNKVLNKVKNTGKKRAEFWPYIEHNLVAYPYIAGAYDKRAPAGYCKDVP  119

Query  139  QAI-IPSPNTERFTSMFSDENPNACSLM  59
            QA    S   E  +S+FSD+NPNACS+M
Sbjct  120  QAYPTYSVPQENMSSLFSDDNPNACSIM  147



>ref|XP_008798426.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Phoenix dactylifera]
Length=151

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 113/149 (76%), Gaps = 4/149 (3%)
 Frame = -1

Query  493  GILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQ  314
            G L++ S L      + K++K +QTV+++V+MDC+GCE +V+ A+SSMKG +S+DINRKQ
Sbjct  3    GTLEYFSGLLGSGHEKHKRKKQLQTVELKVRMDCEGCELKVKKALSSMKGVQSIDINRKQ  62

Query  313  NRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQA  134
             +VTV GYVE  KVLKK +STGKKAE+WPYV Y+LV++PY  GAYDKKAP GYVRNV   
Sbjct  63   QKVTVVGYVEPNKVLKKAQSTGKKAEIWPYVPYNLVTHPYTAGAYDKKAPPGYVRNVESV  122

Query  133  II----PSPNTERFTSMFSDENPNACSLM  59
             +     S   ++ T+MFSD+NPN+CS+M
Sbjct  123  SVSSSQASKQDDQITNMFSDDNPNSCSIM  151



>ref|NP_001152036.1| metal ion binding protein [Zea mays]
 gb|ACG45494.1| metal ion binding protein [Zea mays]
Length=161

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 115/158 (73%), Gaps = 13/158 (8%)
 Frame = -1

Query  493  GILDHLSDLFEVkrrrk-kkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            G L++LSDL     RR+ KKRK  QTV+++V+MDCDGCE +VRNA+SSMKG  SV+INRK
Sbjct  4    GTLEYLSDLLGGGGRRRYKKRKQFQTVELKVRMDCDGCEMKVRNALSSMKGVHSVEINRK  63

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV--  143
            Q +VTV GYVE  KV+K+V++TGKKAE+WPYV Y LV++PYA  AYDKKAP GYVR V  
Sbjct  64   QYKVTVQGYVEPHKVVKRVQATGKKAEIWPYVPYSLVAHPYAAPAYDKKAPPGYVRRVDA  123

Query  142  ----------PQAIIPSPNTERFTSMFSDENPNACSLM  59
                      P A    P  ER  +MFSD+NPNACS+M
Sbjct  124  VMPVSSTYGGPTAAAGPPQEERLATMFSDDNPNACSVM  161



>ref|XP_006428133.1| hypothetical protein CICLE_v10026695mg [Citrus clementina]
 ref|XP_006464268.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Citrus sinensis]
 gb|ESR41373.1| hypothetical protein CICLE_v10026695mg [Citrus clementina]
Length=153

 Score =   173 bits (439),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 115/152 (76%), Gaps = 4/152 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKL-MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            G  G L++LSDL      + KK+K  +QTVD++V+MDCDGCE +V+NAVSS+ G KSV+I
Sbjct  2    GVAGTLEYLSDLMGSSGHKHKKKKKQLQTVDLKVRMDCDGCELKVKNAVSSLSGVKSVEI  61

Query  325  NRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            NRKQ +V+V+GYVEA KVLKK +STGK+AE+WPYV Y+LV+ PY  GAYDK+AP GYVR 
Sbjct  62   NRKQQKVSVTGYVEANKVLKKAKSTGKRAEIWPYVPYNLVAQPYIAGAYDKRAPPGYVRK  121

Query  145  VPQAIIPSPNT---ERFTSMFSDENPNACSLM  59
            V      +  T   + + SMFSD+NPNACS+M
Sbjct  122  VEGTATNASVTTLEDPYISMFSDDNPNACSIM  153



>ref|XP_011021357.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 isoform X1 [Populus euphratica]
Length=124

 Score =   172 bits (436),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 102/125 (82%), Gaps = 3/125 (2%)
 Frame = -1

Query  427  MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTG  248
            MQTV+I+VKMDCDGCERRV+NAV+SMKG K+V++NRKQ+RV VSGYV+  KVL++V+STG
Sbjct  1    MQTVEIKVKMDCDGCERRVKNAVTSMKGVKTVEVNRKQSRVVVSGYVDPNKVLRRVKSTG  60

Query  247  KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQAIIPSPNT--ERFTSMFSDENPN  74
            K AE WPY+   LV YPY  GAYDK+AP+GYVRNV QA  P+ N   E   S+FSD+N N
Sbjct  61   KVAEFWPYIPQHLVYYPYVSGAYDKRAPAGYVRNVVQA-YPASNAPEENIVSLFSDDNVN  119

Query  73   ACSLM  59
            ACS+M
Sbjct  120  ACSIM  124



>ref|NP_001043154.1| Os01g0507700 [Oryza sativa Japonica Group]
 dbj|BAC06873.1| farnesylated protein 2-like [Oryza sativa Japonica Group]
 dbj|BAF05068.1| Os01g0507700 [Oryza sativa Japonica Group]
 gb|EAY74242.1| hypothetical protein OsI_02122 [Oryza sativa Indica Group]
 gb|EAZ12071.1| hypothetical protein OsJ_01952 [Oryza sativa Japonica Group]
 dbj|BAG87344.1| unnamed protein product [Oryza sativa Japonica Group]
Length=151

 Score =   173 bits (439),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 113/151 (75%), Gaps = 5/151 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL----MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG+LD LSD+  +   ++  +      +QTV+I+VKMDC+GCERRV+NAV SM+G  SV 
Sbjct  1    MGVLDSLSDMCSLTETKEALKLRKKRPLQTVNIKVKMDCEGCERRVKNAVKSMRGVTSVA  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +N KQ+R TV+GYVEA KVL++V+STGK AE+WPYV Y + +YPY  GAYDKKAP+G+VR
Sbjct  61   VNPKQSRCTVTGYVEASKVLERVKSTGKAAEMWPYVPYTMTTYPYVGGAYDKKAPAGFVR  120

Query  148  NVPQAII-PSPNTERFTSMFSDENPNACSLM  59
              P A+  PS    R+ +MFSDEN ++CS+M
Sbjct  121  GNPAAMADPSAPEVRYMTMFSDENVDSCSIM  151



>gb|KEH24715.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=155

 Score =   173 bits (439),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 115/155 (74%), Gaps = 9/155 (6%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkk-----rKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSV  332
            MG LD+LS+                RK MQTV+I+V+MDCDGCERRVRNAV+S+KG KSV
Sbjct  1    MGALDYLSNFCTTVSVTNSTIKRAKRKAMQTVEIKVRMDCDGCERRVRNAVTSLKGVKSV  60

Query  331  DINRKQNRVTVSGYVEAKKVLKKVESTGK-KAELWPYVKYDLVSYPYAPGAYDKKAPSGY  155
            ++NRKQ+RV VSGYV+  KVLK+++STGK +A+ WPYV+  LV YPYA GAYDK+APSG+
Sbjct  61   EVNRKQSRVIVSGYVDPNKVLKRIKSTGKVRAQFWPYVEQQLVYYPYAYGAYDKRAPSGF  120

Query  154  VRNVPQAI-IPSPN--TERFTSMFSDENPNACSLM  59
            VRNV QA  + S N   E   S+F+D+N NACS+M
Sbjct  121  VRNVVQAAPMASSNHQEELLVSLFNDDNVNACSIM  155



>ref|XP_002281217.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Vitis vinifera]
Length=151

 Score =   173 bits (438),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 114/151 (75%), Gaps = 4/151 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++LSDL      + KKRK  QTV+++V+MDC+GCE +V+  +SS+ G KSVDIN
Sbjct  2    GVGGTLEYLSDLMS-SGHKHKKRKQSQTVELKVRMDCEGCELKVKKTLSSLSGVKSVDIN  60

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ +VTV+GYV+A KVLKK +STGKKAELWPYV Y+LV+ PYA  AYDKKAP GYVRNV
Sbjct  61   RKQQKVTVTGYVDANKVLKKAKSTGKKAELWPYVPYNLVAQPYAVHAYDKKAPPGYVRNV  120

Query  142  PQAIIPSPNT---ERFTSMFSDENPNACSLM  59
             Q  I    T   + + +MFSDENPNACS+M
Sbjct  121  EQPPISGTVTRYEDPYITMFSDENPNACSIM  151



>ref|XP_011097135.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Sesamum indicum]
Length=147

 Score =   172 bits (436),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 108/147 (73%), Gaps = 1/147 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL-MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINR  320
            MG L  LS+   +     + ++  MQTV+I+VKMDCDGCER+V+NAV +++G K+V+INR
Sbjct  1    MGALYCLSNFCTLTTNSTRTKRRSMQTVEIKVKMDCDGCERKVKNAVKNLRGVKTVEINR  60

Query  319  KQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            KQ+RVTVSGYV+  KVLK V++TGK AE WPY+ Y+ V YP+    YDKKAP GYVRNV 
Sbjct  61   KQSRVTVSGYVDPNKVLKSVKNTGKGAEFWPYIPYNRVQYPHVSQVYDKKAPEGYVRNVQ  120

Query  139  QAIIPSPNTERFTSMFSDENPNACSLM  59
               +P+   E F  +FSD+NPNACS+M
Sbjct  121  AVPVPNATEETFAYLFSDDNPNACSIM  147



>ref|XP_007048040.1| Heavy metal transport/detoxification domain-containing protein 
[Theobroma cacao]
 gb|EOX92197.1| Heavy metal transport/detoxification domain-containing protein 
[Theobroma cacao]
Length=152

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 114/151 (75%), Gaps = 3/151 (2%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++LSDL      + KK+K + TV+++V+MDCDGCE +V+ A++S+ G KSV+IN
Sbjct  2    GVAGTLEYLSDLMSSSGHKYKKKKQLHTVELKVRMDCDGCELKVKKALASLSGVKSVNIN  61

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ +VTV+GYVE  KVLKK +STGK+AE+WPYV Y+LV+ PYA  AYDKKAP GYVRNV
Sbjct  62   RKQQKVTVTGYVETNKVLKKAKSTGKRAEIWPYVPYNLVAQPYAAPAYDKKAPPGYVRNV  121

Query  142  PQAIIPSPNT---ERFTSMFSDENPNACSLM  59
               +  +  T   + + S+FSD+NPNACS+M
Sbjct  122  ENNVTTAAVTRYEDPYISLFSDDNPNACSVM  152



>gb|KHN33671.1| hypothetical protein glysoja_013677 [Glycine soja]
Length=180

 Score =   172 bits (437),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 113/154 (73%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrK--LMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG LDH+S+LF+      K +K   +QTV+++VKMDC+GCER+VR AV  MKG   VD+ 
Sbjct  27   MGALDHISELFDCSSGSSKHKKRKQLQTVEVKVKMDCEGCERKVRKAVEGMKGVNQVDVE  86

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            RK N+VTV GYVEA KV+ ++   TGKKAELWPYV YD+V++PYAPG YDKKAPSGYVRN
Sbjct  87   RKANKVTVVGYVEASKVVARIAHRTGKKAELWPYVPYDVVAHPYAPGVYDKKAPSGYVRN  146

Query  145  VP----QAIIPSPNTE-RFTSMFSDENPNACSLM  59
                    +  + +TE R+T+ FSDENP+AC +M
Sbjct  147  TDDPHYSHLARASSTEVRYTTAFSDENPSACVVM  180



>gb|ACN27116.1| unknown [Zea mays]
 tpg|DAA61192.1| TPA: metal ion binding protein [Zea mays]
Length=162

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 116/160 (73%), Gaps = 16/160 (10%)
 Frame = -1

Query  493  GILDHLSDLFEVkrrrkkkrKL--MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINR  320
            G L++LSDL      R++ +K    QTV+++V+MDCDGCE +VRNA+SSMKG  SV+INR
Sbjct  4    GTLEYLSDLLGGGGGRRRYKKRKQFQTVELKVRMDCDGCEMKVRNALSSMKGVHSVEINR  63

Query  319  KQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            KQ +VTV GYVE  KV+K+V++TGKKAE+WPYV Y LV++PYA  AYDKKAP GYVR V 
Sbjct  64   KQYKVTVQGYVEPHKVVKRVQATGKKAEIWPYVPYSLVAHPYAAPAYDKKAPPGYVRRV-  122

Query  139  QAIIPSPNT-------------ERFTSMFSDENPNACSLM  59
             A++P  +T             ER  +MFSD+NPNACS+M
Sbjct  123  DAVMPVSSTYGGPAAAAGPPQEERLATMFSDDNPNACSVM  162



>ref|XP_009403887.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403895.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=115

 Score =   171 bits (432),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 101/115 (88%), Gaps = 1/115 (1%)
 Frame = -1

Query  400  MDCDGCERRVRNAVSSMKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYV  221
            MDCDGCERRV++AVSS++G  +V++NRKQ+RVTV+G++EAK+V++K++STGK+AE WPYV
Sbjct  1    MDCDGCERRVKHAVSSIRGVTNVNVNRKQSRVTVTGHIEAKEVVRKIKSTGKRAEAWPYV  60

Query  220  KYDLVSYPYAPGAYDKKAPSGYVRNVPQAII-PSPNTERFTSMFSDENPNACSLM  59
             Y LV+YPY  GAYDKKAP+G+VRNV QA+  PS   E+ +S+FSDENPNAC++M
Sbjct  61   PYSLVAYPYVAGAYDKKAPAGFVRNVAQAVASPSAPEEKISSLFSDENPNACTVM  115



>ref|XP_004162724.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
Length=115

 Score =   171 bits (432),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 100/116 (86%), Gaps = 3/116 (3%)
 Frame = -1

Query  400  MDCDGCERRVRNAVSSMKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYV  221
            MDCDGCERRV+NAV+ MKGAK+V++NRKQ++VTV+G+VEA +VLKKV  TGK+AELWPYV
Sbjct  1    MDCDGCERRVKNAVTKMKGAKTVEVNRKQSKVTVTGFVEANRVLKKVRRTGKRAELWPYV  60

Query  220  KYDLVSYPYAPGAYDKKAPSGYVRNVPQAIIPSPNT--ERFTSMFSDENPNACSLM  59
             Y++V+YPY   AYDK+AP+G+V+N  QA IPSPN   E+ T+MFSD+NPN CS+M
Sbjct  61   PYNVVAYPYVTQAYDKRAPAGFVKNAVQA-IPSPNAVDEKLTTMFSDDNPNGCSVM  115



>ref|XP_002285811.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Vitis vinifera]
 emb|CBI19116.3| unnamed protein product [Vitis vinifera]
Length=149

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 116/150 (77%), Gaps = 4/150 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G +  L++ SDL   K+ +K+K+  +QTVD++V+MDC+GC+ +V+ A+SS+KG KSVD+N
Sbjct  2    GVVATLEYFSDLLSSKKGKKRKQ--LQTVDLKVRMDCEGCQLKVKKALSSLKGVKSVDVN  59

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
             KQ + +V+GY +AKKVLKK +STGKKAELWPYV Y+LV++PY    YDKKAP GYVR+ 
Sbjct  60   LKQQKASVTGYADAKKVLKKAQSTGKKAELWPYVPYNLVAHPYVAQVYDKKAPPGYVRSS  119

Query  142  --PQAIIPSPNTERFTSMFSDENPNACSLM  59
              P     SP  E++T+MFSD+NPNACS+M
Sbjct  120  ENPAITAMSPLEEQYTTMFSDDNPNACSIM  149



>gb|KHG30573.1| Copper chaperone for superoxide dismutase [Gossypium arboreum]
Length=153

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 116/153 (76%), Gaps = 7/153 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkr-KLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINR  320
            MG+LDH+SDLF+     K K+ K +QTV+I+VKMDC+GCER+V+ +V  MKG   VD+ R
Sbjct  1    MGVLDHVSDLFDCSHSSKHKKRKQLQTVEIKVKMDCEGCERKVKKSVEGMKGVTQVDVER  60

Query  319  KQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            K +++TV GYV+ KKV+ +V   TGKK ELWPYV YD+V++PYAPG YDKKAP+GYVRN 
Sbjct  61   KASKLTVVGYVDPKKVVARVAHRTGKKVELWPYVPYDVVAHPYAPGVYDKKAPAGYVRNA  120

Query  142  --PQA--IIPSPNTE-RFTSMFSDENPNACSLM  59
              PQ   +  + +TE R+T+ FSDENP ACS+M
Sbjct  121  EDPQVSHLARASSTEVRYTTAFSDENPAACSVM  153



>ref|XP_008232814.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Prunus mume]
 ref|XP_008246221.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Prunus mume]
Length=155

 Score =   172 bits (435),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 115/154 (75%), Gaps = 6/154 (4%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++LSDL      + KK+K +QTV+++V+MDCDGCE +V+ A+SS+ G KSV+IN
Sbjct  2    GVGGTLEYLSDLVHNSSHKHKKKKQLQTVELKVRMDCDGCELKVKKALSSLSGVKSVEIN  61

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ +V+V+GYVEA KVLKK +STGK+AE+WPY+ Y+LV+ PY   AYDKKAP GYVRNV
Sbjct  62   RKQQKVSVTGYVEANKVLKKAKSTGKRAEIWPYIPYNLVAQPYIAQAYDKKAPPGYVRNV  121

Query  142  PQAIIPSPN------TERFTSMFSDENPNACSLM  59
                + S         + +T+MFSD+NPNACS+M
Sbjct  122  ENMNMTSSTGTVTRYEDPYTTMFSDDNPNACSIM  155



>ref|XP_009369898.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Pyrus x bretschneideri]
Length=153

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 116/152 (76%), Gaps = 4/152 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++LSDL      + KK+K +QTV+++++MDCDGCE +V+NA+SS+ G KSV+IN
Sbjct  2    GVGGTLEYLSDLVNNSGHKHKKKKQLQTVELKIRMDCDGCELKVKNALSSLTGVKSVEIN  61

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ +V+V+GYVE  KVLKK +STGK+AE+WPYV Y+LV+ PY   AYDKKAP GYVRNV
Sbjct  62   RKQQKVSVTGYVEPNKVLKKAKSTGKRAEIWPYVPYNLVAQPYIAQAYDKKAPPGYVRNV  121

Query  142  ---PQAIIPSPNTER-FTSMFSDENPNACSLM  59
               P +   +   E  +T+MFSD+NPNACS+M
Sbjct  122  DNNPSSTGTATKYEDPYTTMFSDDNPNACSIM  153



>gb|EMT26095.1| Superoxide dismutase 1 copper chaperone [Aegilops tauschii]
Length=160

 Score =   171 bits (433),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 119/160 (74%), Gaps = 13/160 (8%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrr---kkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSV  332
            G  G LD+LS+L     RR   K+KRK  QTV+++V+MDCDGCE +VRNA+SSMKG +SV
Sbjct  2    GVGGTLDYLSELLGGGGRRRSYKQKRKQFQTVELKVRMDCDGCELKVRNALSSMKGVQSV  61

Query  331  DINRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYV  152
            +INRKQ +VTV G+VE  KV+K+V++TGKKAE+WPY+ Y+LV++PYA   YDKKAP GYV
Sbjct  62   EINRKQYKVTVQGFVEPHKVVKRVQTTGKKAEIWPYIPYNLVAHPYAAQTYDKKAPPGYV  121

Query  151  RNVPQAIIP---------SPNTERFTSMFSDENPNACSLM  59
            R V  A++P             ER T+MFSD+NPNACS+M
Sbjct  122  RKV-DAVMPVASYGGPGAGAQEERLTTMFSDDNPNACSVM  160



>ref|XP_007159730.1| hypothetical protein PHAVU_002G262500g [Phaseolus vulgaris]
 gb|ESW31724.1| hypothetical protein PHAVU_002G262500g [Phaseolus vulgaris]
Length=153

 Score =   171 bits (432),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 118/156 (76%), Gaps = 12/156 (8%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKL-MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            G  G L++LSDL     + KKK+K   QTV+++V+MDCDGCE +V+NA+SS+ G KSV+I
Sbjct  2    GVGGTLEYLSDLMGSGYQHKKKKKKQFQTVELKVRMDCDGCELKVKNALSSLSGVKSVEI  61

Query  325  NRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            NRKQ +VTVSGYVEA KVLKK +STGKKAE+WPYV Y+LV++PYA  AYDKKAP GYVR 
Sbjct  62   NRKQQKVTVSGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAHPYAVAAYDKKAPPGYVRR  121

Query  145  VPQAIIPSPNTERFT-------SMFSDENPNACSLM  59
            V    +P+ NT   T       +MFSD+NPNACS+M
Sbjct  122  VE---VPA-NTGTITRYEDPYVTMFSDDNPNACSIM  153



>ref|XP_011046678.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Populus euphratica]
 ref|XP_011046679.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Populus euphratica]
Length=154

 Score =   171 bits (432),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 111/154 (72%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkk--krKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG LDHLSD F+      K  KR+ +QTV+++V++DC+GCER+V+ A+  MKG K VD+ 
Sbjct  1    MGALDHLSDFFDCSSGSSKLKKRRQLQTVEVKVRIDCEGCERKVKRALEGMKGVKQVDVE  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            RK N+VTV GYV+  KV+ +V   TGKKAELWPYV YD+V++PYAPG YDKKAP+GYVRN
Sbjct  61   RKANKVTVVGYVDPSKVVARVAHRTGKKAELWPYVPYDMVAHPYAPGVYDKKAPAGYVRN  120

Query  145  -----VPQAIIPSPNTERFTSMFSDENPNACSLM  59
                 V Q    S    R+T+ FSDENP AC++M
Sbjct  121  AEDPHVSQLARASSTEVRYTTAFSDENPAACAVM  154



>ref|XP_002460130.1| hypothetical protein SORBIDRAFT_02g023130 [Sorghum bicolor]
 gb|EER96651.1| hypothetical protein SORBIDRAFT_02g023130 [Sorghum bicolor]
Length=161

 Score =   171 bits (433),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 102/133 (77%), Gaps = 11/133 (8%)
 Frame = -1

Query  427  MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTG  248
             QTV+++V+MDCDGCE +VRNA+SSMKG  SV+INRKQ +VTV GYVE  KV+K+V++TG
Sbjct  30   FQTVELKVRMDCDGCEMKVRNALSSMKGVHSVEINRKQYKVTVQGYVEPHKVVKRVQATG  89

Query  247  KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQAIIP----------SPNTERFTS  98
            KKAE+WPYV Y LV++PYA  AYDKKAP GYVR V  A++P           P  ER  +
Sbjct  90   KKAEIWPYVPYSLVAHPYAAPAYDKKAPPGYVRRV-DAVMPVSSYGGPTAAGPQEERLVT  148

Query  97   MFSDENPNACSLM  59
            MFSD+NPNACS+M
Sbjct  149  MFSDDNPNACSIM  161



>ref|XP_008365962.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Malus domestica]
Length=153

 Score =   171 bits (432),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++LSDL      + KK+K +QTV+++V+MDCDGCE +V+NA+SS+ G KSV+IN
Sbjct  2    GVGGTLEYLSDLVNNSGHKHKKKKQLQTVELKVRMDCDGCELKVKNALSSLTGVKSVEIN  61

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ +V+V+GYVE  KVLKK +STGK+AE+WPYV Y+LV+ PY   AYDKKAP GYVRNV
Sbjct  62   RKQQKVSVTGYVEPNKVLKKAKSTGKRAEIWPYVPYNLVAQPYIAQAYDKKAPPGYVRNV  121

Query  142  PQAIIPSPNTER----FTSMFSDENPNACSLM  59
                  +    +    +T+MFSD+NPNACS+M
Sbjct  122  DNNPSSTGTVTKYEDPYTTMFSDDNPNACSIM  153



>ref|XP_006380445.1| hypothetical protein POPTR_0007s06000g [Populus trichocarpa]
 gb|ERP58242.1| hypothetical protein POPTR_0007s06000g [Populus trichocarpa]
Length=151

 Score =   171 bits (432),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 112/151 (74%), Gaps = 4/151 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L+ LSDL      + KK++L QTV+++V+MDCDGCE +V+NA+SSM G K V+IN
Sbjct  2    GVSGTLEFLSDLVGSGGHKHKKKQL-QTVELKVRMDCDGCELKVKNALSSMSGVKKVEIN  60

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ RVTVSGYV++ KVLKK +STGK+AE+WPYV Y LV+ P+A  AYDKKAP GYVR V
Sbjct  61   RKQQRVTVSGYVDSNKVLKKAKSTGKRAEIWPYVPYSLVAQPFATQAYDKKAPPGYVRKV  120

Query  142  PQAIIPSPNT---ERFTSMFSDENPNACSLM  59
                     T   + +TSMFSD+NPNACS+M
Sbjct  121  ENTAAIGTVTKYEDPYTSMFSDDNPNACSIM  151



>ref|XP_006366527.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum tuberosum]
Length=154

 Score =   170 bits (431),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 110/153 (72%), Gaps = 5/153 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L+++S++  +  +   K++   TV+++V+MDCDGCE +V+  +SS+ G KSV+IN
Sbjct  2    GLGGTLEYISNMMNISHKSNNKKRQFHTVELKVRMDCDGCELKVKKTLSSLSGVKSVEIN  61

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ +VTV+GYVEA KVLKK +STGKKAE+WPYV Y+LV+ PYA  +YDKKAP GYVR V
Sbjct  62   RKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAVASYDKKAPPGYVRRV  121

Query  142  PQAIIPSPNTERF-----TSMFSDENPNACSLM  59
               +  +    RF      SMFSD+NPNAC +M
Sbjct  122  DHNMTTTETISRFEDLAYVSMFSDDNPNACFIM  154



>ref|XP_004956674.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Setaria italica]
Length=159

 Score =   170 bits (431),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 102/133 (77%), Gaps = 11/133 (8%)
 Frame = -1

Query  427  MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTG  248
             QTV++RV+MDCDGCE +VRNA+SSMKG +SV+INRKQ +VTV GYVE  KV+K+V++TG
Sbjct  28   FQTVELRVRMDCDGCEMKVRNALSSMKGVQSVEINRKQYKVTVQGYVEPHKVVKRVQATG  87

Query  247  KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQAIIP----------SPNTERFTS  98
            KKAE+WPYV Y  V++PYA  AYDKKAP GYVR V  A++P           P  ER  +
Sbjct  88   KKAEIWPYVPYSHVAHPYAAPAYDKKAPPGYVRRV-DAVMPVSSYGGPTAAGPQEERLVT  146

Query  97   MFSDENPNACSLM  59
            MFSD+NPNACS+M
Sbjct  147  MFSDDNPNACSIM  159



>ref|XP_008790801.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Phoenix dactylifera]
Length=149

 Score =   170 bits (430),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 101/126 (80%), Gaps = 3/126 (2%)
 Frame = -1

Query  427  MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTG  248
            +QTV+++V+MDC+GCE +V+ A+SSMKG +SVDINRKQ +VTV GYVE  KVLKK +STG
Sbjct  24   LQTVELKVRMDCEGCELKVKKALSSMKGVQSVDINRKQQKVTVIGYVEQHKVLKKAKSTG  83

Query  247  KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQAII---PSPNTERFTSMFSDENP  77
            KKAE+WPYV Y+LV +PYA  AYDKKAP GYVRNV    I   P    ++ T++FSD+NP
Sbjct  84   KKAEIWPYVPYNLVLHPYAAQAYDKKAPPGYVRNVEAITISSQPYRQEDQLTNLFSDDNP  143

Query  76   NACSLM  59
            NACS+M
Sbjct  144  NACSVM  149



>gb|EYU41325.1| hypothetical protein MIMGU_mgv1a026598mg [Erythranthe guttata]
Length=145

 Score =   169 bits (429),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 112/146 (77%), Gaps = 1/146 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+LS+   V   R K++  MQTV+I+VKMDCDGCERRV+NAV ++KG K+V++NRK
Sbjct  1    MGALDYLSNFCTVTSPRSKRKS-MQTVEIKVKMDCDGCERRVKNAVKNIKGVKTVEVNRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
             +RVTV+GYV+  KVLK+V +TGK+AE WPY+ ++LV +P+    YDKKAPSGYV+NV  
Sbjct  60   LSRVTVNGYVDPNKVLKRVNNTGKRAEFWPYIPHNLVQFPHLSQVYDKKAPSGYVKNVQA  119

Query  136  AIIPSPNTERFTSMFSDENPNACSLM  59
              I +   E  T +FS++NP+ACS+M
Sbjct  120  YPIQNATEETITYLFSEDNPHACSIM  145



>ref|XP_003578035.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Brachypodium distachyon]
Length=160

 Score =   170 bits (430),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 120/160 (75%), Gaps = 13/160 (8%)
 Frame = -1

Query  502  GRMGILDHLSDLFE---VkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSV  332
            G  G L++LSDL      +RR K+KR+  QTV+++V+MDC+GCE +VRNA+SSMKG +SV
Sbjct  2    GVSGTLEYLSDLLSNSSRRRRYKQKRRQFQTVELKVRMDCEGCELKVRNALSSMKGVQSV  61

Query  331  DINRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYV  152
            +INRKQ +VTV G+VE  KV+K+V++TGKKAE+WPY+ Y+LV++PYA   YDKKAP GYV
Sbjct  62   EINRKQYKVTVQGFVEPHKVVKRVQATGKKAEIWPYIPYNLVAHPYAAQTYDKKAPPGYV  121

Query  151  RNVPQAIIP---------SPNTERFTSMFSDENPNACSLM  59
            R    A++P         +   ER T+MFSD+NPNACS+M
Sbjct  122  RR-QDAVMPVASYGSGPGAAQEERLTTMFSDDNPNACSIM  160



>ref|XP_009378545.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Pyrus x bretschneideri]
Length=153

 Score =   170 bits (430),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 115/153 (75%), Gaps = 7/153 (5%)
 Frame = -1

Query  496  MGI---LDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            MG+   L++LSDL      + KK+K +QTV+++V+MDCDGCE +V+NA+SS+ G KSV+I
Sbjct  1    MGVGETLEYLSDLVNNSGYKHKKKKQLQTVELKVRMDCDGCELKVKNALSSLTGVKSVEI  60

Query  325  NRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            NRKQ +VTV+GYVE  KVLKK +STGK+AE+WPYV Y+LV+ PY   AYDKKAP GYVRN
Sbjct  61   NRKQQKVTVTGYVEPNKVLKKAKSTGKRAEIWPYVPYNLVAQPYIAQAYDKKAPPGYVRN  120

Query  145  VPQAIIPSPNTER----FTSMFSDENPNACSLM  59
            V      +    +    +T+MFSD+NPNACS+M
Sbjct  121  VDNNPSSTGTVTKYEDPYTTMFSDDNPNACSIM  153



>ref|XP_004492985.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cicer arietinum]
Length=147

 Score =   169 bits (429),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 116/148 (78%), Gaps = 3/148 (2%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG L +L   F      K KRK MQTV+I+VKMDCDGCERRVRNAV++MKG KSV+INRK
Sbjct  1    MGALHYLISNFCTAPNTKTKRKPMQTVEIKVKMDCDGCERRVRNAVATMKGVKSVEINRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKK-AELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            Q++VTV+G+V+  KVLK+V++TGKK AE WPYV   +V+YP+APG YDK+AP+GYV+NV 
Sbjct  61   QSKVTVNGFVDPNKVLKRVKNTGKKRAEFWPYVPQHVVTYPHAPGVYDKRAPAGYVKNV-  119

Query  139  QAIIPSPNT-ERFTSMFSDENPNACSLM  59
            Q +  S +T E+  S FS++N NACS+M
Sbjct  120  QTLPSSIDTEEKLMSYFSEDNVNACSIM  147



>ref|XP_007041823.1| Farnesylated protein 6 isoform 1 [Theobroma cacao]
 gb|EOX97654.1| Farnesylated protein 6 isoform 1 [Theobroma cacao]
Length=154

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 111/154 (72%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkk--krKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG LDH+SDLF+  R   K  KRK +QTV+I+VKMDC+GCER+V+ +V  MKG   VD+ 
Sbjct  1    MGALDHVSDLFDCSRSSSKLKKRKQLQTVEIKVKMDCEGCERKVKKSVEGMKGVTQVDVE  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            RK N++TV GYV+  KV+ +V   TGKK ELWPYV YD+V++PYAPG YDKKAP+GYVRN
Sbjct  61   RKANKLTVVGYVDPAKVVARVAHRTGKKVELWPYVPYDVVAHPYAPGVYDKKAPAGYVRN  120

Query  145  -----VPQAIIPSPNTERFTSMFSDENPNACSLM  59
                 V Q    S    R+T+ FSDENP ACS+M
Sbjct  121  AEDPQVSQLARASSTEVRYTTAFSDENPAACSVM  154



>ref|XP_004144847.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
 ref|XP_004164903.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
 gb|KGN43252.1| hypothetical protein Csa_7G012410 [Cucumis sativus]
Length=154

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 113/154 (73%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrr--rkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG+LDHLSD F+      + KKRK +QTV++++++DC+GCER+V+ A+  MKG K VD++
Sbjct  1    MGVLDHLSDYFDCSSHGHKHKKRKQLQTVELKIRIDCEGCERKVKRALEGMKGVKQVDVD  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR-  149
            RK N+ TV GYVE  KV+ +V   TGKKAELWPYV YD+V++PYAPG YDKKAP+GYVR 
Sbjct  61   RKANKATVVGYVEPSKVVARVAHRTGKKAELWPYVPYDVVAHPYAPGVYDKKAPAGYVRK  120

Query  148  ----NVPQAIIPSPNTERFTSMFSDENPNACSLM  59
                NV Q    S    R+T+ FSDENP AC++M
Sbjct  121  ADDPNVYQLARASSTEVRYTTAFSDENPAACAVM  154



>ref|XP_011005631.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Populus euphratica]
Length=151

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 112/151 (74%), Gaps = 4/151 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L+ LSDL      + KK++L QTV+++V+MDCDGCE +V+NA+SSM G K V+IN
Sbjct  2    GVSGTLEFLSDLVGSGGHKHKKKQL-QTVELKVRMDCDGCELKVKNALSSMSGVKKVEIN  60

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ RVTVSGYV++ KVLKK +STGK+AE+WPYV Y LV+ P+A  AYDK+AP GYVR V
Sbjct  61   RKQQRVTVSGYVDSNKVLKKAKSTGKRAEIWPYVPYSLVAQPFAAQAYDKRAPPGYVRKV  120

Query  142  PQAIIPSPNT---ERFTSMFSDENPNACSLM  59
                     T   + +TSMFSD+NPNACS+M
Sbjct  121  ENTAAIGTVTRYEDPYTSMFSDDNPNACSIM  151



>ref|XP_002534419.1| metal ion binding protein, putative [Ricinus communis]
 gb|EEF27963.1| metal ion binding protein, putative [Ricinus communis]
Length=154

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 111/154 (72%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVk--rrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG LDH S LF+      + KKRK +QTV+I+V++DC+GCER+V+ AV  MKG K VD++
Sbjct  1    MGALDHFSHLFDCSHGSSKHKKRKQLQTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVD  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR-  149
            RK N++TV GYV+  KV+ +V   TGK+AELWPYV YD+V++PYAPG YDKKAPSGYVR 
Sbjct  61   RKSNKLTVVGYVDPSKVVARVAHRTGKRAELWPYVPYDVVAHPYAPGVYDKKAPSGYVRR  120

Query  148  ----NVPQAIIPSPNTERFTSMFSDENPNACSLM  59
                 V Q    S    R+T+ FSDENP ACS+M
Sbjct  121  AEDPQVSQLARASSTEVRYTTAFSDENPQACSIM  154



>ref|XP_007137345.1| hypothetical protein PHAVU_009G119300g [Phaseolus vulgaris]
 gb|AGV54330.1| metal ion binding protein [Phaseolus vulgaris]
 gb|ESW09339.1| hypothetical protein PHAVU_009G119300g [Phaseolus vulgaris]
Length=154

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 114/154 (74%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkk--krKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG LDH+S+LF+      K  KRK +QTV+++VKMDC+GCER+VR AV  MKG   V+++
Sbjct  1    MGALDHISELFDCSHGSSKLKKRKQLQTVEVKVKMDCEGCERKVRKAVEGMKGVNQVEVD  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            RK N+VTV GYV+  KV+ ++   TGKKAELWPYV YD+V++PYAPG YDKKAPSGYVRN
Sbjct  61   RKANKVTVVGYVDPSKVVARIAHRTGKKAELWPYVPYDVVAHPYAPGVYDKKAPSGYVRN  120

Query  145  VP----QAIIPSPNTE-RFTSMFSDENPNACSLM  59
                    +  + +TE R+T+ FSDENP AC++M
Sbjct  121  TDDPHYSHLARASSTEVRYTTAFSDENPTACAVM  154



>ref|XP_003602005.1| hypothetical protein MTR_3g087770 [Medicago truncatula]
 gb|AES72256.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
 gb|AFK47104.1| unknown [Medicago truncatula]
Length=152

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 113/151 (75%), Gaps = 3/151 (2%)
 Frame = -1

Query  502  GRMGILDHLSDLFE--VkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            G  G L++LSDL        + KK+K +QTV+++V+MDCDGCE +V+ A+SSM G KSV+
Sbjct  2    GVGGTLEYLSDLMGSGHHHHKIKKKKQLQTVELKVRMDCDGCELKVKKALSSMNGVKSVE  61

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            INRKQ +VTV+GYVEA KVLKK +STGKKAE+WPYV Y++V +PYA  +YDKKAP GYVR
Sbjct  62   INRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNMVVHPYAAPSYDKKAPPGYVR  121

Query  148  NV-PQAIIPSPNTERFTSMFSDENPNACSLM  59
             +     + +      T+MFSDENPNACS+M
Sbjct  122  RLETTGTVRAYEEPHLTTMFSDENPNACSIM  152



>ref|XP_008374328.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Malus domestica]
Length=153

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 112/152 (74%), Gaps = 4/152 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++LSDL      + KK+K +QTV+++V+MDCDGCE +V+NA+SS+ G KSV+IN
Sbjct  2    GVGGTLEYLSDLVNNSGYKHKKKKQLQTVELKVRMDCDGCELKVKNALSSLTGVKSVEIN  61

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ +V V+GYVE  KVLKK +STGK+AE+WPYV Y LV+ PY   AYDKKAP GYVRNV
Sbjct  62   RKQQKVXVTGYVEPNKVLKKAKSTGKRAEIWPYVPYSLVAQPYIAQAYDKKAPPGYVRNV  121

Query  142  PQAIIPSPNTER----FTSMFSDENPNACSLM  59
                  +    +    +T+MFSD+NPNACS+M
Sbjct  122  DNNPSSTGTVTKYEDPYTTMFSDDNPNACSIM  153



>gb|KDP46890.1| hypothetical protein JCGZ_24099 [Jatropha curcas]
Length=146

 Score =   169 bits (428),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 112/146 (77%), Gaps = 3/146 (2%)
 Frame = -1

Query  487  LDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQNR  308
            + +LSDL      + KK+K +QTV+++V+MDCDGCE +V+NA+SS+ G K V+INRKQ +
Sbjct  1    MGYLSDLMGSGGYKHKKKKQLQTVELKVRMDCDGCELKVKNALSSLSGVKKVEINRKQQK  60

Query  307  VTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQAII  128
            VTV+GYV++ KVLKK +STGKKAE+WPYV Y+LV+ PY   AYDKKAP GYVR V  ++ 
Sbjct  61   VTVTGYVDSNKVLKKAKSTGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPGYVRKVESSVA  120

Query  127  PSPNT---ERFTSMFSDENPNACSLM  59
                T   + +TSMFSD+NPNACS+M
Sbjct  121  SGTITRYEDPYTSMFSDDNPNACSIM  146



>ref|XP_007206070.1| hypothetical protein PRUPE_ppa012771mg [Prunus persica]
 gb|EMJ07269.1| hypothetical protein PRUPE_ppa012771mg [Prunus persica]
Length=155

 Score =   169 bits (428),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 115/154 (75%), Gaps = 6/154 (4%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++LSDL      + KK+K +QTV+++V+MDCDGCE +V+ A+SS+ G KSV+IN
Sbjct  2    GVGGTLEYLSDLVNNSGHKHKKKKQLQTVELKVRMDCDGCELKVKKALSSLSGVKSVEIN  61

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ +V+V+GYVEA KVLKK +STGK+AE+WPYV Y+LV+ PY   AYDK+AP G+VRNV
Sbjct  62   RKQQKVSVTGYVEANKVLKKAKSTGKRAEIWPYVPYNLVAQPYIAQAYDKRAPPGHVRNV  121

Query  142  PQAIIPSPN------TERFTSMFSDENPNACSLM  59
                + S         + +T+MFSD+NPNACS+M
Sbjct  122  ENMNMTSSTGTVTRYEDPYTTMFSDDNPNACSIM  155



>ref|XP_004502447.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cicer arietinum]
Length=153

 Score =   169 bits (428),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLF---EVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSV  332
            G  G L++LSDL       + + K++K +QTV+++V+MDCDGCE +V+ A+SS+ G KSV
Sbjct  2    GVGGTLEYLSDLMGSGHHHQHKIKRKKQLQTVELKVRMDCDGCELKVKKALSSLNGVKSV  61

Query  331  DINRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYV  152
            +INRKQ +VTV GYVEA KVLKK +STGKKAE+WPYV Y++V++PYA  AYDKKAP GYV
Sbjct  62   EINRKQQKVTVMGYVEANKVLKKAKSTGKKAEIWPYVPYNMVTHPYAVPAYDKKAPPGYV  121

Query  151  RNV-PQAIIPSPNTERFTSMFSDENPNACSLM  59
            R +     + +      T++FSDENPNACS+M
Sbjct  122  RRLETTGTVITYEDSHITTLFSDENPNACSIM  153



>ref|XP_002528981.1| metal ion binding protein, putative [Ricinus communis]
 gb|EEF33400.1| metal ion binding protein, putative [Ricinus communis]
Length=153

 Score =   169 bits (427),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLF-EVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            G  G L++LSDL      + KKK+K +QTV+++++MDCDGCE +V+NA+SSM G K V+I
Sbjct  2    GVGGTLEYLSDLMGSSGHKYKKKKKQLQTVELKIRMDCDGCELKVKNALSSMSGVKKVEI  61

Query  325  NRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            NRKQ +VTV+GYV+  KVLKK +STGKKAE+WPYV Y+LV+ PY   AYDKKAP GYVRN
Sbjct  62   NRKQQKVTVTGYVDPNKVLKKAKSTGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPGYVRN  121

Query  145  VPQAIIPSPNT---ERFTSMFSDENPNACSLM  59
            V         T   + ++SMFSD+NPNACS+M
Sbjct  122  VENTATSGTVTRYEDPYSSMFSDDNPNACSIM  153



>ref|XP_011090461.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Sesamum indicum]
Length=152

 Score =   168 bits (426),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 118/151 (78%), Gaps = 3/151 (2%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKL-MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            G  G L+++S+L    R+ KKKRK   QTV+++V+MDCDGCE +V+NA+SS+ G KSV+I
Sbjct  2    GVSGTLEYISELMSSGRKDKKKRKKQFQTVNLKVRMDCDGCELKVKNALSSLTGVKSVEI  61

Query  325  NRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            NRKQ +VTV+GYVE  KVLKK +STGKKAE+WPYV Y+LV+ PYAP AYDKKAP+G+VR 
Sbjct  62   NRKQQKVTVTGYVEESKVLKKAKSTGKKAEIWPYVPYNLVAQPYAPQAYDKKAPAGFVRK  121

Query  145  VPQAIIPS--PNTERFTSMFSDENPNACSLM  59
            +     P+   + + + +MFSD+NPNACS+M
Sbjct  122  LDNPPPPTRIDHQDPYIAMFSDDNPNACSIM  152



>ref|XP_008447957.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis melo]
Length=154

 Score =   168 bits (426),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 112/154 (73%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkr--rrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG+LDHLSD F+      + KKRK +QTV++++++DC+GCER+V+ A+  MKG K VD++
Sbjct  1    MGVLDHLSDYFDCSSHGSKHKKRKQLQTVELKIRIDCEGCERKVKRALEGMKGVKQVDVD  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR-  149
            RK N+ TV GYVE  KV+ +V   TGKKAELWPYV YD+V++PYAPG YDKKAP+GYVR 
Sbjct  61   RKSNKATVVGYVEPSKVVARVAHRTGKKAELWPYVPYDVVAHPYAPGVYDKKAPAGYVRK  120

Query  148  ----NVPQAIIPSPNTERFTSMFSDENPNACSLM  59
                NV Q    S    R+T+ FSDENP AC +M
Sbjct  121  ADDPNVYQLARASSTEVRYTTAFSDENPAACVVM  154



>ref|XP_004302198.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Fragaria vesca subsp. vesca]
Length=152

 Score =   168 bits (426),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 111/151 (74%), Gaps = 3/151 (2%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++LSDL      + KK+K +QTV+++V+MDCDGCE +V+ A+SS+ G KSV+IN
Sbjct  2    GVGGTLEYLSDLMGSGGHKHKKKKQLQTVELKVRMDCDGCELKVKKALSSLSGVKSVEIN  61

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ + +V+GYVE  KVLKK +STGK+AE+WPYV Y+LV+ PY   AYDKKAP GYVR V
Sbjct  62   RKQQKASVTGYVEPNKVLKKAKSTGKRAEIWPYVPYNLVAQPYMAPAYDKKAPPGYVRKV  121

Query  142  PQAIIPSPNT---ERFTSMFSDENPNACSLM  59
                     T   + +T+MFSDENPNACS+M
Sbjct  122  ENTATTGTMTRYEDPYTAMFSDENPNACSIM  152



>ref|XP_002306185.1| GMFP7 family protein [Populus trichocarpa]
 gb|EEE86696.1| GMFP7 family protein [Populus trichocarpa]
Length=154

 Score =   168 bits (426),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 110/154 (71%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkk--krKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG LDHLS  F+      K  KR+ +QTV+++V++DC+GCER+V+ A+  MKG K VD+ 
Sbjct  1    MGALDHLSGFFDCSSGSSKLKKRRQLQTVEVKVRIDCEGCERKVKRALEGMKGVKQVDVE  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            RK N+VTV GYV+  KV+ +V   TGKKAELWPYV YD+V++PYAPG YDKKAP+GYVRN
Sbjct  61   RKANKVTVVGYVDPSKVVARVAHRTGKKAELWPYVPYDMVAHPYAPGVYDKKAPAGYVRN  120

Query  145  -----VPQAIIPSPNTERFTSMFSDENPNACSLM  59
                 V Q    S    R+T+ FSDENP AC++M
Sbjct  121  AEDPQVSQLARASSTEVRYTTAFSDENPAACAIM  154



>ref|NP_001238649.1| uncharacterized protein LOC100500473 [Glycine max]
 gb|ACU15561.1| unknown [Glycine max]
Length=152

 Score =   168 bits (425),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 113/152 (74%), Gaps = 5/152 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++LSDL        KK+K  QTV+++V+MDCDGCE +V+NA+SS+ G KSV+IN
Sbjct  2    GVGGTLEYLSDLMGSGHHHHKKKKQFQTVELKVRMDCDGCELKVKNALSSLSGVKSVEIN  61

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ +VTV+GYVE  KVLKK +STGKKAE+WPYV Y+LV +PYA  +YDKKAP GYVR V
Sbjct  62   RKQQKVTVTGYVEPNKVLKKAKSTGKKAEIWPYVPYNLVVHPYAVPSYDKKAPPGYVRRV  121

Query  142  PQAIIPSPNTER----FTSMFSDENPNACSLM  59
             +A   +    R    + +MFSD+NPNACS+M
Sbjct  122  -EAPAHTGTITRYEDPYITMFSDDNPNACSIM  152



>emb|CAD70173.1| farnesylated protein 3 [Hordeum vulgare subsp. vulgare]
Length=151

 Score =   168 bits (425),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 113/151 (75%), Gaps = 5/151 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL----MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LDHLSDL  +   ++  +       QTV+I+VKMDC+GCERRV+NAV S++G  SV 
Sbjct  1    MGALDHLSDLCSMTETKESLKLRKKRPQQTVNIKVKMDCEGCERRVKNAVKSIRGVTSVA  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +N K ++VTV+G+VE +KVL++V+STGK AE+WPYV Y L +YPY  GAYDKKAP+G+VR
Sbjct  61   VNPKMSKVTVTGHVEPRKVLERVKSTGKAAEMWPYVPYTLATYPYVGGAYDKKAPAGFVR  120

Query  148  NVPQAII-PSPNTERFTSMFSDENPNACSLM  59
            + PQA+  P+     + +MF+DE+ NAC++M
Sbjct  121  SAPQAMADPAAPEIHYMNMFNDEDVNACTVM  151



>ref|XP_011088612.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Sesamum indicum]
Length=154

 Score =   167 bits (424),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 112/154 (73%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkk--krKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG LDHLS +F+      K  KRK +QTV+I++K+DC+GCER+VR +V  MKG  SV+++
Sbjct  1    MGALDHLSHIFDCSSGHSKLKKRKQLQTVEIKIKIDCEGCERKVRRSVEGMKGVTSVEVS  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
             KQN++TV GYVE +KV+ +V   TGKKAELWPYV YD+V++PYAPG YDKKAP+GYVRN
Sbjct  61   PKQNKLTVIGYVEPEKVVARVAHRTGKKAELWPYVPYDVVAHPYAPGVYDKKAPAGYVRN  120

Query  145  -----VPQAIIPSPNTERFTSMFSDENPNACSLM  59
                 V Q    S    R+T+ FSDENP AC +M
Sbjct  121  SEDPQVSQLARASSTEVRYTTAFSDENPAACVVM  154



>ref|XP_010558674.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Tarenaya hassleriana]
Length=147

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 112/148 (76%), Gaps = 3/148 (2%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG  D++S         K+KRK +QTV+I+VKMDCDGCERR+RN V  MKG K+V++NRK
Sbjct  1    MGAFDYISSFCSYTYTGKRKRKPLQTVEIKVKMDCDGCERRIRNIVRRMKGVKTVEVNRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
            Q+R+TV+G+V+  KVLK+V+STGKKAE WPY+   +V YP+APG YDK+AP+G++RN  Q
Sbjct  61   QSRLTVNGHVDPNKVLKRVKSTGKKAEFWPYIPQHVVYYPFAPGMYDKRAPAGHIRNPGQ  120

Query  136  AIIPSPNT--ERFTSMFSDENPNACSLM  59
            A  P+ N   E + S+FSD+N + CS+M
Sbjct  121  A-FPNANAPEENYVSLFSDDNVHGCSIM  147



>ref|XP_007139206.1| hypothetical protein PHAVU_008G010200g [Phaseolus vulgaris]
 gb|ESW11200.1| hypothetical protein PHAVU_008G010200g [Phaseolus vulgaris]
Length=145

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 103/125 (82%), Gaps = 3/125 (2%)
 Frame = -1

Query  427  MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTG  248
            MQTV+I+VKMDCDGCER+VRNAV+ MKG KSV+INRKQ+RVTV+G V+  KVL +V+ TG
Sbjct  22   MQTVEIKVKMDCDGCERKVRNAVAKMKGVKSVEINRKQSRVTVNGCVDPNKVLNRVKRTG  81

Query  247  KK-AELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQAIIPSPNT-ERFTSMFSDENPN  74
            KK AE WPYV   +V+YP+A G YDK+APSGYVRN+ Q+  PS  T E+F S+FS++N N
Sbjct  82   KKRAEFWPYVPQHVVTYPHASGVYDKRAPSGYVRNM-QSFTPSAETEEKFMSLFSEDNVN  140

Query  73   ACSLM  59
            ACS+M
Sbjct  141  ACSIM  145



>gb|AIE40061.1| heavy metal-associated isoprenylated protein 3 [Triticum aestivum]
Length=151

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 113/151 (75%), Gaps = 5/151 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL----MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LDHLSDL  +   ++  +      +QTV+I+VKMDC+GCERRV+NAV S++G  SV 
Sbjct  1    MGALDHLSDLCSMTETKEALKLRKKRPLQTVNIKVKMDCEGCERRVKNAVKSIRGVTSVA  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +N K +++TV+G+VE +KVL++V STGK AE+WPYV Y L +YPY  GAYDKKAP+G+VR
Sbjct  61   VNPKMSKMTVTGHVEPRKVLERVMSTGKAAEMWPYVPYTLATYPYVGGAYDKKAPAGFVR  120

Query  148  NVPQAII-PSPNTERFTSMFSDENPNACSLM  59
            + PQA+  P+     + +MF+DE+ NAC++M
Sbjct  121  SAPQAMADPAAPEIHYMNMFNDEDVNACTVM  151



>emb|CAD70172.1| farnesylated protein 2 [Hordeum vulgare subsp. vulgare]
Length=151

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 110/151 (73%), Gaps = 5/151 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL----MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG+LDHLSDL  +   +   +      +QTV+I+VKMDC+GCER+V+NAV S++G  +V 
Sbjct  1    MGVLDHLSDLCSMTDTKAALKLRKRRPLQTVNIKVKMDCEGCERKVKNAVKSIRGVTAVS  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +N K ++VTV+G+VE  KVL +V+STGK AE+WPYV Y L +YPY  GAYDKKAP+G+VR
Sbjct  61   VNPKMSKVTVTGFVEPSKVLARVKSTGKVAEMWPYVPYSLTTYPYVGGAYDKKAPAGFVR  120

Query  148  NVPQAII-PSPNTERFTSMFSDENPNACSLM  59
              PQA+  P     R+ +MF DE+ N+C++M
Sbjct  121  GAPQAMADPGAPEVRYMNMFDDEDVNSCTIM  151



>gb|EAZ44469.1| hypothetical protein OsJ_29086 [Oryza sativa Japonica Group]
Length=160

 Score =   167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 104/133 (78%), Gaps = 11/133 (8%)
 Frame = -1

Query  427  MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTG  248
             QTV+++V+MDCDGCE +VRNA+SSMKG +SV+INRKQ +VTV G+VE  KV+K+V++TG
Sbjct  29   FQTVELKVRMDCDGCELKVRNALSSMKGVQSVEINRKQYKVTVQGFVEPHKVVKRVQATG  88

Query  247  KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQAIIPSPN----------TERFTS  98
            KKAE+WPYV Y LV++PYA  AYDK+AP G+VR V  A++P  +           ER T+
Sbjct  89   KKAEIWPYVPYTLVAHPYAAPAYDKRAPPGHVRRV-DAVMPVASYGSAAAAAAPEERLTT  147

Query  97   MFSDENPNACSLM  59
            MFSDENPNACS+M
Sbjct  148  MFSDENPNACSIM  160



>ref|XP_011092975.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform X1 [Sesamum indicum]
 ref|XP_011092978.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform X2 [Sesamum indicum]
Length=154

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 116/154 (75%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkk--krKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG LDHLS++F+      K  KRK +QTV+I++K+DC+GCER+VR +V  MKG  SVD++
Sbjct  1    MGALDHLSNIFDCSSGHSKLKKRKQLQTVEIKIKIDCEGCERKVRRSVEGMKGVTSVDVS  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
             KQN++TV+GYV+ +KV+ +V   TGKKAELWPYV YD+V +PYAPG YDKKAP+GYVR 
Sbjct  61   AKQNKLTVTGYVDPEKVVARVAHRTGKKAELWPYVPYDVVEHPYAPGVYDKKAPAGYVRK  120

Query  145  V--PQA--IIPSPNTE-RFTSMFSDENPNACSLM  59
               PQ   +  + +TE R+T+ FSDENP AC +M
Sbjct  121  ADDPQVSQLARATSTEVRYTTAFSDENPAACVVM  154



>gb|KDP29662.1| hypothetical protein JCGZ_18824 [Jatropha curcas]
Length=154

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 114/154 (74%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkr--rrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG LDH S +F+      + KKRK +QTV+I+V++DC+GCER+V+ A+  MKG K VD+ 
Sbjct  1    MGALDHFSHIFDCSHGRSKLKKRKQLQTVEIKVRIDCEGCERKVKRALEGMKGVKQVDVE  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            RK N+VTV GYV+  KV+ +V   TGKKAELWPYV YD+V++PYAPG YDKKAPSGYVR 
Sbjct  61   RKANKVTVVGYVDPSKVVARVAHRTGKKAELWPYVPYDVVAHPYAPGVYDKKAPSGYVRR  120

Query  145  V--PQA--IIPSPNTE-RFTSMFSDENPNACSLM  59
               PQ   +  + +TE R+T+ FSDENP AC++M
Sbjct  121  AEDPQVSNLARASSTEVRYTTAFSDENPQACAIM  154



>gb|AFK40125.1| unknown [Lotus japonicus]
Length=155

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 114/154 (74%), Gaps = 6/154 (4%)
 Frame = -1

Query  502  GRMGILDHLSDLFE---VkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSV  332
            G  G L++LSDL         + KK+K +QTV+++V+MDCDGCE +V+  +SS+ G KSV
Sbjct  2    GISGTLEYLSDLMGSGYHHHHKMKKKKQLQTVELKVRMDCDGCELKVKKTLSSLSGVKSV  61

Query  331  DINRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYV  152
            +INRKQ +VTV+GYVE  KVLKK +STGK+AE+WPYV Y+LV++PYA  AYDKKAP+GYV
Sbjct  62   EINRKQQKVTVTGYVEPNKVLKKAKSTGKRAEIWPYVPYNLVAHPYAAPAYDKKAPAGYV  121

Query  151  RNVPQAIIPSPNT---ERFTSMFSDENPNACSLM  59
            R V         T   + +++MFSDENPNACS+M
Sbjct  122  RRVETTAATGTVTRYEDPYSNMFSDENPNACSIM  155



>ref|XP_009381902.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
Length=146

 Score =   166 bits (421),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 100/126 (79%), Gaps = 3/126 (2%)
 Frame = -1

Query  427  MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTG  248
            +QTV+++V+MDC+GCE +VRNA+SS+ G +SVDINRKQN+VTV+GYVE  KVLKKV STG
Sbjct  21   LQTVELKVRMDCEGCELKVRNAISSVTGVQSVDINRKQNKVTVTGYVEQHKVLKKVRSTG  80

Query  247  KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQAII---PSPNTERFTSMFSDENP  77
            K+ E+WPYV Y+LV++P+    YDKKAP GYVRNV    +   P    +  T++FSD+NP
Sbjct  81   KRVEIWPYVPYNLVTHPHGAQIYDKKAPPGYVRNVEVVTVSSQPLRQDDLLTNLFSDDNP  140

Query  76   NACSLM  59
            NACS+M
Sbjct  141  NACSIM  146



>gb|AGW45453.1| metal ion binding [Reaumuria trigyna]
Length=154

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 109/154 (71%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkr--rrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG LDHLSDLF+      +  KR+ +QTV+I++K+DC+GCER+VR +V  MKG   VDI 
Sbjct  1    MGALDHLSDLFDCGGGGHKMHKRRQLQTVEIKIKIDCEGCERKVRRSVEGMKGVNQVDIE  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
             KQN++TV GYVE  KVL +V   TGKKA+LWPYV YD+V +PYA G YD+KAP+GYVRN
Sbjct  61   PKQNKLTVVGYVEPSKVLARVRHRTGKKADLWPYVPYDVVEHPYAQGVYDRKAPAGYVRN  120

Query  145  -----VPQAIIPSPNTERFTSMFSDENPNACSLM  59
                 + Q    S    R+T+ FSDENP ACS+M
Sbjct  121  CDDPGMSQLARASSTEVRYTTAFSDENPTACSIM  154



>ref|XP_009390577.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
Length=149

 Score =   166 bits (421),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 102/126 (81%), Gaps = 3/126 (2%)
 Frame = -1

Query  427  MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTG  248
             QTV+++V+MDC+GCE +VRNA+S+M+G +SVDINRKQ +VTV+GYVE  KV+K+V+STG
Sbjct  24   FQTVELKVRMDCEGCELKVRNALSTMRGVQSVDINRKQYKVTVTGYVEPHKVIKRVQSTG  83

Query  247  KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQAIIPSPNT---ERFTSMFSDENP  77
            KKAELWPYV Y+LV++PY    YDKKAP GYVRN+    + S      ++ TS+FSD+NP
Sbjct  84   KKAELWPYVPYNLVAHPYVAPTYDKKAPPGYVRNMEVIAVSSQVVRPEDQLTSLFSDDNP  143

Query  76   NACSLM  59
            NACS+M
Sbjct  144  NACSIM  149



>ref|XP_003518642.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform X1 [Glycine max]
 gb|KHN47257.1| hypothetical protein glysoja_035048 [Glycine soja]
Length=145

 Score =   166 bits (421),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 113/148 (76%), Gaps = 5/148 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG L+++   F       KK K MQTV+I+VKMDCDGCER+VRNAV+++KG KSV+INRK
Sbjct  1    MGALNYIISNF--CTVPSKKIKTMQTVEIKVKMDCDGCERKVRNAVATIKGVKSVEINRK  58

Query  316  QNRVTVSGYVEAKKVLKKVESTGKK-AELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            Q+RVTV+G V+  KVL +V+ TGKK AE WPYV   +V+YP+A G YDK+AP GYVRNV 
Sbjct  59   QSRVTVNGCVDPNKVLNRVKRTGKKRAEFWPYVAQHVVTYPHASGIYDKRAPGGYVRNV-  117

Query  139  QAIIPSPNT-ERFTSMFSDENPNACSLM  59
            Q   PS +T E+F S+FS++N NACS+M
Sbjct  118  QTFTPSADTEEKFMSLFSEDNVNACSIM  145



>gb|EAZ08809.1| hypothetical protein OsI_31075 [Oryza sativa Indica Group]
Length=161

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 104/134 (78%), Gaps = 12/134 (9%)
 Frame = -1

Query  427  MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTG  248
             QTV+++V+MDCDGCE +VRNA+SSMKG +SV+INRKQ +VTV G+VE  KV+K+V++TG
Sbjct  29   FQTVELKVRMDCDGCELKVRNALSSMKGVQSVEINRKQYKVTVQGFVEPHKVVKRVQATG  88

Query  247  KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQAIIPSPN-----------TERFT  101
            KKAE+WPYV Y LV++PYA  AYDK+AP G+VR V  A++P  +            ER T
Sbjct  89   KKAEIWPYVPYTLVAHPYAAPAYDKRAPPGHVRRV-DAVMPVASYGSAAAAAAAPEERLT  147

Query  100  SMFSDENPNACSLM  59
            +MFSDENPNACS+M
Sbjct  148  TMFSDENPNACSIM  161



>gb|KDP32706.1| hypothetical protein JCGZ_11998 [Jatropha curcas]
Length=150

 Score =   166 bits (420),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++LSDL     ++ KKRK MQTV ++++MDCDGC R+V+N +S +KGAKSVDI+
Sbjct  2    GVAGTLEYLSDLLS-SVKKGKKRKQMQTVALKIRMDCDGCARKVKNVLSGVKGAKSVDID  60

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
             KQ + TV+GYVE KKVLK  +ST KK ELWPYV Y LV+ PY   AYDKKAP+ +VR V
Sbjct  61   MKQQKATVTGYVEPKKVLKAAQSTKKKVELWPYVPYTLVANPYVSQAYDKKAPANHVRAV  120

Query  142  PQAIIPSPNT--ERFTSMFSDENPNACSLM  59
            P     +  T  +++T+MFSDENPN+CS+M
Sbjct  121  PATATITETTVDDQYTNMFSDENPNSCSIM  150



>ref|XP_009391452.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
Length=149

 Score =   166 bits (419),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 113/149 (76%), Gaps = 6/149 (4%)
 Frame = -1

Query  493  GILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQ  314
            G LD LS L     R  K+++  QTV++RV+MDC+GCE +VRNA+S+MKG +SVDI+RKQ
Sbjct  3    GTLDFLSSLLGGGHRYNKRKQF-QTVELRVRMDCEGCELKVRNALSTMKGVRSVDISRKQ  61

Query  313  NRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQA  134
             +VTV+GYVE  KV+K+V+STGKKAE+WPYV Y++V+ PYA   YDKKAP+GYVRNV   
Sbjct  62   YKVTVTGYVEPHKVVKRVKSTGKKAEIWPYVPYNVVARPYAAQTYDKKAPAGYVRNVEAI  121

Query  133  IIPS----PNTERFTSMFSDENPNACSLM  59
             + S    P  E   ++FSD+NPNACS+M
Sbjct  122  RVSSQVVKPEDE-LAALFSDDNPNACSIM  149



>ref|XP_004239997.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum lycopersicum]
Length=154

 Score =   166 bits (420),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 109/153 (71%), Gaps = 5/153 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L+++ D+ ++  +   K++   TV+++++MDCDGCE +V+  +SS+ G KSV+IN
Sbjct  2    GLGGTLEYIYDMMKISHKSNNKKRQFHTVELKIRMDCDGCELKVKKTLSSISGVKSVEIN  61

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ +VTV+GYVEA KVLKK +STGKKAE+WPYV Y+LV+ PYA  +YDKKAP GYVR V
Sbjct  62   RKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAVASYDKKAPPGYVRRV  121

Query  142  PQAIIPSPNTERF-----TSMFSDENPNACSLM  59
               +       RF      +MFSD+NPNAC +M
Sbjct  122  DHNMTTIGTISRFEDHDYVTMFSDDNPNACFIM  154



>ref|XP_003604043.1| Farnesylated protein (ATFP6) [Medicago truncatula]
 gb|AES74294.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=156

 Score =   166 bits (420),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 112/156 (72%), Gaps = 10/156 (6%)
 Frame = -1

Query  496  MGILDHLSDLFEVkr-rrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINR  320
            MG +DH+S+LF+       K RK +QTV+++VKMDC+GCER+VR +V  MKG   VDI+R
Sbjct  1    MGAMDHISELFDCSGGSSHKHRKQLQTVEVKVKMDCEGCERKVRRSVEGMKGVNQVDIDR  60

Query  319  KQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN-  146
            K ++VTV GYVE  KV+ ++   TGK+AE+WPYV YD+V++PYA G YDKKAPSGYVRN 
Sbjct  61   KAHKVTVQGYVEPNKVVARIAHRTGKRAEIWPYVPYDVVAHPYAQGTYDKKAPSGYVRNN  120

Query  145  ------VPQAIIPSPNTE-RFTSMFSDENPNACSLM  59
                      +  + +TE R+T+ FSDENP ACS+M
Sbjct  121  YDNNQYSGSHLARASSTEVRYTTAFSDENPTACSVM  156



>gb|KDO42373.1| hypothetical protein CISIN_1g036289mg, partial [Citrus sinensis]
Length=149

 Score =   166 bits (419),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 111/148 (75%), Gaps = 4/148 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKL-MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            G  G L++LSDL      + KK+K  +QTVD++V+MDCDGCE +V+NAVSS+ G KSV+I
Sbjct  2    GVAGTLEYLSDLMGSSGHKHKKKKKQLQTVDLKVRMDCDGCELKVKNAVSSLSGVKSVEI  61

Query  325  NRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            NRKQ +V+V+GYVEA KVLKK +STGK+AE+WPYV Y+LV+ PY  GAYDK+AP GYVR 
Sbjct  62   NRKQQKVSVTGYVEANKVLKKAKSTGKRAEIWPYVPYNLVAQPYIAGAYDKRAPPGYVRK  121

Query  145  VPQAIIPSPNT---ERFTSMFSDENPNA  71
            V      +  T   + + SMFSD+NPNA
Sbjct  122  VEGTATNASVTTLEDPYISMFSDDNPNA  149



>ref|XP_004500726.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cicer arietinum]
Length=154

 Score =   166 bits (419),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 109/154 (71%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkr-rrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINR  320
            MG LDH+S+LF+       KKRK +QTV+++VKMDC+GCER+VR AV  MKG   VDI+R
Sbjct  1    MGALDHISELFDCSGGSHHKKRKQLQTVEVKVKMDCEGCERKVRKAVEGMKGVNQVDIDR  60

Query  319  KQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            K ++VTV GYVE  KV+ ++   TGK+AE+WPY+ YD V++PYA G YD+KAPSGYVRN 
Sbjct  61   KASKVTVVGYVEPSKVVARIAHRTGKRAEIWPYIPYDAVAHPYAQGVYDRKAPSGYVRNT  120

Query  142  ------PQAIIPSPNTERFTSMFSDENPNACSLM  59
                  P     S    R+T+ FSDENP AC++M
Sbjct  121  YGESQYPNLARASSTEVRYTTAFSDENPAACAVM  154



>ref|XP_010549763.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Tarenaya hassleriana]
Length=170

 Score =   166 bits (420),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 115/155 (74%), Gaps = 3/155 (2%)
 Frame = -1

Query  517  RLKKAGRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAK  338
            RL++   MG LD++S         K+KRK +QTV+I+VKMDCDGCERR+RN V  MKG K
Sbjct  17   RLREERAMGALDYISSFCSYTHTGKRKRKPLQTVEIKVKMDCDGCERRIRNIVRRMKGVK  76

Query  337  SVDINRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSG  158
            +V+++RKQ+RVTV+G+V+  KVL +V+STGKKAE WPY+   +V YP+APG YDK+AP G
Sbjct  77   TVEVDRKQSRVTVNGHVDPNKVLTRVKSTGKKAEFWPYIPQHVVYYPFAPGMYDKRAPIG  136

Query  157  YVRNVPQAIIPSPNT--ERFTSMFSDENPNACSLM  59
            ++RN  QA  P+ N   E + S+FSD+N + CS++
Sbjct  137  HIRNPGQA-FPNANAPEENYVSLFSDDNVHGCSIV  170



>gb|AFK33831.1| unknown [Lotus japonicus]
Length=156

 Score =   166 bits (419),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 111/156 (71%), Gaps = 10/156 (6%)
 Frame = -1

Query  496  MGILDHLSDLFEVkr---rrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            MG LDH+S+LF+       + KKRK  QTV+++VKMDC+GCER+V+ +V  MKG   V++
Sbjct  1    MGALDHISELFDCSSFGNSKYKKRKQFQTVEVKVKMDCEGCERKVKKSVEGMKGVTQVEV  60

Query  325  NRKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
             RK ++VTV+GYVE  KV+ ++   TGK+AELWPYV YD+V++PYAPG YDKKAPSGYVR
Sbjct  61   ERKASKVTVTGYVEPSKVVARIAHRTGKRAELWPYVPYDVVAHPYAPGVYDKKAPSGYVR  120

Query  148  ------NVPQAIIPSPNTERFTSMFSDENPNACSLM  59
                  NV      S    R+T+ FSDENP AC++M
Sbjct  121  NSEYDPNVSHLARASSTEVRYTTAFSDENPTACAVM  156



>ref|XP_003531366.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform 1 [Glycine max]
 ref|XP_003531367.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform 2 [Glycine max]
Length=153

 Score =   166 bits (419),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 113/152 (74%), Gaps = 4/152 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKL-MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            G  G L++LSDL        KK+K   QTV+++V+MDCDGCE +V+NA+SS+ G KSV+I
Sbjct  2    GVGGTLEYLSDLMGSGHHHHKKKKKQFQTVELKVRMDCDGCELKVKNALSSLSGVKSVEI  61

Query  325  NRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            NRKQ +VTV+GYVE  KVLKK +STGKKAE+WPYV Y+LV++PYA  +YDKKAP GYVR 
Sbjct  62   NRKQQKVTVTGYVEPNKVLKKAKSTGKKAEIWPYVPYNLVAHPYAVPSYDKKAPPGYVRR  121

Query  145  V---PQAIIPSPNTERFTSMFSDENPNACSLM  59
            V       I +   + + +MFSD+NPNACS+M
Sbjct  122  VEAPAHTGIITRYEDPYITMFSDDNPNACSIM  153



>gb|ABK96034.1| unknown [Populus trichocarpa]
Length=154

 Score =   166 bits (419),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 110/154 (71%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkr--rrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG+LDHL D F+      + KKRK +QTV+++V++DC+GCER+V+ A+  MKG K V + 
Sbjct  1    MGVLDHLPDFFDCSGGGSKHKKRKSLQTVEVKVRIDCEGCERKVKRALEGMKGVKQVVVE  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            RK N+VTV GYVE  KV+ +V   TGKKAELWPYV YD+V++PYAPG YDKKAP+GYVRN
Sbjct  61   RKANKVTVVGYVEPSKVVARVAHRTGKKAELWPYVPYDMVAHPYAPGVYDKKAPAGYVRN  120

Query  145  -----VPQAIIPSPNTERFTSMFSDENPNACSLM  59
                 V Q    S    R+T+ FSDENP AC +M
Sbjct  121  AEDPQVSQLARASSFEVRYTTAFSDENPAACVIM  154



>ref|NP_001168502.1| metal ion binding protein [Zea mays]
 gb|ACN28459.1| unknown [Zea mays]
 tpg|DAA39963.1| TPA: metal ion binding protein [Zea mays]
Length=161

 Score =   166 bits (419),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 116/160 (73%), Gaps = 16/160 (10%)
 Frame = -1

Query  493  GILDHLSDLF----EVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            G L++LSDL        RRR  +R   QTV+++V+MDCDGCE +VRNA+S MKG  SV+I
Sbjct  3    GTLEYLSDLLGGCSSSSRRRYNRRTQFQTVELKVRMDCDGCEMKVRNALSRMKGVHSVEI  62

Query  325  NRKQNRVTVSGYVEAKKVLKKVESTGKK-AELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +RKQ++VTV GYVE  KV+K+V++TGKK AE+WPYV Y LV++PYA  AYD+KAP GYVR
Sbjct  63   DRKQSKVTVQGYVEPHKVVKRVQATGKKAAEIWPYVPYSLVAHPYAAPAYDRKAPPGYVR  122

Query  148  NVPQAIIPS----------PNTERFTSMFSDENPNACSLM  59
             V  A++P+          P  ER  +MFSD+NPNACS+M
Sbjct  123  RV-DAVMPASSYGGPTAAGPQEERLVNMFSDDNPNACSIM  161



>ref|NP_001288682.1| heavy metal-associated isoprenylated plant protein 26-like [Zea 
mays]
 gb|ACG30673.1| farnesylated protein 2 [Zea mays]
 gb|AFW65058.1| farnesylated protein 2 isoform 1 [Zea mays]
 gb|AFW65059.1| farnesylated protein 2 isoform 2 [Zea mays]
Length=151

 Score =   165 bits (418),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 112/151 (74%), Gaps = 5/151 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL----MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MGILDHLS L  +   ++  +      +QTV+I+VKMDC+GCERRV++AV SM+G  SV 
Sbjct  1    MGILDHLSHLCSITETKEALKLRKKRPLQTVNIKVKMDCEGCERRVKSAVKSMRGVTSVA  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +N KQ++ TV+G VE  KVL++V++TGK AE+WPYV Y L +YPY  GAYDKKAP+G+VR
Sbjct  61   VNAKQSKCTVTGNVEPAKVLERVKATGKNAEMWPYVPYALTTYPYVGGAYDKKAPAGFVR  120

Query  148  NVPQAII-PSPNTERFTSMFSDENPNACSLM  59
            + PQA+  P     ++ +MF+D+N +AC++M
Sbjct  121  SAPQAMADPGAPELKYMNMFNDDNVDACTVM  151



>gb|EMS58641.1| hypothetical protein TRIUR3_09648 [Triticum urartu]
Length=293

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 122/167 (73%), Gaps = 13/167 (8%)
 Frame = -1

Query  523  THRLKKAGRMGILDHLSDLFEV---krrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSS  353
            T+  ++ G  G LD+LS+L      +R  K+KRK  QTV+++V+MDCDGCE +VRNA+S 
Sbjct  35   TNWTERMGVGGTLDYLSELLGGGGRRRSYKQKRKQFQTVELKVRMDCDGCELKVRNALSG  94

Query  352  MKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDK  173
            MKG +SV+INRKQ +VTV G+VE  KV+K+V++TGKKAE+WPY+ Y+LV++PYA   YDK
Sbjct  95   MKGVQSVEINRKQYKVTVQGFVEPHKVVKRVQATGKKAEIWPYIPYNLVAHPYAAQTYDK  154

Query  172  KAPSGYVRNVPQAIIP---------SPNTERFTSMFSDENPNACSLM  59
            KAP GYVR V  A++P             ER T+MFSD+NPNACS++
Sbjct  155  KAPPGYVRKV-DAVMPVASYGGPGAGAQEERLTTMFSDDNPNACSVI  200



>gb|ABR17552.1| unknown [Picea sitchensis]
Length=148

 Score =   164 bits (416),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 115/149 (77%), Gaps = 4/149 (3%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG L + SDLF  ++  KK+++ ++TV+++V+MDCDGCER+VR A++SM G +SV+I+RK
Sbjct  1    MGALGYFSDLFGRRKIIKKRKQ-IKTVELKVRMDCDGCERKVRKALASMSGVQSVEIDRK  59

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
              +VTV+GYVEA KVLKKV+ +GK+AELWPYV Y+LVS PY+P  YDKKAP GYVR    
Sbjct  60   LQKVTVTGYVEANKVLKKVKESGKRAELWPYVPYNLVSEPYSPHTYDKKAPPGYVRKESF  119

Query  136  AIIPS---PNTERFTSMFSDENPNACSLM  59
            +   S   P  E+ T++FS+ENPNAC +M
Sbjct  120  STTTSNSNPLDEQLTTVFSEENPNACLIM  148



>ref|XP_009397973.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
Length=155

 Score =   165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 115/155 (74%), Gaps = 9/155 (6%)
 Frame = -1

Query  496  MGILDHLSDL--FEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG L+H+S++  F     + KK+  +QTV+I+V+MDC+GCER+VR AV  MKG  SV+I 
Sbjct  1    MGFLEHISEICSFPSSHNKFKKKNQLQTVEIKVRMDCEGCERKVRKAVEGMKGVSSVEIE  60

Query  322  RKQNRVTVSGYVEAKKVLKKVE-STGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
             KQ++VTV GYV+ KKV+++V   TGKKAE WPYV YD+V++PYAPGAYDKKAP GYVRN
Sbjct  61   AKQHKVTVVGYVDPKKVIRRVAWKTGKKAEPWPYVPYDVVAHPYAPGAYDKKAPPGYVRN  120

Query  145  VPQAIIPSP-----NTE-RFTSMFSDENPNACSLM  59
            V      +P     +TE ++T+ FSD+NPN CS+M
Sbjct  121  VVDDPAAAPLARASSTEVKYTTAFSDDNPNNCSVM  155



>ref|XP_007201826.1| hypothetical protein PRUPE_ppa012801mg [Prunus persica]
 gb|EMJ03025.1| hypothetical protein PRUPE_ppa012801mg [Prunus persica]
Length=154

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 112/154 (73%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVk--rrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG LDHLSDLF+      R +KRK  QTV+I+VKMDC+GCER+VR +V  MKG   V + 
Sbjct  1    MGALDHLSDLFDCSGGSSRHRKRKQFQTVEIKVKMDCEGCERKVRRSVEGMKGVTQVTVE  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            RK +++TV GYV+  KVL +V   TGKK E WPYV YD+V++PYA G YDKKAPSGYVRN
Sbjct  61   RKAHKLTVVGYVDPGKVLARVAHRTGKKVEFWPYVPYDVVAHPYAAGVYDKKAPSGYVRN  120

Query  145  V--PQA--IIPSPNTE-RFTSMFSDENPNACSLM  59
            V  PQ   +  + +TE R+T+ FSDENP AC++M
Sbjct  121  VEDPQLRNLARASSTEVRYTTAFSDENPAACAVM  154



>ref|XP_004237423.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Solanum lycopersicum]
Length=152

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 116/154 (75%), Gaps = 9/154 (6%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L+++S++  +++ +KKK++   TV+++V+MDC+GCE +V+N +SSM G KSV+IN
Sbjct  2    GVGGTLEYISEMMSIEKPKKKKKQF-NTVELKVRMDCEGCEMKVKNTLSSMSGVKSVEIN  60

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ +VTV+GYVE  KVLKK +STGKKAE+WPY+ Y+LVS PYA  AYDKKAP GYVR V
Sbjct  61   RKQQKVTVTGYVEPNKVLKKAKSTGKKAEIWPYIPYNLVSQPYAAQAYDKKAPPGYVRRV  120

Query  142  PQAIIPSPNT------ERFTSMFSDENPNACSLM  59
             Q   P+  T        + +MFSD+NPNACS+M
Sbjct  121  DQ--YPTTGTVARYEDPSYVNMFSDDNPNACSIM  152



>ref|XP_008357285.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform X2 [Malus domestica]
Length=154

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 112/154 (73%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVk--rrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG+LDH SDLF+        KKR+  QTV+I+VKMDC+GCER+V+ +V  MKG   VD+ 
Sbjct  1    MGVLDHFSDLFDCSGGSSSFKKRRQFQTVEIKVKMDCEGCERKVKRSVEGMKGVTQVDVE  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            RK +++TV GYV+  KVL +V   TGKK ELWPYV YD+V++PYA G YDKKAPSGYVRN
Sbjct  61   RKAHKLTVVGYVDPGKVLARVAHRTGKKVELWPYVPYDVVAHPYAAGVYDKKAPSGYVRN  120

Query  145  V--PQA--IIPSPNTE-RFTSMFSDENPNACSLM  59
               PQ   +  + +TE R+T+ FSDENP+AC +M
Sbjct  121  SQDPQMRNLARASSTEXRYTTAFSDENPDACVIM  154



>ref|XP_010926254.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Elaeis guineensis]
Length=150

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 112/149 (75%), Gaps = 5/149 (3%)
 Frame = -1

Query  493  GILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQ  314
            G L++ S L     + +KK++L QTV+++V+MDC+GCE +V+ A+SSMKG +SV+INRKQ
Sbjct  3    GTLEYFSGLLGSGHKHRKKQQL-QTVELKVRMDCEGCELKVKKALSSMKGVQSVNINRKQ  61

Query  313  NRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP--  140
             +VTV GYVE  KVLKK +STGKKAE+WPYV Y+ V++PY  G YDKKAP GYVR+V   
Sbjct  62   QKVTVVGYVEPNKVLKKAQSTGKKAEIWPYVPYNSVTHPYTAGTYDKKAPPGYVRSVEAG  121

Query  139  --QAIIPSPNTERFTSMFSDENPNACSLM  59
               +I  S   ++  +MFSD+NPN+CS+M
Sbjct  122  TVSSIQASKQDDQMINMFSDDNPNSCSIM  150



>ref|XP_008377735.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Malus domestica]
Length=154

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 112/154 (73%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVk--rrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG+LDH SDLF+        KKR+  QTV+I+VKMDC+GCER+V+ +V  MKG   VD+ 
Sbjct  1    MGVLDHFSDLFDCSGGSSSFKKRRQFQTVEIKVKMDCEGCERKVKRSVEGMKGVTQVDVE  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            RK +++TV GYV+  KVL +V   TGKK ELWPYV YD+V++PYA G YDKKAPSGYVRN
Sbjct  61   RKAHKLTVVGYVDPGKVLARVAHRTGKKVELWPYVPYDVVAHPYAAGVYDKKAPSGYVRN  120

Query  145  V--PQA--IIPSPNTE-RFTSMFSDENPNACSLM  59
               PQ   +  + +TE R+T+ FSDENP+AC +M
Sbjct  121  SQDPQMRNLARASSTEVRYTTAFSDENPDACVIM  154



>ref|XP_006660571.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Oryza brachyantha]
Length=162

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 112/160 (70%), Gaps = 15/160 (9%)
 Frame = -1

Query  493  GILDHLSDLFEVkrrrkkkrKL---MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G +++LSDL       +++ +     QTV+++V+MDCDGCE +VRNA+S MKG +SV+IN
Sbjct  3    GTMEYLSDLLGGGGGGRRRYRKRKQFQTVELKVRMDCDGCELKVRNALSGMKGVQSVEIN  62

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ +VTV G+VE  KV+K+V++TGKKAE+WPYV Y LV++PYA  AYDKKAP G+VR V
Sbjct  63   RKQYKVTVQGFVEPGKVVKRVQATGKKAEIWPYVPYSLVAHPYAAPAYDKKAPPGHVRRV  122

Query  142  ------------PQAIIPSPNTERFTSMFSDENPNACSLM  59
                          A   +   ER T+MFSDENPNACS+M
Sbjct  123  DAVVPVPPAXXXXAAAAAAAQEERLTTMFSDENPNACSIM  162



>ref|XP_004289875.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Fragaria vesca subsp. vesca]
Length=152

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 109/152 (72%), Gaps = 6/152 (4%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL-MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINR  320
            MG LDH S LF+       K++   QTV+I+VKMDC+GCER+VR +V  MKG   VDI+R
Sbjct  1    MGALDHFSHLFDCSSGSHHKKRKNFQTVEIKVKMDCEGCERKVRRSVEGMKGVTQVDIDR  60

Query  319  KQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            K +++TV GYVE KKVL +V   TGKK E+WPYV YD+V +PYA G YDKKAP+GYVR+ 
Sbjct  61   KASKLTVVGYVEPKKVLARVAHRTGKKVEIWPYVPYDVVDHPYAQGVYDKKAPAGYVRSD  120

Query  142  PQ---AIIPSPNTE-RFTSMFSDENPNACSLM  59
             Q    +  + +TE R+T+ FSDENP AC++M
Sbjct  121  QQMSGGLARASSTEVRYTTAFSDENPAACTVM  152



>ref|XP_009355667.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Pyrus x bretschneideri]
Length=154

 Score =   164 bits (415),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 112/154 (73%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrk--kkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG+LDH SDLF+        KKRK  QTV+I+VKMDC+GCER+V+ +V  MKG   VD++
Sbjct  1    MGVLDHFSDLFDCSSGSSRLKKRKQFQTVEIKVKMDCEGCERKVKRSVEGMKGVTQVDVD  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            RK +++TV GYV+  KVL +V   TGKK E WPYV YD+V++PYA G YDKKAPSGYVRN
Sbjct  61   RKSHKLTVVGYVDPGKVLARVAHRTGKKVEFWPYVPYDVVAHPYAAGVYDKKAPSGYVRN  120

Query  145  V--PQA--IIPSPNTE-RFTSMFSDENPNACSLM  59
               PQ   +  + +TE R+T+ FSDENP+AC +M
Sbjct  121  AQDPQMRNLARASSTEVRYTTAFSDENPDACVVM  154



>ref|XP_007131717.1| hypothetical protein PHAVU_011G035900g [Phaseolus vulgaris]
 gb|ESW03711.1| hypothetical protein PHAVU_011G035900g [Phaseolus vulgaris]
Length=156

 Score =   164 bits (415),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 112/156 (72%), Gaps = 10/156 (6%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkk---krKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            MG LDH+SDLF+      K   KRK  QTV+++VKMDC+GCER+V+ +V  MKG   V++
Sbjct  1    MGALDHISDLFDCSHTSSKLKKKRKQFQTVEVKVKMDCEGCERKVKKSVEGMKGVTQVEV  60

Query  325  NRKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +RK ++VTVSGYVE  KV+  +   TGK+AELWPYV YD+V++PYAPG YDKKAPSGYVR
Sbjct  61   DRKASKVTVSGYVEPSKVVSHIAHRTGKRAELWPYVPYDVVAHPYAPGVYDKKAPSGYVR  120

Query  148  NVP-----QAIIPSPNTE-RFTSMFSDENPNACSLM  59
            N         +  + +TE R+T+ FSD+NP AC +M
Sbjct  121  NADVDPRLSNLARASSTEVRYTTAFSDDNPAACVVM  156



>gb|KHN13913.1| hypothetical protein glysoja_016197 [Glycine soja]
Length=145

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 109/147 (74%), Gaps = 3/147 (2%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG L+++   F       KK K MQTV+I+VKMDCDGCER+VRNAV+++KG KSV+INRK
Sbjct  1    MGALNYIISNF--CTVPSKKIKTMQTVEIKVKMDCDGCERKVRNAVATIKGVKSVEINRK  58

Query  316  QNRVTVSGYVEAKKVLKKVESTG-KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            Q+RVTV+G V+  KVL +V+ TG KKAE WPYV   +V+YP+A G YDK+AP GYVRNV 
Sbjct  59   QSRVTVNGCVDPNKVLNRVKRTGKKKAEFWPYVPQHVVTYPHASGVYDKRAPGGYVRNVQ  118

Query  139  QAIIPSPNTERFTSMFSDENPNACSLM  59
                 +   E+F S+FS++N NACS+M
Sbjct  119  TFAASADTEEKFMSLFSEDNVNACSIM  145



>ref|XP_008236023.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Prunus mume]
Length=154

 Score =   164 bits (415),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 112/154 (73%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVk--rrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG LDHLSDLF+      R +KRK  QTV+I+VKMDC+GCER+VR +V  MKG   V + 
Sbjct  1    MGALDHLSDLFDCSGGSSRLRKRKQFQTVEIKVKMDCEGCERKVRRSVEGMKGVTQVTVE  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            RK +++TV GYV+  KVL +V   TGKK E WPYV YD+V++PYA G YDKKAPSGYVRN
Sbjct  61   RKAHKLTVVGYVDPGKVLARVAHRTGKKVEFWPYVPYDVVAHPYAAGVYDKKAPSGYVRN  120

Query  145  V--PQA--IIPSPNTE-RFTSMFSDENPNACSLM  59
            V  PQ   +  + +TE R+T+ FSDENP AC++M
Sbjct  121  VEDPQLRNLARASSTEVRYTTAFSDENPAACAVM  154



>ref|XP_006579369.1| PREDICTED: uncharacterized protein LOC100500473 isoform X1 [Glycine 
max]
Length=153

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 113/153 (74%), Gaps = 6/153 (4%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKL-MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            G  G L++LSDL        KK+K   QTV+++V+MDCDGCE +V+NA+SS+ G KSV+I
Sbjct  2    GVGGTLEYLSDLMGSGHHHHKKKKKQFQTVELKVRMDCDGCELKVKNALSSLSGVKSVEI  61

Query  325  NRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            NRKQ +VTV+GYVE  KVLKK +STGKKAE+WPYV Y+LV +PYA  +YDKKAP GYVR 
Sbjct  62   NRKQQKVTVTGYVEPNKVLKKAKSTGKKAEIWPYVPYNLVVHPYAVPSYDKKAPPGYVRR  121

Query  145  VPQAIIPSPNTER----FTSMFSDENPNACSLM  59
            V +A   +    R    + +MFSD+NPNACS+M
Sbjct  122  V-EAPAHTGTITRYEDPYITMFSDDNPNACSIM  153



>ref|XP_011046131.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Populus euphratica]
Length=154

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 106/154 (69%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL--MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG LDHL D F+      K +K   +QTV+++V++DC+GCER+VR A+  MKG K V + 
Sbjct  1    MGALDHLPDFFDCSGGGSKHKKRKNLQTVEVKVRIDCEGCERKVRRALEGMKGVKQVVVE  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            RK N+VTV GYVE  KV+ +V   TGKKAELWPYV YD V++PYAPG YDKKAP+GYVRN
Sbjct  61   RKANKVTVVGYVEPSKVVARVAHRTGKKAELWPYVPYDTVAHPYAPGVYDKKAPAGYVRN  120

Query  145  -----VPQAIIPSPNTERFTSMFSDENPNACSLM  59
                 V Q    S    R+T+ FSDENP AC +M
Sbjct  121  AEDPQVSQLARASSFEVRYTTAFSDENPAACVIM  154



>ref|XP_002307397.1| hypothetical protein POPTR_0005s16490g [Populus trichocarpa]
 gb|EEE94393.1| hypothetical protein POPTR_0005s16490g [Populus trichocarpa]
Length=150

 Score =   163 bits (413),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++ SDL     ++ KKRK MQTV ++V+MDC+GCER++++ +S +KGAKSVD++
Sbjct  2    GVAGTLEYFSDLLS-NVKKGKKRKQMQTVALKVRMDCEGCERKIKSVLSGVKGAKSVDVD  60

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
             KQ +VTV+GYVE KKVLK  +ST KK E+WPYV Y LV+ PY   AYDKKAP+ +VR V
Sbjct  61   MKQQKVTVTGYVEPKKVLKAAQSTKKKVEMWPYVPYTLVANPYVSQAYDKKAPANHVRAV  120

Query  142  PQAIIPSPNT--ERFTSMFSDENPNACSLM  59
            P     S  T  + +T+MFSDENPNACS+M
Sbjct  121  PVTATISETTMDDNYTNMFSDENPNACSIM  150



>ref|XP_006422591.1| hypothetical protein CICLE_v10029481mg [Citrus clementina]
 ref|XP_006486737.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Citrus sinensis]
 gb|ESR35831.1| hypothetical protein CICLE_v10029481mg [Citrus clementina]
 gb|KDO68073.1| hypothetical protein CISIN_1g031714mg [Citrus sinensis]
 gb|KDO68074.1| hypothetical protein CISIN_1g031714mg [Citrus sinensis]
 gb|KDO68075.1| hypothetical protein CISIN_1g031714mg [Citrus sinensis]
Length=154

 Score =   163 bits (413),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 109/154 (71%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkk--krKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG++DH SD F+      K  KR+ +QTV+++V++DC+GCER+V+ AV  MKG K VD+ 
Sbjct  1    MGVVDHFSDYFDCSHGSSKLKKRRQLQTVEVKVRIDCEGCERKVKRAVEGMKGVKQVDVE  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR-  149
            RK N+VTV GYVE  KV+ ++   TGKKAE+WPYV YD+V++PYAPG YD+KAP+GYVR 
Sbjct  61   RKANKVTVVGYVEPSKVVSRIAHRTGKKAEIWPYVPYDVVAHPYAPGVYDRKAPAGYVRR  120

Query  148  ----NVPQAIIPSPNTERFTSMFSDENPNACSLM  59
                 V Q    S    R+T+ FSDEN  AC++M
Sbjct  121  ADDPQVSQIARASSFEVRYTTAFSDENTQACAIM  154



>ref|XP_002278879.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Vitis vinifera]
 emb|CAN62146.1| hypothetical protein VITISV_016892 [Vitis vinifera]
 emb|CBI37869.3| unnamed protein product [Vitis vinifera]
Length=155

 Score =   163 bits (412),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 111/155 (72%), Gaps = 9/155 (6%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkr--KLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG LDH+S LF+      K +  K +QTV+I+VKMDC+GCER+VR AV  MKG   VD+ 
Sbjct  1    MGALDHVSHLFDCSHGSSKLKRRKQLQTVEIKVKMDCEGCERKVRRAVEGMKGVTQVDVV  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
             K +++TV GYV+  KV+ +V   TGKKAELWPYV YD+V++PYAPG YDKKAP GYVRN
Sbjct  61   PKHHKLTVVGYVDPAKVVSRVAHRTGKKAELWPYVPYDVVAHPYAPGVYDKKAPPGYVRN  120

Query  145  V---PQ--AIIPSPNTE-RFTSMFSDENPNACSLM  59
                PQ   +  + +TE R+T+ FSDENP AC++M
Sbjct  121  AYEDPQYSHLARASSTEVRYTTAFSDENPAACAIM  155



>gb|KHN44322.1| hypothetical protein glysoja_014363 [Glycine soja]
Length=155

 Score =   163 bits (412),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 113/155 (73%), Gaps = 9/155 (6%)
 Frame = -1

Query  496  MGILDHLSDLFEV----krrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG+ D+LSDL        + + K +K +QTV+++V MDCDGC  +V+ A+SS+ G KSV+
Sbjct  1    MGVGDYLSDLIGSGNGNHQHKNKNKKQLQTVELKVMMDCDGCVLKVKKALSSLDGVKSVE  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            INRKQ +VTV+GYVE  KVLKK +STGKKAE+WPYV +++V+ PYA  AYDKKAP GYVR
Sbjct  61   INRKQQKVTVTGYVEPNKVLKKAKSTGKKAEIWPYVPFNMVANPYAVQAYDKKAPPGYVR  120

Query  148  NVPQA-----IIPSPNTERFTSMFSDENPNACSLM  59
             V  +      + +   + +T+MFSDENPNACS+M
Sbjct  121  RVDNSSVTIGTVTTAYADPYTTMFSDENPNACSIM  155



>ref|XP_011097602.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Sesamum indicum]
Length=158

 Score =   163 bits (413),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 116/157 (74%), Gaps = 9/157 (6%)
 Frame = -1

Query  502  GRMGILDHLSDL-----FEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAK  338
            G MG  D+LS+L     ++ K+++KKK K +QTV+++V+MDCDGCE +V+ A+SS+ G K
Sbjct  2    GVMGSFDYLSELMMSSSYKQKQKKKKKLKQLQTVNLKVRMDCDGCELKVKKALSSLSGVK  61

Query  337  SVDINRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSG  158
            SV+INRK  +VTV+GYVE  KVLKK +STGKKAELWPYV Y+LV+ PYAP AYDKKAP G
Sbjct  62   SVEINRKLQKVTVTGYVEQNKVLKKAKSTGKKAELWPYVPYNLVAQPYAPAAYDKKAPPG  121

Query  157  YVRNVPQAIIPSPNTERFT----SMFSDENPNACSLM  59
            +VR V           RF     +MFSD+NPNACS+M
Sbjct  122  FVRKVDNPQKDMGTITRFEDPYFTMFSDDNPNACSIM  158



>ref|XP_004513852.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cicer arietinum]
Length=147

 Score =   162 bits (411),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 112/147 (76%), Gaps = 1/147 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MGIL +LS+      +   KR   +TV+IRVKMDC+GC R+VRNAV   +G +S D+N+K
Sbjct  1    MGILRNLSEYIIACLKPPAKRIPKKTVNIRVKMDCEGCVRKVRNAVEDFEGVESFDVNQK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
              R+TV+G+++AK+VL++V++TGK A++WP+V Y+LV+YPYA GAYD KAP+G+VRNVPQ
Sbjct  61   LQRLTVTGFIDAKEVLEEVKNTGKTADIWPFVPYNLVTYPYARGAYDMKAPTGFVRNVPQ  120

Query  136  AI-IPSPNTERFTSMFSDENPNACSLM  59
            AI  P     +   +F+D+NPNACS+M
Sbjct  121  AIGDPKSPEMKMMVLFNDDNPNACSVM  147



>ref|XP_008233984.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Prunus mume]
Length=149

 Score =   162 bits (411),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 111/149 (74%), Gaps = 2/149 (1%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L++LS+L    RR KKKRK +QTV ++++MDC+GC R+V+  +S +KGAKSVDI+
Sbjct  2    GVQGTLEYLSNLLSSARRGKKKRKQIQTVAVKIRMDCEGCARKVKKVLSGVKGAKSVDID  61

Query  322  RKQNRVTVSGY-VEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
             KQ + TV+GY VEAKKVLK  +ST KK ELWPYV Y LV++PYA GAYDKKAP   VR 
Sbjct  62   LKQQKATVTGYNVEAKKVLKAAQSTKKKCELWPYVPYTLVAHPYASGAYDKKAPPNMVRK  121

Query  145  VPQAIIPSPNTERFTSMFSDENPNACSLM  59
            VP     + + E +T MFSD+NPNACS+M
Sbjct  122  VPDTATAAVD-ESYTIMFSDDNPNACSIM  149



>ref|XP_004504043.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cicer arietinum]
Length=154

 Score =   163 bits (412),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 112/153 (73%), Gaps = 5/153 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEV-krrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            G  G L++LSDL        KKK+K +QTV+++++MDCDGCE +++  +SS+ G KSV+I
Sbjct  2    GVGGTLEYLSDLMSTGHHHLKKKKKQLQTVELKIRMDCDGCELKIKKTLSSLSGVKSVEI  61

Query  325  NRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
            NRKQ +VTV+GYVE  KVLKK +STGK+AE+WPYV Y+LV+ PYA  +YDKKAP GYVR 
Sbjct  62   NRKQQKVTVTGYVEPNKVLKKAKSTGKRAEIWPYVPYNLVAQPYAVSSYDKKAPPGYVRR  121

Query  145  VPQAIIPSPNTER----FTSMFSDENPNACSLM  59
            V  A   +    R    + +MFSDENPNACS+M
Sbjct  122  VENAAATTGTMTRYEDPYVNMFSDENPNACSIM  154



>ref|XP_007163627.1| hypothetical protein PHAVU_001G250300g [Phaseolus vulgaris]
 ref|XP_007163628.1| hypothetical protein PHAVU_001G250300g [Phaseolus vulgaris]
 ref|XP_007163629.1| hypothetical protein PHAVU_001G250300g [Phaseolus vulgaris]
 gb|ESW35621.1| hypothetical protein PHAVU_001G250300g [Phaseolus vulgaris]
 gb|ESW35622.1| hypothetical protein PHAVU_001G250300g [Phaseolus vulgaris]
 gb|ESW35623.1| hypothetical protein PHAVU_001G250300g [Phaseolus vulgaris]
Length=154

 Score =   163 bits (412),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 108/154 (70%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrK----LMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG+ D+LSDL        +        +QTV+++V MDCDGC  +V+  +SS+ G +SV+
Sbjct  1    MGVGDYLSDLMGTGSGNHQHNTKNRKQLQTVELKVMMDCDGCVLKVKKTLSSLDGVESVE  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            INRKQ +VTV+GYVEA KVLKK +STGKKAE+WPYV Y++V+ PY   AYDKKAP GYVR
Sbjct  61   INRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNMVANPYTVQAYDKKAPPGYVR  120

Query  148  NVPQA----IIPSPNTERFTSMFSDENPNACSLM  59
             V  +     + +   + +T+MFSDENPNACS+M
Sbjct  121  RVDNSAAIGTVTAAYEDPYTTMFSDENPNACSIM  154



>ref|XP_010028730.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Eucalyptus grandis]
 gb|KCW55531.1| hypothetical protein EUGRSUZ_I01418 [Eucalyptus grandis]
Length=154

 Score =   162 bits (411),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 109/154 (71%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVk--rrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG LDH +DLF+      R K+RK +QTV+++VK+DC+GCERRVR AV  MKG + VDI+
Sbjct  1    MGALDHFADLFDCSGGSSRLKRRKQLQTVEVKVKLDCEGCERRVRRAVEGMKGVQQVDID  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR-  149
            RK ++VTV GYVE  KV+ ++   TGK+AELWPYV YD V +PYA G YD+KAP+GYVR 
Sbjct  61   RKSSKVTVVGYVEPSKVIGRISHRTGKRAELWPYVPYDEVDHPYAQGVYDRKAPAGYVRY  120

Query  148  ----NVPQAIIPSPNTERFTSMFSDENPNACSLM  59
                   Q    S    R+T+ FS+ENPNAC++M
Sbjct  121  SQDPRQNQLARASSTEVRYTTAFSEENPNACAVM  154



>ref|NP_001236151.1| uncharacterized protein LOC100527442 [Glycine max]
 gb|ACU16534.1| unknown [Glycine max]
 gb|KHN03150.1| hypothetical protein glysoja_038919 [Glycine soja]
Length=147

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRK  317
            MG LD+L + F    + K+K    +TV++RVKMDC+GCER+V+NAV  ++G +S D+NRK
Sbjct  1    MGFLDNLQEWFTACTKPKEKLVPKKTVNVRVKMDCEGCERKVKNAVKDLEGVESYDVNRK  60

Query  316  QNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQ  137
              RV+V+GYV++++VL++V +TGK A+LWP+V YDLV++PY  GAYD KAPSG+VRNVP 
Sbjct  61   LQRVSVTGYVDSEEVLEEVRNTGKTADLWPFVPYDLVAFPYVKGAYDIKAPSGFVRNVPD  120

Query  136  AI-IPSPNTERFTSMFSDENPNACSLM  59
            A+  P     +    F D+NP+ACS+M
Sbjct  121  AMGDPKSPEMKLMRAFDDDNPHACSIM  147



>ref|XP_010933357.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Elaeis guineensis]
Length=154

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 117/154 (76%), Gaps = 8/154 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEV-krrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINR  320
            MG+LD++S+L  + K +RK ++K  QTV+++V++DC+GCER+V+ A+  +KG  SV+I R
Sbjct  1    MGVLDYVSELCSLPKDQRKLRKKQFQTVEMKVRIDCEGCERKVKKALEEIKGVSSVEIER  60

Query  319  KQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            KQN+VTV+GYV+ KKV+K+V   TGK  E WPYV YD+V +PYAPGAYD+KAP GYVRNV
Sbjct  61   KQNKVTVTGYVDGKKVIKRVRRRTGKMVEPWPYVPYDMVPHPYAPGAYDRKAPPGYVRNV  120

Query  142  ------PQAIIPSPNTERFTSMFSDENPNACSLM  59
                   Q +  S   ER++S FSD+NPN+C++M
Sbjct  121  MDDPKLAQLVRASSMEERYSSAFSDDNPNSCAIM  154



>ref|XP_006359700.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum tuberosum]
Length=153

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 109/153 (71%), Gaps = 7/153 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkr--KLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG+LDH+SD+F+   +  K +  K +QTV+I+VKMDC+GCER+VR +V  MKG  SV I 
Sbjct  1    MGVLDHISDMFDCSSQHSKHKRRKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVTIE  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR-  149
             KQ+++TV GYV+ +KV+ +V   TGKKAE+WPYV YD+V++PYA G YDKKAP+GYVR 
Sbjct  61   PKQHKLTVVGYVDPEKVVARVAHRTGKKAEIWPYVPYDVVAHPYAQGVYDKKAPAGYVRR  120

Query  148  ---NVPQAIIPSPNTERFTSMFSDENPNACSLM  59
                  Q    S    R+T+ FSDENP AC +M
Sbjct  121  DDFQTNQLARASSTEVRYTTAFSDENPAACVVM  153



>ref|XP_009413013.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Musa acuminata subsp. malaccensis]
Length=155

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 119/155 (77%), Gaps = 9/155 (6%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrr--rkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG+L+H+S+L  V R   + KK K +QTV+++V+MDC+GCERRVR AV  MKG  SV+I 
Sbjct  1    MGLLEHVSELCSVSRSRKKLKKNKQLQTVELKVRMDCEGCERRVRKAVEGMKGVSSVEIE  60

Query  322  RKQNRVTVSGYVEAKKVLKKVE-STGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRN  146
             KQ +VTV G+V+ KKV+K+VE  TGKKAE WPYV YD+V +PYAPGAYDKKAP GYVRN
Sbjct  61   PKQKKVTVIGFVDPKKVIKRVEWKTGKKAEPWPYVPYDVVPHPYAPGAYDKKAPPGYVRN  120

Query  145  V---PQA--IIPSPNTE-RFTSMFSDENPNACSLM  59
            V   P A  +  + +TE ++T+ FSD+NPN+C++M
Sbjct  121  VLDDPDAAPLARASSTEVKYTTAFSDDNPNSCTIM  155



>ref|XP_003607174.1| Farnesylated protein (ATFP6) [Medicago truncatula]
 gb|AES89371.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=156

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 111/156 (71%), Gaps = 10/156 (6%)
 Frame = -1

Query  496  MGILDHLSDLFEVk---rrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            MG LDH+SDLF+        KKKRK  QTV+++VKMDC+GCER+V+ +V  MKG   V++
Sbjct  1    MGALDHISDLFDCSYRRSTYKKKRKQFQTVEVKVKMDCEGCERKVKKSVEGMKGVTQVEV  60

Query  325  NRKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            +RK ++VTV+GYVE  KV+ ++   TGK+ ELWPYV YD+V++PYAPG YDKKAPSGYVR
Sbjct  61   DRKASKVTVTGYVEPSKVVARMSHRTGKRVELWPYVPYDVVAHPYAPGVYDKKAPSGYVR  120

Query  148  ------NVPQAIIPSPNTERFTSMFSDENPNACSLM  59
                  NV      S    R+T+ FSD+NP AC++M
Sbjct  121  NANYDPNVSNLARASSAEVRYTTAFSDDNPTACAIM  156



>ref|NP_001050249.1| Os03g0383900 [Oryza sativa Japonica Group]
 gb|ABF96289.1| heavy-metal-associated domain-containing protein, putative, expressed 
[Oryza sativa Japonica Group]
 gb|ABF96290.1| heavy-metal-associated domain-containing protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12163.1| Os03g0383900 [Oryza sativa Japonica Group]
 dbj|BAG91565.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59159.1| hypothetical protein OsJ_11078 [Oryza sativa Japonica Group]
Length=157

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 111/155 (72%), Gaps = 10/155 (6%)
 Frame = -1

Query  493  GILDHLSDLFEV----krrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            G L++L+ LF         +  KR+ +QTV+++V+MDCDGCE +V+NA+S++KG +SV I
Sbjct  3    GSLEYLAGLFSCGDHHHGHKNSKRRQLQTVELKVRMDCDGCELKVKNALSTLKGVESVKI  62

Query  325  NRKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPY-APGAYDKKAPSGYVR  149
            NRKQ +VTVSGYVEA KVL+K +STGKK+ELWPYV Y   S PY A  AYD++AP G+VR
Sbjct  63   NRKQQKVTVSGYVEASKVLRKAQSTGKKSELWPYVPYSAASQPYVAAAAYDRRAPPGHVR  122

Query  148  NVPQAIIP-----SPNTERFTSMFSDENPNACSLM  59
            NV  +            ER T++F+DE+PNACSLM
Sbjct  123  NVEASSAAYVSGGGRTEERLTNLFNDEDPNACSLM  157



>ref|XP_004231044.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum lycopersicum]
Length=153

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 108/153 (71%), Gaps = 7/153 (5%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkr--KLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            MG+LDH+SD+F+      K +  K +QTV+I+VKMDC+GCER+VR +V  MKG  SV I 
Sbjct  1    MGVLDHISDMFDCSSEHSKHKRRKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVTIE  60

Query  322  RKQNRVTVSGYVEAKKVLKKV-ESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR-  149
             KQ+++TV GYV+ +KV+ +V   TGKKAE+WPYV YD+V++PYA G YDKKAP+GYVR 
Sbjct  61   PKQHKLTVVGYVDPEKVVSRVAHRTGKKAEIWPYVPYDVVAHPYAQGVYDKKAPAGYVRR  120

Query  148  ---NVPQAIIPSPNTERFTSMFSDENPNACSLM  59
                  Q    S    R+T+ FSDENP AC +M
Sbjct  121  DDFQTNQLARASSTEVRYTTAFSDENPAACVVM  153



>ref|XP_004958383.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Setaria italica]
Length=159

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 99/131 (76%), Gaps = 8/131 (6%)
 Frame = -1

Query  427  MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTG  248
            +QTV+++V+MDC+GCE +VR+A+SSMKG +SV+INRKQ +VTV G+VEA KVLKK +STG
Sbjct  29   LQTVELKVRMDCEGCELKVRSALSSMKGVESVEINRKQQKVTVVGFVEASKVLKKAQSTG  88

Query  247  KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQAIIPSPNTER--------FTSMF  92
            KKAE+WPYV Y LVS PY  G YDK+AP GYVR+     + +   ++         T MF
Sbjct  89   KKAEIWPYVPYSLVSQPYVAGTYDKRAPPGYVRSAEPGYVAAGGQQQHVGRPHDHLTDMF  148

Query  91   SDENPNACSLM  59
            +DENPN+CS+M
Sbjct  149  NDENPNSCSVM  159



>gb|EPS65925.1| hypothetical protein M569_08856 [Genlisea aurea]
Length=156

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 112/156 (72%), Gaps = 10/156 (6%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkk---rKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDI  326
            MG LDHLS +F+      KK   R+ +QTV+I++KMDC+GCER+V+ +V  MKG  SV+I
Sbjct  1    MGALDHLSRMFDCSSGHSKKFKKRRQLQTVEIKIKMDCEGCERKVKKSVEGMKGVTSVEI  60

Query  325  NRKQNRVTVSGYVEAKKVLKKVE-STGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVR  149
            N KQ+++TV GYV+  KV+ +V   TGKKAELWPYV YD+V++PYAPG YD+KAP+GYVR
Sbjct  61   NPKQSKLTVVGYVDPDKVVSRVAFRTGKKAELWPYVPYDVVAHPYAPGVYDRKAPAGYVR  120

Query  148  N------VPQAIIPSPNTERFTSMFSDENPNACSLM  59
            N      V Q    +    R+T+ FSD+NP AC++M
Sbjct  121  NSGGDPQVSQLARATSAEVRYTTAFSDDNPTACAVM  156



>dbj|BAJ91258.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=152

 Score =   161 bits (408),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 112/152 (74%), Gaps = 6/152 (4%)
 Frame = -1

Query  496  MGILDHLSDLFEVkrrrkkkrKL----MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVD  329
            MG LDHLS L  +   R+  R      + TV+I+VK+DCDGCERRVRNAV S++G  +V 
Sbjct  1    MGALDHLSRLCNLTHTREAIRIKKRRPLTTVNIKVKLDCDGCERRVRNAVKSIRGVTTVV  60

Query  328  INRKQNRVTVSGYVEAKKVLKKVESTGK-KAELWPYVKYDLVSYPYAPGAYDKKAPSGYV  152
            +NRK N+VTV+GYVE +KVL +V+ TGK  A++WPYV Y + +YPY  G+YDKKAP+G V
Sbjct  61   VNRKINKVTVTGYVEPRKVLARVKRTGKTTADMWPYVPYSVATYPYVGGSYDKKAPAGLV  120

Query  151  RNVPQAII-PSPNTERFTSMFSDENPNACSLM  59
            RNVPQA+  P+    ++ +MF+DE+ NAC++M
Sbjct  121  RNVPQAMADPAAPEVKYMNMFNDEDVNACTVM  152



>emb|CDY38431.1| BnaA10g17270D [Brassica napus]
Length=149

 Score =   161 bits (408),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 112/150 (75%), Gaps = 5/150 (3%)
 Frame = -1

Query  496  MGILDHLSDLFE-VkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINR  320
            MG  D++S          K KRK +QTV+I+VKMDCDGCERR+RN V  MKG K+V++NR
Sbjct  1    MGAFDYISSFCSYTYSNAKTKRKPLQTVEIKVKMDCDGCERRLRNVVRRMKGVKTVEVNR  60

Query  319  KQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVP  140
            KQ+R+TV+G+V+  KVLK+V+STGKKAE WPY+   +V YP+APG YDK+AP+G++RN  
Sbjct  61   KQSRLTVNGHVDPNKVLKRVKSTGKKAEFWPYIPQHMVYYPFAPGMYDKRAPAGHIRNPT  120

Query  139  QAIIPSPNT--ERFTSMFSDENPN-ACSLM  59
            QA  P+ N   E + S+FSD+N + ACS+M
Sbjct  121  QA-FPAANAPGENYVSLFSDDNVHAACSIM  149



>gb|KHN29092.1| hypothetical protein glysoja_008427 [Glycine soja]
Length=140

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 101/127 (80%), Gaps = 5/127 (4%)
 Frame = -1

Query  427  MQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDINRKQNRVTVSGYVEAKKVLKKVESTG  248
             QTV+++V+MDCDGCE +V+NA+SS+ G KSV+INRKQ +VTV+GYVE  KVLKK +STG
Sbjct  15   FQTVELKVRMDCDGCELKVKNALSSLSGVKSVEINRKQQKVTVTGYVEPNKVLKKAKSTG  74

Query  247  KKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNVPQAIIPSPNTER----FTSMFSDEN  80
            KKAE+WPYV Y+LV++PYA  +YDKKAP GYVR V +A   +    R    + +MFSD+N
Sbjct  75   KKAEIWPYVPYNLVAHPYAVPSYDKKAPPGYVRRV-EAPAHTGTITRYEDPYITMFSDDN  133

Query  79   PNACSLM  59
            PNACS+M
Sbjct  134  PNACSIM  140



>ref|XP_006363944.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum tuberosum]
Length=152

 Score =   161 bits (408),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 113/152 (74%), Gaps = 5/152 (3%)
 Frame = -1

Query  502  GRMGILDHLSDLFEVkrrrkkkrKLMQTVDIRVKMDCDGCERRVRNAVSSMKGAKSVDIN  323
            G  G L+++S++  + + +KKK++   TV+++V+MDC+GCE +V+N +SSM G KSV+IN
Sbjct  2    GVGGTLEYISEMMSIDKPKKKKKQFT-TVELKVRMDCEGCEMKVKNTLSSMSGVKSVEIN  60

Query  322  RKQNRVTVSGYVEAKKVLKKVESTGKKAELWPYVKYDLVSYPYAPGAYDKKAPSGYVRNV  143
            RKQ +VTV+GYVE  KVLKK +STGKKAE+WPYV Y+LVS PYA  AYDKKAP G+VR V
Sbjct  61   RKQQKVTVTGYVEQNKVLKKAKSTGKKAEIWPYVPYNLVSQPYAAQAYDKKAPPGFVRRV  120

Query  142  PQ----AIIPSPNTERFTSMFSDENPNACSLM  59
             Q      +   +   + +MFSD+NPNAC +M
Sbjct  121  DQYPTTGTVARYDDPSYVNMFSDDNPNACFIM  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 871913062560