BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15881_g3_i1 len=907 path=[3997:0-906]

Length=907
                                                                      Score     E

ref|XP_009589619.1|  PREDICTED: kinesin-like protein NACK1              379   4e-120   
ref|XP_009804137.1|  PREDICTED: kinesin-like protein NACK1              379   5e-120   
ref|XP_004235748.1|  PREDICTED: kinesin-like protein NACK1              378   1e-119   
ref|XP_006341574.1|  PREDICTED: kinesin-like protein NACK1-like i...    377   4e-119   
ref|XP_011072914.1|  PREDICTED: kinesin-like protein NACK1              369   2e-116   
emb|CDO98410.1|  unnamed protein product                                369   2e-116   
ref|XP_008356658.1|  PREDICTED: kinesin-like protein NACK1              369   5e-116   
ref|XP_009347467.1|  PREDICTED: kinesin-like protein NACK1              369   5e-116   
ref|XP_008240232.1|  PREDICTED: kinesin-like protein NACK1              363   5e-114   
ref|XP_007210400.1|  hypothetical protein PRUPE_ppa000865mg             363   5e-114   
gb|EYU21085.1|  hypothetical protein MIMGU_mgv1a000841mg                362   9e-114   
ref|XP_008393328.1|  PREDICTED: kinesin-like protein NACK1              360   7e-113   
gb|KDP35186.1|  hypothetical protein JCGZ_10720                         359   1e-112   
ref|XP_009360131.1|  PREDICTED: kinesin-like protein NACK1              359   2e-112   
ref|XP_006477781.1|  PREDICTED: kinesin-like protein NACK1-like         358   6e-112   
ref|XP_006442593.1|  hypothetical protein CICLE_v10018724mg             357   1e-111   
gb|KDO49802.1|  hypothetical protein CISIN_1g002128mg                   354   9e-111   
ref|XP_011045827.1|  PREDICTED: kinesin-like protein NACK1 isofor...    349   5e-110   
gb|KHG01962.1|  Kinesin-related 4                                       351   1e-109   
ref|XP_011045826.1|  PREDICTED: kinesin-like protein NACK1 isofor...    349   6e-109   
ref|XP_010110084.1|  Kinesin-related protein 4                          350   6e-109   
emb|CBI15491.3|  unnamed protein product                                346   1e-108   
ref|XP_011045825.1|  PREDICTED: kinesin-like protein NACK1 isofor...    348   2e-108   
ref|XP_008460891.1|  PREDICTED: kinesin-like protein NACK1              348   2e-108   
ref|XP_002279228.1|  PREDICTED: kinesin-like protein NACK1              348   3e-108   Vitis vinifera
ref|XP_002318539.1|  hypothetical protein POPTR_0012s05060g             347   4e-108   Populus trichocarpa [western balsam poplar]
ref|XP_004166306.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    347   6e-108   
gb|KGN64145.1|  hypothetical protein Csa_1G042550                       347   9e-108   
ref|XP_004137483.1|  PREDICTED: uncharacterized protein LOC101215425    343   1e-106   
ref|XP_004300503.1|  PREDICTED: uncharacterized protein LOC101315243    343   3e-106   
ref|XP_006303901.1|  hypothetical protein CARUB_v10008207mg             341   1e-105   
ref|XP_002893000.1|  hypothetical protein ARALYDRAFT_472057             340   2e-105   
ref|XP_010279346.1|  PREDICTED: kinesin-like protein NACK1              340   2e-105   
ref|NP_173273.2|  kinesin HINKEL                                        340   3e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459448.1|  PREDICTED: kinesin-like protein NACK1              340   5e-105   
gb|AAF25984.1|AC013354_3  F15H18.12                                     340   7e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010036903.1|  PREDICTED: kinesin-like protein NACK1              338   2e-104   
ref|XP_007036597.1|  ATP binding microtubule motor family protein...    337   4e-104   
ref|XP_010498223.1|  PREDICTED: kinesin-like protein NACK1              337   4e-104   
ref|XP_004512893.1|  PREDICTED: kinesin-II 95 kDa subunit-like is...    337   6e-104   
ref|XP_010477014.1|  PREDICTED: kinesin-like protein NACK1              336   8e-104   
ref|XP_006416611.1|  hypothetical protein EUTSA_v10006702mg             336   9e-104   
ref|XP_011008305.1|  PREDICTED: kinesin-like protein NACK1              336   9e-104   
gb|KHG07573.1|  kif4                                                    335   1e-103   
ref|XP_010693857.1|  PREDICTED: kinesin-like protein NACK1              335   2e-103   
ref|XP_002321490.2|  nodulin-25 precursor family protein                334   4e-103   Populus trichocarpa [western balsam poplar]
ref|XP_003534160.1|  PREDICTED: kinesin-like protein NACK1-like i...    327   3e-100   
gb|KHN23757.1|  Kinesin-related protein 4                               327   3e-100   
ref|XP_008792831.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...    325   2e-99    
emb|CDY19208.1|  BnaC05g14090D                                          324   4e-99    
ref|XP_010906990.1|  PREDICTED: kinesin-like protein NACK1              323   5e-99    
ref|XP_010250094.1|  PREDICTED: kinesin-like protein NACK1              323   6e-99    
ref|XP_003620405.1|  Kinesin-like protein KIF3A                         322   1e-98    
emb|CDY26167.1|  BnaA06g12500D                                          323   1e-98    
ref|XP_009149278.1|  PREDICTED: kinesin-like protein NACK1              323   1e-98    
gb|AES76623.2|  ATP-binding microtubule motor family protein            322   1e-98    
ref|XP_008775906.1|  PREDICTED: kinesin-like protein NACK1              322   2e-98    
gb|KHN20772.1|  Kinesin-related protein 4                               322   3e-98    
ref|XP_003528955.1|  PREDICTED: kinesin-like protein NACK1-like i...    321   3e-98    
ref|XP_010540004.1|  PREDICTED: kinesin-like protein NACK1              321   5e-98    
emb|CDY21709.1|  BnaA09g44600D                                          318   6e-97    
ref|XP_010922342.1|  PREDICTED: kinesin-like protein NACK1              317   8e-97    
ref|XP_009407329.1|  PREDICTED: kinesin-like protein NACK1              317   2e-96    
ref|XP_009117616.1|  PREDICTED: kinesin-like protein NACK1              316   2e-96    
emb|CDX81870.1|  BnaC08g37310D                                          315   4e-96    
ref|XP_009418072.1|  PREDICTED: kinesin-like protein NACK1              309   1e-93    
ref|XP_010537463.1|  PREDICTED: kinesin-like protein NACK1 isofor...    303   1e-92    
ref|XP_010537459.1|  PREDICTED: kinesin-like protein NACK1 isofor...    303   3e-91    
gb|EMS53749.1|  Kinesin-related protein 4                               300   2e-90    
dbj|BAK03253.1|  predicted protein                                      293   5e-88    
ref|NP_001043186.1|  Os01g0513900                                       291   3e-87    Oryza sativa Japonica Group [Japonica rice]
gb|EEC70753.1|  hypothetical protein OsI_02166                          291   3e-87    Oryza sativa Indica Group [Indian rice]
gb|KCW44323.1|  hypothetical protein EUGRSUZ_L02231                     278   1e-86    
ref|XP_010041499.1|  PREDICTED: kinesin-like protein NACK2              279   1e-86    
ref|XP_006644227.1|  PREDICTED: kinesin-like protein NACK1-like         290   2e-86    
ref|XP_004968822.1|  PREDICTED: kinesin-like protein NACK1-like i...    287   1e-85    
ref|XP_007152726.1|  hypothetical protein PHAVU_004G154300g             286   3e-85    
gb|EMT03728.1|  Kinesin-related protein 4                               285   4e-85    
ref|XP_002437695.1|  hypothetical protein SORBIDRAFT_10g001010          285   1e-84    Sorghum bicolor [broomcorn]
gb|KDP33977.1|  hypothetical protein JCGZ_07548                         283   3e-84    
ref|XP_006381563.1|  TETRASPORE family protein                          282   1e-83    
gb|ACL52849.1|  unknown                                                 275   1e-83    Zea mays [maize]
ref|XP_011039916.1|  PREDICTED: kinesin-like protein NACK2              281   2e-83    
ref|XP_010051345.1|  PREDICTED: kinesin-like protein NACK2              280   3e-83    
ref|XP_002275046.2|  PREDICTED: kinesin-like protein NACK2              281   3e-83    Vitis vinifera
emb|CBI27754.3|  unnamed protein product                                281   3e-83    
gb|KCW81847.1|  hypothetical protein EUGRSUZ_C03198                     280   4e-83    
ref|XP_002875601.1|  hypothetical protein ARALYDRAFT_323079             280   6e-83    
ref|XP_003568740.1|  PREDICTED: kinesin-like protein NACK1              280   6e-83    
emb|CDP03034.1|  unnamed protein product                                279   1e-82    
ref|XP_007012544.1|  ATP binding microtubule motor family protein...    279   1e-82    
ref|XP_007012545.1|  ATP binding microtubule motor family protein...    279   1e-82    
ref|XP_010503028.1|  PREDICTED: kinesin-like protein NACK2              278   3e-82    
gb|KDO73778.1|  hypothetical protein CISIN_1g003967mg                   275   4e-82    
ref|XP_010514712.1|  PREDICTED: kinesin-like protein NACK2              277   4e-82    
ref|XP_006290563.1|  hypothetical protein CARUB_v10016650mg             276   9e-82    
ref|XP_008659376.1|  PREDICTED: kinesin-like protein NACK1              276   1e-81    
ref|XP_008460562.1|  PREDICTED: kinesin-like protein NACK2 isofor...    276   1e-81    
ref|NP_189907.2|  kinesin TETRASPORE                                    276   1e-81    Arabidopsis thaliana [mouse-ear cress]
emb|CAD42234.1|  kinesin-like protein                                   276   1e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008460563.1|  PREDICTED: kinesin-like protein NACK2 isofor...    276   1e-81    
emb|CAD42658.1|  kinesin-like protein                                   276   1e-81    Arabidopsis thaliana [mouse-ear cress]
gb|KGN51423.1|  hypothetical protein Csa_5G537000                       275   2e-81    
ref|XP_006474579.1|  PREDICTED: kinesin-like protein NACK2-like         275   4e-81    
ref|XP_006452892.1|  hypothetical protein CICLE_v10007377mg             275   5e-81    
gb|KHG14242.1|  Kinesin-related 4                                       275   5e-81    
gb|EMS62599.1|  Kinesin-related protein 4                               276   1e-80    
ref|XP_006419132.1|  hypothetical protein EUTSA_v10002392mg             273   1e-80    
gb|AAK91813.1|AF272750_1  kinesin heavy chain                           270   2e-80    Zea mays [maize]
ref|XP_010323978.1|  PREDICTED: kinesin-like protein NACK2              272   5e-80    
emb|CDY44836.1|  BnaCnng11920D                                          271   6e-80    
ref|XP_006353764.1|  PREDICTED: kinesin-like protein NACK2-like         271   9e-80    
emb|CAB89042.1|  kinesin-like protein                                   269   5e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004287670.1|  PREDICTED: uncharacterized protein LOC101306666    268   1e-78    
sp|Q8S949.1|NACK2_TOBAC  RecName: Full=Kinesin-like protein NACK2...    268   1e-78    Nicotiana tabacum [American tobacco]
ref|XP_009786270.1|  PREDICTED: kinesin-like protein NACK2 isofor...    268   1e-78    
ref|XP_009786269.1|  PREDICTED: kinesin-like protein NACK2 isofor...    268   1e-78    
ref|XP_009786272.1|  PREDICTED: kinesin-like protein NACK2 isofor...    268   1e-78    
ref|XP_009786271.1|  PREDICTED: kinesin-like protein NACK2 isofor...    268   2e-78    
ref|XP_010430934.1|  PREDICTED: kinesin-like protein NACK2              267   2e-78    
ref|XP_010687583.1|  PREDICTED: kinesin-like protein NACK2              267   2e-78    
ref|XP_009150293.1|  PREDICTED: kinesin-like protein NACK2              267   2e-78    
emb|CDY30956.1|  BnaA06g19570D                                          267   2e-78    
ref|XP_010107075.1|  Kinesin-related protein 4                          267   2e-78    
gb|AFW86156.1|  LOW QUALITY PROTEIN: kinesin heavy chain                267   3e-78    
ref|XP_007203229.1|  hypothetical protein PRUPE_ppa000925mg             266   7e-78    
ref|XP_010261715.1|  PREDICTED: kinesin-like protein NACK2              266   1e-77    
ref|XP_010535794.1|  PREDICTED: kinesin-like protein NACK2 isofor...    265   2e-77    
ref|XP_010535793.1|  PREDICTED: kinesin-like protein NACK2 isofor...    265   2e-77    
ref|XP_009625447.1|  PREDICTED: kinesin-like protein NACK2              263   6e-77    
ref|XP_008242294.1|  PREDICTED: kinesin-like protein NACK2              263   8e-77    
gb|AES92142.2|  ATP-binding microtubule motor family protein            263   2e-76    
ref|XP_008337808.1|  PREDICTED: kinesin-like protein NACK2 isofor...    260   1e-75    
ref|XP_008337807.1|  PREDICTED: kinesin-like protein NACK2 isofor...    260   1e-75    
ref|XP_003609945.1|  Kinesin-like protein                               259   5e-75    
gb|KHG07572.1|  kif4                                                    258   5e-75    
ref|XP_007154542.1|  hypothetical protein PHAVU_003G127400g             258   5e-75    
ref|XP_009359691.1|  PREDICTED: kinesin-like protein NACK2              258   6e-75    
ref|XP_011078149.1|  PREDICTED: kinesin-like protein NACK2              258   8e-75    
ref|XP_004508037.1|  PREDICTED: centromere-associated protein E-l...    256   1e-74    
ref|XP_010227940.1|  PREDICTED: kinesin-like protein NACK1              256   3e-74    
ref|XP_004508036.1|  PREDICTED: centromere-associated protein E-l...    255   6e-74    
ref|XP_003541319.1|  PREDICTED: kinesin-like protein NACK2-like i...    248   1e-71    
ref|XP_006842375.1|  hypothetical protein AMTR_s00079p00190770          242   4e-69    
ref|XP_002992286.1|  hypothetical protein SELMODRAFT_135047             229   6e-65    
ref|XP_002987833.1|  hypothetical protein SELMODRAFT_126650             228   1e-64    
gb|EPS71432.1|  hypothetical protein M569_03327                         214   3e-59    
gb|EYU28300.1|  hypothetical protein MIMGU_mgv1a001029mg                211   1e-58    
ref|XP_002516209.1|  microtubule motor, putative                        199   3e-54    Ricinus communis
ref|XP_001779285.1|  predicted protein                                  183   3e-48    
gb|KHN45051.1|  Kinesin-related protein 4                               177   2e-46    
ref|XP_006854867.1|  hypothetical protein AMTR_s00182p00038530          172   3e-44    
ref|XP_010240187.1|  PREDICTED: kinesin-like protein NACK1 isofor...    169   9e-44    
ref|XP_010240186.1|  PREDICTED: kinesin-like protein NACK1 isofor...    169   2e-43    
ref|NP_001047565.2|  Os02g0644400                                       159   2e-43    Oryza sativa Japonica Group [Japonica rice]
gb|EEC73688.1|  hypothetical protein OsI_08259                          159   2e-43    Oryza sativa Indica Group [Indian rice]
ref|XP_010240185.1|  PREDICTED: kinesin-like protein NACK1 isofor...    169   2e-43    
gb|EMT24668.1|  Kinesin-related protein 11                              166   2e-42    
ref|XP_002512997.1|  ATP binding protein, putative                      165   3e-42    Ricinus communis
ref|XP_006652585.1|  PREDICTED: kinesin-like protein NACK1-like         166   3e-42    
ref|XP_008663419.1|  PREDICTED: kinesin-like protein NACK1 isofor...    166   4e-42    
gb|AAK91822.1|AF272759_1  kinesin heavy chain                           165   4e-42    Zea mays [maize]
gb|KHG01762.1|  Kinesin-related 11                                      165   5e-42    
ref|XP_007042026.1|  ATP binding microtubule motor family protein...    165   6e-42    
gb|KDP27640.1|  hypothetical protein JCGZ_19645                         165   8e-42    
dbj|BAJ94998.1|  predicted protein                                      164   9e-42    
gb|KHN17757.1|  hypothetical protein glysoja_005954                     152   1e-41    
gb|EMS68002.1|  Kinesin-related protein 11                              164   1e-41    
dbj|BAJ95863.1|  predicted protein                                      164   2e-41    
ref|XP_002452843.1|  hypothetical protein SORBIDRAFT_04g033456          160   3e-41    Sorghum bicolor [broomcorn]
ref|XP_008444776.1|  PREDICTED: kinesin-like protein NACK1              163   4e-41    
gb|AAK91812.1|AF272749_1  kinesin heavy chain                           161   4e-41    Zea mays [maize]
ref|XP_002448243.1|  hypothetical protein SORBIDRAFT_06g023880          162   5e-41    Sorghum bicolor [broomcorn]
gb|EEE57467.1|  hypothetical protein OsJ_07707                          160   6e-41    Oryza sativa Japonica Group [Japonica rice]
dbj|BAF00479.1|  hypothetical protein                                   153   7e-41    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008678883.1|  PREDICTED: kinesin-like protein NACK1 isofor...    161   8e-41    
ref|XP_002305465.1|  kinesin motor family protein                       161   8e-41    Populus trichocarpa [western balsam poplar]
dbj|BAD25802.1|  putative kinesin heavy chain                           160   8e-41    Oryza sativa Japonica Group [Japonica rice]
gb|EEC77720.1|  hypothetical protein OsI_16807                          162   1e-40    Oryza sativa Indica Group [Indian rice]
emb|CAE03025.3|  OSJNBa0091D06.23                                       161   1e-40    Oryza sativa [red rice]
ref|NP_001053433.1|  Os04g0538800                                       162   1e-40    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008678882.1|  PREDICTED: kinesin-like protein NACK1 isofor...    161   1e-40    
gb|KHF98979.1|  Kinesin-related 11                                      161   2e-40    
ref|XP_004148539.1|  PREDICTED: kinesin-like protein KIN12B-like        161   2e-40    
ref|XP_011083601.1|  PREDICTED: kinesin-like protein NACK1              160   2e-40    
gb|EEC73693.1|  hypothetical protein OsI_08272                          160   3e-40    Oryza sativa Indica Group [Indian rice]
ref|XP_004976382.1|  PREDICTED: kinesin-like protein NACK1-like i...    160   3e-40    
ref|XP_008663418.1|  PREDICTED: kinesin-like protein NACK1 isofor...    160   3e-40    
ref|NP_001047571.1|  Os02g0645100                                       160   4e-40    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009389113.1|  PREDICTED: kinesin-like protein NACK1              160   4e-40    
ref|XP_010271468.1|  PREDICTED: kinesin-like protein NACK2              160   5e-40    
gb|EMS48860.1|  Kinesin-related protein 4                               159   5e-40    
gb|EMT03608.1|  Kinesin-related protein 4                               159   5e-40    
ref|XP_010933747.1|  PREDICTED: kinesin-like protein NACK1              159   6e-40    
gb|EYU38855.1|  hypothetical protein MIMGU_mgv1a000996mg                159   9e-40    
ref|XP_011037209.1|  PREDICTED: kinesin-like protein NACK1              159   9e-40    
ref|XP_006647603.1|  PREDICTED: kinesin-like protein NACK1-like         157   2e-39    
ref|XP_004953277.1|  PREDICTED: kinesin-like protein NACK1-like i...    157   2e-39    
ref|XP_008791670.1|  PREDICTED: kinesin-like protein NACK2 isofor...    158   3e-39    
ref|XP_009398104.1|  PREDICTED: kinesin-like protein NACK1              157   3e-39    
ref|XP_008796871.1|  PREDICTED: kinesin-like protein NACK1              156   7e-39    
ref|XP_006380794.1|  hypothetical protein POPTR_0007s13860g             156   1e-38    
ref|XP_002313758.2|  kinesin motor family protein                       156   1e-38    Populus trichocarpa [western balsam poplar]
ref|XP_003569980.1|  PREDICTED: kinesin-like protein NACK2              155   1e-38    
ref|XP_008236841.1|  PREDICTED: kinesin-like protein NACK2              155   1e-38    
ref|XP_004152764.1|  PREDICTED: uncharacterized protein LOC101212680    155   1e-38    
ref|XP_004167109.1|  PREDICTED: uncharacterized LOC101212680            155   1e-38    
ref|XP_010472110.1|  PREDICTED: kinesin-like protein NACK1              155   2e-38    
dbj|BAD93933.1|  putative kinesin heavy chain                           153   2e-38    Arabidopsis thaliana [mouse-ear cress]
tpg|DAA36662.1|  TPA: hypothetical protein ZEAMMB73_386599              154   2e-38    
ref|XP_011025920.1|  PREDICTED: kinesin-like protein NACK2              155   2e-38    
ref|XP_008669086.1|  PREDICTED: kinesin-like protein NACK1 isofor...    154   2e-38    
ref|XP_010416871.1|  PREDICTED: kinesin-like protein NACK1              154   3e-38    
ref|XP_010919403.1|  PREDICTED: kinesin-like protein NACK1 isofor...    154   3e-38    
ref|XP_010263900.1|  PREDICTED: kinesin-like protein NACK1 isofor...    155   3e-38    
tpg|DAA36661.1|  TPA: hypothetical protein ZEAMMB73_386599              154   3e-38    
ref|XP_010647602.1|  PREDICTED: kinesin-like protein NACK1              154   4e-38    
ref|XP_007201806.1|  hypothetical protein PRUPE_ppa001038mg             154   4e-38    
ref|XP_008669081.1|  PREDICTED: kinesin-like protein NACK1 isofor...    154   4e-38    
ref|XP_006296345.1|  hypothetical protein CARUB_v10025517mg             154   4e-38    
ref|XP_006383133.1|  kinesin motor family protein                       154   4e-38    
ref|XP_010429028.1|  PREDICTED: kinesin-like protein NACK1              154   5e-38    
ref|XP_010919401.1|  PREDICTED: kinesin-like protein NACK2 isofor...    154   5e-38    
ref|NP_179726.2|  ATP binding microtubule motor family protein          153   8e-38    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880373.1|  kinesin motor family protein                       153   9e-38    
ref|XP_008448048.1|  PREDICTED: kinesin-like protein NACK2              153   9e-38    
gb|KHF98716.1|  Kinesin-related 11                                      153   1e-37    
ref|XP_009140272.1|  PREDICTED: kinesin-like protein NACK1              152   2e-37    
ref|XP_011047336.1|  PREDICTED: kinesin-like protein NACK2 isofor...    152   2e-37    
ref|XP_011047311.1|  PREDICTED: kinesin-like protein NACK2 isofor...    152   2e-37    
emb|CDX99601.1|  BnaC04g33580D                                          152   2e-37    
ref|XP_009393646.1|  PREDICTED: kinesin-like protein NACK1              152   2e-37    
ref|XP_010028653.1|  PREDICTED: kinesin-like protein NACK1 isofor...    152   2e-37    
ref|XP_002868873.1|  kinesin motor family protein                       152   2e-37    
ref|XP_009338641.1|  PREDICTED: kinesin-like protein NACK2 isofor...    152   2e-37    
ref|XP_004512117.1|  PREDICTED: kinesin-related protein 4-like is...    152   2e-37    
ref|XP_004512118.1|  PREDICTED: kinesin-related protein 4-like is...    152   2e-37    
ref|XP_010028651.1|  PREDICTED: kinesin-like protein NACK1 isofor...    152   2e-37    
ref|XP_009338640.1|  PREDICTED: kinesin-like protein NACK2 isofor...    152   3e-37    
ref|XP_008775730.1|  PREDICTED: kinesin-like protein NACK1 isofor...    152   3e-37    
ref|XP_010526578.1|  PREDICTED: kinesin-like protein NACK1 isofor...    151   3e-37    
emb|CDY15900.1|  BnaA04g12110D                                          151   4e-37    
ref|XP_009791027.1|  PREDICTED: kinesin-like protein NACK1              152   4e-37    
gb|KDP38590.1|  hypothetical protein JCGZ_04515                         151   4e-37    
ref|XP_009386197.1|  PREDICTED: kinesin-like protein NACK1              151   4e-37    
ref|XP_010909958.1|  PREDICTED: kinesin-like protein NACK1              151   4e-37    
ref|XP_007131749.1|  hypothetical protein PHAVU_011G038800g             151   5e-37    
ref|XP_010531480.1|  PREDICTED: kinesin-like protein NACK1              150   5e-37    
ref|XP_007131750.1|  hypothetical protein PHAVU_011G038800g             151   5e-37    
gb|KDO49884.1|  hypothetical protein CISIN_1g002139mg                   150   7e-37    
ref|XP_009597015.1|  PREDICTED: kinesin-like protein NACK1              150   7e-37    
emb|CDY13822.1|  BnaA09g43240D                                          150   8e-37    
gb|KDO49883.1|  hypothetical protein CISIN_1g002139mg                   150   8e-37    
gb|KDO49879.1|  hypothetical protein CISIN_1g002139mg                   150   9e-37    
ref|XP_006423481.1|  hypothetical protein CICLE_v10027758mg             150   9e-37    
ref|XP_006487385.1|  PREDICTED: kinesin-like protein NACK1-like i...    150   9e-37    
gb|KHN25430.1|  Centromere-associated protein E                         150   1e-36    
ref|XP_010091188.1|  Kinesin-related protein 11                         150   1e-36    
ref|XP_006423484.1|  hypothetical protein CICLE_v10027758mg             149   1e-36    
ref|XP_007203241.1|  hypothetical protein PRUPE_ppa001146mg             149   1e-36    
ref|XP_009117419.1|  PREDICTED: kinesin-like protein NACK1              149   1e-36    
ref|XP_006487377.1|  PREDICTED: kinesin-like protein NACK1-like i...    150   1e-36    
ref|XP_010446407.1|  PREDICTED: kinesin-like protein NACK1 isofor...    149   2e-36    
ref|XP_009378197.1|  PREDICTED: kinesin-like protein NACK1 isofor...    150   2e-36    
ref|XP_009767346.1|  PREDICTED: kinesin-like protein NACK2 isofor...    149   2e-36    
ref|XP_008372766.1|  PREDICTED: kinesin-like protein NACK1              149   2e-36    
ref|XP_009378198.1|  PREDICTED: kinesin-like protein NACK2 isofor...    149   2e-36    
ref|XP_009378441.1|  PREDICTED: kinesin-like protein NACK1              149   2e-36    
ref|XP_006423482.1|  hypothetical protein CICLE_v10027758mg             149   2e-36    
ref|XP_009767348.1|  PREDICTED: kinesin-like protein NACK2 isofor...    149   2e-36    
ref|XP_010431843.1|  PREDICTED: kinesin-like protein NACK1              149   2e-36    
ref|XP_010436987.1|  PREDICTED: kinesin-like protein NACK1              149   2e-36    
ref|XP_010445916.1|  PREDICTED: kinesin-like protein NACK1              141   2e-36    
ref|XP_006283113.1|  hypothetical protein CARUB_v10004132mg             149   2e-36    
ref|XP_008241798.1|  PREDICTED: kinesin-like protein NACK1              149   3e-36    
ref|XP_009617690.1|  PREDICTED: kinesin-like protein NACK2              149   3e-36    
emb|CDX82016.1|  BnaC08g35850D                                          148   4e-36    
ref|XP_009587868.1|  PREDICTED: kinesin-like protein NACK2              148   5e-36    
ref|XP_009760421.1|  PREDICTED: kinesin-like protein NACK2              148   5e-36    
emb|CDY22404.1|  BnaA06g37260D                                          147   6e-36    
ref|XP_010315333.1|  PREDICTED: kinesin-like protein NACK2 isofor...    147   7e-36    
ref|XP_010315335.1|  PREDICTED: kinesin-like protein NACK2 isofor...    147   7e-36    
ref|XP_010649060.1|  PREDICTED: kinesin-like protein NACK1              148   7e-36    
ref|XP_008452051.1|  PREDICTED: kinesin-like protein NACK1 isofor...    148   7e-36    
ref|XP_009345268.1|  PREDICTED: kinesin-like protein NACK1              147   8e-36    
ref|XP_007046742.1|  ATP binding microtubule motor family protein...    147   1e-35    
emb|CDP01925.1|  unnamed protein product                                147   1e-35    
ref|NP_195606.2|  ATP binding microtubule motor family protein          147   1e-35    
dbj|BAF02000.1|  kinesin like protein                                   146   1e-35    
emb|CAB38815.1|  kinesin like protein                                   146   2e-35    
ref|XP_009407965.1|  PREDICTED: kinesin-like protein NACK2              146   2e-35    
ref|XP_008382370.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...    146   3e-35    
gb|EMS48622.1|  Kinesin-related protein 4                               146   3e-35    
emb|CDP07439.1|  unnamed protein product                                145   4e-35    
ref|XP_004232466.1|  PREDICTED: kinesin-like protein NACK2              145   5e-35    
gb|AES95091.2|  ATP-binding microtubule motor family protein            145   6e-35    
ref|XP_006340707.1|  PREDICTED: kinesin-like protein NACK1-like         145   6e-35    
ref|XP_003612133.1|  Kinesin-related protein                            145   6e-35    
ref|XP_009101918.1|  PREDICTED: kinesin-like protein NACK1              144   6e-35    
ref|XP_006404570.1|  hypothetical protein EUTSA_v10000043mg             144   6e-35    
ref|XP_006411686.1|  hypothetical protein EUTSA_v10024409mg             144   6e-35    
ref|XP_004509341.1|  PREDICTED: kinesin-related protein 4-like is...    145   8e-35    
ref|XP_004509338.1|  PREDICTED: kinesin-related protein 4-like is...    145   9e-35    
ref|XP_003519876.1|  PREDICTED: kinesin-like protein NACK1-like         144   1e-34    
gb|KHN00495.1|  Kinesin-related protein 11                              144   1e-34    
emb|CDY02395.1|  BnaA02g23040D                                          142   1e-34    
ref|XP_004289095.1|  PREDICTED: uncharacterized protein LOC101300397    144   1e-34    
ref|XP_010494185.1|  PREDICTED: kinesin-like protein NACK2              144   1e-34    
ref|XP_002462712.1|  hypothetical protein SORBIDRAFT_02g030680          143   2e-34    
emb|CDY12957.1|  BnaC02g29640D                                          143   2e-34    
gb|EMT22069.1|  Kinesin-related protein 4                               144   2e-34    
ref|XP_002510482.1|  ATP binding protein, putative                      143   2e-34    
ref|XP_006403375.1|  hypothetical protein EUTSA_v10003349mg             143   3e-34    
ref|XP_009136600.1|  PREDICTED: kinesin-like protein NACK1 isofor...    142   4e-34    
ref|XP_010672217.1|  PREDICTED: kinesin-like protein NACK2              143   4e-34    
gb|EPS66111.1|  hypothetical protein M569_08665                         142   4e-34    
ref|XP_009136598.1|  PREDICTED: kinesin-like protein NACK1 isofor...    143   4e-34    
ref|XP_011088489.1|  PREDICTED: kinesin-like protein NACK1              142   4e-34    
emb|CDX90660.1|  BnaA03g41210D                                          143   4e-34    
ref|XP_009123681.1|  PREDICTED: kinesin-like protein NACK1              143   4e-34    
gb|KDO71126.1|  hypothetical protein CISIN_1g001693mg                   141   5e-34    
ref|NP_001159162.1|  uncharacterized protein LOC100304245               136   5e-34    
gb|KHN39844.1|  Centromere-associated protein E                         142   6e-34    
ref|XP_010033468.1|  PREDICTED: kinesin-like protein NACK1              142   6e-34    
ref|XP_011090438.1|  PREDICTED: kinesin-like protein NACK1              142   6e-34    
ref|XP_002863777.1|  kinesin motor family protein                       142   6e-34    
gb|KHN41676.1|  Kinesin-related protein 4                               142   7e-34    
gb|KDO71125.1|  hypothetical protein CISIN_1g001693mg                   142   7e-34    
ref|XP_011074638.1|  PREDICTED: kinesin-like protein NACK1 isofor...    142   8e-34    
ref|XP_011074636.1|  PREDICTED: kinesin-like protein NACK2 isofor...    142   8e-34    
ref|XP_007156119.1|  hypothetical protein PHAVU_003G260200g             142   8e-34    
ref|XP_006599344.1|  PREDICTED: kinesin-like protein NACK1-like i...    141   8e-34    
ref|XP_007157943.1|  hypothetical protein PHAVU_002G111200g             142   9e-34    
gb|KGN53326.1|  hypothetical protein Csa_4G047870                       142   9e-34    
ref|XP_010317235.1|  PREDICTED: kinesin-like protein NACK1 isofor...    141   9e-34    
ref|XP_010317234.1|  PREDICTED: kinesin-like protein NACK1 isofor...    142   9e-34    
ref|XP_004160983.1|  PREDICTED: uncharacterized LOC101218717            142   9e-34    
gb|KDO71124.1|  hypothetical protein CISIN_1g001693mg                   142   9e-34    
ref|XP_002876073.1|  kinesin motor family protein                       142   9e-34    
ref|XP_004146557.1|  PREDICTED: uncharacterized protein LOC101218717    142   9e-34    
gb|KHN33713.1|  Centromere-associated protein E                         141   1e-33    
ref|XP_006599340.1|  PREDICTED: kinesin-like protein NACK1-like i...    141   1e-33    
ref|XP_010113382.1|  Kinesin-related protein 4                          141   1e-33    
tpg|DAA62428.1|  TPA: hypothetical protein ZEAMMB73_515130              140   1e-33    
ref|XP_010690757.1|  PREDICTED: kinesin-like protein NACK1              141   1e-33    
ref|XP_002301999.2|  kinesin motor family protein                       141   1e-33    
gb|EYU37862.1|  hypothetical protein MIMGU_mgv1a001175mg                141   1e-33    
ref|XP_003538873.1|  PREDICTED: kinesin-like protein NACK1-like i...    141   1e-33    
emb|CDY29004.1|  BnaC07g32100D                                          141   1e-33    
ref|XP_007017694.1|  ATP binding microtubule motor family protein...    141   2e-33    
gb|EYU31140.1|  hypothetical protein MIMGU_mgv1a000697mg                141   2e-33    
tpg|DAA40602.1|  TPA: hypothetical protein ZEAMMB73_556467              132   2e-33    
ref|XP_004238322.1|  PREDICTED: kinesin-like protein NACK2              140   2e-33    
emb|CDO96988.1|  unnamed protein product                                141   2e-33    
ref|XP_008671753.1|  PREDICTED: kinesin-like protein NACK1              132   2e-33    
ref|XP_006403945.1|  hypothetical protein EUTSA_v10010086mg             140   2e-33    
ref|XP_008388149.1|  PREDICTED: kinesin-like protein NACK2              140   3e-33    
ref|XP_008652983.1|  PREDICTED: kinesin-like protein NACK1 isofor...    140   3e-33    
ref|XP_008652981.1|  PREDICTED: kinesin-like protein NACK1 isofor...    140   3e-33    
ref|XP_009336756.1|  PREDICTED: kinesin-like protein NACK1              140   3e-33    
ref|NP_001062429.1|  Os08g0547500                                       140   3e-33    
gb|EYU24075.1|  hypothetical protein MIMGU_mgv1a001308mg                140   3e-33    
gb|EEE69110.1|  hypothetical protein OsJ_28179                          140   3e-33    
ref|XP_006290553.1|  hypothetical protein CARUB_v10016639mg             140   3e-33    
dbj|BAD09937.1|  putative kinesin heavy chain                           140   3e-33    
ref|XP_006466916.1|  PREDICTED: kinesin-like protein NACK1-like i...    140   3e-33    
ref|XP_006466914.1|  PREDICTED: kinesin-like protein NACK1-like i...    140   5e-33    
ref|XP_006435104.1|  hypothetical protein CICLE_v10000097mg             140   5e-33    
ref|XP_006473601.1|  PREDICTED: kinesin-like protein NACK1-like i...    140   5e-33    
ref|XP_004293191.1|  PREDICTED: uncharacterized protein LOC101301847    139   5e-33    
ref|XP_006425531.1|  hypothetical protein CICLE_v10024791mg             140   5e-33    
ref|XP_008388151.1|  PREDICTED: kinesin-like protein NACK1              140   5e-33    
gb|KDO84748.1|  hypothetical protein CISIN_1g001290mg                   140   5e-33    
ref|XP_008669084.1|  PREDICTED: kinesin-like protein NACK1 isofor...    139   5e-33    
emb|CDY22403.1|  BnaA06g37250D                                          135   5e-33    
ref|XP_009777060.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...    139   6e-33    
gb|KDP46700.1|  hypothetical protein JCGZ_06488                         139   6e-33    
ref|XP_006393829.1|  hypothetical protein EUTSA_v10003607mg             139   6e-33    
emb|CDX72728.1|  BnaC07g47500D                                          138   6e-33    
ref|XP_004974127.1|  PREDICTED: kinesin-like protein NACK1-like i...    139   6e-33    
gb|ABB45845.1|  hypothetical protein                                    139   7e-33    
ref|XP_009124667.1|  PREDICTED: kinesin-like protein NACK1              131   7e-33    
ref|XP_004974128.1|  PREDICTED: kinesin-like protein NACK1-like i...    139   7e-33    
ref|XP_004974129.1|  PREDICTED: kinesin-like protein NACK1-like i...    139   7e-33    
ref|XP_003578490.1|  PREDICTED: kinesin-like protein NACK1              139   7e-33    
ref|NP_190684.3|  ATP binding microtubule motor family protein          139   7e-33    
dbj|BAF00728.1|  hypothetical protein                                   139   7e-33    
ref|XP_009101917.1|  PREDICTED: uncharacterized protein LOC103828075    135   7e-33    
gb|KFK28301.1|  hypothetical protein AALP_AA8G498700                    135   7e-33    
ref|NP_001190049.1|  ATP binding microtubule motor family protein       139   8e-33    
tpg|DAA40600.1|  TPA: hypothetical protein ZEAMMB73_646629              137   8e-33    
ref|XP_010515506.1|  PREDICTED: kinesin-like protein NACK1 isofor...    139   8e-33    
ref|XP_010547437.1|  PREDICTED: kinesin-like protein NACK1 isofor...    139   8e-33    
ref|XP_010503800.1|  PREDICTED: kinesin-like protein NACK1              139   8e-33    
ref|XP_010515505.1|  PREDICTED: kinesin-like protein NACK1 isofor...    139   9e-33    
ref|XP_010481985.1|  PREDICTED: kinesin-like protein NACK1              139   9e-33    
ref|XP_002531511.1|  conserved hypothetical protein                     139   9e-33    
gb|EMS46463.1|  Kinesin-related protein 11                              138   9e-33    
gb|KEH20388.1|  ATP-binding microtubule motor family protein            139   1e-32    
ref|NP_199064.1|  ATP binding microtubule motor family protein          139   1e-32    
gb|AET03829.2|  ATP-binding microtubule motor family protein            139   1e-32    
ref|XP_011028954.1|  PREDICTED: kinesin-like protein NACK1 isofor...    138   1e-32    
ref|XP_003629353.1|  Kinesin heavy chain DNA binding protein-like...    139   1e-32    
ref|XP_010484663.1|  PREDICTED: kinesin-like protein NACK1 isofor...    138   1e-32    
dbj|BAK06679.1|  predicted protein                                      138   1e-32    
ref|XP_011028953.1|  PREDICTED: kinesin-like protein NACK1 isofor...    138   1e-32    
gb|KHN36049.1|  Kinesin-related protein 4                               138   1e-32    
ref|XP_003516550.1|  PREDICTED: kinesin-like protein NACK2-like i...    138   1e-32    
ref|XP_010426660.1|  PREDICTED: kinesin-like protein NACK1 isofor...    138   1e-32    
ref|XP_010484662.1|  PREDICTED: kinesin-like protein NACK1 isofor...    138   2e-32    
emb|CBI19799.3|  unnamed protein product                                138   2e-32    
ref|XP_006659658.1|  PREDICTED: kinesin-like protein NACK2-like         138   2e-32    
ref|XP_002280678.2|  PREDICTED: kinesin-like protein NACK1              137   2e-32    
ref|XP_010426656.1|  PREDICTED: kinesin-like protein NACK1 isofor...    138   2e-32    
ref|XP_008668212.1|  PREDICTED: uncharacterized protein LOC100304...    137   2e-32    
ref|XP_008668211.1|  PREDICTED: uncharacterized protein LOC100304...    137   2e-32    
ref|XP_006279726.1|  hypothetical protein CARUB_v10027496mg             138   2e-32    
emb|CDY42594.1|  BnaC01g00060D                                          137   2e-32    
emb|CDY72468.1|  BnaCnng77800D                                          127   2e-32    
gb|EYU40392.1|  hypothetical protein MIMGU_mgv1a001117mg                137   3e-32    
ref|XP_010547443.1|  PREDICTED: kinesin-like protein NACK2 isofor...    137   3e-32    
ref|XP_010547438.1|  PREDICTED: kinesin-like protein NACK1 isofor...    137   4e-32    
ref|XP_010547436.1|  PREDICTED: kinesin-like protein NACK1 isofor...    137   4e-32    
ref|XP_010547440.1|  PREDICTED: kinesin-like protein NACK2 isofor...    137   4e-32    
ref|XP_010547441.1|  PREDICTED: kinesin-like protein NACK2 isofor...    137   4e-32    
ref|XP_010547439.1|  PREDICTED: kinesin-like protein NACK2 isofor...    137   4e-32    
ref|XP_010547442.1|  PREDICTED: kinesin-like protein NACK2 isofor...    137   5e-32    
ref|XP_010535298.1|  PREDICTED: kinesin-like protein NACK1              137   5e-32    
emb|CDY41952.1|  BnaA01g05240D                                          135   7e-32    
gb|EMT18151.1|  Kinesin-related protein 4                               136   7e-32    
emb|CDX73746.1|  BnaC08g22570D                                          136   7e-32    
ref|XP_004958729.1|  PREDICTED: kinesin-like protein NACK1-like         136   7e-32    
ref|XP_010465682.1|  PREDICTED: kinesin-like protein NACK1              136   7e-32    
ref|XP_009140424.1|  PREDICTED: kinesin-like protein NACK1              135   8e-32    
emb|CDX77978.1|  BnaA09g31730D                                          136   8e-32    
emb|CDX72727.1|  BnaC07g47490D                                          132   1e-31    
ref|XP_010444813.1|  PREDICTED: kinesin-like protein NACK2              135   1e-31    
ref|XP_008221318.1|  PREDICTED: kinesin-like protein NACK1              135   1e-31    
gb|KDO84747.1|  hypothetical protein CISIN_1g001290mg                   135   2e-31    
ref|XP_006473600.1|  PREDICTED: kinesin-like protein NACK1-like i...    135   2e-31    
gb|ADQ43205.1|  kinesin motor family protein                            135   2e-31    
ref|XP_003607070.1|  Kinesin-related protein                            134   2e-31    
ref|XP_006473602.1|  PREDICTED: kinesin-like protein NACK1-like i...    135   2e-31    
ref|XP_010550452.1|  PREDICTED: kinesin-like protein NACK1 isofor...    135   2e-31    
ref|XP_006661465.1|  PREDICTED: kinesin-like protein NACK2-like         134   2e-31    
ref|XP_009115793.1|  PREDICTED: kinesin-like protein NACK1 isofor...    134   3e-31    
ref|XP_009115792.1|  PREDICTED: kinesin-like protein NACK1 isofor...    134   3e-31    
ref|XP_010550454.1|  PREDICTED: kinesin-like protein NACK1 isofor...    134   3e-31    
ref|XP_011100938.1|  PREDICTED: kinesin-like protein NACK1              134   3e-31    
gb|KHG01461.1|  Kinesin-related 11                                      134   3e-31    
ref|XP_007135918.1|  hypothetical protein PHAVU_009G003000g             134   3e-31    
ref|XP_002444630.1|  hypothetical protein SORBIDRAFT_07g025040          134   4e-31    
ref|XP_009336747.1|  PREDICTED: kinesin-like protein NACK1              134   4e-31    
gb|EEE70089.1|  hypothetical protein OsJ_30085                          134   4e-31    
ref|NP_001063734.2|  Os09g0528000                                       133   5e-31    
ref|XP_002865077.1|  kinesin motor family protein                       134   5e-31    
emb|CDY30779.1|  BnaC07g16790D                                          133   7e-31    
ref|XP_006281818.1|  hypothetical protein CARUB_v10028003mg             133   1e-30    
ref|XP_011092853.1|  PREDICTED: kinesin-like protein NACK1 isofor...    132   1e-30    
ref|XP_007226270.1|  hypothetical protein PRUPE_ppa019074mg             133   1e-30    
ref|XP_011092849.1|  PREDICTED: kinesin-like protein NACK1 isofor...    132   1e-30    
ref|XP_009386558.1|  PREDICTED: kinesin-like protein NACK1              132   1e-30    
ref|NP_201432.2|  ATP binding microtubule motor family protein          132   2e-30    
emb|CDY34261.1|  BnaA01g13640D                                          131   2e-30    
ref|XP_009137750.1|  PREDICTED: kinesin-like protein NACK2              132   3e-30    
ref|XP_003527612.1|  PREDICTED: kinesin-like protein NACK1-like i...    130   4e-30    
emb|CDX91310.1|  BnaC02g27210D                                          119   5e-30    
ref|XP_006342006.1|  PREDICTED: kinesin-like protein NACK2-like i...    130   5e-30    
gb|KHN20030.1|  Kinesin-related protein 4                               130   5e-30    
ref|XP_006342008.1|  PREDICTED: kinesin-like protein NACK2-like i...    130   5e-30    
ref|XP_006582466.1|  PREDICTED: kinesin-like protein NACK1-like         130   7e-30    
gb|KHN09110.1|  Kinesin-related protein 4                               130   7e-30    
emb|CDY25938.1|  BnaC09g20490D                                          119   8e-30    
emb|CDY45220.1|  BnaA07g12700D                                          130   9e-30    
ref|XP_010235379.1|  PREDICTED: kinesin-like protein NACK2 isofor...    130   9e-30    
ref|XP_010235378.1|  PREDICTED: kinesin-like protein NACK2 isofor...    130   1e-29    
emb|CDY03482.1|  BnaC01g16000D                                          129   1e-29    
ref|XP_007136058.1|  hypothetical protein PHAVU_009G014400g             128   4e-29    
gb|EPS66402.1|  hypothetical protein M569_08376                         120   4e-29    
gb|KHN45902.1|  Kinesin-related protein 11                              127   7e-29    
ref|XP_009772334.1|  PREDICTED: kinesin-like protein NACK2              127   7e-29    
ref|XP_006413467.1|  hypothetical protein EUTSA_v10026976mg             126   2e-28    
ref|XP_006285338.1|  hypothetical protein CARUB_v10006728mg             126   2e-28    
ref|XP_009630370.1|  PREDICTED: kinesin-like protein NACK2 isofor...    126   2e-28    
ref|XP_009630368.1|  PREDICTED: kinesin-like protein NACK1 isofor...    125   3e-28    
gb|EEC84919.1|  hypothetical protein OsI_32119                          125   3e-28    
gb|EEC83991.1|  hypothetical protein OsI_30145                          125   4e-28    
ref|XP_010448602.1|  PREDICTED: kinesin-like protein NACK1              124   9e-28    
ref|XP_010433806.1|  PREDICTED: kinesin-like protein NACK1              124   1e-27    
emb|CDY19865.1|  BnaC09g31310D                                          112   2e-27    
gb|AES73979.2|  ATP-binding microtubule motor family protein            124   2e-27    
ref|XP_003603728.1|  Kinesin-related protein                            124   2e-27    
emb|CDY47294.1|  BnaC04g29750D                                          111   5e-27    
gb|KHG01464.1|  Kinesin-related 4                                       121   7e-27    
dbj|BAB10710.1|  kinesin heavy chain DNA binding protein-like           121   7e-27    
emb|CDY03481.1|  BnaC01g16010D                                          114   5e-26    
gb|EPS72257.1|  hypothetical protein M569_02502                         111   9e-26    
ref|NP_567695.1|  ATP binding microtubule motor family protein          109   1e-22    
emb|CAB51660.1|  putative protein                                       109   1e-22    
ref|XP_010679850.1|  PREDICTED: kinesin-like protein NACK1 isofor...    108   2e-22    



>ref|XP_009589619.1| PREDICTED: kinesin-like protein NACK1 [Nicotiana tomentosiformis]
Length=959

 Score =   379 bits (973),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 177/218 (81%), Positives = 199/218 (91%), Gaps = 2/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEI-QESPASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELEANEAAGY LE++ENI +I +ESP SW ITF+EQ QQIIDLWDVC+VSIIHRSQF
Sbjct  742  QVLELEANEAAGYNLEDDENIHQIPEESPVSWQITFKEQRQQIIDLWDVCYVSIIHRSQF  801

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLFKGD AD+IY+EVE+RRLTWLQQHLAELGNA+PA++GNEPTVSLSSSI+AL+RE+EF
Sbjct  802  YLLFKGDPADEIYLEVELRRLTWLQQHLAELGNATPARVGNEPTVSLSSSIRALKREREF  861

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKRL TRLT EERD LYIKWEVPLEGK RR+ FINKLWT P D KHV ESAEIVAKLVG
Sbjct  862  LAKRLTTRLTAEERDYLYIKWEVPLEGKQRRMQFINKLWTNPHDAKHVHESAEIVAKLVG  921

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE GNMSREMFELNFV+P+D+R WF GW+QI+DLLH+
Sbjct  922  FCEGGNMSREMFELNFVLPSDRRPWFAGWNQISDLLHI  959



>ref|XP_009804137.1| PREDICTED: kinesin-like protein NACK1 [Nicotiana sylvestris]
 ref|XP_009804138.1| PREDICTED: kinesin-like protein NACK1 [Nicotiana sylvestris]
 ref|XP_009804139.1| PREDICTED: kinesin-like protein NACK1 [Nicotiana sylvestris]
 sp|Q8S950.1|NACK1_TOBAC RecName: Full=Kinesin-like protein NACK1; AltName: Full=NPK1-activating 
kinesin-1 [Nicotiana tabacum]
 dbj|BAB86283.1| kinesin-like protein NACK1 [Nicotiana tabacum]
Length=959

 Score =   379 bits (972),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 177/218 (81%), Positives = 199/218 (91%), Gaps = 2/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEI-QESPASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELEANEAAGY LE++ENI +I +ESP SW ITF+EQ QQIIDLWDVC+VSIIHRSQF
Sbjct  742  QVLELEANEAAGYNLEDDENIHQIPEESPVSWQITFKEQRQQIIDLWDVCYVSIIHRSQF  801

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLFKGD AD+IY+EVE+RRLTWLQQHLAELGNA+PA++GNEPTVSLSSSI+AL+RE+EF
Sbjct  802  YLLFKGDPADEIYLEVELRRLTWLQQHLAELGNATPARVGNEPTVSLSSSIRALKREREF  861

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKRL TRLT EERD LYIKWEVPLEGK RR+ FINKLWT P D KHV ESAEIVAKLVG
Sbjct  862  LAKRLTTRLTAEERDYLYIKWEVPLEGKQRRMQFINKLWTNPHDAKHVHESAEIVAKLVG  921

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE GNMSREMFELNFV+P+D+R WF GW+QI+DLLH+
Sbjct  922  FCEGGNMSREMFELNFVLPSDRRPWFAGWNQISDLLHI  959



>ref|XP_004235748.1| PREDICTED: kinesin-like protein NACK1 [Solanum lycopersicum]
 ref|XP_010318630.1| PREDICTED: kinesin-like protein NACK1 [Solanum lycopersicum]
Length=962

 Score =   378 bits (970),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 200/218 (92%), Gaps = 2/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEI-QESPASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELEANEAAGY LE++ENI +I +ESP SW ITF+EQ QQIIDLWDVC+VSIIHRSQF
Sbjct  745  QVLELEANEAAGYNLEDDENIHQIPEESPVSWQITFKEQRQQIIDLWDVCYVSIIHRSQF  804

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLFKGD AD+IY+EVE+RRLTWLQQHLAELGNA+PA++GNEPTVSLSSSI+A++RE+EF
Sbjct  805  YLLFKGDPADEIYLEVELRRLTWLQQHLAELGNATPARVGNEPTVSLSSSIRAIKREREF  864

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKRL TRLT EERD LYIKWEVPLEGK RR+ FINKLWT P D KHV+ESAEIVAKLVG
Sbjct  865  LAKRLTTRLTAEERDYLYIKWEVPLEGKQRRMQFINKLWTNPHDEKHVKESAEIVAKLVG  924

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE GNMSREMFELNFV+P+D+R WF GW+QI+DLLH+
Sbjct  925  FCEGGNMSREMFELNFVLPSDRRPWFAGWNQISDLLHI  962



>ref|XP_006341574.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006341575.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Solanum 
tuberosum]
Length=961

 Score =   377 bits (967),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 175/218 (80%), Positives = 200/218 (92%), Gaps = 2/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEI-QESPASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELEANEAAGY LE++ENI +I +ESP SW ITF++Q QQIIDLWDVC+VSIIHRSQF
Sbjct  744  QVLELEANEAAGYNLEDDENIHQIPEESPVSWQITFKDQRQQIIDLWDVCYVSIIHRSQF  803

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLFKGD AD+IY+EVE+RRLTWLQQHLAELGNA+PA++GNEPTVSLSSSI+A++RE+EF
Sbjct  804  YLLFKGDPADEIYLEVELRRLTWLQQHLAELGNATPARVGNEPTVSLSSSIRAIKREREF  863

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKRL TRLT EERD LYIKWEVPLEGK RR+ FINKLWT P D KHV+ESAEIVAKLVG
Sbjct  864  LAKRLTTRLTAEERDYLYIKWEVPLEGKQRRMQFINKLWTNPHDEKHVKESAEIVAKLVG  923

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE GNMSREMFELNFV+P+D+R WF GW+QI+DLLH+
Sbjct  924  FCEGGNMSREMFELNFVLPSDRRPWFAGWNQISDLLHI  961



>ref|XP_011072914.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
 ref|XP_011072915.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=961

 Score =   369 bits (948),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/218 (77%), Positives = 195/218 (89%), Gaps = 2/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQE-SPASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELEANE AGY LE+ EN    QE SPASWH+TFR+Q QQ+I+LWD+C VSIIHR+QF
Sbjct  744  QVLELEANEEAGYDLEDAENAAGAQEESPASWHVTFRDQRQQLIELWDICHVSIIHRTQF  803

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLFKGD ADQIY+EVE+RRLTWLQQHL E+GNASPA  GNEP +SLSSS++AL+RE+EF
Sbjct  804  YLLFKGDPADQIYVEVELRRLTWLQQHLTEMGNASPAPGGNEPAISLSSSVRALKREREF  863

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKRL +RLTPEERDALYIKWEVPL+GK RR+ F+NKLWT P D KH+QESAEIVAKLVG
Sbjct  864  LAKRLSSRLTPEERDALYIKWEVPLDGKQRRIQFVNKLWTNPHDEKHIQESAEIVAKLVG  923

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE GNMS+EMFELNFV+P+D+R WF+GW+QI+DLLHL
Sbjct  924  FCEGGNMSKEMFELNFVLPSDRRHWFVGWNQISDLLHL  961



>emb|CDO98410.1| unnamed protein product [Coffea canephora]
Length=954

 Score =   369 bits (948),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 192/217 (88%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQE-SPASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELEANEAAGY LEN+E IP IQE SPASW   FREQ QQII+LWDVC VSIIHR+QF
Sbjct  738  QVLELEANEAAGYDLENDEGIPPIQEESPASWQAIFREQRQQIIELWDVCHVSIIHRTQF  797

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLFKGD ADQIY+EVE+RRLTWLQQHLAELGNASPA  GNEPT+SLSSSI+AL+RE+EF
Sbjct  798  YLLFKGDPADQIYLEVELRRLTWLQQHLAELGNASPAHTGNEPTISLSSSIRALKREREF  857

Query  549  LAKRLTRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            LAKRL RL  EERDALYIKW+VPLEG+ RR+ FINKLW  P D  HV+ESA+IVAKLVG 
Sbjct  858  LAKRLKRLPEEERDALYIKWDVPLEGQQRRIQFINKLWRNPHDEMHVKESADIVAKLVGL  917

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESGNMS+EMFELNFV+P+DKR W +GW+QI+DLLHL
Sbjct  918  CESGNMSKEMFELNFVLPSDKRPWIVGWNQISDLLHL  954



>ref|XP_008356658.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
 ref|XP_008356659.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
Length=974

 Score =   369 bits (946),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 198/217 (91%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGY LEN+ENI E +E   SW ITF+EQ QQII+LWD+CFVSIIHR+QFY
Sbjct  758  QVLELEANEAAGYNLENDENICETEEPQVSWQITFKEQRQQIIELWDLCFVSIIHRTQFY  817

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELGNASPAQ+G+EPTVSLSSS++AL+RE+EFL
Sbjct  818  LLFKGDPADQIYVEVELRRLTWLQQHLAELGNASPAQVGDEPTVSLSSSMRALKREREFL  877

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRL +RL  EERDALY+KW+VPLEGK R+L F+NKLW  P DP+H+QESAEIVAKLVGF
Sbjct  878  AKRLSSRLMAEERDALYMKWDVPLEGKQRKLQFVNKLWQDPHDPRHIQESAEIVAKLVGF  937

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESGN+SREMFELNFV+P+D+R W +GW+QI++LL+L
Sbjct  938  CESGNLSREMFELNFVLPSDRRPWMMGWNQISNLLNL  974



>ref|XP_009347467.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=974

 Score =   369 bits (946),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 199/217 (92%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGY LEN+ENI E +E   SW ITF+EQ QQII+LWD+CFVSIIHR+QFY
Sbjct  758  QVLELEANEAAGYNLENDENICETEEPQVSWQITFKEQRQQIIELWDLCFVSIIHRTQFY  817

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELGNASPAQ+G+EPTVSLSSS++AL+RE+EFL
Sbjct  818  LLFKGDPADQIYVEVELRRLTWLQQHLAELGNASPAQVGDEPTVSLSSSMRALKREREFL  877

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRL +RLT EERDALY+KW+VPLEGK R+L F+NKLW  P DP+H+QESAEIVAKLVGF
Sbjct  878  AKRLSSRLTAEERDALYMKWDVPLEGKQRKLQFVNKLWQDPHDPRHIQESAEIVAKLVGF  937

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG++SREMFELNFV+P+D+R W +GW+QI++LL+L
Sbjct  938  CESGHLSREMFELNFVLPSDRRPWMMGWNQISNLLNL  974



>ref|XP_008240232.1| PREDICTED: kinesin-like protein NACK1 [Prunus mume]
Length=976

 Score =   363 bits (933),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 195/217 (90%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGY +EN+EN  E +E   SW ITF+EQ QQII+LWD+CFVSIIHR+QFY
Sbjct  760  QVLELEANEAAGYDIENDENTCEPEEPMVSWQITFKEQRQQIIELWDLCFVSIIHRTQFY  819

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWLQ HLAELGN+SPA +G+EPTVSLSSSI+AL+RE+EFL
Sbjct  820  LLFKGDPADQIYVEVELRRLTWLQHHLAELGNSSPAHVGDEPTVSLSSSIRALKREREFL  879

Query  546  AKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRLT RLT EERDALY+KW+VPLEGK R++ F+NKLWT P D KHVQESAEIVAKLVGF
Sbjct  880  AKRLTSRLTVEERDALYMKWDVPLEGKQRKMQFVNKLWTDPHDAKHVQESAEIVAKLVGF  939

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESGNMS+EMFELNFV+P+DKRSW  GW+ I++LL+L
Sbjct  940  CESGNMSKEMFELNFVLPSDKRSWITGWNPISNLLNL  976



>ref|XP_007210400.1| hypothetical protein PRUPE_ppa000865mg [Prunus persica]
 gb|EMJ11599.1| hypothetical protein PRUPE_ppa000865mg [Prunus persica]
Length=976

 Score =   363 bits (933),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 196/217 (90%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGY +EN+EN  E +E   SW ITF+EQ QQII+LWD+CFVSIIHR+QFY
Sbjct  760  QVLELEANEAAGYDIENDENTCEPEEPMVSWQITFKEQRQQIIELWDLCFVSIIHRTQFY  819

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWLQ HLAELG+ASPA +G+EPTVSLSSSI+AL+RE+EFL
Sbjct  820  LLFKGDPADQIYVEVELRRLTWLQHHLAELGSASPAHVGDEPTVSLSSSIRALKREREFL  879

Query  546  AKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRLT RLT EERDALY+KW+VPLEGK R++ F+NKLWT P D KH+QESAEIVAKLVGF
Sbjct  880  AKRLTSRLTAEERDALYMKWDVPLEGKQRKMQFVNKLWTDPHDAKHIQESAEIVAKLVGF  939

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESGNMS+EMFELNFV+P+DKRSW +GW+ I++LL+L
Sbjct  940  CESGNMSKEMFELNFVLPSDKRSWIMGWNPISNLLNL  976



>gb|EYU21085.1| hypothetical protein MIMGU_mgv1a000841mg [Erythranthe guttata]
Length=966

 Score =   362 bits (930),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 195/221 (88%), Gaps = 5/221 (2%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQE--SPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELEANEAAG+ LE + N   IQE  SPA WH++F EQ QQII+LWDVC VSIIHRSQ
Sbjct  746  QVLELEANEAAGHNLEGDMNDCVIQEEESPAQWHVSFMEQRQQIIELWDVCHVSIIHRSQ  805

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPA--QLGNEPTVSLSSSIKALRRE  559
            FYLLFKGD+ADQIY+EVE+RRL WLQQHL E+GNASPA   +GNEPT+SLSSSI+AL+RE
Sbjct  806  FYLLFKGDTADQIYVEVELRRLAWLQQHLVEIGNASPAPSHMGNEPTISLSSSIRALKRE  865

Query  558  KEFLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAK  382
            +EFLAKRL TR+T EERDALY+KWEVPLEGK RR+ F+NKLWT P D +HV+ESAEIVAK
Sbjct  866  REFLAKRLSTRMTAEERDALYMKWEVPLEGKQRRMQFMNKLWTNPHDERHVRESAEIVAK  925

Query  381  LVGFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            LVGFCE GNMS+EMFELNFV+P+DKR WF+GW+QI+DLLHL
Sbjct  926  LVGFCEGGNMSKEMFELNFVLPSDKRHWFVGWNQISDLLHL  966



>ref|XP_008393328.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
Length=974

 Score =   360 bits (925),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 197/217 (91%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGY LEN+E+  E +E   SW ITF+EQ QQII+LWD+CFVSIIHR+QFY
Sbjct  758  QVLELEANEAAGYNLENDEDTCETEEPQVSWQITFKEQRQQIIELWDLCFVSIIHRTQFY  817

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELG+ASPA +G+EP VSLSSS++AL+RE+EFL
Sbjct  818  LLFKGDPADQIYMEVELRRLTWLQQHLAELGDASPAHVGDEPRVSLSSSMRALKREREFL  877

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRL +RLT EERDALY+KW+VPLEGK+R+L F+NKLW  P DP+H+QESAE+VAKLVGF
Sbjct  878  AKRLSSRLTAEERDALYMKWDVPLEGKHRKLQFVNKLWQDPHDPRHIQESAEVVAKLVGF  937

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESGN+SREMFELNFV+P+D+R W +GW+QI++LL+L
Sbjct  938  CESGNLSREMFELNFVLPSDRRPWMMGWNQISNLLNL  974



>gb|KDP35186.1| hypothetical protein JCGZ_10720 [Jatropha curcas]
Length=963

 Score =   359 bits (922),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 190/217 (88%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGY +E+EENI E  E   SW +TFREQ QQII+LWDVC+VSIIHR+QFY
Sbjct  747  QVLELEANEAAGYNIEDEENINEPAEPQVSWQVTFREQRQQIIELWDVCYVSIIHRTQFY  806

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWLQ HLAE+GN SPA+ G+EPT+SLSS I+ALRRE+EFL
Sbjct  807  LLFKGDPADQIYMEVELRRLTWLQDHLAEIGNTSPARAGDEPTISLSSCIRALRREREFL  866

Query  546  AKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRLT RLT EERDALY+KW+VPLEGK R+L F+NKLWT P D +HVQESAEIVAKLVGF
Sbjct  867  AKRLTSRLTVEERDALYMKWDVPLEGKQRKLQFVNKLWTNPNDARHVQESAEIVAKLVGF  926

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CE GNMS+EMFELNF +P DKR W +GW+ I++LLHL
Sbjct  927  CEGGNMSKEMFELNFALPTDKRPWIMGWNPISNLLHL  963



>ref|XP_009360131.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=974

 Score =   359 bits (922),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 197/217 (91%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGY LEN+E+  E +E   SW ITF+EQ QQII+LWD+CFVSIIHR+QFY
Sbjct  758  QVLELEANEAAGYNLENDEDTCETEEPQVSWQITFKEQRQQIIELWDLCFVSIIHRTQFY  817

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELG+ASPA +G+EP VSLSSS++AL+RE+EFL
Sbjct  818  LLFKGDPADQIYVEVELRRLTWLQQHLAELGDASPAHVGDEPRVSLSSSMRALKREREFL  877

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRL +RLT EER+ALY+KW+VPLEGK+R+L F+NKLW  P DP+H+QESAEIVAKLVGF
Sbjct  878  AKRLSSRLTAEEREALYMKWDVPLEGKHRKLQFVNKLWQDPHDPRHIQESAEIVAKLVGF  937

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESGN+SREMFELNFV+P+D+R W +GW+QI++LL+L
Sbjct  938  CESGNLSREMFELNFVLPSDRRPWMMGWNQISNLLNL  974



>ref|XP_006477781.1| PREDICTED: kinesin-like protein NACK1-like [Citrus sinensis]
Length=962

 Score =   358 bits (918),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 193/216 (89%), Gaps = 2/216 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLE+EANEAAGY +EN+E I E +E   +WHITFREQ QQII+LWDVCFVSIIHR+QFY
Sbjct  746  QVLEMEANEAAGYNMENDETIVETEEPEVAWHITFREQRQQIIELWDVCFVSIIHRTQFY  805

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQL-GNEPTVSLSSSIKALRREKEF  550
            LLFKGD ADQIY+EVE+RRLTWLQQHL+ELGNASP  + G EPT+SLSSSI+AL+RE+EF
Sbjct  806  LLFKGDPADQIYMEVELRRLTWLQQHLSELGNASPLPVAGGEPTISLSSSIRALKREREF  865

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKRL +RLT EERD+LYIKW+VPL+GK+RRL F++KLWT P DP+H+QESAEIVAKLVG
Sbjct  866  LAKRLSSRLTAEERDSLYIKWDVPLDGKHRRLQFVSKLWTDPHDPRHIQESAEIVAKLVG  925

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLL  265
            FCE GNMS+EMFELNF IP DKR W +GW+QI++LL
Sbjct  926  FCEGGNMSKEMFELNFAIPADKRPWMMGWNQISNLL  961



>ref|XP_006442593.1| hypothetical protein CICLE_v10018724mg [Citrus clementina]
 gb|ESR55833.1| hypothetical protein CICLE_v10018724mg [Citrus clementina]
Length=962

 Score =   357 bits (916),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 193/216 (89%), Gaps = 2/216 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLE+EANEAAGY +EN+ENI E +E   +WHITFREQ QQII+LWDVCFVSIIHR+QFY
Sbjct  746  QVLEMEANEAAGYNMENDENIVETEEPEVAWHITFREQRQQIIELWDVCFVSIIHRTQFY  805

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQL-GNEPTVSLSSSIKALRREKEF  550
            LLFKGD ADQIY+EVE+RRLTWLQQHL+ELGNASP  + G EPT+SLSSSI+AL+RE+EF
Sbjct  806  LLFKGDPADQIYMEVELRRLTWLQQHLSELGNASPLPVAGGEPTISLSSSIRALKREREF  865

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKRL +RLT EERD+LYIKW+V L+GK+RRL F++KLWT P DP+HVQESAEIVAKLVG
Sbjct  866  LAKRLSSRLTAEERDSLYIKWDVQLDGKHRRLQFVSKLWTDPHDPRHVQESAEIVAKLVG  925

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLL  265
            FCE GNMS+EMFELNF IP DKR W +GW+QI++LL
Sbjct  926  FCEGGNMSKEMFELNFAIPADKRPWMMGWNQISNLL  961



>gb|KDO49802.1| hypothetical protein CISIN_1g002128mg [Citrus sinensis]
Length=962

 Score =   354 bits (909),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 192/216 (89%), Gaps = 2/216 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLE+EANEAAGY +EN+E I E +E   +WHITFREQ QQII+LWDVCFVSIIHR+QFY
Sbjct  746  QVLEMEANEAAGYNMENDETIVETEEPEVAWHITFREQRQQIIELWDVCFVSIIHRTQFY  805

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQL-GNEPTVSLSSSIKALRREKEF  550
            LLFKGD ADQIY+EVE+RRLTWLQQHL+ELGNASP  + G EPT+SLSSSI+AL+RE+EF
Sbjct  806  LLFKGDPADQIYMEVELRRLTWLQQHLSELGNASPLPVAGGEPTISLSSSIRALKREREF  865

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKRL +RLT EERD+LYIKW+V L+GK+RRL F++KLWT P DP+HVQESAEIVAKLVG
Sbjct  866  LAKRLSSRLTAEERDSLYIKWDVQLDGKHRRLQFVSKLWTDPHDPRHVQESAEIVAKLVG  925

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLL  265
            FCE GNMS+EMFELNF IP DKR W +GW+QI++LL
Sbjct  926  FCEGGNMSKEMFELNFAIPADKRPWMMGWNQISNLL  961



>ref|XP_011045827.1| PREDICTED: kinesin-like protein NACK1 isoform X3 [Populus euphratica]
Length=813

 Score =   349 bits (896),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 191/217 (88%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGYT+E EENI E ++   SWH+TFREQ Q II+LWD+C+VSIIHR+QFY
Sbjct  597  QVLELEANEAAGYTIEEEENINEPEQPQVSWHVTFREQRQLIIELWDMCYVSIIHRTQFY  656

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELGNASPA  G+EPT+SLSSSI+AL+REKEFL
Sbjct  657  LLFKGDPADQIYMEVELRRLTWLQQHLAELGNASPAHFGDEPTISLSSSIRALKREKEFL  716

Query  546  AKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRLT RLT EERD LYIKW VPL+GK RRL F+NKLWT P D KH+QESA+IVAKLVGF
Sbjct  717  AKRLTSRLTAEERDELYIKWNVPLDGKQRRLQFVNKLWTDPHDAKHIQESADIVAKLVGF  776

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CE GN+S+EMFELNF +P DKR W  GW+QI++LLHL
Sbjct  777  CEVGNLSKEMFELNFALPTDKRPWMTGWNQISNLLHL  813



>gb|KHG01962.1| Kinesin-related 4 [Gossypium arboreum]
Length=963

 Score =   351 bits (901),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 193/217 (89%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGY LE+ E+  E +E   +WH+TF+EQ +QII+LWDVC+VSIIHR+QFY
Sbjct  747  QVLELEANEAAGYNLEDNESEIEPEEPQVAWHVTFKEQRRQIIELWDVCYVSIIHRTQFY  806

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRL WLQQH AELGNASPA  G+EPTVSLSSSI+AL+RE+EFL
Sbjct  807  LLFKGDPADQIYMEVELRRLNWLQQHFAELGNASPAITGDEPTVSLSSSIRALKREREFL  866

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRL TRLT +ERDALYIKW VPL+GK+RRL FINKLWT P DPKH++ESA+IVAKLVGF
Sbjct  867  AKRLTTRLTFDERDALYIKWNVPLDGKHRRLQFINKLWTDPHDPKHIEESAQIVAKLVGF  926

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESGN+S+EMFELNF +P DK+ W +GW+QI++LL+L
Sbjct  927  CESGNLSKEMFELNFALPADKKPWMVGWNQISNLLNL  963



>ref|XP_011045826.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Populus euphratica]
Length=925

 Score =   349 bits (895),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 191/217 (88%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGYT+E EENI E ++   SWH+TFREQ Q II+LWD+C+VSIIHR+QFY
Sbjct  709  QVLELEANEAAGYTIEEEENINEPEQPQVSWHVTFREQRQLIIELWDMCYVSIIHRTQFY  768

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELGNASPA  G+EPT+SLSSSI+AL+REKEFL
Sbjct  769  LLFKGDPADQIYMEVELRRLTWLQQHLAELGNASPAHFGDEPTISLSSSIRALKREKEFL  828

Query  546  AKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRLT RLT EERD LYIKW VPL+GK RRL F+NKLWT P D KH+QESA+IVAKLVGF
Sbjct  829  AKRLTSRLTAEERDELYIKWNVPLDGKQRRLQFVNKLWTDPHDAKHIQESADIVAKLVGF  888

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CE GN+S+EMFELNF +P DKR W  GW+QI++LLHL
Sbjct  889  CEVGNLSKEMFELNFALPTDKRPWMTGWNQISNLLHL  925



>ref|XP_010110084.1| Kinesin-related protein 4 [Morus notabilis]
 gb|EXC25171.1| Kinesin-related protein 4 [Morus notabilis]
Length=963

 Score =   350 bits (897),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 189/217 (87%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANE AGY L+N+EN  E ++   SW ++F+EQ QQII+LWD CFVSIIHR+QFY
Sbjct  747  QVLELEANEEAGYDLDNDENACEPEKPQVSWQVSFKEQRQQIIELWDFCFVSIIHRTQFY  806

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWLQQHL ++GNASPA +G+EPT+SLSSSI+ALRRE+EFL
Sbjct  807  LLFKGDPADQIYMEVEMRRLTWLQQHLVQIGNASPAHVGDEPTISLSSSIRALRREREFL  866

Query  546  AKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRLT RLT EERD LY+KW+VPLEGK R++ F+NKLWT P D +HVQESAEIVAKLVGF
Sbjct  867  AKRLTSRLTAEERDVLYMKWDVPLEGKQRKIQFVNKLWTNPHDARHVQESAEIVAKLVGF  926

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CE GNMSREMFELNF  P+DKR W  GW+QI++LL+L
Sbjct  927  CEGGNMSREMFELNFSHPSDKRPWIAGWNQISNLLNL  963



>emb|CBI15491.3| unnamed protein product [Vitis vinifera]
Length=849

 Score =   346 bits (888),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 190/217 (88%), Gaps = 2/217 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLE+EANEAAGY LE E      +    SWH+TFREQ QQII+LWD+CFVSIIHR+QFY
Sbjct  634  QVLEMEANEAAGYNLEEENTAEPEEPP-VSWHVTFREQRQQIIELWDLCFVSIIHRTQFY  692

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELGNASPA++G+EPT+SLSSSI+AL+REKEFL
Sbjct  693  LLFKGDPADQIYMEVELRRLTWLQQHLAELGNASPARVGDEPTISLSSSIRALKREKEFL  752

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRL TRLT EER+ LY+KW+VPLEGK R++ F+NKLWT P D KHVQESAE+VAKLVGF
Sbjct  753  AKRLTTRLTLEERELLYLKWDVPLEGKQRKMQFVNKLWTDPHDAKHVQESAEVVAKLVGF  812

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CES NMS+EMFELNFV+P DKR W  GW+QI++LLHL
Sbjct  813  CESSNMSKEMFELNFVLPADKRPWVTGWNQISNLLHL  849



>ref|XP_011045825.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Populus euphratica]
Length=964

 Score =   348 bits (894),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 191/217 (88%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGYT+E EENI E ++   SWH+TFREQ Q II+LWD+C+VSIIHR+QFY
Sbjct  748  QVLELEANEAAGYTIEEEENINEPEQPQVSWHVTFREQRQLIIELWDMCYVSIIHRTQFY  807

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELGNASPA  G+EPT+SLSSSI+AL+REKEFL
Sbjct  808  LLFKGDPADQIYMEVELRRLTWLQQHLAELGNASPAHFGDEPTISLSSSIRALKREKEFL  867

Query  546  AKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRLT RLT EERD LYIKW VPL+GK RRL F+NKLWT P D KH+QESA+IVAKLVGF
Sbjct  868  AKRLTSRLTAEERDELYIKWNVPLDGKQRRLQFVNKLWTDPHDAKHIQESADIVAKLVGF  927

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CE GN+S+EMFELNF +P DKR W  GW+QI++LLHL
Sbjct  928  CEVGNLSKEMFELNFALPTDKRPWMTGWNQISNLLHL  964



>ref|XP_008460891.1| PREDICTED: kinesin-like protein NACK1 [Cucumis melo]
Length=960

 Score =   348 bits (893),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 188/217 (87%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAG  L+ +EN  +  +    WH+TFREQ QQII+LWDVC+VSIIHRSQFY
Sbjct  744  QVLELEANEAAGNKLDCDENTFDQDDDQVPWHLTFREQRQQIIELWDVCYVSIIHRSQFY  803

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWL  HLAE GNASPA +G+EPT+S SSS++ALRRE+EFL
Sbjct  804  LLFKGDEADQIYLEVEMRRLTWLHDHLAEFGNASPAHVGDEPTISRSSSMRALRREREFL  863

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRL TRLT EERDALYIKWEVPLEGK R++ F+NKLWT P DPKH+Q+SAEIVAKLVGF
Sbjct  864  AKRLTTRLTAEERDALYIKWEVPLEGKQRKIQFVNKLWTNPHDPKHIQDSAEIVAKLVGF  923

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
             E GNMSREMFELNFV+P+DKR W +GW+ I++LL+L
Sbjct  924  REGGNMSREMFELNFVVPSDKRPWIMGWNPISNLLNL  960



>ref|XP_002279228.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010663629.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
Length=962

 Score =   348 bits (892),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 190/217 (88%), Gaps = 2/217 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLE+EANEAAGY LE E      +    SWH+TFREQ QQII+LWD+CFVSIIHR+QFY
Sbjct  747  QVLEMEANEAAGYNLEEENTAEPEEPP-VSWHVTFREQRQQIIELWDLCFVSIIHRTQFY  805

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELGNASPA++G+EPT+SLSSSI+AL+REKEFL
Sbjct  806  LLFKGDPADQIYMEVELRRLTWLQQHLAELGNASPARVGDEPTISLSSSIRALKREKEFL  865

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRL TRLT EER+ LY+KW+VPLEGK R++ F+NKLWT P D KHVQESAE+VAKLVGF
Sbjct  866  AKRLTTRLTLEERELLYLKWDVPLEGKQRKMQFVNKLWTDPHDAKHVQESAEVVAKLVGF  925

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CES NMS+EMFELNFV+P DKR W  GW+QI++LLHL
Sbjct  926  CESSNMSKEMFELNFVLPADKRPWVTGWNQISNLLHL  962



>ref|XP_002318539.1| hypothetical protein POPTR_0012s05060g [Populus trichocarpa]
 gb|EEE96759.1| hypothetical protein POPTR_0012s05060g [Populus trichocarpa]
Length=964

 Score =   347 bits (891),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 190/217 (88%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGYT+E EENI E ++   SWH+TFREQ Q II+LWD+C+VSIIHR+QFY
Sbjct  748  QVLELEANEAAGYTIEEEENINEPEQPQVSWHVTFREQRQLIIELWDMCYVSIIHRTQFY  807

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELGNASPA  G+EPT+SLSSSI+AL+REKEFL
Sbjct  808  LLFKGDPADQIYMEVELRRLTWLQQHLAELGNASPAHFGDEPTISLSSSIRALKREKEFL  867

Query  546  AKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRLT RLT EERD LYIKW VPL+GK RRL F+NKLWT P D KH+QESA+IVAKLVGF
Sbjct  868  AKRLTSRLTAEERDELYIKWNVPLDGKQRRLQFVNKLWTDPHDAKHIQESADIVAKLVGF  927

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CE G MS+EMFELNF +P DKR W  GW+QI+++LHL
Sbjct  928  CEGGKMSKEMFELNFALPTDKRPWITGWNQISNILHL  964



>ref|XP_004166306.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101229623 
[Cucumis sativus]
Length=960

 Score =   347 bits (890),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 187/217 (86%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAG  L+ +EN  +  +    WH+TFREQ QQII+LWD C+VSIIHRSQFY
Sbjct  744  QVLELEANEAAGNKLDCDENTFDQDDDQVPWHLTFREQRQQIIELWDACYVSIIHRSQFY  803

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWL  HLAE GNASPA +G+EPT+S SSS++ALRRE+EFL
Sbjct  804  LLFKGDEADQIYLEVEMRRLTWLHDHLAEFGNASPAHVGDEPTISRSSSMRALRREREFL  863

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRL TRLT EERDALYIKWEVPLEGK R++ F+NKLWT P DPKH+Q+SAEIVAKLVGF
Sbjct  864  AKRLTTRLTAEERDALYIKWEVPLEGKQRKIQFVNKLWTNPHDPKHIQDSAEIVAKLVGF  923

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
             E GNMSREMFELNFV+P+DKR W +GW+ I++LL+L
Sbjct  924  REGGNMSREMFELNFVVPSDKRPWIMGWNPISNLLNL  960



>gb|KGN64145.1| hypothetical protein Csa_1G042550 [Cucumis sativus]
Length=960

 Score =   347 bits (889),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 187/217 (86%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAG  L+ +EN  +  +    WH+TFREQ QQII+LWD C+VSIIHRSQFY
Sbjct  744  QVLELEANEAAGNKLDCDENTFDQDDDQVPWHLTFREQRQQIIELWDACYVSIIHRSQFY  803

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWL  HLAE GNASPA +G+EPT+S SSS++ALRRE+EFL
Sbjct  804  LLFKGDEADQIYLEVEMRRLTWLHDHLAEFGNASPAHVGDEPTISRSSSMRALRREREFL  863

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRL TRLT EERDALYIKWEVPLEGK R++ F+NKLWT P DPKH+Q+SAEIVAKLVGF
Sbjct  864  AKRLTTRLTAEERDALYIKWEVPLEGKQRKIQFVNKLWTNPHDPKHIQDSAEIVAKLVGF  923

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
             E GNMSREMFELNFV+P+DKR W +GW+ I++LL+L
Sbjct  924  REGGNMSREMFELNFVVPSDKRPWIMGWNPISNLLNL  960



>ref|XP_004137483.1| PREDICTED: uncharacterized protein LOC101215425 [Cucumis sativus]
Length=960

 Score =   343 bits (881),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 185/217 (85%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAG  L+ +EN  +  +    WH+TFREQ QQII+LWD C+VSIIHRSQFY
Sbjct  744  QVLELEANEAAGNKLDCDENTFDQDDDQVPWHLTFREQRQQIIELWDACYVSIIHRSQFY  803

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWL  HLAE GNASPA +G+EPT+S SSS  ALRRE+EFL
Sbjct  804  LLFKGDEADQIYLEVEMRRLTWLHDHLAEFGNASPAHVGDEPTISRSSSFFALRREREFL  863

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRL TRLT EERDALYIKWEVPLEGK R++ F+NKLWT P DPKH+Q+SAEIVAKLVGF
Sbjct  864  AKRLTTRLTAEERDALYIKWEVPLEGKQRKIQFVNKLWTNPHDPKHIQDSAEIVAKLVGF  923

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
             E GNMSREMFELNFV+P+DKR W +GW+ I++LL+L
Sbjct  924  REGGNMSREMFELNFVVPSDKRPWIMGWNPISNLLNL  960



>ref|XP_004300503.1| PREDICTED: uncharacterized protein LOC101315243 [Fragaria vesca 
subsp. vesca]
Length=978

 Score =   343 bits (879),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 191/218 (88%), Gaps = 2/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGY +EN+E   E +E    W ITF++Q QQII+LWD+C+VSIIHR+QFY
Sbjct  761  QVLELEANEAAGYDMENDEITCEQEEPQIPWQITFKDQRQQIIELWDLCYVSIIHRTQFY  820

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPA-QLGNEPTVSLSSSIKALRREKEF  550
            +LFKGD ADQIY+EVE+RRLTWLQ+HLAELGNASPA  +G+EPTVSLSSSI+AL+RE+EF
Sbjct  821  MLFKGDPADQIYVEVELRRLTWLQEHLAELGNASPAPHVGDEPTVSLSSSIRALKREREF  880

Query  549  LAKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKR+T RL+ EERDALYIKW+VPLEGK RR+ F+NKLW  P D KH+QESAEIVAKLVG
Sbjct  881  LAKRVTSRLSAEERDALYIKWDVPLEGKQRRMQFVNKLWIDPHDAKHIQESAEIVAKLVG  940

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCESGNM +EMFELNF +P+D+R W +GW+ I++LL+L
Sbjct  941  FCESGNMPKEMFELNFALPSDRRPWIMGWNPISNLLNL  978



>ref|XP_006303901.1| hypothetical protein CARUB_v10008207mg [Capsella rubella]
 gb|EOA36799.1| hypothetical protein CARUB_v10008207mg [Capsella rubella]
Length=978

 Score =   341 bits (875),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 192/219 (88%), Gaps = 3/219 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEEN--IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELEAN+ AGY++ENEEN  + + ++S  +WHITF E+ QQII+LW VC VSIIHR+Q
Sbjct  760  QVLELEANDGAGYSVENEENTIMEDEEQSQVAWHITFIEERQQIIELWHVCHVSIIHRTQ  819

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            FYLLFKGD ADQIY+EVE+RRLTWL+QHLAE+GNA+PA+  +E  VSLSSSIKALRRE+E
Sbjct  820  FYLLFKGDQADQIYMEVELRRLTWLEQHLAEVGNATPARNCDESIVSLSSSIKALRRERE  879

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLAKR+ +RLTPEER+ LY+KW+VPLEGK R+L F+NKLWT P D +HVQESAEIVAKLV
Sbjct  880  FLAKRVNSRLTPEEREELYMKWDVPLEGKQRKLQFVNKLWTDPYDSRHVQESAEIVAKLV  939

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            GFCESGN+S+EMFELNF +P+DKR W IGWD I++LLHL
Sbjct  940  GFCESGNISKEMFELNFAVPSDKRQWNIGWDNISNLLHL  978



>ref|XP_002893000.1| hypothetical protein ARALYDRAFT_472057 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69259.1| hypothetical protein ARALYDRAFT_472057 [Arabidopsis lyrata subsp. 
lyrata]
Length=974

 Score =   340 bits (873),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 192/219 (88%), Gaps = 3/219 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEEN--IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELEAN+ AGY++ENEEN  + + ++S  +WHITF E+ QQII+LW VC VSIIHR+Q
Sbjct  756  QVLELEANDGAGYSVENEENTIMEDEEQSQVAWHITFIEERQQIIELWHVCHVSIIHRTQ  815

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            FYLLFKGD ADQIY+EVE+RRLTWL+QHLAE+GNA+PA+  +E  VSLSSSIKALRRE+E
Sbjct  816  FYLLFKGDQADQIYMEVELRRLTWLEQHLAEVGNATPARNCDESVVSLSSSIKALRRERE  875

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLAKR+ +RLTPEER+ LY+KW+VPLEGK R+L F+NKLWT P D +HVQESAEIVAKLV
Sbjct  876  FLAKRVNSRLTPEEREELYMKWDVPLEGKQRKLQFVNKLWTDPYDSRHVQESAEIVAKLV  935

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            GFCESGN+S+EMFELNF +P+D+R W IGWD I++LLHL
Sbjct  936  GFCESGNISKEMFELNFAVPSDRRQWNIGWDNISNLLHL  974



>ref|XP_010279346.1| PREDICTED: kinesin-like protein NACK1 [Nelumbo nucifera]
Length=964

 Score =   340 bits (872),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 186/217 (86%), Gaps = 2/217 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGY LEN+E   E QE    W++TF E  QQII+LWD+C VSIIHR+QFY
Sbjct  749  QVLELEANEAAGYDLENDEGATE-QEPTIPWNVTFCEWRQQIIELWDLCHVSIIHRTQFY  807

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELGNASPA LG+EPT+SLSSSI+AL+RE+EFL
Sbjct  808  LLFKGDPADQIYMEVELRRLTWLQQHLAELGNASPAHLGDEPTISLSSSIRALKREREFL  867

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRL TRLT EERD LYIKW+V L+GK R+  F+NKLWT P D KH+QESAEIVAKLVGF
Sbjct  868  AKRLMTRLTAEERDVLYIKWDVALDGKQRKHQFVNKLWTNPHDVKHIQESAEIVAKLVGF  927

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CE GN+S+EMFELNF +P DKR W +GW+ I++LLHL
Sbjct  928  CEGGNVSKEMFELNFALPADKRPWILGWNPISNLLHL  964



>ref|NP_173273.2| kinesin HINKEL [Arabidopsis thaliana]
 sp|Q8S905.1|NACK1_ARATH RecName: Full=Kinesin-like protein NACK1; Short=AtNACK1; AltName: 
Full=NPK1-activating kinesin-1; AltName: Full=Protein HINKEL 
[Arabidopsis thaliana]
 dbj|BAB88748.1| AtNACK1 kinesin-like protein [Arabidopsis thaliana]
 gb|AEE29708.1| kinesin HINKEL [Arabidopsis thaliana]
Length=974

 Score =   340 bits (872),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 192/219 (88%), Gaps = 3/219 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEEN--IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELEAN+ AGY++ENEEN  + + +++  +WHITF E+ QQII+LW VC VSIIHR+Q
Sbjct  756  QVLELEANDGAGYSVENEENTIMEDEEQNQVAWHITFIEERQQIIELWHVCHVSIIHRTQ  815

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            FYLLFKGD ADQIY+EVE+RRLTWL+QHLAE+GNA+PA+  +E  VSLSSSIKALRRE+E
Sbjct  816  FYLLFKGDQADQIYMEVELRRLTWLEQHLAEVGNATPARNCDESVVSLSSSIKALRRERE  875

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLAKR+ +RLTPEER+ LY+KW+VPLEGK R+L F+NKLWT P D +HVQESAEIVAKLV
Sbjct  876  FLAKRVNSRLTPEEREELYMKWDVPLEGKQRKLQFVNKLWTDPYDSRHVQESAEIVAKLV  935

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            GFCESGN+S+EMFELNF +P+DKR W IGWD I++LLHL
Sbjct  936  GFCESGNISKEMFELNFAVPSDKRQWNIGWDNISNLLHL  974



>ref|XP_010459448.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=981

 Score =   340 bits (871),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 191/219 (87%), Gaps = 3/219 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEEN--IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELEAN+ AGY++ENEEN  + + +++  +WHITF E+ QQII+LW VC VSIIHR+Q
Sbjct  763  QVLELEANDGAGYSVENEENTMMEDEEQNQVAWHITFIEERQQIIELWHVCHVSIIHRTQ  822

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            FYLLFKGD ADQIY+EVE+RRLTWL+QHLAE+GNA+PA+  +E  VSLSSSIKALRRE+E
Sbjct  823  FYLLFKGDQADQIYMEVELRRLTWLEQHLAEVGNATPARNCDESIVSLSSSIKALRRERE  882

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLAKR+ +RLTPEER+ LY KW+VPLEGK R+L F+NKLWT P D +HVQESAEIVAKLV
Sbjct  883  FLAKRVNSRLTPEEREELYTKWDVPLEGKQRKLQFVNKLWTDPYDSRHVQESAEIVAKLV  942

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            GFCESGN+S+EMFELNF +P+DKR W IGWD I++LLHL
Sbjct  943  GFCESGNISKEMFELNFAVPSDKRQWNIGWDNISNLLHL  981



>gb|AAF25984.1|AC013354_3 F15H18.12 [Arabidopsis thaliana]
Length=1003

 Score =   340 bits (871),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 192/219 (88%), Gaps = 3/219 (1%)
 Frame = -2

Query  906   QVLELEANEAAGYTLENEEN--IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
             QVLELEAN+ AGY++ENEEN  + + +++  +WHITF E+ QQII+LW VC VSIIHR+Q
Sbjct  785   QVLELEANDGAGYSVENEENTIMEDEEQNQVAWHITFIEERQQIIELWHVCHVSIIHRTQ  844

Query  732   FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
             FYLLFKGD ADQIY+EVE+RRLTWL+QHLAE+GNA+PA+  +E  VSLSSSIKALRRE+E
Sbjct  845   FYLLFKGDQADQIYMEVELRRLTWLEQHLAEVGNATPARNCDESVVSLSSSIKALRRERE  904

Query  552   FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
             FLAKR+ +RLTPEER+ LY+KW+VPLEGK R+L F+NKLWT P D +HVQESAEIVAKLV
Sbjct  905   FLAKRVNSRLTPEEREELYMKWDVPLEGKQRKLQFVNKLWTDPYDSRHVQESAEIVAKLV  964

Query  375   GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
             GFCESGN+S+EMFELNF +P+DKR W IGWD I++LLHL
Sbjct  965   GFCESGNISKEMFELNFAVPSDKRQWNIGWDNISNLLHL  1003



>ref|XP_010036903.1| PREDICTED: kinesin-like protein NACK1 [Eucalyptus grandis]
 ref|XP_010036904.1| PREDICTED: kinesin-like protein NACK1 [Eucalyptus grandis]
 gb|KCW48561.1| hypothetical protein EUGRSUZ_K02233 [Eucalyptus grandis]
Length=976

 Score =   338 bits (867),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 188/217 (87%), Gaps = 2/217 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAG+ L+ ++N  E  +    W +TF+EQ QQII+LWDVCFVSIIHR+QFY
Sbjct  761  QVLELEANEAAGHDLQ-DDNTNEPDQPQVPWSLTFKEQRQQIIELWDVCFVSIIHRTQFY  819

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWLQ HLAELGNASPA +G+EP VSLSSSI+AL+RE+EFL
Sbjct  820  LLFKGDPADQIYMEVELRRLTWLQHHLAELGNASPAHVGDEPIVSLSSSIRALKREREFL  879

Query  546  AKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRLT RLT EER+ALYIKW+VPLEGK R+L F++KLWT P DP+H+QESAEIVAKLVGF
Sbjct  880  AKRLTSRLTAEEREALYIKWDVPLEGKQRKLQFVSKLWTDPHDPQHIQESAEIVAKLVGF  939

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
               GNMS+EMFELNF +P DKR W +GW+QI++LL+L
Sbjct  940  SGGGNMSKEMFELNFAVPADKRPWMMGWNQISNLLNL  976



>ref|XP_007036597.1| ATP binding microtubule motor family protein isoform 1 [Theobroma 
cacao]
 gb|EOY21098.1| ATP binding microtubule motor family protein isoform 1 [Theobroma 
cacao]
Length=964

 Score =   337 bits (864),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 192/217 (88%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGY +E++E+  E +E   +WH+TFREQ QQII+LWDVC+VSIIHR+QFY
Sbjct  748  QVLELEANEAAGYNIEDDESAIEPEEPQVAWHVTFREQRQQIIELWDVCYVSIIHRTQFY  807

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRL WLQQH AELGNASPA +G+E +VSLSSSI+AL+RE+EFL
Sbjct  808  LLFKGDPADQIYMEVELRRLNWLQQHFAELGNASPALVGDESSVSLSSSIRALKREREFL  867

Query  546  AKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRLT RL+ EERDALYIKW+VPL+GK R+L FINKLWT P D KH++ESA+IVAKLVGF
Sbjct  868  AKRLTSRLSVEERDALYIKWDVPLDGKQRKLQFINKLWTDPHDAKHIEESAQIVAKLVGF  927

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CE GNMS+EMFELNF +P DKR W +GW+QI++LL+L
Sbjct  928  CEGGNMSKEMFELNFALPADKRPWVVGWNQISNLLNL  964



>ref|XP_010498223.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=976

 Score =   337 bits (864),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 191/219 (87%), Gaps = 3/219 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEEN--IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELEAN+ AGY++ENEEN  + + +++  +WHITF E+ QQII+LW VC VSIIHR+Q
Sbjct  758  QVLELEANDGAGYSVENEENTMMEDEEQNQVAWHITFIEERQQIIELWHVCHVSIIHRTQ  817

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            FYLLFKGD ADQIY+EVE+RRLTWL+QHLAE+GNA+PA+  +E  VSLSSSIKALRRE+E
Sbjct  818  FYLLFKGDQADQIYMEVELRRLTWLEQHLAEVGNATPARNCDESIVSLSSSIKALRRERE  877

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLAKR+ +RLTPEER+ LY KW+VPLEGK R+L F+NKLWT P D +HVQESAEIVAKLV
Sbjct  878  FLAKRVNSRLTPEEREDLYTKWDVPLEGKQRKLQFVNKLWTDPYDSRHVQESAEIVAKLV  937

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            GFCESGN+S+EMFELNF +P+DKR W IGW+ I++LLHL
Sbjct  938  GFCESGNISKEMFELNFAVPSDKRQWNIGWNNISNLLHL  976



>ref|XP_004512893.1| PREDICTED: kinesin-II 95 kDa subunit-like isoform X1 [Cicer arietinum]
 ref|XP_004512894.1| PREDICTED: kinesin-II 95 kDa subunit-like isoform X2 [Cicer arietinum]
Length=962

 Score =   337 bits (863),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 189/218 (87%), Gaps = 2/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEA+G+ +E+E    E++E   SW +TFREQ QQI++LWD C+VSIIHR+QFY
Sbjct  745  QVLELEANEASGHNIEDEVYTGELEEPQVSWQVTFREQQQQILELWDACYVSIIHRTQFY  804

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPA-QLGNEPTVSLSSSIKALRREKEF  550
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELGNASPA   G+EPTVSLSSS++AL+RE+EF
Sbjct  805  LLFKGDQADQIYMEVELRRLTWLQQHLAELGNASPAPHAGDEPTVSLSSSMRALKREREF  864

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKRL +RL PEER+ALYIKW+VPL+GK R++ F++KLWT P D KHVQESAEIVAKLV 
Sbjct  865  LAKRLISRLAPEEREALYIKWDVPLDGKQRKMQFVSKLWTDPYDRKHVQESAEIVAKLVD  924

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FC  GNMS+EMFELNFV+P+DKR W +GW+ + +LL+L
Sbjct  925  FCTGGNMSKEMFELNFVLPSDKRPWLMGWNHLTNLLNL  962



>ref|XP_010477014.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=976

 Score =   336 bits (862),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 189/219 (86%), Gaps = 3/219 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEEN--IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELEAN+ AGY+ ENEEN  + + +++  +WHITF E+ QQII+LW VC VSIIHR+Q
Sbjct  758  QVLELEANDGAGYSAENEENTMMEDEEQNQVAWHITFIEERQQIIELWHVCHVSIIHRTQ  817

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            FYLLFKGD ADQIY+EVE+RRLTWL+QHLAE+GNA+PA+  +E  VSLSSSIKALRRE+E
Sbjct  818  FYLLFKGDQADQIYMEVELRRLTWLEQHLAEVGNATPARNCDESVVSLSSSIKALRRERE  877

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLAKR+ +RL PEER+ LY KW+VPLEGK R+L F+NKLWT P D +HVQESAEIVAKLV
Sbjct  878  FLAKRVNSRLRPEEREELYTKWDVPLEGKQRKLQFVNKLWTDPYDSRHVQESAEIVAKLV  937

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            GFCESGN+S+EMFELNF +P+DKR W IGWD I++LLHL
Sbjct  938  GFCESGNISKEMFELNFAVPSDKRQWNIGWDNISNLLHL  976



>ref|XP_006416611.1| hypothetical protein EUTSA_v10006702mg [Eutrema salsugineum]
 gb|ESQ34964.1| hypothetical protein EUTSA_v10006702mg [Eutrema salsugineum]
Length=968

 Score =   336 bits (862),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 160/219 (73%), Positives = 191/219 (87%), Gaps = 3/219 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQ--ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELEANE AGY++ENEE + E    +S  +WHITF E+ QQII+LW VC VSIIHR+Q
Sbjct  750  QVLELEANEGAGYSVENEEKMIEEDEEQSQVAWHITFIEERQQIIELWHVCHVSIIHRTQ  809

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            FYLLFKGD ADQIY+EVE+RRLTWL+QHLAE+GNA+PA+ G+E  VSLSSSIKALRRE+E
Sbjct  810  FYLLFKGDQADQIYMEVELRRLTWLEQHLAEVGNATPARNGDESIVSLSSSIKALRRERE  869

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLA+R+ +RLTPEER+ LY+KW+VPLEGK R+L F+NKLWT P D +HVQESAEIVAKLV
Sbjct  870  FLARRVNSRLTPEEREELYMKWDVPLEGKQRKLQFVNKLWTDPYDSRHVQESAEIVAKLV  929

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            GFCESGN+S+EMFELNF +P+DKR W IGWD I++LLHL
Sbjct  930  GFCESGNISKEMFELNFAVPSDKRQWNIGWDNISNLLHL  968



>ref|XP_011008305.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
Length=964

 Score =   336 bits (861),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 185/218 (85%), Gaps = 2/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESP-ASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELEANEAAGY +E EE     QE P  SWH+TFREQ Q II+LWDVC+VSIIHR+QF
Sbjct  747  QVLELEANEAAGYNIEEEEENINEQEEPQVSWHVTFREQRQLIIELWDVCYVSIIHRTQF  806

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLF GD ADQIY+EVE+RRLTWLQ+HLAELGNASPA  G+E T+SLSSSI+AL+REKEF
Sbjct  807  YLLFSGDPADQIYMEVELRRLTWLQKHLAELGNASPAHFGDESTISLSSSIRALKREKEF  866

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKRL +RLT EERDALYIKW VPL+GK RRL F+NKLWT P D  H+QESA+IVAKLVG
Sbjct  867  LAKRLASRLTMEERDALYIKWNVPLDGKQRRLQFVNKLWTDPHDANHIQESADIVAKLVG  926

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE GNMS+EMFELNF +P DKR W +GW+ I++ LHL
Sbjct  927  FCEGGNMSKEMFELNFALPTDKRPWIMGWNPISNFLHL  964



>gb|KHG07573.1| kif4 [Gossypium arboreum]
Length=962

 Score =   335 bits (860),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 188/217 (87%), Gaps = 1/217 (0%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGY LE +E+  E +E    W++TF+EQ QQII+LWDVC+VSIIHR+QFY
Sbjct  746  QVLELEANEAAGYNLEVDESAIEPEEPQVPWYVTFKEQRQQIIELWDVCYVSIIHRTQFY  805

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD ADQIY+EVE+RRL W+Q H AELGN+SPA +G+EPTVSLSSSI+AL+RE+EFL
Sbjct  806  LLFRGDPADQIYMEVELRRLNWMQHHFAELGNSSPALVGDEPTVSLSSSIRALKREREFL  865

Query  546  AKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRLT RL+ EERDALYIKW+VPLEGK R++ FINKLWT P D K+++ESA+IVAKLVGF
Sbjct  866  AKRLTSRLSVEERDALYIKWDVPLEGKQRKMQFINKLWTDPHDVKNIEESAQIVAKLVGF  925

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
             E GNMSREMFELNF +P DK  W +GW+QI++LL+L
Sbjct  926  SEGGNMSREMFELNFALPTDKSPWTVGWNQISNLLNL  962



>ref|XP_010693857.1| PREDICTED: kinesin-like protein NACK1 [Beta vulgaris subsp. vulgaris]
Length=984

 Score =   335 bits (860),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/218 (74%), Positives = 187/218 (86%), Gaps = 2/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGY +EN+E   E  E   SWHITF+EQ QQII+LWDVC+VSIIHR+QFY
Sbjct  767  QVLELEANEAAGYNVENDEEDFEENEPQVSWHITFKEQRQQIIELWDVCYVSIIHRTQFY  826

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPA-QLGNEPTVSLSSSIKALRREKEF  550
            LLFKGD+ADQIY+EVE+RRLTWLQQHLAE GNASPA   G+EPTVS+SSSI+ALRRE+EF
Sbjct  827  LLFKGDTADQIYMEVELRRLTWLQQHLAETGNASPAPPSGDEPTVSISSSIRALRREREF  886

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKR+ TRL+PEE++ALY+KW +PLEGK RRL+F++KLWT P DP HV ESAEIVAKLVG
Sbjct  887  LAKRVTTRLSPEEKEALYMKWGIPLEGKQRRLHFVSKLWTDPHDPLHVHESAEIVAKLVG  946

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE G  SREMFELNF  P DKR W  GW+ I++LLH+
Sbjct  947  FCEGGKASREMFELNFAHPTDKRPWIAGWNHISNLLHI  984



>ref|XP_002321490.2| nodulin-25 precursor family protein [Populus trichocarpa]
 gb|EEF05617.2| nodulin-25 precursor family protein [Populus trichocarpa]
Length=964

 Score =   334 bits (857),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 185/218 (85%), Gaps = 2/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESP-ASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELEANEAAGY +E EE     QE P  SWH+TFREQ Q II+LWDVC+VSIIHR+QF
Sbjct  747  QVLELEANEAAGYNMEEEEENINEQEEPQVSWHVTFREQRQLIIELWDVCYVSIIHRTQF  806

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLF GD ADQIY+EVE+RRLTWLQ+HLAELGNASPA  G+E T+SLSSSI+AL+REKEF
Sbjct  807  YLLFSGDPADQIYMEVELRRLTWLQKHLAELGNASPAHFGDESTISLSSSIRALKREKEF  866

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKRL +RLT EERDALYIKW VPL+ K RRL F+NKLWT P D KH+QESA+IVAKLVG
Sbjct  867  LAKRLASRLTTEERDALYIKWNVPLDEKQRRLQFVNKLWTDPHDVKHIQESADIVAKLVG  926

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE GNMS+EMFELNF +P DKR W +GW+ I++ LHL
Sbjct  927  FCEGGNMSKEMFELNFALPTDKRPWIMGWNPISNFLHL  964



>ref|XP_003534160.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Glycine 
max]
 ref|XP_006587490.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Glycine 
max]
Length=962

 Score =   327 bits (837),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 188/218 (86%), Gaps = 2/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEA G+ ++NEE   E +E   SW ITF+EQ Q+I++LWD+C+VSIIHR+QFY
Sbjct  745  QVLELEANEANGHNIDNEEYSCEPEEPQVSWQITFKEQQQEILELWDLCYVSIIHRTQFY  804

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPA-QLGNEPTVSLSSSIKALRREKEF  550
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELGNASPA  +G EPT+SLSSSI+AL+RE+EF
Sbjct  805  LLFKGDPADQIYMEVELRRLTWLQQHLAELGNASPAPHVGEEPTISLSSSIRALKREREF  864

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKRL TRL+ EER+ALY+KW+VPL+GK R++ FI+KLWT P D  HVQESAEIVA+LVG
Sbjct  865  LAKRLTTRLSLEEREALYMKWDVPLDGKQRKMQFISKLWTDPHDQIHVQESAEIVARLVG  924

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            F   GNMS+EMFELNFV+P+DKR W +GW+ + +LL+L
Sbjct  925  FRTGGNMSKEMFELNFVLPSDKRPWLMGWNHLTNLLNL  962



>gb|KHN23757.1| Kinesin-related protein 4 [Glycine soja]
Length=962

 Score =   327 bits (837),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 188/218 (86%), Gaps = 2/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEA G+ ++NEE   E +E   SW ITF+EQ Q+I++LWD+C+VSIIHR+QFY
Sbjct  745  QVLELEANEANGHNIDNEEYSCEPEEPQVSWQITFKEQQQEILELWDLCYVSIIHRTQFY  804

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPA-QLGNEPTVSLSSSIKALRREKEF  550
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELGNASPA  +G EPT+SLSSSI+AL+RE+EF
Sbjct  805  LLFKGDPADQIYMEVELRRLTWLQQHLAELGNASPAPHVGEEPTISLSSSIRALKREREF  864

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKRL TRL+ EER+ALY+KW+VPL+GK R++ FI+KLWT P D  HVQESAEIVA+LVG
Sbjct  865  LAKRLTTRLSLEEREALYMKWDVPLDGKQRKMQFISKLWTDPHDQIHVQESAEIVARLVG  924

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            F   GNMS+EMFELNFV+P+DKR W +GW+ + +LL+L
Sbjct  925  FRTGGNMSKEMFELNFVLPSDKRPWLMGWNHLTNLLNL  962



>ref|XP_008792831.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-like protein NACK1 [Phoenix 
dactylifera]
Length=964

 Score =   325 bits (832),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 184/218 (84%), Gaps = 2/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTL-ENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELE+NEAAG+ + E +E+I E+Q S  +W   F+EQMQQII LWDVC VSIIHRSQF
Sbjct  747  QVLELESNEAAGHEVPEADEHISELQNSTDAWDSVFKEQMQQIIQLWDVCHVSIIHRSQF  806

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLF+GD ADQIYIEVE+RRL WLQQH AE+GNASPA +G+EP VSLSSSIKALR+E+EF
Sbjct  807  YLLFRGDRADQIYIEVELRRLAWLQQHFAEVGNASPAHIGDEPAVSLSSSIKALRQEREF  866

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            L++R+ +RLT EER+ LYIKW+VPLEGK R+L  +NKLWT P DP H++ESA+IVA+LVG
Sbjct  867  LSRRVNSRLTEEERERLYIKWQVPLEGKQRKLQLVNKLWTDPNDPAHIEESADIVARLVG  926

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE GN+S+EMFELNF +P  K+ WF+GW  I++LL L
Sbjct  927  FCEGGNISKEMFELNFALPASKKPWFLGWQPISNLLRL  964



>emb|CDY19208.1| BnaC05g14090D [Brassica napus]
Length=974

 Score =   324 bits (830),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/228 (69%), Positives = 190/228 (83%), Gaps = 13/228 (6%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQ--ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELEANE AGY++E+EE   E    +S  +WHITF E+ QQII+LW VC VSIIHR+Q
Sbjct  748  QVLELEANEGAGYSVEDEEKTIEENEEQSQVAWHITFTEERQQIIELWHVCHVSIIHRTQ  807

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGN---------EPTVSLSSS  580
            FYLLFKGD ADQIY+EVE+RRLTWL+QHLAE+GNA+PA++GN            VSLSSS
Sbjct  808  FYLLFKGDQADQIYMEVELRRLTWLEQHLAEVGNATPARIGNGTPSKNGDDTAVVSLSSS  867

Query  579  IKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQE  403
            I+ALRRE+EFLA+R+ +RLTPEER+ LY+KW+VPLEGK R+L F+NKLWT P D +HVQE
Sbjct  868  IRALRREREFLARRINSRLTPEEREELYMKWDVPLEGKQRKLQFVNKLWTDPYDSRHVQE  927

Query  402  SAEIVAKLVGFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            SAEIVAKLVGFCESGN+S+EMFELNF +P+DKR W IGWD I++LLHL
Sbjct  928  SAEIVAKLVGFCESGNISKEMFELNFAMPSDKR-WNIGWDNISNLLHL  974



>ref|XP_010906990.1| PREDICTED: kinesin-like protein NACK1 [Elaeis guineensis]
Length=957

 Score =   323 bits (829),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 183/218 (84%), Gaps = 2/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTL-ENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELEANEAAG+ + E EE+I E+Q S  +W   F+EQMQQII LWDVC VSIIHRSQF
Sbjct  740  QVLELEANEAAGHDVSEAEEHISEMQNSTDAWDSVFKEQMQQIIQLWDVCHVSIIHRSQF  799

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLF+GD ADQIYIEVE+RRLTWLQQH AE+GNASPA  G+E  +SLSSS+KALR+E+EF
Sbjct  800  YLLFRGDQADQIYIEVELRRLTWLQQHFAEVGNASPAHFGDETAISLSSSVKALRQEREF  859

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            L++R+ +RLT EER+ LYIKW+VPLEGK R+L  +NKLWT P DP H++ESA+IVA+LVG
Sbjct  860  LSRRVNSRLTEEERERLYIKWQVPLEGKQRKLQLVNKLWTDPNDPAHIEESADIVARLVG  919

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE GN+++EMFELNF +P  K+ WF+GW  I++LL L
Sbjct  920  FCEGGNITKEMFELNFSLPASKKPWFLGWQPISNLLRL  957



>ref|XP_010250094.1| PREDICTED: kinesin-like protein NACK1 [Nelumbo nucifera]
Length=965

 Score =   323 bits (828),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 184/217 (85%), Gaps = 6/217 (3%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEA   AGY L+NE +I E QE P  W+ITF +  QQII LWDVC VSIIHR+QFY
Sbjct  754  QVLELEA---AGYDLDNE-SINE-QEPPVPWNITFHDWRQQIIQLWDVCHVSIIHRTQFY  808

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWLQQHLAE+GNASPA  G+EPT+SLSSSI+A++RE+EFL
Sbjct  809  LLFKGDPADQIYMEVELRRLTWLQQHLAEVGNASPAHFGDEPTISLSSSIRAVKREREFL  868

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRL TR T  ERDALYIKW+VP++GK R+  F+NKLWT P D KHV+ESAE+VAKLVGF
Sbjct  869  AKRLMTRFTSWERDALYIKWDVPIDGKQRKHQFVNKLWTDPHDAKHVRESAEMVAKLVGF  928

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CE GN+S+EMFELNF +P DKR+W +GW+ I++LLHL
Sbjct  929  CEGGNVSKEMFELNFALPADKRTWILGWNPISNLLHL  965



>ref|XP_003620405.1| Kinesin-like protein KIF3A [Medicago truncatula]
Length=945

 Score =   322 bits (826),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 185/219 (84%), Gaps = 3/219 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEA+G  +E E    E +E   SW +TF+E   QI++LWDVC+VSIIHR+QFY
Sbjct  727  QVLELEANEASGQDIEEEVYTGEPEEPQVSWQVTFKEMQHQILELWDVCYVSIIHRTQFY  786

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQL--GNEPTVSLSSSIKALRREKE  553
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELGNASPA    G+E T+SLSSS++AL+RE+E
Sbjct  787  LLFKGDPADQIYMEVELRRLTWLQQHLAELGNASPAPTVGGDELTISLSSSMRALKRERE  846

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLAKRL +RLTPEER+ LY+KW+VPL+GK R++ F++KLWT P D +HVQESAEIVAKLV
Sbjct  847  FLAKRLISRLTPEEREILYMKWDVPLDGKQRKMQFVSKLWTDPCDQRHVQESAEIVAKLV  906

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            GFC  GNMS+EMFELNFV+P+DKR W +GW+ + +LL+L
Sbjct  907  GFCTGGNMSKEMFELNFVLPSDKRPWLMGWNHLTNLLNL  945



>emb|CDY26167.1| BnaA06g12500D [Brassica napus]
Length=980

 Score =   323 bits (827),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/228 (69%), Positives = 190/228 (83%), Gaps = 13/228 (6%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQ--ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELEANE AGY++E+EE   E    +S  +WHITF E+ QQII+LW VC VSIIHR+Q
Sbjct  754  QVLELEANEGAGYSVEDEEKTIEENEEQSQVAWHITFIEERQQIIELWHVCHVSIIHRTQ  813

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGN---------EPTVSLSSS  580
            FYLLFKGD ADQIY+EVE+RRLTWL+QHLAE+GNA+PA++GN            VSLSSS
Sbjct  814  FYLLFKGDQADQIYMEVELRRLTWLEQHLAEVGNATPARIGNGTPSKNGDDTAVVSLSSS  873

Query  579  IKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQE  403
            I+ALRRE+EFLA+R+ +RLTPEER+ LY+KW+VPLEGK R+L F+NKLWT P D +HVQE
Sbjct  874  IRALRREREFLARRINSRLTPEEREELYMKWDVPLEGKQRKLQFVNKLWTDPYDSRHVQE  933

Query  402  SAEIVAKLVGFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            SAEIVAKLVGFCESGN+S+EMFELNF +P+DKR W IGWD I++LLHL
Sbjct  934  SAEIVAKLVGFCESGNISKEMFELNFAMPSDKR-WNIGWDNISNLLHL  980



>ref|XP_009149278.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
Length=980

 Score =   323 bits (827),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/228 (69%), Positives = 190/228 (83%), Gaps = 13/228 (6%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQ--ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELEANE AGY++E+EE   E    +S  +WHITF E+ QQII+LW VC VSIIHR+Q
Sbjct  754  QVLELEANEGAGYSVEDEEKTIEENEEQSQVAWHITFIEERQQIIELWHVCHVSIIHRTQ  813

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGN---------EPTVSLSSS  580
            FYLLFKGD ADQIY+EVE+RRLTWL+QHLAE+GNA+PA++GN            VSLSSS
Sbjct  814  FYLLFKGDQADQIYMEVELRRLTWLEQHLAEVGNATPARIGNGTPSKNGDDTAVVSLSSS  873

Query  579  IKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQE  403
            I+ALRRE+EFLA+R+ +RLTPEER+ LY+KW+VPLEGK R+L F+NKLWT P D +HVQE
Sbjct  874  IRALRREREFLARRINSRLTPEEREELYMKWDVPLEGKQRKLQFVNKLWTDPYDSRHVQE  933

Query  402  SAEIVAKLVGFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            SAEIVAKLVGFCESGN+S+EMFELNF +P+DKR W IGWD I++LLHL
Sbjct  934  SAEIVAKLVGFCESGNISKEMFELNFAMPSDKR-WNIGWDNISNLLHL  980



>gb|AES76623.2| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=964

 Score =   322 bits (825),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 185/219 (84%), Gaps = 3/219 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEA+G  +E E    E +E   SW +TF+E   QI++LWDVC+VSIIHR+QFY
Sbjct  746  QVLELEANEASGQDIEEEVYTGEPEEPQVSWQVTFKEMQHQILELWDVCYVSIIHRTQFY  805

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQL--GNEPTVSLSSSIKALRREKE  553
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELGNASPA    G+E T+SLSSS++AL+RE+E
Sbjct  806  LLFKGDPADQIYMEVELRRLTWLQQHLAELGNASPAPTVGGDELTISLSSSMRALKRERE  865

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLAKRL +RLTPEER+ LY+KW+VPL+GK R++ F++KLWT P D +HVQESAEIVAKLV
Sbjct  866  FLAKRLISRLTPEEREILYMKWDVPLDGKQRKMQFVSKLWTDPCDQRHVQESAEIVAKLV  925

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            GFC  GNMS+EMFELNFV+P+DKR W +GW+ + +LL+L
Sbjct  926  GFCTGGNMSKEMFELNFVLPSDKRPWLMGWNHLTNLLNL  964



>ref|XP_008775906.1| PREDICTED: kinesin-like protein NACK1 [Phoenix dactylifera]
Length=964

 Score =   322 bits (825),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 182/219 (83%), Gaps = 3/219 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTL--ENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELE NEAAG+ +  E +ENI E+Q SP +W   +REQMQQII LW +C VSIIHRSQ
Sbjct  746  QVLELEVNEAAGHDVAAEADENISELQSSPDTWDSVYREQMQQIIQLWHICHVSIIHRSQ  805

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            FYLLF+GD ADQIYIEVE+RRLTWLQQH AE+GNASPA  G+EP VSL SSI+ALR+E+E
Sbjct  806  FYLLFRGDQADQIYIEVELRRLTWLQQHFAEVGNASPAYTGDEPPVSLPSSIRALRQERE  865

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FL++R+ +RLT EER+ LYIKW+VPLEGK R+L  +NKLWT P DP H++ESA+IVA+LV
Sbjct  866  FLSRRVNSRLTEEERELLYIKWQVPLEGKQRKLQLVNKLWTDPNDPAHIEESADIVARLV  925

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            GFCE GN+++EMFELNF +P  K+ WF+GW  I++LL L
Sbjct  926  GFCEGGNIAKEMFELNFALPASKKPWFLGWQPISNLLRL  964



>gb|KHN20772.1| Kinesin-related protein 4 [Glycine soja]
Length=962

 Score =   322 bits (824),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 185/218 (85%), Gaps = 2/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEA G+ ++NEE   E +E   SW I F+EQ QQI++LWD+C+VSIIHR+QFY
Sbjct  745  QVLELEANEANGHNIDNEEYSCEPEEPQISWQIAFKEQRQQILELWDLCYVSIIHRTQFY  804

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPA-QLGNEPTVSLSSSIKALRREKEF  550
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELGNASPA  +G EPT+SLSSSI+AL+RE+EF
Sbjct  805  LLFKGDPADQIYMEVELRRLTWLQQHLAELGNASPAPHVGEEPTISLSSSIRALKREREF  864

Query  549  LAKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKRLT RL+ EER+ALY+KW+VPL+GK R++ FI+KLWT P D  HVQESAEIVAKLV 
Sbjct  865  LAKRLTSRLSLEEREALYMKWDVPLDGKQRKMQFISKLWTDPHDQIHVQESAEIVAKLVS  924

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            F   GNMS+EMFELNFV+P+D R W +GW+ + +LL+L
Sbjct  925  FRTGGNMSKEMFELNFVLPSDNRPWLMGWNHLTNLLNL  962



>ref|XP_003528955.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Glycine 
max]
 ref|XP_006583433.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Glycine 
max]
Length=962

 Score =   321 bits (823),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 185/218 (85%), Gaps = 2/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEA G+ ++NEE   E +E   SW I F+EQ QQI++LWD+C+VSIIHR+QFY
Sbjct  745  QVLELEANEANGHNIDNEEYSCEPEEPQISWQIAFKEQRQQILELWDLCYVSIIHRTQFY  804

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPA-QLGNEPTVSLSSSIKALRREKEF  550
            LLFKGD ADQIY+EVE+RRLTWLQQHLAELGNASPA  +G EPT+SLSSSI+AL+RE+EF
Sbjct  805  LLFKGDPADQIYMEVELRRLTWLQQHLAELGNASPAPHVGEEPTISLSSSIRALKREREF  864

Query  549  LAKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKRLT RL+ EER+ALY+KW+VPL+GK R++ FI+KLWT P D  HVQESAEIVAKLV 
Sbjct  865  LAKRLTSRLSLEEREALYMKWDVPLDGKQRKMQFISKLWTDPHDQIHVQESAEIVAKLVS  924

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            F   GNMS+EMFELNFV+P+D R W +GW+ + +LL+L
Sbjct  925  FRTGGNMSKEMFELNFVLPSDNRPWLMGWNHLTNLLNL  962



>ref|XP_010540004.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
Length=972

 Score =   321 bits (822),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 190/219 (87%), Gaps = 3/219 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESP-ASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELEANEAAG+ +E+ EN  E +E+   +WHI F++Q QQI++LW VC VSIIHR+QF
Sbjct  754  QVLELEANEAAGHNIEDHENEIEEEETQQVAWHIMFKQQRQQIVELWHVCHVSIIHRTQF  813

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLFKGD ADQIY+EVE+RRLTWL+ HLAE+GNA+PA+ G+EP +S+SSSI+ALRRE+EF
Sbjct  814  YLLFKGDQADQIYMEVELRRLTWLEHHLAEVGNATPARNGDEPAISISSSIRALRREREF  873

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LA+R+ +RLTPEERD+LY+KW+VPLEGK R+L F+NKLWT P D +HV+ESA IVAKLVG
Sbjct  874  LARRVNSRLTPEERDSLYMKWDVPLEGKQRKLQFVNKLWTDPYDTRHVEESAAIVAKLVG  933

Query  372  FCESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE G N+S+EMFELNF +P+DKR W IGWD I++LLHL
Sbjct  934  FCEGGNNISKEMFELNFAVPSDKRQWNIGWDNISNLLHL  972



>emb|CDY21709.1| BnaA09g44600D [Brassica napus]
Length=949

 Score =   318 bits (814),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 189/220 (86%), Gaps = 5/220 (2%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQE--SPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVL+LE N+ AGY++ENEE   E  E  S  +WHITF E+ +QI++LW VC VSII R+Q
Sbjct  731  QVLDLE-NDGAGYSVENEEKTVEEDEELSQVAWHITFIEEREQILELWHVCHVSIIRRTQ  789

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTV-SLSSSIKALRREK  556
            FYLLFKGD  DQIY+EVE+RRLTWL+QHLAE+GNA+PA+ G+EP V SLSSSI+ALRRE+
Sbjct  790  FYLLFKGDQTDQIYMEVELRRLTWLEQHLAEVGNATPARTGDEPAVVSLSSSIRALRRER  849

Query  555  EFLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKL  379
            EFLA+R+ +RLTPEER+ LY+KW+VPLEGK+R+L F+NKLWT P D +HVQESAEIVAKL
Sbjct  850  EFLARRINSRLTPEEREELYMKWDVPLEGKHRKLQFVNKLWTDPYDSRHVQESAEIVAKL  909

Query  378  VGFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            VGFCESGN+S+EMFELNF +P+DKR W IGWD I++LLHL
Sbjct  910  VGFCESGNISKEMFELNFALPSDKRQWNIGWDNISNLLHL  949



>ref|XP_010922342.1| PREDICTED: kinesin-like protein NACK1 [Elaeis guineensis]
Length=959

 Score =   317 bits (813),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/218 (67%), Positives = 180/218 (83%), Gaps = 2/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGY-TLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELE+NEAAG+   E + NI E+Q SP +W   ++EQMQQII LW +C VSIIHRSQF
Sbjct  742  QVLELESNEAAGHDGAEADGNISELQSSPDTWDSVYKEQMQQIIQLWHICHVSIIHRSQF  801

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLFKGD ADQIYIEVE+RRL+WLQQH  E+GNASPA  G+EP VSLSSSI+ALR+E+EF
Sbjct  802  YLLFKGDRADQIYIEVELRRLSWLQQHFTEIGNASPAHTGDEPAVSLSSSIRALRQEREF  861

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            L++R+ +RLT EER+ LYIKW+VPLEGK R+L  +NKLW  P DP H++ESA+IVA+LVG
Sbjct  862  LSRRVNSRLTEEEREMLYIKWQVPLEGKQRKLQLVNKLWIDPNDPAHIEESADIVARLVG  921

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE GN+++EMFELNF +P  K+ WF+GW  I++LL L
Sbjct  922  FCEGGNIAKEMFELNFSLPASKKPWFLGWQPISNLLRL  959



>ref|XP_009407329.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=962

 Score =   317 bits (811),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 180/218 (83%), Gaps = 3/218 (1%)
 Frame = -2

Query  906  QVLELEANEAAGY-TLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELEANEAAGY   E +E+I +   SP +W   F+EQMQQII LWDVC VSIIHR+QF
Sbjct  746  QVLELEANEAAGYDAAEGDESITDAGNSPDAWKSRFKEQMQQIIQLWDVCHVSIIHRTQF  805

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLF+GD ADQIYIEVE+RRLTWLQQH AE+GNASPAQ+G+E ++SLSSSIKALR E+EF
Sbjct  806  YLLFRGDPADQIYIEVEVRRLTWLQQHFAEVGNASPAQMGDE-SISLSSSIKALRHEREF  864

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LA+RL +RLT +ER+ LYIKW+VPLEGK R+L  + KLW  P DP H++ESA+IVA+LVG
Sbjct  865  LARRLQSRLTEDERERLYIKWQVPLEGKQRKLQLVYKLWADPNDPAHIEESADIVARLVG  924

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE GNM++EMFELNF +P  K+ W +GW  I++LL L
Sbjct  925  FCEGGNMAKEMFELNFTLPASKKPWLLGWQPISNLLRL  962



>ref|XP_009117616.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
Length=949

 Score =   316 bits (810),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 187/220 (85%), Gaps = 5/220 (2%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQE--SPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVL+LE N+ AGY++ENEE   E  E  S  +WHITF E+ +QI++LW VC VSII R+Q
Sbjct  731  QVLDLE-NDGAGYSVENEEKTVEEDEELSQVAWHITFIEEREQILELWHVCHVSIIRRTQ  789

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTV-SLSSSIKALRREK  556
            FYLLFKGD  DQIY+EVE+RRLTWL+QHLAE+GNA+PA+ G+EP V SLSSSI+ALRRE+
Sbjct  790  FYLLFKGDQTDQIYMEVELRRLTWLEQHLAEVGNATPARTGDEPAVVSLSSSIRALRRER  849

Query  555  EFLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKL  379
            EFLA+R+ +RLTPEER+ LY+KW+VPLEGK R+L F+NKLWT P D +HVQESAEIVAKL
Sbjct  850  EFLARRINSRLTPEEREELYMKWDVPLEGKQRKLQFVNKLWTDPYDSRHVQESAEIVAKL  909

Query  378  VGFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            VGFCESGN+S+EMFELNF +P DKR W IGWD I++LLHL
Sbjct  910  VGFCESGNISKEMFELNFALPCDKRQWNIGWDNISNLLHL  949



>emb|CDX81870.1| BnaC08g37310D [Brassica napus]
Length=953

 Score =   315 bits (808),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/220 (70%), Positives = 187/220 (85%), Gaps = 5/220 (2%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQE--SPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELE N+ AGY++ENEE   E  E  S  +WHITF E+ +QI++LW VC VSII R+Q
Sbjct  735  QVLELE-NDGAGYSVENEEKTAEESEELSQVAWHITFIEEREQILELWHVCHVSIIRRTQ  793

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTV-SLSSSIKALRREK  556
            FYLLFKGD  DQIY+EVE+RRLTWL+QHLAE+GNA+PA+ G+EP V SLSSSI+ALRRE+
Sbjct  794  FYLLFKGDQTDQIYMEVELRRLTWLEQHLAEVGNATPARTGDEPAVVSLSSSIRALRRER  853

Query  555  EFLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKL  379
            EFLAKR+ +RLT EER+ LY+KW+VPLEGK R+L F+NKLWT P D +HVQESAEIVAKL
Sbjct  854  EFLAKRINSRLTLEEREELYMKWDVPLEGKQRKLQFVNKLWTDPYDSRHVQESAEIVAKL  913

Query  378  VGFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            VGFCESGN+S+EMFELNF +P+DKR W IGWD I++LLHL
Sbjct  914  VGFCESGNISKEMFELNFALPSDKRQWNIGWDNISNLLHL  953



>ref|XP_009418072.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=966

 Score =   309 bits (791),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 181/220 (82%), Gaps = 5/220 (2%)
 Frame = -2

Query  906  QVLELEANEAAGYT--LENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELEANEA+GY    E EENI ++++SPA+W   F EQMQQII LWDVC VSIIHR+Q
Sbjct  748  QVLELEANEASGYDDGEECEENISDLEKSPAAWKSRFEEQMQQIIHLWDVCHVSIIHRTQ  807

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            FYLLF+GD ADQIYIEVE+RR+TWLQ+H  E+GNASPA  G++P +SLSSSIKALR E+E
Sbjct  808  FYLLFRGDPADQIYIEVEVRRMTWLQEHFDEVGNASPAPTGDDP-ISLSSSIKALRHERE  866

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLAKRL +RLT +ER+ LYIKW+VPLEGK R+L  ++KLWT P D  H++ESA+IVA+LV
Sbjct  867  FLAKRLQSRLTEDERERLYIKWQVPLEGKQRKLQLVSKLWTDPNDAAHIEESADIVARLV  926

Query  375  GFCESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            GFCE G NM++EMFELNF +P  K+ W +GW  I++LL L
Sbjct  927  GFCEGGNNMAKEMFELNFALPASKKPWLLGWQPISNLLGL  966



>ref|XP_010537463.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Tarenaya hassleriana]
Length=788

 Score =   303 bits (775),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 187/221 (85%), Gaps = 5/221 (2%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESP-ASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELEANEA+G+ ++  EN  E +E+   +WH+ F++Q QQI++LW VC VSIIHR+QF
Sbjct  568  QVLELEANEASGHNIDEHENTIEEEETQQVAWHLMFKQQRQQIVELWHVCHVSIIHRTQF  627

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLFKGD ADQIY+EVE+RRLTWL+QHLAE+GNA+PA+ G+EP  SLSSSI+ALRRE+EF
Sbjct  628  YLLFKGDQADQIYMEVELRRLTWLEQHLAEVGNATPARNGDEPAESLSSSIRALRREREF  687

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LA+R+ +RLTPEER+ALY++W+VPLEGK R+L  +NKLWT P D +HV+ESA IVAKL+G
Sbjct  688  LARRVNSRLTPEEREALYVEWDVPLEGKQRKLQLVNKLWTDPYDTRHVEESAAIVAKLMG  747

Query  372  FCESG-NMSREMFELNFVIPNDK-RSW-FIGWDQIADLLHL  259
            FCE G N+ +EMFELNF +P+DK R W  IGWD I++LLHL
Sbjct  748  FCEGGNNIPKEMFELNFAVPSDKIRPWNNIGWDNISNLLHL  788



>ref|XP_010537459.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010537460.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010537461.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
Length=975

 Score =   303 bits (775),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 187/221 (85%), Gaps = 5/221 (2%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESP-ASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELEANEA+G+ ++  EN  E +E+   +WH+ F++Q QQI++LW VC VSIIHR+QF
Sbjct  755  QVLELEANEASGHNIDEHENTIEEEETQQVAWHLMFKQQRQQIVELWHVCHVSIIHRTQF  814

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLFKGD ADQIY+EVE+RRLTWL+QHLAE+GNA+PA+ G+EP  SLSSSI+ALRRE+EF
Sbjct  815  YLLFKGDQADQIYMEVELRRLTWLEQHLAEVGNATPARNGDEPAESLSSSIRALRREREF  874

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LA+R+ +RLTPEER+ALY++W+VPLEGK R+L  +NKLWT P D +HV+ESA IVAKL+G
Sbjct  875  LARRVNSRLTPEEREALYVEWDVPLEGKQRKLQLVNKLWTDPYDTRHVEESAAIVAKLMG  934

Query  372  FCESG-NMSREMFELNFVIPNDK-RSW-FIGWDQIADLLHL  259
            FCE G N+ +EMFELNF +P+DK R W  IGWD I++LLHL
Sbjct  935  FCEGGNNIPKEMFELNFAVPSDKIRPWNNIGWDNISNLLHL  975



>gb|EMS53749.1| Kinesin-related protein 4 [Triticum urartu]
Length=917

 Score =   300 bits (767),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 173/217 (80%), Gaps = 3/217 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENE--ENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELE+NE     ++ +  EN    Q+ P SW I F+EQMQ II LWD+C VSIIHR+Q
Sbjct  688  QVLELESNEGKANEMDEDPVENAGSQQDGPESWEILFKEQMQHIIQLWDLCHVSIIHRTQ  747

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            FYLLF+GD ADQIYIEVE+RRLTWLQQH AE+G+ASPA LG++P VSL+SS+KALR E+E
Sbjct  748  FYLLFRGDMADQIYIEVEVRRLTWLQQHFAEVGDASPAALGDDPAVSLASSMKALRNERE  807

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLA+R+ +RLT EERD L+IKW+VPLE K R+L  +NKLW  P D  H++ESA+IVA+LV
Sbjct  808  FLARRMGSRLTEEERDRLFIKWQVPLEAKQRKLQLVNKLWADPNDKAHIEESADIVARLV  867

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLL  265
            GFCE GN+S+EMFELNF +P  ++ W +GW  I++++
Sbjct  868  GFCEGGNISKEMFELNFALPASRKPWLMGWQPISNMI  904



>dbj|BAK03253.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=949

 Score =   293 bits (751),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 172/217 (79%), Gaps = 3/217 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENE--ENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELE+NE     ++ +  EN   +Q+ P SW I F+EQMQ II LWD+C VSIIHR+Q
Sbjct  720  QVLELESNEGKPNEMDEDQVENAGSLQDGPESWEILFKEQMQHIIQLWDLCHVSIIHRTQ  779

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            FYLLF+GD ADQ+YIEVE+RRL WLQQH  E+G+ASPA LG++P VSL+SS+KALR E+E
Sbjct  780  FYLLFRGDMADQVYIEVEVRRLAWLQQHFVEVGDASPAALGDDPAVSLASSMKALRNERE  839

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLA+R+ +RLT EER+ L+IKW+VPLE K R+L  +NKLW  P D  H++ESA+IVA+LV
Sbjct  840  FLARRMGSRLTGEERERLFIKWQVPLEAKQRKLQLVNKLWADPNDKAHIEESADIVARLV  899

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLL  265
            GFCE GN+S+EMFELNF +P  ++ W +GW  I++++
Sbjct  900  GFCEGGNISKEMFELNFALPASRKPWLMGWQPISNMI  936



>ref|NP_001043186.1| Os01g0513900 [Oryza sativa Japonica Group]
 dbj|BAB32972.1| putative KIF3 protein [Oryza sativa Japonica Group]
 dbj|BAF05100.1| Os01g0513900 [Oryza sativa Japonica Group]
 gb|EEE54684.1| hypothetical protein OsJ_01991 [Oryza sativa Japonica Group]
Length=954

 Score =   291 bits (746),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 173/217 (80%), Gaps = 4/217 (2%)
 Frame = -2

Query  906  QVLELEANEAAGYTLE--NEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELE+NE     +E  +EEN   +Q+ P SW   F+EQMQ II LWD+C VSIIHR+Q
Sbjct  732  QVLELESNEGKTNDMEEDSEENAGSLQDGPDSWDRLFKEQMQHIIQLWDLCHVSIIHRTQ  791

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            FYLLF+GD ADQIYIEVE+RRLTWLQQH AE+G+ASPA  G++ T+SL+SSIKALR E+E
Sbjct  792  FYLLFRGDRADQIYIEVEVRRLTWLQQHFAEVGDASPA-AGDDSTISLASSIKALRNERE  850

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLA+R+ +RLT EER+ L+IKW+VPLE K R+L  +N+LWT P D  H+ ESA+IVA+LV
Sbjct  851  FLARRMGSRLTEEERERLFIKWQVPLEAKQRKLQLVNRLWTDPNDQAHIDESADIVARLV  910

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLL  265
            GFCE GN+S+EMFELNF +P  ++ W +GW  I++++
Sbjct  911  GFCEGGNISKEMFELNFAVPASRKPWLMGWQPISNMI  947



>gb|EEC70753.1| hypothetical protein OsI_02166 [Oryza sativa Indica Group]
Length=954

 Score =   291 bits (746),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 173/217 (80%), Gaps = 4/217 (2%)
 Frame = -2

Query  906  QVLELEANEAAGYTLE--NEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELE+NE     +E  +EEN   +Q+ P SW   F+EQMQ II LWD+C VSIIHR+Q
Sbjct  732  QVLELESNEGKTNDMEEDSEENAGSLQDGPDSWDRLFKEQMQHIIQLWDLCHVSIIHRTQ  791

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            FYLLF+GD ADQIYIEVE+RRLTWLQQH AE+G+ASPA  G++ T+SL+SSIKALR E+E
Sbjct  792  FYLLFRGDRADQIYIEVEVRRLTWLQQHFAEVGDASPA-AGDDSTISLASSIKALRNERE  850

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLA+R+ +RLT EER+ L+IKW+VPLE K R+L  +N+LWT P D  H+ ESA+IVA+LV
Sbjct  851  FLARRMGSRLTEEERERLFIKWQVPLEAKQRKLQLVNRLWTDPNDQAHIDESADIVARLV  910

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLL  265
            GFCE GN+S+EMFELNF +P  ++ W +GW  I++++
Sbjct  911  GFCEGGNISKEMFELNFAVPASRKPWLMGWQPISNMI  947



>gb|KCW44323.1| hypothetical protein EUGRSUZ_L02231 [Eucalyptus grandis]
Length=452

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 178/218 (82%), Gaps = 9/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLE+E N   G T +  + +   ++SP  W + F +Q +QII LW +C VSI+HR+QFY
Sbjct  242  QVLEMETN---GTTTDGSDTV---EQSPQPWPLIFEDQRKQIIMLWHLCHVSIMHRTQFY  295

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD +DQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP  S+SSSI+AL++E+E+L
Sbjct  296  LLFRGDPSDQIYLEVELRRLTWLEQHLAELGNASPALLGDEPAGSVSSSIRALKQEREYL  355

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++L+ EER+ LY+KWE+P  GK RRL  +N+LWT P + +HVQESAEIVAKLVGF
Sbjct  356  AKRVSSKLSAEEREMLYVKWEIPPVGKQRRLQLVNRLWTDPYNMQHVQESAEIVAKLVGF  415

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMF+LNFV PNDK+SW +GW+ I++LLHL
Sbjct  416  CESGEHVSKEMFQLNFVSPNDKKSW-LGWNLISNLLHL  452



>ref|XP_010041499.1| PREDICTED: kinesin-like protein NACK2, partial [Eucalyptus grandis]
Length=467

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 178/218 (82%), Gaps = 9/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLE+E N   G T +  + +   ++SP  W + F +Q +QII LW +C VSI+HR+QFY
Sbjct  257  QVLEMETN---GTTTDGSDTV---EQSPQPWPLIFEDQRKQIIMLWHLCHVSIMHRTQFY  310

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD +DQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP  S+SSSI+AL++E+E+L
Sbjct  311  LLFRGDPSDQIYLEVELRRLTWLEQHLAELGNASPALLGDEPAGSVSSSIRALKQEREYL  370

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++L+ EER+ LY+KWE+P  GK RRL  +N+LWT P + +HVQESAEIVAKLVGF
Sbjct  371  AKRVSSKLSAEEREMLYVKWEIPPVGKQRRLQLVNRLWTDPYNMQHVQESAEIVAKLVGF  430

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMF+LNFV PNDK+SW +GW+ I++LLHL
Sbjct  431  CESGEHVSKEMFQLNFVSPNDKKSW-LGWNLISNLLHL  467



>ref|XP_006644227.1| PREDICTED: kinesin-like protein NACK1-like [Oryza brachyantha]
Length=954

 Score =   290 bits (741),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 173/217 (80%), Gaps = 4/217 (2%)
 Frame = -2

Query  906  QVLELEANEAAGYTLEN--EENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELE+NE     +E+  EEN   +Q+ P SW   F+EQMQ II LWD+C VSIIHR+Q
Sbjct  732  QVLELESNEGKTNDMEDDSEENAGSLQDGPDSWDKLFKEQMQHIIQLWDLCHVSIIHRTQ  791

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            FYLLF+GD ADQIYIEVE+RRL+WLQQH AE+G+ASPA  G++  +SL+SSIKALR E+E
Sbjct  792  FYLLFRGDRADQIYIEVEVRRLSWLQQHFAEVGDASPA-AGDDSAISLASSIKALRNERE  850

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLA+R+ +RLT EER+ L+IKW+VPLE K R+L  +N+LWT P D  H++ESA+IVA+LV
Sbjct  851  FLARRMGSRLTEEERERLFIKWQVPLEAKQRKLQLVNRLWTDPNDQAHIEESADIVARLV  910

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLL  265
            GFCE GN+S+EMFELNF +P  ++ W +GW  I++++
Sbjct  911  GFCEGGNISKEMFELNFAVPASRKPWLLGWQPISNMI  947



>ref|XP_004968822.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Setaria 
italica]
 ref|XP_004968823.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Setaria 
italica]
 ref|XP_004968824.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Setaria 
italica]
Length=951

 Score =   287 bits (734),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 170/215 (79%), Gaps = 2/215 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELE+NE        E+N   +Q++P SW   F+EQMQ II LWD+C VSIIHR+QFY
Sbjct  731  QVLELESNEGKSNDDLEEDNSGPLQDTPDSWDRLFKEQMQHIIQLWDLCHVSIIHRTQFY  790

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD ADQIYIEVE+RRLTWLQQH AE+G+ASPA  G++  VSL SSIKALR E+EFL
Sbjct  791  LLFRGDRADQIYIEVEVRRLTWLQQHFAEVGDASPA-AGDDTAVSLVSSIKALRNEREFL  849

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            A+R+ +RLT EER+ L+IKW+VPL+ K R+L  +NKLWT P D  H++ESA++VA+LVGF
Sbjct  850  ARRMGSRLTDEERERLFIKWQVPLDAKQRKLQLVNKLWTDPNDQVHIEESADLVARLVGF  909

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLL  265
            CE GN+S+EMFELNF +P  ++ W +GW  I++++
Sbjct  910  CEGGNISKEMFELNFAVPTSRKPWLVGWQPISNMI  944



>ref|XP_007152726.1| hypothetical protein PHAVU_004G154300g [Phaseolus vulgaris]
 gb|ESW24720.1| hypothetical protein PHAVU_004G154300g [Phaseolus vulgaris]
Length=961

 Score =   286 bits (733),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 179/219 (82%), Gaps = 3/219 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEA G+ ++NEE   E +E    W I F+EQ Q I++LWD+C+VSIIHR+QFY
Sbjct  743  QVLELEANEANGHNIDNEEYPGEPEEPQIPWQIAFKEQRQLILELWDLCYVSIIHRTQFY  802

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPA-QLGNEPT-VSLSSSIKALRREKE  553
            LLFKGD ADQIY+EVE+RRLTWLQQ LAELGN S A   G+E T +SLSSS++AL+RE+E
Sbjct  803  LLFKGDPADQIYMEVELRRLTWLQQQLAELGNVSSAPHAGDEHTAISLSSSMRALKRERE  862

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FL+KRL +RL+ EE +ALY+KW+VPL+GK +R+ FI KLWT P D  HV+ESAEIVA+LV
Sbjct  863  FLSKRLSSRLSLEELEALYMKWDVPLDGKQKRMQFICKLWTDPHDQIHVEESAEIVARLV  922

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            GF   GNMS+EMFELNFV+P+DKR W +GW+ I +LL+L
Sbjct  923  GFRTGGNMSKEMFELNFVLPSDKRPWLMGWNPITNLLNL  961



>gb|EMT03728.1| Kinesin-related protein 4 [Aegilops tauschii]
Length=919

 Score =   285 bits (730),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 164/207 (79%), Gaps = 3/207 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENE--ENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELE+NE     ++ +  EN   +Q+ P SW I F+EQMQ II LWD+C VSIIHR+Q
Sbjct  703  QVLELESNEGKANEMDEDPVENAGSLQDGPESWEILFKEQMQHIIQLWDLCHVSIIHRTQ  762

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            FYLLF+GD ADQIYIEVE+RRLTWLQQH AE+G+ SPA L ++P VSL+SS+KALR E+E
Sbjct  763  FYLLFRGDMADQIYIEVEVRRLTWLQQHFAEVGDTSPAALSDDPAVSLASSMKALRNERE  822

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLA+R+ +RLT EER+ L+IKW+VPLE K R+L  +NKLW  P D  H++ESA+IVA+LV
Sbjct  823  FLARRMGSRLTEEERERLFIKWQVPLEAKQRKLQLVNKLWADPNDKAHIEESADIVARLV  882

Query  375  GFCESGNMSREMFELNFVIPNDKRSWF  295
            GFCE GN+S+EMFELNF +P  ++ W 
Sbjct  883  GFCEGGNISKEMFELNFALPASRKPWL  909



>ref|XP_002437695.1| hypothetical protein SORBIDRAFT_10g001010 [Sorghum bicolor]
 gb|EER89062.1| hypothetical protein SORBIDRAFT_10g001010 [Sorghum bicolor]
Length=950

 Score =   285 bits (728),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 168/215 (78%), Gaps = 5/215 (2%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELE+NE        E+N   +Q+ P SW   F+EQMQ II LWD C VSIIHR+QFY
Sbjct  732  QVLELESNEGKS---NGEDNSGPVQDGPDSWDRLFKEQMQCIIHLWDQCHVSIIHRTQFY  788

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD ADQIYIEVE+RRL WLQQH AE+G+ASP  + ++P VSL SS+KALR E+EFL
Sbjct  789  LLFRGDRADQIYIEVEVRRLVWLQQHFAEVGDASPGAV-DDPAVSLISSMKALRNEREFL  847

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            A+R+ +RLT EER+ L+IKW+VPL+ K R+L  +NKLWT P DP H++ESA++VA+LVGF
Sbjct  848  ARRMGSRLTDEERERLFIKWQVPLDAKQRKLQLVNKLWTDPNDPAHIEESADLVARLVGF  907

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLL  265
            CE GN+S+EMFELNF +P  K+ W +GW  I++++
Sbjct  908  CEGGNISKEMFELNFTVPTSKKPWMVGWQPISNMI  942



>gb|KDP33977.1| hypothetical protein JCGZ_07548 [Jatropha curcas]
Length=946

 Score =   283 bits (724),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 178/218 (82%), Gaps = 9/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEA+      E ++ +  +SP  WH+ F +Q +QI+ LW +C VSIIHR+QFY
Sbjct  736  QVLELEANEAST----TEASVAD--QSPMPWHLLFEDQRKQIVMLWHLCHVSIIHRTQFY  789

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD +DQIY+EVE+RRL+WL+QHL+ELGNASPA LG+EP  S+SSSIKAL++E+E+L
Sbjct  790  LLFKGDPSDQIYMEVELRRLSWLEQHLSELGNASPALLGDEPAGSVSSSIKALKQEREYL  849

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT EER+ LY KWEVP  GK RR   +NKLWT P + KH+QESAEIVAKLVGF
Sbjct  850  AKRVSSKLTAEEREMLYAKWEVPPVGKQRRQQLVNKLWTDPLNMKHIQESAEIVAKLVGF  909

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMFELNFV P DK++W +GW+ I++LLHL
Sbjct  910  CESGEHVSKEMFELNFVNPCDKKTW-MGWNLISNLLHL  946



>ref|XP_006381563.1| TETRASPORE family protein [Populus trichocarpa]
 gb|ERP59360.1| TETRASPORE family protein [Populus trichocarpa]
Length=952

 Score =   282 bits (721),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 175/218 (80%), Gaps = 9/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANE A    EN      + +SP  WH+ F +Q +QII LW +C VSIIHR+QFY
Sbjct  742  QVLELEANEEATTETEN------MDQSPMPWHLVFDDQRKQIIMLWHLCHVSIIHRTQFY  795

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+G+  DQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP  S+SSSIKALR+E+E+L
Sbjct  796  LLFRGEPGDQIYLEVELRRLTWLEQHLAELGNASPALLGDEPASSVSSSIKALRQEREYL  855

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT +ER+ LY+KWE+P  GK RRL  +NKLWT P + +H++ESAEIVAKLVGF
Sbjct  856  AKRVNSKLTVDEREMLYVKWEIPQGGKQRRLQLVNKLWTDPLNMQHIKESAEIVAKLVGF  915

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMFELNF  P DK++W +GW+ I+ LL+L
Sbjct  916  CESGEHVSKEMFELNFANPCDKKTW-MGWNLISSLLNL  952



>gb|ACL52849.1| unknown [Zea mays]
Length=622

 Score =   275 bits (704),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 164/215 (76%), Gaps = 5/215 (2%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELE+NE        E+N   +Q+ P SW   F+EQMQ II LWD C VSIIHR+QFY
Sbjct  404  QVLELESNEGKP---NGEDNSGPLQDGPDSWDRLFKEQMQCIIHLWDQCQVSIIHRTQFY  460

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD ADQIYIEVE+RRL WLQQH AE+G+ASP  +  +P VSL SS+KALR E+EFL
Sbjct  461  LLFRGDKADQIYIEVEVRRLVWLQQHFAEVGDASPGAV-EDPAVSLVSSMKALRNEREFL  519

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            A+R+ +RLT EER+ L+IKW+VPL+ K R+L  +NKLWT P D  H+ ESA +VA+LVGF
Sbjct  520  ARRMGSRLTDEERERLFIKWQVPLDAKQRKLQLVNKLWTDPNDQAHIDESAGLVARLVGF  579

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLL  265
            CE GN+S+EMFELNF +P  +R W +GW  I++++
Sbjct  580  CEGGNISKEMFELNFAVPTSRRPWLVGWQPISNMI  614



>ref|XP_011039916.1| PREDICTED: kinesin-like protein NACK2 [Populus euphratica]
Length=949

 Score =   281 bits (719),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 175/218 (80%), Gaps = 9/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANE A    EN      + +SP  WH+ F +Q +QII LW +C VSIIHR+QFY
Sbjct  739  QVLELEANEEATTETEN------MDQSPMPWHLVFDDQRKQIIMLWHLCHVSIIHRTQFY  792

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+G+  DQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP  S+SSSIKALR+E+E+L
Sbjct  793  LLFRGEPGDQIYLEVELRRLTWLEQHLAELGNASPALLGDEPASSVSSSIKALRQEREYL  852

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT +ER+ LY+KWE+P  GK RRL  +NKLWT P + +H++ES+EIVAKLVGF
Sbjct  853  AKRVNSKLTVDEREMLYVKWEIPQGGKQRRLQLVNKLWTDPLNMQHIKESSEIVAKLVGF  912

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMFELNF  P DK++W +GW+ I+ LL+L
Sbjct  913  CESGAHVSKEMFELNFANPCDKKTW-MGWNLISSLLNL  949



>ref|XP_010051345.1| PREDICTED: kinesin-like protein NACK2 [Eucalyptus grandis]
Length=921

 Score =   280 bits (717),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 178/218 (82%), Gaps = 9/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLE+E N   G T +  + +   ++SP  W + F +Q +QII LW +C VSI+HR+QFY
Sbjct  711  QVLEMETN---GTTTDGSDTV---EQSPQPWPLIFEDQRKQIIMLWHLCHVSIVHRTQFY  764

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD +DQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP  S+SSSI+AL++E+E+L
Sbjct  765  LLFRGDPSDQIYLEVELRRLTWLEQHLAELGNASPALLGDEPAGSVSSSIRALKQEREYL  824

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++L+ EER+ LY+KWE+P  GK RRL  +N+LWT P + +HVQESAEIVAKLVGF
Sbjct  825  AKRVSSKLSAEERELLYVKWEIPPVGKQRRLQLVNRLWTDPYNMQHVQESAEIVAKLVGF  884

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMF+LNFV PNDK+SW +GW+ I++LLHL
Sbjct  885  CESGEHVSKEMFQLNFVSPNDKKSW-LGWNLISNLLHL  921



>ref|XP_002275046.2| PREDICTED: kinesin-like protein NACK2 [Vitis vinifera]
Length=945

 Score =   281 bits (718),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 173/218 (79%), Gaps = 9/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELE NE A       E    I  SP SWH+ F  Q +QII LW +C VSIIHR+QF+
Sbjct  735  QVLELETNEPAT------EETDMIDHSPVSWHLMFESQRKQIIMLWYLCHVSIIHRTQFF  788

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP   +SSSIKAL++E+E+L
Sbjct  789  LLFKGDPADQIYMEVELRRLTWLEQHLAELGNASPALLGDEPASFVSSSIKALKQEREYL  848

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT EER+ LYIKWE+P  GK RRL  +NKLWT P + +H++ESAEIVAKLVGF
Sbjct  849  AKRVSSKLTEEEREMLYIKWEIPAVGKQRRLQLVNKLWTDPHNMEHIKESAEIVAKLVGF  908

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMFELNFV  +D++ W +GW+ I++LLHL
Sbjct  909  CESGEHVSKEMFELNFVSHSDRKPW-MGWNLISNLLHL  945



>emb|CBI27754.3| unnamed protein product [Vitis vinifera]
Length=942

 Score =   281 bits (718),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 173/218 (79%), Gaps = 9/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELE NE A       E    I  SP SWH+ F  Q +QII LW +C VSIIHR+QF+
Sbjct  732  QVLELETNEPAT------EETDMIDHSPVSWHLMFESQRKQIIMLWYLCHVSIIHRTQFF  785

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP   +SSSIKAL++E+E+L
Sbjct  786  LLFKGDPADQIYMEVELRRLTWLEQHLAELGNASPALLGDEPASFVSSSIKALKQEREYL  845

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT EER+ LYIKWE+P  GK RRL  +NKLWT P + +H++ESAEIVAKLVGF
Sbjct  846  AKRVSSKLTEEEREMLYIKWEIPAVGKQRRLQLVNKLWTDPHNMEHIKESAEIVAKLVGF  905

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMFELNFV  +D++ W +GW+ I++LLHL
Sbjct  906  CESGEHVSKEMFELNFVSHSDRKPW-MGWNLISNLLHL  942



>gb|KCW81847.1| hypothetical protein EUGRSUZ_C03198 [Eucalyptus grandis]
Length=943

 Score =   280 bits (717),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 178/218 (82%), Gaps = 9/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLE+E N   G T +  + +   ++SP  W + F +Q +QII LW +C VSI+HR+QFY
Sbjct  733  QVLEMETN---GTTTDGSDTV---EQSPQPWPLIFEDQRKQIIMLWHLCHVSIVHRTQFY  786

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD +DQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP  S+SSSI+AL++E+E+L
Sbjct  787  LLFRGDPSDQIYLEVELRRLTWLEQHLAELGNASPALLGDEPAGSVSSSIRALKQEREYL  846

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++L+ EER+ LY+KWE+P  GK RRL  +N+LWT P + +HVQESAEIVAKLVGF
Sbjct  847  AKRVSSKLSAEERELLYVKWEIPPVGKQRRLQLVNRLWTDPYNMQHVQESAEIVAKLVGF  906

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMF+LNFV PNDK+SW +GW+ I++LLHL
Sbjct  907  CESGEHVSKEMFQLNFVSPNDKKSW-LGWNLISNLLHL  943



>ref|XP_002875601.1| hypothetical protein ARALYDRAFT_323079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51860.1| hypothetical protein ARALYDRAFT_323079 [Arabidopsis lyrata subsp. 
lyrata]
Length=942

 Score =   280 bits (716),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 172/218 (79%), Gaps = 7/218 (3%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANE    +  +  +     ES   W + F EQ +QII LW +C +SIIHR+QFY
Sbjct  730  QVLELEANETGAASESDATD-----ESQMDWPLCFEEQRKQIIMLWHLCHISIIHRTQFY  784

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD ADQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP   ++SSI+AL++E+E+L
Sbjct  785  MLFKGDPADQIYMEVELRRLTWLEQHLAELGNASPALLGDEPASYVASSIRALKQEREYL  844

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ T+L  EER+ LY+KW+VP  GK RR  FINKLWT P + +HV+ESAEIVAKLVGF
Sbjct  845  AKRVNTKLGAEEREMLYLKWDVPPVGKQRRQQFINKLWTDPHNMQHVRESAEIVAKLVGF  904

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            C+SG N+ +EMFELNF  P+DK++W +GW+ I++LLHL
Sbjct  905  CDSGENIRKEMFELNFASPSDKKTWMMGWNFISNLLHL  942



>ref|XP_003568740.1| PREDICTED: kinesin-like protein NACK1 [Brachypodium distachyon]
Length=951

 Score =   280 bits (716),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 172/216 (80%), Gaps = 3/216 (1%)
 Frame = -2

Query  906  QVLELEANEAAGYTLEN-EENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELE+NE     +E+ EEN   +Q+SP SW+  F+ QMQ II LWD+C VSIIHRSQF
Sbjct  730  QVLELESNEGKPNDMEDQEENAGCLQDSPDSWNGLFKAQMQHIIQLWDLCHVSIIHRSQF  789

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLF+GD ADQIYIEVE+RRLTWLQQH AE+G+ASPA  G++  VS++S +KALR E+EF
Sbjct  790  YLLFRGDIADQIYIEVEVRRLTWLQQHFAEVGDASPAP-GDDLAVSIASCMKALRNEREF  848

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LA+R+ +RLT EER+AL++KW+VP+E K R+L  +NKLWT P D  H++ESA+ VA+LVG
Sbjct  849  LARRMRSRLTEEEREALFMKWQVPIEAKQRKLQLVNKLWTNPNDQAHIEESADTVARLVG  908

Query  372  FCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLL  265
            FCE GN+S+EMFELNF  P  ++ + +GW  I++++
Sbjct  909  FCEGGNISKEMFELNFASPASRKPFLMGWQPISNMI  944



>emb|CDP03034.1| unnamed protein product [Coffea canephora]
Length=944

 Score =   279 bits (714),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 177/221 (80%), Gaps = 12/221 (5%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAA    +N      I+ES  SW   F E+ +QI+ LW +C VSIIHR+QFY
Sbjct  731  QVLELEANEAASDGPDN------IEESSISWQSMFEERRKQIVMLWHLCHVSIIHRTQFY  784

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD +DQIY+EVE+RRLTWL+QHLA+LGNASPA LG++P   +SSSIKAL++E+E+L
Sbjct  785  LLFKGDPSDQIYMEVELRRLTWLEQHLADLGNASPALLGDDPASFVSSSIKALKQEREYL  844

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKN---RRLNFINKLWTKPQDPKHVQESAEIVAKL  379
            AKR+ T+LTPEER+ LY+KW +P EGK    RRL  +NKLW  P + +H++ESAEIVAKL
Sbjct  845  AKRVSTKLTPEEREMLYLKWNIPPEGKGKTKRRLQLVNKLWMDPLNMQHIKESAEIVAKL  904

Query  378  VGFCESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            VGFCE+G ++S+EMFELNFV P DK++W IGW+ I++LLHL
Sbjct  905  VGFCETGEHVSKEMFELNFVSPCDKKTW-IGWNLISNLLHL  944



>ref|XP_007012544.1| ATP binding microtubule motor family protein isoform 1 [Theobroma 
cacao]
 gb|EOY30163.1| ATP binding microtubule motor family protein isoform 1 [Theobroma 
cacao]
Length=946

 Score =   279 bits (713),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 174/218 (80%), Gaps = 8/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELE +   G      +    I +SP  WH+ F +Q +QI+ LW +C VSIIHR+QFY
Sbjct  735  QVLELEESNEVGT-----DETDRILQSPLPWHLVFEDQRKQIVMLWHLCHVSIIHRTQFY  789

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD ADQIY+EVE+RRLTWL+QH AELGNASPA LG+EP  S++SSI+AL++E+E+L
Sbjct  790  LLFRGDPADQIYMEVELRRLTWLEQHFAELGNASPALLGDEPAGSVASSIRALKQEREYL  849

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++L+ EER+ LY+KWEVP  GK RRL  +NKLWT P + +HVQESAEIVAKLVGF
Sbjct  850  AKRVSSKLSAEEREILYMKWEVPPVGKQRRLQLVNKLWTDPLNMQHVQESAEIVAKLVGF  909

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMFELNFV P DK+SW +GW+ I++LLHL
Sbjct  910  CESGEHISKEMFELNFVNPCDKKSW-MGWNLISNLLHL  946



>ref|XP_007012545.1| ATP binding microtubule motor family protein isoform 2 [Theobroma 
cacao]
 gb|EOY30164.1| ATP binding microtubule motor family protein isoform 2 [Theobroma 
cacao]
Length=943

 Score =   279 bits (713),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 174/218 (80%), Gaps = 8/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELE +   G      +    I +SP  WH+ F +Q +QI+ LW +C VSIIHR+QFY
Sbjct  732  QVLELEESNEVGT-----DETDRILQSPLPWHLVFEDQRKQIVMLWHLCHVSIIHRTQFY  786

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD ADQIY+EVE+RRLTWL+QH AELGNASPA LG+EP  S++SSI+AL++E+E+L
Sbjct  787  LLFRGDPADQIYMEVELRRLTWLEQHFAELGNASPALLGDEPAGSVASSIRALKQEREYL  846

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++L+ EER+ LY+KWEVP  GK RRL  +NKLWT P + +HVQESAEIVAKLVGF
Sbjct  847  AKRVSSKLSAEEREILYMKWEVPPVGKQRRLQLVNKLWTDPLNMQHVQESAEIVAKLVGF  906

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMFELNFV P DK+SW +GW+ I++LLHL
Sbjct  907  CESGEHISKEMFELNFVNPCDKKSW-MGWNLISNLLHL  943



>ref|XP_010503028.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
 ref|XP_010503029.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
 ref|XP_010503030.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
 ref|XP_010503031.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
Length=940

 Score =   278 bits (711),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 172/218 (79%), Gaps = 7/218 (3%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANE  G   E++       ES   W + F EQ +QII LW +C +SIIHR+QFY
Sbjct  728  QVLELEANET-GPASESDAT----DESQMDWPLCFEEQRKQIIMLWHLCHISIIHRTQFY  782

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD ADQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP   ++SSI+AL++E+E+L
Sbjct  783  MLFKGDPADQIYMEVELRRLTWLEQHLAELGNASPALLGDEPASYVASSIRALKQEREYL  842

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ T+L  EER+ LY+KW+VP  GK RR  FINKLWT P +  HV+ESAEIVAKLVGF
Sbjct  843  AKRVNTKLGAEEREMLYLKWDVPPVGKQRRHQFINKLWTDPHNMHHVRESAEIVAKLVGF  902

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            C+SG N+ +EMFELNF  P+DK++W +GW+ I++LLHL
Sbjct  903  CDSGENIRKEMFELNFASPSDKKTWMMGWNFISNLLHL  940



>gb|KDO73778.1| hypothetical protein CISIN_1g003967mg [Citrus sinensis]
Length=783

 Score =   275 bits (703),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 174/218 (80%), Gaps = 9/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEAN+AA      E +IP     P  WH+ F EQ  QI+ LW +C VSIIHR+QFY
Sbjct  573  QVLELEANDAAS----EETDIPNPSSMP--WHLMFEEQRMQIVMLWHLCHVSIIHRTQFY  626

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD  DQIY+EVE+RRLTWL+QH AELGNASPA LG+EP  S++SS+KAL++E+E+L
Sbjct  627  LLFRGDPTDQIYMEVELRRLTWLEQHFAELGNASPALLGDEPAGSVASSVKALKQEREYL  686

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT EER+ LY+KW++P  GK RRL  +NKLWT P + ++V+ESAEIVA+LVGF
Sbjct  687  AKRVSSKLTAEERELLYMKWDIPQVGKQRRLQLVNKLWTDPLNMQNVKESAEIVAQLVGF  746

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG + S+EMFELNF  P+DK++W +GW+ I++LLHL
Sbjct  747  CESGEHASKEMFELNFANPSDKKTW-MGWNLISNLLHL  783



>ref|XP_010514712.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
 ref|XP_010514713.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
 ref|XP_010514714.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
 ref|XP_010514715.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
Length=940

 Score =   277 bits (709),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 172/218 (79%), Gaps = 7/218 (3%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANE  G   E++       ES   W + F EQ +QII LW +C +SIIHR+QFY
Sbjct  728  QVLELEANET-GPASESDAT----DESQMDWPLCFEEQRKQIIMLWHLCHISIIHRTQFY  782

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD ADQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP   ++SS++AL++E+E+L
Sbjct  783  MLFKGDPADQIYMEVELRRLTWLEQHLAELGNASPALLGDEPASYVASSVRALKQEREYL  842

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ T+L  EER+ LY+KW+VP  GK RR  FINKLWT P +  HV+ESAEIVAKLVGF
Sbjct  843  AKRVNTKLGAEEREMLYLKWDVPPVGKQRRHQFINKLWTDPHNMHHVRESAEIVAKLVGF  902

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            C+SG N+ +EMFELNF  P+DK++W +GW+ I++LLHL
Sbjct  903  CDSGENIRKEMFELNFASPSDKKTWMMGWNFISNLLHL  940



>ref|XP_006290563.1| hypothetical protein CARUB_v10016650mg [Capsella rubella]
 gb|EOA23461.1| hypothetical protein CARUB_v10016650mg [Capsella rubella]
Length=941

 Score =   276 bits (707),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 171/218 (78%), Gaps = 7/218 (3%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLE+EANE    +      +    ES   W + F EQ +QII LW +C +SIIHR+QFY
Sbjct  729  QVLEMEANETGAAS-----ELDATDESQMDWPLCFDEQRKQIIMLWHLCHISIIHRTQFY  783

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD ADQIY+EVE+RRLTWL+QH+AELGNASPA LG+EP   ++SSI+AL++E+++L
Sbjct  784  MLFKGDPADQIYMEVELRRLTWLEQHMAELGNASPALLGDEPASYVASSIRALKQERDYL  843

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ T+L  EER+ LY+KW++P  GK RR  FINKLWT P + +HV+ESAEIVAKLVGF
Sbjct  844  AKRVNTKLGAEEREMLYLKWDIPPVGKQRRHQFINKLWTDPHNMQHVRESAEIVAKLVGF  903

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            C+SG N+ +EMFELNF  P+DK++W +GW+ I++LLHL
Sbjct  904  CDSGENIRKEMFELNFASPSDKKTWMMGWNFISNLLHL  941



>ref|XP_008659376.1| PREDICTED: kinesin-like protein NACK1 [Zea mays]
 gb|AFW86157.1| hypothetical protein ZEAMMB73_908447 [Zea mays]
Length=950

 Score =   276 bits (707),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 164/215 (76%), Gaps = 5/215 (2%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELE+NE        E+N   +Q+ P SW   F+EQMQ II LWD C VSIIHR+QFY
Sbjct  732  QVLELESNEGKP---NGEDNSGPLQDGPDSWDRLFKEQMQCIIHLWDQCQVSIIHRTQFY  788

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD ADQIYIEVE+RRL WLQQH AE+G+ASP  +  +P VSL SS+KALR E+EFL
Sbjct  789  LLFRGDKADQIYIEVEVRRLVWLQQHFAEVGDASPGAV-EDPAVSLVSSMKALRNEREFL  847

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            A+R+ +RLT EER+ L+IKW+VPL+ K R+L  +NKLWT P D  H+ ESA +VA+LVGF
Sbjct  848  ARRMGSRLTDEERERLFIKWQVPLDAKQRKLQLVNKLWTDPNDQAHIDESAGLVARLVGF  907

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLL  265
            CE GN+S+EMFELNF +P  +R W +GW  I++++
Sbjct  908  CEGGNISKEMFELNFAVPTSRRPWLVGWQPISNMI  942



>ref|XP_008460562.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Cucumis melo]
Length=935

 Score =   276 bits (706),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 174/218 (80%), Gaps = 9/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVL+LE NE     L        ++ +P SWH  F +Q +QII LW +C VS+IHR+QFY
Sbjct  725  QVLDLEKNENESGALNT------VEHTPVSWHTIFEDQRKQIIVLWHLCHVSLIHRTQFY  778

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD +DQIY+EVE RRLTWL+QHLAELGNASPA LG++P  S+ +S+KAL++E+E+L
Sbjct  779  LLFKGDPSDQIYMEVEWRRLTWLEQHLAELGNASPALLGDDPASSVYASVKALKQEREYL  838

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT EER+ LY+KWEVP  GK RRL  +NKLWT P + KH+QESAEIVA+LVGF
Sbjct  839  AKRVGSKLTAEEREMLYVKWEVPQVGKQRRLQLVNKLWTDPLNMKHIQESAEIVARLVGF  898

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMFELNFV P+D+++W +GW+ I++LL+L
Sbjct  899  CESGEHVSKEMFELNFVCPSDRKTW-MGWNLISNLLNL  935



>ref|NP_189907.2| kinesin TETRASPORE [Arabidopsis thaliana]
 sp|Q8LNZ2.1|NACK2_ARATH RecName: Full=Kinesin-like protein NACK2; Short=AtNACK2; AltName: 
Full=NPK1-activating kinesin 2; AltName: Full=Protein STUD; 
AltName: Full=Protein TETRASPORE [Arabidopsis thaliana]
 dbj|BAC03248.1| kinesin-like protein [Arabidopsis thaliana]
 gb|AEE77774.1| kinesin TETRASPORE [Arabidopsis thaliana]
Length=938

 Score =   276 bits (706),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 171/218 (78%), Gaps = 7/218 (3%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANE    +  +  +     ES   W + F EQ +QII LW +C +SIIHR+QFY
Sbjct  726  QVLELEANETGAASEYDATD-----ESQMDWPLCFEEQRKQIIMLWHLCHISIIHRTQFY  780

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD ADQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP   ++SSI+AL++E+E+L
Sbjct  781  MLFKGDPADQIYMEVELRRLTWLEQHLAELGNASPALLGDEPASYVASSIRALKQEREYL  840

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ T+L  EER+ LY+KW+VP  GK RR  FINKLWT P + +HV+ESAEIVAKLVGF
Sbjct  841  AKRVNTKLGAEEREMLYLKWDVPPVGKQRRQQFINKLWTDPHNMQHVRESAEIVAKLVGF  900

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            C+SG  + +EMFELNF  P+DK++W +GW+ I++LLHL
Sbjct  901  CDSGETIRKEMFELNFASPSDKKTWMMGWNFISNLLHL  938



>emb|CAD42234.1| kinesin-like protein [Arabidopsis thaliana]
 emb|CAD48111.1| putative kinesin protein [Arabidopsis thaliana]
Length=937

 Score =   276 bits (706),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 171/218 (78%), Gaps = 7/218 (3%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANE    +  +  +     ES   W + F EQ +QII LW +C +SIIHR+QFY
Sbjct  725  QVLELEANETGAASEYDATD-----ESQMDWPLCFEEQRKQIIMLWHLCHISIIHRTQFY  779

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD ADQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP   ++SSI+AL++E+E+L
Sbjct  780  MLFKGDPADQIYMEVELRRLTWLEQHLAELGNASPALLGDEPASYVASSIRALKQEREYL  839

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ T+L  EER+ LY+KW+VP  GK RR  FINKLWT P + +HV+ESAEIVAKLVGF
Sbjct  840  AKRVNTKLGAEEREMLYLKWDVPPVGKQRRQQFINKLWTDPHNMQHVRESAEIVAKLVGF  899

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            C+SG  + +EMFELNF  P+DK++W +GW+ I++LLHL
Sbjct  900  CDSGETIRKEMFELNFASPSDKKTWMMGWNFISNLLHL  937



>ref|XP_008460563.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Cucumis melo]
Length=929

 Score =   276 bits (705),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 174/218 (80%), Gaps = 9/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVL+LE NE     L        ++ +P SWH  F +Q +QII LW +C VS+IHR+QFY
Sbjct  719  QVLDLEKNENESGALNT------VEHTPVSWHTIFEDQRKQIIVLWHLCHVSLIHRTQFY  772

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD +DQIY+EVE RRLTWL+QHLAELGNASPA LG++P  S+ +S+KAL++E+E+L
Sbjct  773  LLFKGDPSDQIYMEVEWRRLTWLEQHLAELGNASPALLGDDPASSVYASVKALKQEREYL  832

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT EER+ LY+KWEVP  GK RRL  +NKLWT P + KH+QESAEIVA+LVGF
Sbjct  833  AKRVGSKLTAEEREMLYVKWEVPQVGKQRRLQLVNKLWTDPLNMKHIQESAEIVARLVGF  892

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMFELNFV P+D+++W +GW+ I++LL+L
Sbjct  893  CESGEHVSKEMFELNFVCPSDRKTW-MGWNLISNLLNL  929



>emb|CAD42658.1| kinesin-like protein [Arabidopsis thaliana]
 emb|CAD45645.1| putative kinesin-like protein [Arabidopsis thaliana]
Length=937

 Score =   276 bits (705),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 171/218 (78%), Gaps = 7/218 (3%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANE    +  +  +     ES   W + F EQ +QII LW +C +SIIHR+QFY
Sbjct  725  QVLELEANETGAASEYDATD-----ESRMDWPLCFEEQRKQIIMLWHLCHISIIHRTQFY  779

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD ADQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP   ++SSI+AL++E+E+L
Sbjct  780  MLFKGDPADQIYMEVELRRLTWLEQHLAELGNASPALLGDEPASYVASSIRALKQEREYL  839

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ T+L  EER+ LY+KW+VP  GK RR  FINKLWT P + +HV+ESAEIVAKLVGF
Sbjct  840  AKRVNTKLGAEEREMLYLKWDVPPVGKQRRQQFINKLWTDPHNMQHVRESAEIVAKLVGF  899

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            C+SG  + +EMFELNF  P+DK++W +GW+ I++LLHL
Sbjct  900  CDSGETIRKEMFELNFASPSDKKTWMMGWNFISNLLHL  937



>gb|KGN51423.1| hypothetical protein Csa_5G537000 [Cucumis sativus]
Length=938

 Score =   275 bits (704),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 175/218 (80%), Gaps = 8/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVL+LE N      L     +  I+ +PASWH  F +Q +QII LW +C VS+IHR+QFY
Sbjct  727  QVLDLEKNGNESGAL-----MDTIEHTPASWHTIFEDQRKQIIVLWHLCHVSLIHRTQFY  781

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD +DQIY++VE RRLTWL+QHLAELGNASPA LG++P  S+ +S+KAL++E+E+L
Sbjct  782  LLFKGDPSDQIYMDVEWRRLTWLEQHLAELGNASPALLGDDPASSVYASVKALKQEREYL  841

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT EER+ LY+KWEVP  GK RRL  +NKLWT P + KH+QESAEIVAKLVGF
Sbjct  842  AKRVSSKLTVEEREMLYVKWEVPQVGKQRRLQLVNKLWTDPLNMKHIQESAEIVAKLVGF  901

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMFELNFV P+D+++W +GW+ I++LL+L
Sbjct  902  CESGEHVSKEMFELNFVCPSDRKTW-MGWNLISNLLNL  938



>ref|XP_006474579.1| PREDICTED: kinesin-like protein NACK2-like [Citrus sinensis]
Length=945

 Score =   275 bits (702),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 174/218 (80%), Gaps = 9/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEAN+AA      E +IP     P  WH+ F EQ  QI+ LW +C VSIIHR+QFY
Sbjct  735  QVLELEANDAAS----EETDIPNPSSMP--WHLMFEEQRMQIVMLWHLCHVSIIHRTQFY  788

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD  DQIY+EVE+RRLTWL+QH AELGNASPA LG+EP  S++SS+KAL++E+E+L
Sbjct  789  LLFRGDPTDQIYMEVELRRLTWLEQHFAELGNASPALLGDEPAGSVASSVKALKQEREYL  848

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT EER+ LY+KW++P  GK RRL  +NKLWT P + ++V+ESAEIVA+LVGF
Sbjct  849  AKRVSSKLTAEERELLYMKWDIPQVGKQRRLQLVNKLWTDPLNMQNVKESAEIVAQLVGF  908

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG + S+EMFELNF  P+DK++W +GW+ I++LLHL
Sbjct  909  CESGEHASKEMFELNFANPSDKKTW-MGWNLISNLLHL  945



>ref|XP_006452892.1| hypothetical protein CICLE_v10007377mg [Citrus clementina]
 gb|ESR66132.1| hypothetical protein CICLE_v10007377mg [Citrus clementina]
Length=943

 Score =   275 bits (702),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 174/218 (80%), Gaps = 9/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEAN+AA      E +IP     P  WH+ F EQ  QI+ LW +C VSIIHR+QFY
Sbjct  733  QVLELEANDAAS----EETDIPNPSSMP--WHLMFEEQRMQIVMLWHLCHVSIIHRTQFY  786

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD  DQIY+EVE+RRLTWL+QH AELGNASPA LG+EP  S++SS+KAL++E+E+L
Sbjct  787  LLFRGDPTDQIYMEVELRRLTWLEQHFAELGNASPALLGDEPAGSVASSVKALKQEREYL  846

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT EER+ LY+KW++P  GK RRL  +NKLWT P + ++V+ESAEIVA+LVGF
Sbjct  847  AKRVSSKLTAEERELLYMKWDIPQVGKQRRLQLVNKLWTDPLNMQNVKESAEIVAQLVGF  906

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG + S+EMFELNF  P+DK++W +GW+ I++LLHL
Sbjct  907  CESGEHASKEMFELNFANPSDKKTW-MGWNLISNLLHL  943



>gb|KHG14242.1| Kinesin-related 4 [Gossypium arboreum]
Length=947

 Score =   275 bits (702),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 177/218 (81%), Gaps = 8/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELE  + +G T + E ++    +SP  WH+ F +Q +QI+ LW +C VSIIHR+QFY
Sbjct  736  QVLELEEAKESG-TDDAESDL----QSPMPWHMVFEDQRKQIVMLWHLCHVSIIHRTQFY  790

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD ADQIY+EVE+RRLTWL+Q  AELGNASPA LG+EP   ++SSIKAL++E+E+L
Sbjct  791  LLFRGDPADQIYMEVELRRLTWLEQQFAELGNASPALLGDEPAGLVASSIKALKQEREYL  850

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT EER+ LY+KW+VP  GK RRL  +NKLWT P + +HVQESAE+VAKLVGF
Sbjct  851  AKRVSSKLTVEERELLYLKWDVPAVGKQRRLQLVNKLWTDPLNMQHVQESAELVAKLVGF  910

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMFELNFV P+DK+SW +GW+ I++LLHL
Sbjct  911  CESGEHLSKEMFELNFVNPSDKKSW-MGWNLISNLLHL  947



>gb|EMS62599.1| Kinesin-related protein 4 [Triticum urartu]
Length=1276

 Score =   276 bits (706),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 168/218 (77%), Gaps = 4/218 (2%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENE--ENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELE+NE     +E +  EN   +Q+ P SW   F+EQMQ II LWD+C+VSIIHR+Q
Sbjct  730  QVLELESNEGKPNDMEEDPQENAGCLQDGPESWERLFKEQMQHIIQLWDICYVSIIHRTQ  789

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            FY LF+GD+ADQIYIEVE+RRL WLQQHLAE+G+ASPA  G+E  VS +SSIKALR E+E
Sbjct  790  FYRLFRGDTADQIYIEVEVRRLLWLQQHLAEVGDASPAAPGDEHAVSRASSIKALRNERE  849

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLA+R+ +++T EER+ L+IKW VPLE K R+L   +KLWT P D  H++ESA+IVA+LV
Sbjct  850  FLARRMGSKMTEEERERLFIKWRVPLEAKQRKLQLASKLWTDPDDEAHIEESADIVARLV  909

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFI-GWDQIADLL  265
            GFCE GN+S+EMFELNF  P  K+ W   GW  I++++
Sbjct  910  GFCEGGNVSKEMFELNFASPATKKPWLTAGWHPISNMI  947



>ref|XP_006419132.1| hypothetical protein EUTSA_v10002392mg [Eutrema salsugineum]
 gb|ESQ37568.1| hypothetical protein EUTSA_v10002392mg [Eutrema salsugineum]
Length=940

 Score =   273 bits (699),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 169/218 (78%), Gaps = 7/218 (3%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVL+LEANE A  +  +  +     ES   W + F EQ +QII LW +C +SIIHR+QFY
Sbjct  728  QVLDLEANETAAASESDATD-----ESQMDWPLCFEEQRKQIIMLWHLCHISIIHRTQFY  782

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
             LFKGD ADQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP   ++SSI+AL++E+E+L
Sbjct  783  KLFKGDPADQIYMEVELRRLTWLEQHLAELGNASPALLGDEPASYVASSIRALKQEREYL  842

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ T+L  EER+ LY+KW+VP  GK RR   INKLWT P + +HV+ESAEIVAKLVGF
Sbjct  843  AKRVNTKLGAEEREMLYLKWDVPPVGKQRRQQLINKLWTDPHNTQHVRESAEIVAKLVGF  902

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            C+SG N+ +EMFELNF  P  K++W +GW+ I++LLHL
Sbjct  903  CDSGENIRKEMFELNFASPAGKKTWMMGWNFISNLLHL  940



>gb|AAK91813.1|AF272750_1 kinesin heavy chain [Zea mays]
Length=765

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 158/207 (76%), Gaps = 5/207 (2%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELE+NE        E+N   +Q+ P SW   F+EQMQ II LWD C VSIIHR+QFY
Sbjct  544  QVLELESNEGKP---NGEDNSGPLQDGPDSWDRLFKEQMQCIIHLWDQCQVSIIHRTQFY  600

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD ADQIYIEVE+RRL WLQQH AE+G+ASP  +  +P VSL SS+KALR E+EFL
Sbjct  601  LLFRGDKADQIYIEVEVRRLVWLQQHFAEVGDASPGAV-EDPAVSLVSSMKALRNEREFL  659

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            A+R+ +RLT EER+ L+IKW+VPL+ K R+L  +NKLWT P D  H+ ESA +VA+LVGF
Sbjct  660  ARRMGSRLTDEERERLFIKWQVPLDAKQRKLQLVNKLWTDPNDQAHIDESAGLVARLVGF  719

Query  369  CESGNMSREMFELNFVIPNDKRSWFIG  289
            CE GN+S+EMFELNF +P  +R W +G
Sbjct  720  CEGGNISKEMFELNFAVPTSRRPWLVG  746



>ref|XP_010323978.1| PREDICTED: kinesin-like protein NACK2 [Solanum lycopersicum]
Length=960

 Score =   272 bits (696),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 179/219 (82%), Gaps = 10/219 (5%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAA     +E +I E  +SP SWH+ F +Q QQII LW +C VS++HR+QFY
Sbjct  749  QVLELEANEAA----TDEADITE--QSPLSWHLVFEDQRQQIIMLWHLCHVSLVHRTQFY  802

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD +DQIY+EVE+RRLTWL QHLA LGNASPA LG++P   +SSSIKAL++E+E+L
Sbjct  803  MLFKGDPSDQIYMEVELRRLTWLDQHLAGLGNASPALLGDDPAGYVSSSIKALKQEREYL  862

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGK-NRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            AKR+ ++L  EER+ LY+KW++P EGK  RRL  +NKLW+ P + ++ +ESAE+VAKLVG
Sbjct  863  AKRVSSKLNAEEREMLYMKWDIPPEGKQKRRLQLVNKLWSDPLNMQNARESAEVVAKLVG  922

Query  372  FCESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE+G ++S+EMF+LNFV P+DK++W +GW+ I++LLHL
Sbjct  923  FCETGEHVSKEMFQLNFVSPSDKKTW-LGWNLISNLLHL  960



>emb|CDY44836.1| BnaCnng11920D [Brassica napus]
Length=909

 Score =   271 bits (693),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 166/218 (76%), Gaps = 13/218 (6%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QV+ELE NE A           E  ES   W + F EQ +QII LW +C +SIIHR+QFY
Sbjct  703  QVIELEGNETA-----------ESDESQMEWPLCFEEQRKQIIMLWHLCHISIIHRTQFY  751

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD ADQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP   ++SSI+AL++E+E+L
Sbjct  752  MLFKGDPADQIYMEVELRRLTWLEQHLAELGNASPALLGDEPASYVASSIRALKQEREYL  811

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ T+L  EER+ LY+KW+V   GK RR   INKLWT P + +HV+ESAEIVAKLVGF
Sbjct  812  AKRVNTKLGAEEREMLYLKWDVAPVGKQRRQQLINKLWTDPHNTEHVKESAEIVAKLVGF  871

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            C+SG N+ +EMFELNF  P DK++W +GW+ I++ LHL
Sbjct  872  CDSGENIRKEMFELNFASPADKKTWMMGWNFISNFLHL  909



>ref|XP_006353764.1| PREDICTED: kinesin-like protein NACK2-like [Solanum tuberosum]
Length=957

 Score =   271 bits (693),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 179/219 (82%), Gaps = 10/219 (5%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAA     +E +I +  +SP SWH+ F +Q QQII LW +C VS++HR+QFY
Sbjct  746  QVLELEANEAAS----DEADITD--QSPLSWHLVFEDQRQQIIMLWHLCHVSLVHRTQFY  799

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD +DQIY+EVE+RRLTWL QHLA LGNASPA LG++P   +SSSIKAL++E+E+L
Sbjct  800  MLFKGDPSDQIYMEVELRRLTWLDQHLAGLGNASPALLGDDPAGYVSSSIKALKQEREYL  859

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKN-RRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            AKR+ ++L  EER+ LY+KW++P EGK  RRL  +NKLW+ P + ++V ESAE+VAKLVG
Sbjct  860  AKRVSSKLNAEEREMLYMKWDIPPEGKQRRRLQLVNKLWSDPLNMQNVCESAEVVAKLVG  919

Query  372  FCESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE+G ++S+EMF+LNFV P+DK++W +GW+ I++LLHL
Sbjct  920  FCETGEHVSKEMFQLNFVSPSDKKTW-LGWNLISNLLHL  957



>emb|CAB89042.1| kinesin-like protein [Arabidopsis thaliana]
Length=932

 Score =   269 bits (687),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 169/218 (78%), Gaps = 7/218 (3%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            Q+L  +ANE    +  +  +     ES   W + F EQ +QII LW +C +SIIHR+QFY
Sbjct  720  QLLVCQANETGAASEYDATD-----ESQMDWPLCFEEQRKQIIMLWHLCHISIIHRTQFY  774

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD ADQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP   ++SSI+AL++E+E+L
Sbjct  775  MLFKGDPADQIYMEVELRRLTWLEQHLAELGNASPALLGDEPASYVASSIRALKQEREYL  834

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ T+L  EER+ LY+KW+VP  GK RR  FINKLWT P + +HV+ESAEIVAKLVGF
Sbjct  835  AKRVNTKLGAEEREMLYLKWDVPPVGKQRRQQFINKLWTDPHNMQHVRESAEIVAKLVGF  894

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            C+SG  + +EMFELNF  P+DK++W +GW+ I++LLHL
Sbjct  895  CDSGETIRKEMFELNFASPSDKKTWMMGWNFISNLLHL  932



>ref|XP_004287670.1| PREDICTED: uncharacterized protein LOC101306666 [Fragaria vesca 
subsp. vesca]
Length=947

 Score =   268 bits (685),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 174/219 (79%), Gaps = 9/219 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQES-PASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QV+ +E ++ AG      E   +I ES P +WH+TF E  ++I+ LW +C VSI HRSQF
Sbjct  735  QVISMEEDKEAGT-----EETDKINESIPLAWHLTFEEDRREIVMLWHLCHVSITHRSQF  789

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLFKGD +DQIY+EVE+RRL WL+QH ++LGNASPA LG+EP+ ++S+SIKAL++E+E+
Sbjct  790  YLLFKGDPSDQIYMEVELRRLQWLEQHFSDLGNASPALLGDEPSGTVSASIKALKQEREY  849

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKR+ ++LT +ER+ LY KW+VP  GK RRL  +NKLWT P + +HVQESAEIVAKLVG
Sbjct  850  LAKRVSSKLTADERELLYAKWDVPPGGKQRRLQLVNKLWTDPHNMQHVQESAEIVAKLVG  909

Query  372  FCESGN-MSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCESG  +S+EMFELNF  P+DK++W +GW+ I++LL+L
Sbjct  910  FCESGEPVSKEMFELNFACPSDKKTW-MGWNLISNLLNL  947



>sp|Q8S949.1|NACK2_TOBAC RecName: Full=Kinesin-like protein NACK2; AltName: Full=NPK1-activating 
kinesin 2 [Nicotiana tabacum]
 dbj|BAB86284.1| kinesin-like protein NACK2 [Nicotiana tabacum]
Length=955

 Score =   268 bits (685),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 179/219 (82%), Gaps = 10/219 (5%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAA     +E +I +  +SP SWH+ F +Q QQII LW +C VS++HR+QFY
Sbjct  744  QVLELEANEAAS----DEADISD--QSPLSWHLVFEDQRQQIIMLWHLCHVSLVHRTQFY  797

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD +DQIY+EVE+RRLTWL +HLA LGNASPA LG++    +SSSIKAL++E+E+L
Sbjct  798  MLFKGDPSDQIYLEVELRRLTWLDEHLAGLGNASPALLGDDAAGYVSSSIKALKQEREYL  857

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKN-RRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            AKR+ ++L  EER+ LY+KW++P +GK  RRL  +NKLW+ P + ++V++SAE+VAKLVG
Sbjct  858  AKRVSSKLNAEEREMLYVKWDIPPDGKQRRRLQLVNKLWSDPLNMQNVRDSAEVVAKLVG  917

Query  372  FCESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE+G ++S+EMF+LNFV P+DK++W IGW+ I++LLHL
Sbjct  918  FCETGEHVSKEMFQLNFVSPSDKKTW-IGWNLISNLLHL  955



>ref|XP_009786270.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Nicotiana sylvestris]
Length=956

 Score =   268 bits (685),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 179/219 (82%), Gaps = 10/219 (5%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAA     +E +I +  +SP SWH+ F +Q QQII LW +C VS++HR+QFY
Sbjct  745  QVLELEANEAAS----DEADISD--QSPLSWHLVFEDQRQQIIMLWHLCHVSLVHRTQFY  798

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD +DQIY+EVE+RRLTWL +HLA LGNASPA LG++    +SSSIKAL++E+E+L
Sbjct  799  MLFKGDPSDQIYLEVELRRLTWLDEHLAGLGNASPALLGDDAAGYVSSSIKALKQEREYL  858

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKN-RRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            AKR+ ++L  EER+ LY+KW++P +GK  RRL  +NKLW+ P + ++V++SAE+VAKLVG
Sbjct  859  AKRVSSKLNAEEREMLYVKWDIPPDGKQRRRLQLVNKLWSDPLNMQNVRDSAEVVAKLVG  918

Query  372  FCESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE+G ++S+EMF+LNFV P+DK++W IGW+ I++LLHL
Sbjct  919  FCETGEHVSKEMFQLNFVSPSDKKTW-IGWNLISNLLHL  956



>ref|XP_009786269.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Nicotiana sylvestris]
Length=958

 Score =   268 bits (685),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 179/219 (82%), Gaps = 10/219 (5%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAA     +E +I +  +SP SWH+ F +Q QQII LW +C VS++HR+QFY
Sbjct  747  QVLELEANEAAS----DEADISD--QSPLSWHLVFEDQRQQIIMLWHLCHVSLVHRTQFY  800

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD +DQIY+EVE+RRLTWL +HLA LGNASPA LG++    +SSSIKAL++E+E+L
Sbjct  801  MLFKGDPSDQIYLEVELRRLTWLDEHLAGLGNASPALLGDDAAGYVSSSIKALKQEREYL  860

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKN-RRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            AKR+ ++L  EER+ LY+KW++P +GK  RRL  +NKLW+ P + ++V++SAE+VAKLVG
Sbjct  861  AKRVSSKLNAEEREMLYVKWDIPPDGKQRRRLQLVNKLWSDPLNMQNVRDSAEVVAKLVG  920

Query  372  FCESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE+G ++S+EMF+LNFV P+DK++W IGW+ I++LLHL
Sbjct  921  FCETGEHVSKEMFQLNFVSPSDKKTW-IGWNLISNLLHL  958



>ref|XP_009786272.1| PREDICTED: kinesin-like protein NACK2 isoform X4 [Nicotiana sylvestris]
Length=953

 Score =   268 bits (685),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 179/219 (82%), Gaps = 10/219 (5%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAA     +E +I +  +SP SWH+ F +Q QQII LW +C VS++HR+QFY
Sbjct  742  QVLELEANEAAS----DEADISD--QSPLSWHLVFEDQRQQIIMLWHLCHVSLVHRTQFY  795

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD +DQIY+EVE+RRLTWL +HLA LGNASPA LG++    +SSSIKAL++E+E+L
Sbjct  796  MLFKGDPSDQIYLEVELRRLTWLDEHLAGLGNASPALLGDDAAGYVSSSIKALKQEREYL  855

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKN-RRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            AKR+ ++L  EER+ LY+KW++P +GK  RRL  +NKLW+ P + ++V++SAE+VAKLVG
Sbjct  856  AKRVSSKLNAEEREMLYVKWDIPPDGKQRRRLQLVNKLWSDPLNMQNVRDSAEVVAKLVG  915

Query  372  FCESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE+G ++S+EMF+LNFV P+DK++W IGW+ I++LLHL
Sbjct  916  FCETGEHVSKEMFQLNFVSPSDKKTW-IGWNLISNLLHL  953



>ref|XP_009786271.1| PREDICTED: kinesin-like protein NACK2 isoform X3 [Nicotiana sylvestris]
Length=955

 Score =   268 bits (684),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 179/219 (82%), Gaps = 10/219 (5%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAA     +E +I +  +SP SWH+ F +Q QQII LW +C VS++HR+QFY
Sbjct  744  QVLELEANEAAS----DEADISD--QSPLSWHLVFEDQRQQIIMLWHLCHVSLVHRTQFY  797

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD +DQIY+EVE+RRLTWL +HLA LGNASPA LG++    +SSSIKAL++E+E+L
Sbjct  798  MLFKGDPSDQIYLEVELRRLTWLDEHLAGLGNASPALLGDDAAGYVSSSIKALKQEREYL  857

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKN-RRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            AKR+ ++L  EER+ LY+KW++P +GK  RRL  +NKLW+ P + ++V++SAE+VAKLVG
Sbjct  858  AKRVSSKLNAEEREMLYVKWDIPPDGKQRRRLQLVNKLWSDPLNMQNVRDSAEVVAKLVG  917

Query  372  FCESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE+G ++S+EMF+LNFV P+DK++W IGW+ I++LLHL
Sbjct  918  FCETGEHVSKEMFQLNFVSPSDKKTW-IGWNLISNLLHL  955



>ref|XP_010430934.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
Length=888

 Score =   267 bits (682),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 168/218 (77%), Gaps = 7/218 (3%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANE  G   E++       ES   W + F EQ +QII LW +C +SIIHR+QFY
Sbjct  676  QVLELEANET-GPASESDAT----DESQMDWPLCFEEQRKQIIMLWHLCHISIIHRTQFY  730

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD ADQIY+EVE+RRLTWL+QHLAELGNASPA +     +SL  SI+AL++E+E+L
Sbjct  731  MLFKGDPADQIYMEVELRRLTWLEQHLAELGNASPALVFTSICLSLVYSIRALKQEREYL  790

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ T+L  EER+ LY+KW+VP  GK RR  FINKLWT P +  HV+ESAEIVAKLVGF
Sbjct  791  AKRVNTKLGAEEREMLYLKWDVPPVGKQRRHQFINKLWTDPHNMHHVRESAEIVAKLVGF  850

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            C+SG N+ +EMFELNF  P+DK++W +GW+ I++LLHL
Sbjct  851  CDSGENIRKEMFELNFASPSDKKTWMMGWNFISNLLHL  888



>ref|XP_010687583.1| PREDICTED: kinesin-like protein NACK2 [Beta vulgaris subsp. vulgaris]
Length=940

 Score =   267 bits (683),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 171/219 (78%), Gaps = 10/219 (5%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEA EA   + +         +SP SW I F EQ +QI+ LW +C VS++HR+QF+
Sbjct  729  QVLELEAGEATNNSQD------AANQSPLSWLIIFEEQRKQIVMLWHLCHVSLVHRTQFF  782

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD ADQIY+EVE+RRLTWL+QHL++LGNASPA L +EP   +SSSIKAL++E+E L
Sbjct  783  LLFKGDPADQIYMEVELRRLTWLEQHLSDLGNASPALLSDEPASYVSSSIKALKQEREDL  842

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGK-NRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            A+R+ +RLT EER+ LY +W++P EGK  RRL  +NKLWT P + +HVQESA++VAKLVG
Sbjct  843  ARRVSSRLTAEERETLYRRWDIPPEGKQKRRLQLVNKLWTNPHNMQHVQESADVVAKLVG  902

Query  372  FCESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCESG  +SREMFELNF  P DK++W +GW+ I++LLHL
Sbjct  903  FCESGEQLSREMFELNFKSPCDKKTW-MGWNLISNLLHL  940



>ref|XP_009150293.1| PREDICTED: kinesin-like protein NACK2 [Brassica rapa]
Length=911

 Score =   267 bits (682),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 165/218 (76%), Gaps = 13/218 (6%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QV+ELE NE A           E  ES     + F EQ +QII LW +C +SIIHR+QFY
Sbjct  705  QVIELEGNETA-----------ESDESQMERPLCFEEQRKQIIMLWHLCHISIIHRTQFY  753

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD ADQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP   ++SSI+AL++E+E+L
Sbjct  754  MLFKGDPADQIYMEVELRRLTWLEQHLAELGNASPALLGDEPASYVASSIRALKQEREYL  813

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ T+L  EER+ LY+KW+V   GK RR   INKLWT P + +HV+ESAEIVAKLVGF
Sbjct  814  AKRVNTKLGAEEREMLYLKWDVAPVGKQRRQQLINKLWTDPHNTEHVKESAEIVAKLVGF  873

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            C+SG N+ +EMFELNF  P DK++W +GW+ I++ LHL
Sbjct  874  CDSGENIRKEMFELNFASPADKKTWMMGWNFISNFLHL  911



>emb|CDY30956.1| BnaA06g19570D [Brassica napus]
Length=911

 Score =   267 bits (682),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 165/218 (76%), Gaps = 13/218 (6%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QV+ELE NE A           E  ES     + F EQ +QII LW +C +SIIHR+QFY
Sbjct  705  QVIELEGNETA-----------ESDESQMERPLCFEEQRKQIIMLWHLCHISIIHRTQFY  753

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD ADQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP   ++SSI+AL++E+E+L
Sbjct  754  MLFKGDPADQIYMEVELRRLTWLEQHLAELGNASPALLGDEPASYVASSIRALKQEREYL  813

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ T+L  EER+ LY+KW+V   GK RR   INKLWT P + +HV+ESAEIVAKLVGF
Sbjct  814  AKRVNTKLGAEEREMLYLKWDVAPVGKQRRQQLINKLWTDPHNTEHVKESAEIVAKLVGF  873

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            C+SG N+ +EMFELNF  P DK++W +GW+ I++ LHL
Sbjct  874  CDSGENIRKEMFELNFASPADKKTWMMGWNFISNFLHL  911



>ref|XP_010107075.1| Kinesin-related protein 4 [Morus notabilis]
 gb|EXC13596.1| Kinesin-related protein 4 [Morus notabilis]
Length=956

 Score =   267 bits (683),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 174/218 (80%), Gaps = 8/218 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVL+LE +  AG  +  E  +P    SP  W + F E+ ++II LW +C VSI+HR+QFY
Sbjct  745  QVLQLEESNEAGAEV-TESLVP----SPEPWELIFEEERKEIIMLWHLCHVSIVHRTQFY  799

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD ADQ+Y+EVE+RRLTWL+QHL++LGNASPA LG+EP  S+S+SI+AL++E+E+L
Sbjct  800  MLFKGDPADQMYLEVELRRLTWLEQHLSDLGNASPALLGDEPAGSVSASIRALKQEREYL  859

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT EER+ LY KWEVP  GK RRL  +NKLWT P + +HVQ+SAE+VAKLVGF
Sbjct  860  AKRVSSKLTVEEREMLYTKWEVPPGGKQRRLQLVNKLWTDPYNMQHVQQSAEVVAKLVGF  919

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG + S+EMFEL FV P+DK+SW +GW+ I++LL+L
Sbjct  920  CESGEHASKEMFELTFVCPSDKKSW-MGWNLISNLLNL  956



>gb|AFW86156.1| LOW QUALITY PROTEIN: kinesin heavy chain, partial [Zea mays]
Length=949

 Score =   267 bits (682),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 156/205 (76%), Gaps = 5/205 (2%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELE+NE        E+N   +Q+ P SW   F+EQMQ II LWD C VSIIHR+QFY
Sbjct  732  QVLELESNEGKP---NGEDNSGPLQDGPDSWDRLFKEQMQCIIHLWDQCQVSIIHRTQFY  788

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD ADQIYIEVE+RRL WLQQH AE+G+ASP  +  +P VSL SS+KALR E+EFL
Sbjct  789  LLFRGDKADQIYIEVEVRRLVWLQQHFAEVGDASPGAV-EDPAVSLVSSMKALRNEREFL  847

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            A+R+ +RLT EER+ L+IKW+VPL+ K R+L  +NKLWT P D  H+ ESA +VA+LVGF
Sbjct  848  ARRMGSRLTDEERERLFIKWQVPLDAKQRKLQLVNKLWTDPNDQAHIDESAGLVARLVGF  907

Query  369  CESGNMSREMFELNFVIPNDKRSWF  295
            CE GN+S+EMFELNF +P  +R W 
Sbjct  908  CEGGNISKEMFELNFAVPTSRRPWL  932



>ref|XP_007203229.1| hypothetical protein PRUPE_ppa000925mg [Prunus persica]
 gb|EMJ04428.1| hypothetical protein PRUPE_ppa000925mg [Prunus persica]
Length=960

 Score =   266 bits (680),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 175/219 (80%), Gaps = 9/219 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQES-PASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QV+ LE ++ AG      +   +I ES P +W +TF E+ ++I+ LW +C VSIIHR+QF
Sbjct  748  QVIALEEDQEAGV-----DEPDKIDESLPETWQLTFEEERKEIVMLWHLCHVSIIHRTQF  802

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            Y+LFKGD  DQIY+EVE+RRL WL++H ++LGNASPA LG+EP  S+S+SIKAL++E+E+
Sbjct  803  YMLFKGDPTDQIYMEVELRRLQWLERHFSDLGNASPALLGDEPAGSVSASIKALKQEREY  862

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKR+ +RLT +ER+ LY+KWE+P  GK RRL  +NKLWT P + +HVQESAEIVAKLVG
Sbjct  863  LAKRVSSRLTADEREMLYVKWEIPPGGKQRRLQLVNKLWTDPHNMQHVQESAEIVAKLVG  922

Query  372  FCESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCESG ++S+EMFELNF  P+DK++W +GW+ I++LL+L
Sbjct  923  FCESGEHVSKEMFELNFAHPSDKKTW-MGWNLISNLLNL  960



>ref|XP_010261715.1| PREDICTED: kinesin-like protein NACK2 [Nelumbo nucifera]
Length=954

 Score =   266 bits (679),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 178/219 (81%), Gaps = 10/219 (5%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAA     +E   P+  +SP SWH  F +Q +QII LW +C VSI+HR+QFY
Sbjct  743  QVLELEANEAA----VSETVAPD--QSPMSWHFVFEDQRKQIIMLWHLCHVSIVHRTQFY  796

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLF+GD ADQIY+EVE+RRLTWL+Q+LAELGNASPA LG+EP  S+SSSI+AL++E+E+L
Sbjct  797  LLFRGDPADQIYMEVELRRLTWLEQYLAELGNASPALLGDEPASSISSSIRALKQEREYL  856

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKN-RRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            AKR+ TRLT +ER+ LYIKWEVP +GK  RRL  +NKLWT P + +HVQESA+IVAKLVG
Sbjct  857  AKRVSTRLTADEREMLYIKWEVPPDGKQRRRLQLVNKLWTDPLNMQHVQESADIVAKLVG  916

Query  372  FCESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE+  ++++EMFELNFV  +DKR+W  GW+ I++L HL
Sbjct  917  FCETDEHITKEMFELNFVPFSDKRTWN-GWNLISNLFHL  954



>ref|XP_010535794.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Tarenaya hassleriana]
 ref|XP_010535795.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Tarenaya hassleriana]
Length=946

 Score =   265 bits (677),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 173/219 (79%), Gaps = 9/219 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEA    LE++     ++ES   W + F EQ +QII LW +C +SIIHR+QFY
Sbjct  734  QVLELEANEATA-ALESDA----MEESQVPWPLCFEEQRKQIIMLWHLCHISIIHRTQFY  788

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKG+  DQIY++VE+RRLTWL+QHLAELGNASPA L +EP   ++SS++AL++E+E+L
Sbjct  789  LLFKGEETDQIYMDVELRRLTWLEQHLAELGNASPALLSDEPASYVASSVRALKQEREYL  848

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT EER+ALY+KWEVP  GK RR  FINKLWT P D +HV+ESA++VAKLVGF
Sbjct  849  AKRVNSKLTAEEREALYMKWEVPPVGKQRRNQFINKLWTNPHDMEHVKESAQVVAKLVGF  908

Query  369  CESGN--MSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            C++G   + +EMFELNF  P DK++  +GW+ I++LLHL
Sbjct  909  CDAGENVVRKEMFELNFASPLDKKTG-MGWNFISNLLHL  946



>ref|XP_010535793.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Tarenaya hassleriana]
Length=953

 Score =   265 bits (677),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 173/219 (79%), Gaps = 9/219 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEA    LE++     ++ES   W + F EQ +QII LW +C +SIIHR+QFY
Sbjct  741  QVLELEANEATA-ALESDA----MEESQVPWPLCFEEQRKQIIMLWHLCHISIIHRTQFY  795

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKG+  DQIY++VE+RRLTWL+QHLAELGNASPA L +EP   ++SS++AL++E+E+L
Sbjct  796  LLFKGEETDQIYMDVELRRLTWLEQHLAELGNASPALLSDEPASYVASSVRALKQEREYL  855

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT EER+ALY+KWEVP  GK RR  FINKLWT P D +HV+ESA++VAKLVGF
Sbjct  856  AKRVNSKLTAEEREALYMKWEVPPVGKQRRNQFINKLWTNPHDMEHVKESAQVVAKLVGF  915

Query  369  CESGN--MSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            C++G   + +EMFELNF  P DK++  +GW+ I++LLHL
Sbjct  916  CDAGENVVRKEMFELNFASPLDKKTG-MGWNFISNLLHL  953



>ref|XP_009625447.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
Length=953

 Score =   263 bits (673),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 177/219 (81%), Gaps = 10/219 (5%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEA EAA     +E +I +  +SP SWH+ F +Q QQII LW +C VS++HR+QFY
Sbjct  742  QVLELEATEAAS----DEADISD--QSPLSWHLVFEDQRQQIIMLWHLCHVSLVHRTQFY  795

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            +LFKGD +DQIY+EVE+RRLTWL +HLA LGNASPA LG++    +SSSIKAL++E+E+L
Sbjct  796  MLFKGDLSDQIYMEVELRRLTWLDEHLAGLGNASPALLGDDAAGYVSSSIKALKQEREYL  855

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKN-RRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            AKR+ ++L  EER+ LY+KW++P +GK  RRL  +NKLW+ P + ++V++SAE+VAKLVG
Sbjct  856  AKRVSSKLNAEEREILYVKWDIPPDGKQRRRLQLVNKLWSDPLNMQNVRDSAEVVAKLVG  915

Query  372  FCESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCE+G ++S+EMF+LNFV P DK++W +GW+ I++LLHL
Sbjct  916  FCETGEHVSKEMFQLNFVSPCDKKTW-VGWNLISNLLHL  953



>ref|XP_008242294.1| PREDICTED: kinesin-like protein NACK2 [Prunus mume]
Length=946

 Score =   263 bits (672),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 174/219 (79%), Gaps = 9/219 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQES-PASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QV+ LE ++ AG      +   +I ES P +W +TF E+ ++I+ LW +C VSIIHR+QF
Sbjct  734  QVIALEEDQPAGV-----DEPDKIDESLPETWQLTFEEERKEIVMLWHLCHVSIIHRTQF  788

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            Y+LFKGD  DQIY+EVE+RRL WL++H ++LGNASPA LG+EP  S+S+SIKAL++E+E+
Sbjct  789  YMLFKGDPTDQIYMEVELRRLQWLERHFSDLGNASPALLGDEPAGSVSASIKALKQEREY  848

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVG  373
            LAKR+ ++LT +ER+ LY+KWE+P  GK RRL  +NKLWT P + +HV ESAEIVAKLVG
Sbjct  849  LAKRVSSKLTADEREMLYVKWEIPPGGKQRRLQLVNKLWTDPHNMQHVHESAEIVAKLVG  908

Query  372  FCESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            FCESG ++S+EMFELNF  P+DK++W +GW+ I++LL+L
Sbjct  909  FCESGEHVSKEMFELNFAHPSDKKTW-MGWNLISNLLNL  946



>gb|AES92142.2| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=1037

 Score =   263 bits (671),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 167/217 (77%), Gaps = 8/217 (4%)
 Frame = -2

Query  906   QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
             QVLELEAN++        E +  I  SP SWHI F +Q +QII LW +C +S++HR+QFY
Sbjct  828   QVLELEANKSIT------EEMDTIDRSPLSWHILFEQQRKQIIMLWHLCHISLVHRTQFY  881

Query  726   LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
             LL +GD +DQ+Y+EVE+RRLTWL+QHLAELGNASPA LG+EP  S+S+SIKAL++E+E+L
Sbjct  882   LLLRGDPSDQVYMEVELRRLTWLEQHLAELGNASPALLGDEPADSVSASIKALKQEREYL  941

Query  546   AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
             AKR+  +LT EER+ LY +WEVP  GK RRL F+NKLW  P D +H+Q+SAEIVAKLV F
Sbjct  942   AKRVNCKLTAEERELLYSRWEVPPVGKQRRLQFVNKLWMNPYDMQHIQDSAEIVAKLVDF  1001

Query  369   CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
             C S   S++MF LNF  P+++++W  GW+ I++LL L
Sbjct  1002  CVSNENSKDMFALNFASPHNRKTW-AGWNFISNLLKL  1037



>ref|XP_008337808.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Malus domestica]
Length=942

 Score =   260 bits (664),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 174/218 (80%), Gaps = 7/218 (3%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QV+ LE ++ A   ++  +NI E    P +W +TF E  ++II LW +C VSIIHR+QFY
Sbjct  730  QVIALEKDQDA--VIDEMDNIDE--SLPGTWELTFEEDRKEIIMLWHLCHVSIIHRTQFY  785

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKG+ +DQIY+EVE+RRL WL+QH ++LGNASPA LG+EP  S+++SIKAL++E+E+L
Sbjct  786  LLFKGEPSDQIYMEVELRRLQWLEQHFSDLGNASPALLGDEPAGSVAASIKALKQEREYL  845

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT EER+ LY KWE+P  GK RRL  +NKLWT P + ++VQESAEIVAKLVGF
Sbjct  846  AKRVSSKLTAEEREMLYAKWEIPPGGKQRRLQLVNKLWTDPHNMQNVQESAEIVAKLVGF  905

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMFELNF  P+DK++W +GW+ I++LL+L
Sbjct  906  CESGEHISKEMFELNFAHPSDKKTW-MGWNLISNLLNL  942



>ref|XP_008337807.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Malus domestica]
Length=944

 Score =   260 bits (664),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 174/218 (80%), Gaps = 7/218 (3%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QV+ LE ++ A   ++  +NI E    P +W +TF E  ++II LW +C VSIIHR+QFY
Sbjct  732  QVIALEKDQDA--VIDEMDNIDE--SLPGTWELTFEEDRKEIIMLWHLCHVSIIHRTQFY  787

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKG+ +DQIY+EVE+RRL WL+QH ++LGNASPA LG+EP  S+++SIKAL++E+E+L
Sbjct  788  LLFKGEPSDQIYMEVELRRLQWLEQHFSDLGNASPALLGDEPAGSVAASIKALKQEREYL  847

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT EER+ LY KWE+P  GK RRL  +NKLWT P + ++VQESAEIVAKLVGF
Sbjct  848  AKRVSSKLTAEEREMLYAKWEIPPGGKQRRLQLVNKLWTDPHNMQNVQESAEIVAKLVGF  907

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMFELNF  P+DK++W +GW+ I++LL+L
Sbjct  908  CESGEHISKEMFELNFAHPSDKKTW-MGWNLISNLLNL  944



>ref|XP_003609945.1| Kinesin-like protein [Medicago truncatula]
Length=1228

 Score =   259 bits (663),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 166/216 (77%), Gaps = 8/216 (4%)
 Frame = -2

Query  903   VLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYL  724
             VLELEAN++        E +  I  SP SWHI F +Q +QII LW +C +S++HR+QFYL
Sbjct  1020  VLELEANKSIT------EEMDTIDRSPLSWHILFEQQRKQIIMLWHLCHISLVHRTQFYL  1073

Query  723   LFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLA  544
             L +GD +DQ+Y+EVE+RRLTWL+QHLAELGNASPA LG+EP  S+S+SIKAL++E+E+LA
Sbjct  1074  LLRGDPSDQVYMEVELRRLTWLEQHLAELGNASPALLGDEPADSVSASIKALKQEREYLA  1133

Query  543   KRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFC  367
             KR+  +LT EER+ LY +WEVP  GK RRL F+NKLW  P D +H+Q+SAEIVAKLV FC
Sbjct  1134  KRVNCKLTAEERELLYSRWEVPPVGKQRRLQFVNKLWMNPYDMQHIQDSAEIVAKLVDFC  1193

Query  366   ESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
              S   S++MF LNF  P+++++W  GW+ I++LL L
Sbjct  1194  VSNENSKDMFALNFASPHNRKTW-AGWNFISNLLKL  1228



>gb|KHG07572.1| kif4 [Gossypium arboreum]
Length=929

 Score =   258 bits (659),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 156/217 (72%), Gaps = 34/217 (16%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANEAAGY LE +E+  E +E    W                             
Sbjct  746  QVLELEANEAAGYNLEVDESAIEPEEPQVPW-----------------------------  776

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
                GD ADQIY+EVE+RRL W+Q H AELGN+SPA +G+EPTVSLSSSI+AL+RE+EFL
Sbjct  777  ----GDPADQIYMEVELRRLNWMQHHFAELGNSSPALVGDEPTVSLSSSIRALKREREFL  832

Query  546  AKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKRLT RL+ EERDALYIKW+VPLEGK R++ FINKLWT P D K+++ESA+IVAKLVGF
Sbjct  833  AKRLTSRLSVEERDALYIKWDVPLEGKQRKMQFINKLWTDPHDVKNIEESAQIVAKLVGF  892

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
             E GNMSREMFELNF +P DK  W +GW+QI++LL+L
Sbjct  893  SEGGNMSREMFELNFALPTDKSPWTVGWNQISNLLNL  929



>ref|XP_007154542.1| hypothetical protein PHAVU_003G127400g [Phaseolus vulgaris]
 gb|ESW26536.1| hypothetical protein PHAVU_003G127400g [Phaseolus vulgaris]
Length=941

 Score =   258 bits (659),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 164/216 (76%), Gaps = 6/216 (3%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEAN++        ++ P+   SP  WHI F +Q +QII LW +C +S++HR+QF+
Sbjct  732  QVLELEANKSLNV---GHDDTPD--RSPLPWHILFEQQRKQIIMLWHLCHISLVHRTQFF  786

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LL  GD +DQIY+EVE+RRLTWL+QHLAELGNASPA LG+EP  S+S+SI+ALR+E+E+L
Sbjct  787  LLLGGDPSDQIYMEVELRRLTWLEQHLAELGNASPALLGDEPASSVSASIRALRQEREYL  846

Query  546  AKRLTRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFC  367
            AK++ +LT EER+ LY KWEVP  GK RRL  +NKLWT P + +HVQESAEIVAKL+ F 
Sbjct  847  AKKVNKLTAEEREVLYTKWEVPPVGKQRRLQLVNKLWTDPYNMQHVQESAEIVAKLIDFS  906

Query  366  ESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
             S   SREM ELNF  P +K+SW  GW+ I++LL+ 
Sbjct  907  VSDENSREMIELNFSSPFNKKSW-AGWNFISNLLNF  941



>ref|XP_009359691.1| PREDICTED: kinesin-like protein NACK2 [Pyrus x bretschneideri]
Length=942

 Score =   258 bits (658),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 174/218 (80%), Gaps = 7/218 (3%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QV+ LE ++ A   ++  +NI E    P +W +TF E  ++II LW +C VSIIHR+QFY
Sbjct  730  QVIALEKDQDA--VIDEMDNIDE--SLPGTWELTFEEDRKEIIMLWHLCHVSIIHRTQFY  785

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKG+ +DQIY+EVE+RRL WL+QH ++LGNASPA LG+EP  S+++SIKAL++E+E+L
Sbjct  786  LLFKGEPSDQIYMEVELRRLQWLEQHFSDLGNASPALLGDEPAGSVAASIKALKQEREYL  845

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+ ++LT +ER+ LY KWE+P  GK RRL  +NKLWT P + ++VQESAEIVAKLVGF
Sbjct  846  AKRVSSKLTVDEREILYAKWEIPPGGKQRRLQLVNKLWTDPHNMQNVQESAEIVAKLVGF  905

Query  369  CESG-NMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            CESG ++S+EMFELNF  P+DK++W +GW+ I++LL+L
Sbjct  906  CESGEHISKEMFELNFAHPSDKKTW-MGWNLISNLLNL  942



>ref|XP_011078149.1| PREDICTED: kinesin-like protein NACK2 [Sesamum indicum]
Length=943

 Score =   258 bits (658),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 174/220 (79%), Gaps = 10/220 (5%)
 Frame = -2

Query  906  QVLELE-ANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELE ANEA+     +E  I  I +    W + F +Q ++II LW VC VSI+HR+QF
Sbjct  730  QVLELEEANEASS---SDEAEI--IDQPHMPWSVVFEDQRKEIIMLWHVCHVSIVHRTQF  784

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLLF+GD +DQIY+EVE+RRL WL+QHL E+GNASPA LG++P  S+SSSIKAL++E+E+
Sbjct  785  YLLFRGDPSDQIYMEVELRRLKWLEQHLDEVGNASPALLGDDPPGSVSSSIKALKQEREY  844

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGKN-RRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            LAKR+ ++LT EER+ LY+KW++P EGK  RRL  +NKLWT P + +HV+ESAE+VAKLV
Sbjct  845  LAKRVSSKLTTEERELLYLKWDIPPEGKQRRRLQLVNKLWTDPLNMEHVKESAEVVAKLV  904

Query  375  GFCESGN-MSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            GFCES   +SREMFELNFV  +DK++W +GW+ I++LLHL
Sbjct  905  GFCESTQPVSREMFELNFVPLSDKKTW-MGWNLISNLLHL  943



>ref|XP_004508037.1| PREDICTED: centromere-associated protein E-like isoform X2 [Cicer 
arietinum]
Length=816

 Score =   256 bits (653),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 163/217 (75%), Gaps = 8/217 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEAN++        E +  +  SP SW I F +Q +QII LW +C +S++HR+QFY
Sbjct  607  QVLELEANKSVT------EEMDTVDRSPLSWRILFEQQRKQIIMLWHLCHISLVHRTQFY  660

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LL +GD  DQ+Y+EVE+RRLTWL+QHLAELGNASPA LG+EP  S+ +SIKALR+E+E+L
Sbjct  661  LLLRGDPTDQVYVEVELRRLTWLEQHLAELGNASPALLGDEPAGSVLASIKALRQEREYL  720

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+  +LT EER+ LY KWEVP  GK RRL  +NKLWT P +  H+QESAEIVAKL+ F
Sbjct  721  AKRVNCKLTLEEREMLYAKWEVPPIGKQRRLQLVNKLWTDPYNMHHIQESAEIVAKLIDF  780

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            C S   S++MF LNF  P ++++W  GW+ I++LL+L
Sbjct  781  CVSDENSKDMFALNFASPYNRKTW-AGWNFISNLLNL  816



>ref|XP_010227940.1| PREDICTED: kinesin-like protein NACK1 [Brachypodium distachyon]
Length=970

 Score =   256 bits (654),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 163/217 (75%), Gaps = 9/217 (4%)
 Frame = -2

Query  906  QVLELEANEAA--GYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELE++E    G   + EEN+ +    P SW   F+ QMQ II LW +C VSIIHR+Q
Sbjct  752  QVLELESDEGKQNGIEQDPEENVGDC---PESWERLFKAQMQHIILLWGLCHVSIIHRTQ  808

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            FYLLFKGD+ADQIYIEVE+RRL WLQQHL E+G+ +     ++  VS +SSIKALR E+E
Sbjct  809  FYLLFKGDTADQIYIEVEVRRLLWLQQHLDEVGDDAH---DDDLAVSRASSIKALRSERE  865

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            FLA+R+ +R+T EER+ L+IKW+VPLE K R+L  +NKLWT P +  HV+ESA+IVA+LV
Sbjct  866  FLARRMGSRMTEEERERLFIKWQVPLEAKQRKLQLVNKLWTDPSNEVHVEESADIVARLV  925

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLL  265
            GFCE GN+S+EMFELNF +P  ++ W  GW  I++++
Sbjct  926  GFCEGGNVSKEMFELNFTVPASRKPWLTGWHPISNMI  962



>ref|XP_004508036.1| PREDICTED: centromere-associated protein E-like isoform X1 [Cicer 
arietinum]
Length=946

 Score =   255 bits (651),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 163/217 (75%), Gaps = 8/217 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEAN++        E +  +  SP SW I F +Q +QII LW +C +S++HR+QFY
Sbjct  737  QVLELEANKSVT------EEMDTVDRSPLSWRILFEQQRKQIIMLWHLCHISLVHRTQFY  790

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LL +GD  DQ+Y+EVE+RRLTWL+QHLAELGNASPA LG+EP  S+ +SIKALR+E+E+L
Sbjct  791  LLLRGDPTDQVYVEVELRRLTWLEQHLAELGNASPALLGDEPAGSVLASIKALRQEREYL  850

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            AKR+  +LT EER+ LY KWEVP  GK RRL  +NKLWT P +  H+QESAEIVAKL+ F
Sbjct  851  AKRVNCKLTLEEREMLYAKWEVPPIGKQRRLQLVNKLWTDPYNMHHIQESAEIVAKLIDF  910

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            C S   S++MF LNF  P ++++W  GW+ I++LL+L
Sbjct  911  CVSDENSKDMFALNFASPYNRKTW-AGWNFISNLLNL  946



>ref|XP_003541319.1| PREDICTED: kinesin-like protein NACK2-like isoform X1 [Glycine 
max]
 ref|XP_006593967.1| PREDICTED: kinesin-like protein NACK2-like isoform X2 [Glycine 
max]
Length=950

 Score =   248 bits (634),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 167/217 (77%), Gaps = 8/217 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEAN+    +L  E++ P+   SP  WHI F +Q +QII LW +C +S++HR+QF+
Sbjct  741  QVLELEANK----SLNEEKDTPD--RSPLPWHILFDQQRKQIIMLWHLCHISLVHRTQFF  794

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LL  GD +DQIY+EVE+RRLT L+QHLAELGNASPA LG+EP  S+S+SI+AL++E+E L
Sbjct  795  LLLGGDPSDQIYMEVELRRLTRLEQHLAELGNASPALLGDEPAGSVSASIRALKQEREHL  854

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            A+++ T+LT EER+ LY KWEVP  GK RRL F+NKLWT P + +HVQESAEIVAKL+ F
Sbjct  855  ARKVNTKLTAEERELLYAKWEVPPVGKQRRLQFVNKLWTDPYNMQHVQESAEIVAKLIDF  914

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
              S   S++M ELNF  P +K++W  GW+ I++LL+L
Sbjct  915  SVSDENSKDMIELNFSSPFNKKTW-AGWNFISNLLNL  950



>ref|XP_006842375.1| hypothetical protein AMTR_s00079p00190770 [Amborella trichopoda]
 gb|ERN04050.1| hypothetical protein AMTR_s00079p00190770 [Amborella trichopoda]
Length=1007

 Score =   242 bits (617),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 144/187 (77%), Gaps = 4/187 (2%)
 Frame = -2

Query  906   QVLELEANEAAGYTLENEE--NIPEIQ-ESPASWHITFREQMQQIIDLWDVCFVSIIHRS  736
             QVL+LE +       E  E  N  E+   SP++W + F  Q +QII LWDVC VSI+HR+
Sbjct  819   QVLKLEEDNELAPADEGVESQNFSELNNRSPSAWKLEFENQRRQIILLWDVCLVSIVHRT  878

Query  735   QFYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREK  556
             QFYLLFKGD ADQIY+EVE+RRLTWL+QH AELGNASPA  G EP +SLSSSI+AL+ E+
Sbjct  879   QFYLLFKGDPADQIYMEVELRRLTWLEQHFAELGNASPAPFGEEPAISLSSSIRALKHER  938

Query  555   EFLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKL  379
             E L+KR+ +R TPEER+ LY+KW+VPL+GK R+L  +NKLWT P +  HVQESA IVAKL
Sbjct  939   EVLSKRVNSRFTPEEREMLYLKWDVPLDGKQRKLQLVNKLWTDPNNMLHVQESAAIVAKL  998

Query  378   VGFCESG  358
             VGFCE+G
Sbjct  999   VGFCEAG  1005



>ref|XP_002992286.1| hypothetical protein SELMODRAFT_135047 [Selaginella moellendorffii]
 gb|EFJ06667.1| hypothetical protein SELMODRAFT_135047 [Selaginella moellendorffii]
Length=869

 Score =   229 bits (584),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 153/219 (70%), Gaps = 7/219 (3%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENE--ENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELE+N   G   ENE  E  P +  SP+ W + F +Q  QII+LWDVC VSIIHR+Q
Sbjct  655  QVLELESNNTGG---ENEYGEMTPSLH-SPSGWRLQFEKQRMQIIELWDVCQVSIIHRTQ  710

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELG-NASPAQLGNEPTVSLSSSIKALRREK  556
            FYLLF+GD AD +Y+EVE RRL WLQ+  A+   N  P  +  +   S ++S+KALRRE+
Sbjct  711  FYLLFRGDPADAMYMEVEFRRLLWLQEQFAKNDQNQGPGVIDEDNISSYAASVKALRRER  770

Query  555  EFLAKRLTRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            E LAKR+ R+ PE +D L +KWE+PLE K R+L  I KLWT  +D +H+Q+SAE+VA +V
Sbjct  771  EMLAKRMRRMPPEMKDELLVKWEIPLESKQRKLQLIEKLWTDARDMQHIQDSAEVVAMIV  830

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            GF E G+ S+EMF LNF  P+ ++ +  GW+ I+ +L+L
Sbjct  831  GFWEPGSASKEMFALNFAPPSSQKPFHFGWNSISTMLNL  869



>ref|XP_002987833.1| hypothetical protein SELMODRAFT_126650 [Selaginella moellendorffii]
 gb|EFJ11136.1| hypothetical protein SELMODRAFT_126650 [Selaginella moellendorffii]
Length=869

 Score =   228 bits (582),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 152/219 (69%), Gaps = 7/219 (3%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENE--ENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            QVLELE+N   G   ENE  E  P +  SP+ W + F +Q  QII+LWDVC VSIIHR+Q
Sbjct  655  QVLELESNNTGG---ENEYGEMTPSLH-SPSGWRLQFEKQRMQIIELWDVCQVSIIHRTQ  710

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELG-NASPAQLGNEPTVSLSSSIKALRREK  556
            FYLLF+GD AD +Y+EVE RRL WLQ+  A+   N  P     +   S ++S+KALRRE+
Sbjct  711  FYLLFRGDPADAMYMEVEFRRLLWLQEQFAKNDQNQGPGVTDEDNISSYAASVKALRRER  770

Query  555  EFLAKRLTRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            E LAKR+ R+ PE +D L +KWE+PLE K R+L  I KLWT  +D +H+Q+SAE+VA +V
Sbjct  771  EMLAKRMRRMPPEMKDELLVKWEIPLESKQRKLQLIEKLWTDARDMQHIQDSAEVVAMIV  830

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            GF E G+ S+EMF LNF  P+ ++ +  GW+ I+ +L+L
Sbjct  831  GFWEPGSASKEMFALNFAPPSSQKPFHFGWNSISTMLNL  869



>gb|EPS71432.1| hypothetical protein M569_03327 [Genlisea aurea]
Length=921

 Score =   214 bits (544),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 141/190 (74%), Gaps = 22/190 (12%)
 Frame = -2

Query  816  WHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQHLAEL  637
            W   F EQ ++II LW +C VSIIHR+QFYLL K                 WL+QHL EL
Sbjct  750  WPEVFEEQRKEIIMLWHLCHVSIIHRTQFYLLLK-----------------WLEQHLDEL  792

Query  636  GNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLT-RLTPEERDALYIKWEVPLEGKNRR  460
            GNASPA LG++P  S++SSIKAL++E+E+LAKR++ +LT +ER+ALY KWEVP EGK RR
Sbjct  793  GNASPALLGDDPPGSVTSSIKALKQEREYLAKRVSSKLTADEREALYAKWEVPPEGKQRR  852

Query  459  LNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGN---MSREMFELNFVIPNDKRSWFIG  289
            L+ +N+LWT P +  HV+ESA++VAKLVGFCES     +SREMFEL+FV  +DK++W +G
Sbjct  853  LHLVNRLWTDPLNMAHVRESAQVVAKLVGFCESSGGQPLSREMFELSFVPLSDKKTW-MG  911

Query  288  WDQIADLLHL  259
            W+ I++LLHL
Sbjct  912  WNLISNLLHL  921



>gb|EYU28300.1| hypothetical protein MIMGU_mgv1a001029mg [Erythranthe guttata]
Length=908

 Score =   211 bits (538),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 153/220 (70%), Gaps = 26/220 (12%)
 Frame = -2

Query  906  QVLELE-ANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQF  730
            QVLELE ANEA+    E++      Q    SW   F +Q ++II LW +C VSI+HR+QF
Sbjct  711  QVLELEEANEASS---EDDAETLTGQSPTPSWIAVFEDQRKEIIMLWHLCHVSIVHRTQF  767

Query  729  YLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEF  550
            YLL                    L+QHL +LGNASPA LG++P  S+SSSIKAL++E+E+
Sbjct  768  YLL------------------RCLEQHLDDLGNASPALLGDDPACSVSSSIKALKQEREY  809

Query  549  LAKRL-TRLTPEERDALYIKWEVPLEGK-NRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
            LAKR+ ++LT EER+ LY+KW++P EGK  RR   +NKLWT P +  HV+ESAE+VAKLV
Sbjct  810  LAKRVSSKLTAEEREVLYLKWDIPPEGKQKRRQQLVNKLWTDPLNMGHVKESAEVVAKLV  869

Query  375  GFCESGN-MSREMFELNFVIPNDKRSWFIGWDQIADLLHL  259
            GFCES   +SREMF+LNFV  +DK+SW +GW+ I++LLHL
Sbjct  870  GFCESAQPVSREMFQLNFVPLSDKKSW-MGWNLISNLLHL  908



>ref|XP_002516209.1| microtubule motor, putative [Ricinus communis]
 gb|EEF46211.1| microtubule motor, putative [Ricinus communis]
Length=891

 Score =   199 bits (506),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 127/162 (78%), Gaps = 7/162 (4%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            QVLELEANE  G T E    +  I +SP +WH+ F +Q +QI+ LW +C VSIIHR+QFY
Sbjct  736  QVLELEANE--GTTAE----MDIIDQSPMAWHLLFEDQRKQIVMLWHLCHVSIIHRTQFY  789

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD +DQIY+EVE+RRL+WL+QHL+ELGNASPA LG+EP  S+SSSIKAL++E+E+L
Sbjct  790  LLFKGDPSDQIYMEVELRRLSWLEQHLSELGNASPALLGDEPAGSVSSSIKALKQEREYL  849

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQ  424
            AKR+ ++LT EER+ LY KWE+P  GK RRL  ++ L  K Q
Sbjct  850  AKRVSSKLTAEEREVLYAKWEIPPVGKQRRLQLLSILLDKLQ  891



>ref|XP_001779285.1| predicted protein [Physcomitrella patens]
 gb|EDQ55887.1| predicted protein [Physcomitrella patens]
Length=951

 Score =   183 bits (465),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 141/222 (64%), Gaps = 15/222 (7%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQ------ESPASWHITFREQMQQIIDLWDVCFVSII  745
            QVLELEA       +E ++++ + +      +S  SW + F +Q   I+++WD C VSI+
Sbjct  734  QVLELEAGGLDDEEVEGDDHLNDDELDLQPVQSLDSWKLQFDQQRALILEMWDTCNVSIV  793

Query  744  HRSQFYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALR  565
            HR+QFYLLF GD AD IY+EVE+RRLTWLQ+      N +    GN     L S+ K+L+
Sbjct  794  HRTQFYLLFNGDPADSIYMEVELRRLTWLQE------NFNAESQGNHIKFVLCST-KSLK  846

Query  564  REKEFLAKRLTRLTP-EERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIV  388
            RE++ LAK+++R  P EER+ LYI+W VPL+ K R+L  + KLW  P + +HV+ SAE+V
Sbjct  847  RERDLLAKQMSRRLPNEEREDLYIRWGVPLDTKQRKLQLVYKLWADPHNLRHVEASAEVV  906

Query  387  AKLVGFCESGNMSREMFELNFVIPNDKRS-WFIGWDQIADLL  265
            +++VG    G   +EMF LNF +PN   +    GW+ ++ LL
Sbjct  907  SRIVGIINPGCAPKEMFALNFTLPNHAETPGMFGWNGLSALL  948



>gb|KHN45051.1| Kinesin-related protein 4 [Glycine soja]
Length=921

 Score =   177 bits (450),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 128/202 (63%), Gaps = 44/202 (22%)
 Frame = -2

Query  735  QFYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSS---------  583
            QF+LL  GD +DQIY+EVE+RRLT L+QHLAELGNASPA LG+EP  S+S+         
Sbjct  721  QFFLLLGGDPSDQIYMEVELRRLTRLEQHLAELGNASPALLGDEPAGSVSARYARVFERH  780

Query  582  ---------------------------------SIKALRREKEFLAKRL-TRLTPEERDA  505
                                             SI+AL++E+E LA+++ T+LT EER+ 
Sbjct  781  VSFLTIPASPALLGVFDNSLNQVSLIKLVYLKNSIRALKQEREHLARKVNTKLTAEEREL  840

Query  504  LYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNF  325
            LY KWEVP  GK RRL F+NKLWT P + +HVQESAEIVAKL+ F  S   S++M ELNF
Sbjct  841  LYAKWEVPPVGKQRRLQFVNKLWTDPYNMQHVQESAEIVAKLIDFSVSDENSKDMIELNF  900

Query  324  VIPNDKRSWFIGWDQIADLLHL  259
              P +K++W  GW+ I++LL+L
Sbjct  901  SSPFNKKTW-AGWNFISNLLNL  921



>ref|XP_006854867.1| hypothetical protein AMTR_s00182p00038530 [Amborella trichopoda]
 gb|ERN16334.1| hypothetical protein AMTR_s00182p00038530 [Amborella trichopoda]
Length=969

 Score =   172 bits (435),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 123/178 (69%), Gaps = 2/178 (1%)
 Frame = -2

Query  852  ENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIR  673
            E  PE  +S ++W + F  Q ++II+LW  C VS+ HR+ F+LLF+GD AD IYIEVE+R
Sbjct  778  EASPEHTQSLSNWPLEFERQRREIIELWHTCHVSLFHRTYFFLLFRGDPADSIYIEVELR  837

Query  672  RLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLTR-LTPEERDALYI  496
            RL++L+   A+  N     L +  +++L++SI+ LRRE+E  ++++ R LT +ER+ LY 
Sbjct  838  RLSFLKNKFADR-NPGILMLEDGHSMTLAASIRGLRRERESFSRQMKRRLTSQERENLYR  896

Query  495  KWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
            KW + LE K RRL    +LWT PQD  HVQESA +VA+++GF ESG   +EMFEL+F 
Sbjct  897  KWGIGLETKQRRLQLAQQLWTNPQDMDHVQESATVVARVLGFSESGQALKEMFELSFT  954



>ref|XP_010240187.1| PREDICTED: kinesin-like protein NACK1 isoform X3 [Brachypodium 
distachyon]
Length=823

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 122/176 (69%), Gaps = 2/176 (1%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +  +SP+ W + F ++ Q+IIDLW  C+ S++HR+ F+LLFKGD AD IY+EVEIRRL
Sbjct  629  IMDALQSPSRWPLEFEKKQQEIIDLWHACYASLVHRTYFFLLFKGDPADSIYMEVEIRRL  688

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   ++ G  S A +G+  T SL SS K L+RE+E L +++  RL+ EER+++Y KW
Sbjct  689  SFLKDTYSKGGMESKAVIGSLNT-SLVSSAKKLQREREMLCRQMQKRLSIEERESMYTKW  747

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             V L  K RRL    +LWT+ +D +H++ESA +VA+L+G  E G   REMF L+F 
Sbjct  748  GVSLASKRRRLQVARRLWTETKDLEHIRESASLVARLIGLLEPGKALREMFGLSFA  803



>ref|XP_010240186.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Brachypodium 
distachyon]
Length=940

 Score =   169 bits (429),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 122/176 (69%), Gaps = 2/176 (1%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +  +SP+ W + F ++ Q+IIDLW  C+ S++HR+ F+LLFKGD AD IY+EVEIRRL
Sbjct  746  IMDALQSPSRWPLEFEKKQQEIIDLWHACYASLVHRTYFFLLFKGDPADSIYMEVEIRRL  805

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   ++ G  S A +G+  T SL SS K L+RE+E L +++  RL+ EER+++Y KW
Sbjct  806  SFLKDTYSKGGMESKAVIGSLNT-SLVSSAKKLQREREMLCRQMQKRLSIEERESMYTKW  864

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             V L  K RRL    +LWT+ +D +H++ESA +VA+L+G  E G   REMF L+F 
Sbjct  865  GVSLASKRRRLQVARRLWTETKDLEHIRESASLVARLIGLLEPGKALREMFGLSFA  920



>ref|NP_001047565.2| Os02g0644400 [Oryza sativa Japonica Group]
 dbj|BAF09479.2| Os02g0644400, partial [Oryza sativa Japonica Group]
Length=204

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 126/186 (68%), Gaps = 5/186 (3%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I  + +SP+ W + F ++ Q+II+LW  C +S++HR+ F+LLFKG++AD IY+EVE+RRL
Sbjct  8    IEGVSQSPSRWPLEFEKKQQEIIELWQACSISLVHRTYFFLLFKGEAADSIYMEVELRRL  67

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   +     S A +G+  T  ++S+ K L+RE+E LA+++  RL+ EER+  Y KW
Sbjct  68   SFLRDTYSRGSTPSNAIVGSLSTSPVASA-KKLQREREMLARQMQKRLSTEEREHTYTKW  126

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVI---  319
             V L+ K R+L    +LWT+ +D +HV+ESA +VAKL+G  E G + +EMF L+F     
Sbjct  127  GVSLDSKRRKLQVARRLWTETKDLEHVRESASLVAKLIGLQEPGQVLKEMFGLSFAPQQQ  186

Query  318  PNDKRS  301
            P  +RS
Sbjct  187  PTRRRS  192



>gb|EEC73688.1| hypothetical protein OsI_08259 [Oryza sativa Indica Group]
Length=217

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 126/186 (68%), Gaps = 5/186 (3%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I  + +SP+ W + F ++ Q+II+LW  C +S++HR+ F+LLFKG++AD IY+EVE+RRL
Sbjct  21   IEGVSQSPSRWPLEFEKKQQEIIELWQACSISLVHRTYFFLLFKGEAADSIYMEVELRRL  80

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   +     S A +G+  T  ++S+ K L+RE+E LA+++  RL+ EER+  Y KW
Sbjct  81   SFLRDTYSRGSTPSNAIVGSLSTSPVASA-KKLQREREMLARQMQKRLSTEEREHTYTKW  139

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVI---  319
             V L+ K R+L    +LWT+ +D +HV+ESA +VAKL+G  E G + +EMF L+F     
Sbjct  140  GVSLDSKRRKLQVARRLWTETKDLEHVRESASLVAKLIGLQEPGQVLKEMFGLSFAPQQQ  199

Query  318  PNDKRS  301
            P  +RS
Sbjct  200  PTRRRS  205



>ref|XP_010240185.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Brachypodium 
distachyon]
Length=951

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 122/176 (69%), Gaps = 2/176 (1%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +  +SP+ W + F ++ Q+IIDLW  C+ S++HR+ F+LLFKGD AD IY+EVEIRRL
Sbjct  757  IMDALQSPSRWPLEFEKKQQEIIDLWHACYASLVHRTYFFLLFKGDPADSIYMEVEIRRL  816

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   ++ G  S A +G+  T SL SS K L+RE+E L +++  RL+ EER+++Y KW
Sbjct  817  SFLKDTYSKGGMESKAVIGSLNT-SLVSSAKKLQREREMLCRQMQKRLSIEERESMYTKW  875

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             V L  K RRL    +LWT+ +D +H++ESA +VA+L+G  E G   REMF L+F 
Sbjct  876  GVSLASKRRRLQVARRLWTETKDLEHIRESASLVARLIGLLEPGKALREMFGLSFA  931



>gb|EMT24668.1| Kinesin-related protein 11 [Aegilops tauschii]
Length=833

 Score =   166 bits (420),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 117/176 (66%), Gaps = 2/176 (1%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +  +SP+ W + F  + Q+IIDLW  C+ S++HR+ F+LLFKGD AD IY+EVEIRRL
Sbjct  639  IMDALQSPSRWPLEFERKQQEIIDLWHACYASLVHRTYFFLLFKGDPADSIYMEVEIRRL  698

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+      G  S    G+ P  SL SS + L+RE+E L +++  RL+ EER+++Y KW
Sbjct  699  SFLKDTYGNGGMESKVVAGS-PNTSLVSSARKLQREREMLCRQMQKRLSIEERESMYTKW  757

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             V L  K RRL    +LWT+ ++ +HV+ESA +VA+L+G  E G   REMF L+F 
Sbjct  758  GVSLSSKRRRLQVARRLWTETKNLEHVRESASLVARLIGLLEPGKALREMFGLSFA  813



>ref|XP_002512997.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF49500.1| ATP binding protein, putative [Ricinus communis]
Length=842

 Score =   165 bits (418),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 118/180 (66%), Gaps = 6/180 (3%)
 Frame = -2

Query  822  ASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQHLA  643
            + W +TF  Q  +I++LW  C VS++HR+ F+LLFKGD  D IY+EVE+RRL++L+++ +
Sbjct  660  SDWSLTFERQRSEILELWQTCNVSLVHRTYFFLLFKGDPTDSIYMEVELRRLSFLKENFS  719

Query  642  ELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLEGKN  466
            + GN +   LG   T S +SSIKAL RE+  L+K +  RL+ EER   Y KW + L  K 
Sbjct  720  Q-GNQA---LGGGGTFSFASSIKALHRERGMLSKLMQKRLSEEERKRFYQKWGIGLNSKR  775

Query  465  RRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPNDKRSWFIGW  286
            RRL   N+LW+  +D  H+ ESA IVAKLV F E G   +EMF L+F  P+ +R   +GW
Sbjct  776  RRLQLANRLWSNTKDINHIMESAAIVAKLVKFVEQGQALKEMFGLSFTPPSTRRRS-LGW  834



>ref|XP_006652585.1| PREDICTED: kinesin-like protein NACK1-like [Oryza brachyantha]
Length=941

 Score =   166 bits (420),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 120/188 (64%), Gaps = 7/188 (4%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +   SP+ W + F ++ ++IIDLW  C VS++HR+ F+LLFKGD+AD IY+EVE+RRL
Sbjct  754  ITDALRSPSRWPLEFEKKQEEIIDLWHACNVSLVHRTYFFLLFKGDAADSIYMEVELRRL  813

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLT-RLTPEERDALYIKW  490
            T+L+         S   + + P +SL SS K L RE+E L +++  RL+ EER+++Y KW
Sbjct  814  TFLKD------TYSSGAVASIPNISLVSSAKKLHREREMLCRQMQRRLSIEERESMYTKW  867

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPND  310
             V L  K RRL    +LWT+ +D +HV+ESA +VA+L+G  E G   REMF L+F     
Sbjct  868  GVTLTSKRRRLQVARRLWTETKDLEHVRESASLVARLIGLLEPGKALREMFGLSFAPQQF  927

Query  309  KRSWFIGW  286
             R  +  W
Sbjct  928  TRRSYNSW  935



>ref|XP_008663419.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Zea mays]
 ref|XP_008663420.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Zea mays]
 gb|ACN34614.1| unknown [Zea mays]
 gb|AFW59004.1| kinesin heavy chain [Zea mays]
Length=939

 Score =   166 bits (419),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 121/188 (64%), Gaps = 2/188 (1%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +I +SP+ W + F ++ Q+IIDLW  C VS++HR+ F+LLFKGD AD IY+EVE+RRL
Sbjct  745  IMDILQSPSRWPLEFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRL  804

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   +  G+     +    + SL SS K L+RE+E L +++  RLT +ER++LY KW
Sbjct  805  SFLKNTYSN-GSMGYDMVAGSLSTSLVSSAKKLQREREMLCRQMQKRLTIQERESLYTKW  863

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPND  310
             V L  K RRL    +LWT+ +D +HV+ESA +VA+L+G  E G   REMF L+F     
Sbjct  864  GVSLSSKRRRLQVARRLWTETRDLEHVRESASLVARLIGLLEPGKALREMFGLSFAPQQS  923

Query  309  KRSWFIGW  286
             R     W
Sbjct  924  TRRSHSSW  931



>gb|AAK91822.1|AF272759_1 kinesin heavy chain [Zea mays]
Length=897

 Score =   165 bits (418),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 121/188 (64%), Gaps = 2/188 (1%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +I +SP+ W + F ++ Q+IIDLW  C VS++HR+ F+LLFKGD AD IY+EVE+RRL
Sbjct  703  IMDILQSPSRWPLEFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRL  762

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   +  G+     +    + SL SS K L+RE+E L +++  RLT +ER++LY KW
Sbjct  763  SFLKNTYSN-GSMGYDMVAGSLSTSLVSSAKKLQREREMLCRQMQKRLTIQERESLYTKW  821

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPND  310
             V L  K RRL    +LWT+ +D +HV+ESA +VA+L+G  E G   REMF L+F     
Sbjct  822  GVSLSSKRRRLQVARRLWTETRDLEHVRESASLVARLIGLLEPGKALREMFGLSFAPQQS  881

Query  309  KRSWFIGW  286
             R     W
Sbjct  882  TRRSHSSW  889



>gb|KHG01762.1| Kinesin-related 11 [Gossypium arboreum]
Length=909

 Score =   165 bits (418),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 138/218 (63%), Gaps = 10/218 (5%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIP--EIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQ  733
            Q   LE +E+ G +++     P  E   +P  W + F    + I++LW  C VS++HR+ 
Sbjct  698  QDTSLEVDES-GMSMKGAGLDPMHEASGTPLDWPLEFERLQRAILELWQACNVSLVHRTY  756

Query  732  FYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKE  553
            F+LLFKGD  D IY+EVEIRRLT+L++  ++ GN +   + +  T++L+SS++ALRRE+ 
Sbjct  757  FFLLFKGDRTDSIYMEVEIRRLTFLKETFSQ-GNQA---VEDGRTLTLASSVRALRRERR  812

Query  552  FLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLV  376
             L+K +  R + EER  LY+KW + L  K RRL  +N+LW+K +D  HV ESA IVAKL+
Sbjct  813  TLSKLMRKRFSEEERQKLYLKWGISLNSKQRRLQLVNQLWSKNKDMDHVTESATIVAKLI  872

Query  375  GFCESGNMSREMFELNFVIPNDKRSWFIGW-DQIADLL  265
             F E G   +EMF L+F  P  +R  + GW + +A L+
Sbjct  873  RFVEQGRALKEMFGLSFTPPRPRRRSY-GWKNSMASLI  909



>ref|XP_007042026.1| ATP binding microtubule motor family protein, putative [Theobroma 
cacao]
 gb|EOX97857.1| ATP binding microtubule motor family protein, putative [Theobroma 
cacao]
Length=965

 Score =   165 bits (418),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 135/213 (63%), Gaps = 8/213 (4%)
 Frame = -2

Query  894  LEANEAA-GYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLF  718
            LEA+E+  G      + + E   +P  W + F  Q + I +LW  C VS++HR+ F+LLF
Sbjct  758  LEADESGKGMKDVGLDPMHEASGTPLDWPLEFERQQRAIFELWQACNVSLVHRTYFFLLF  817

Query  717  KGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKR  538
            KGD  D IY+EVE+RRLT+L++  ++ GN +   + +  T++L+SS++ALRRE++ L+K 
Sbjct  818  KGDPTDSIYMEVELRRLTFLKETFSQ-GNQA---VEDGRTLTLASSVRALRRERQTLSKL  873

Query  537  L-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCES  361
            +  R + EER  LY KW + L  K RRL  +N+LW+  +D  HV ESA IVAKL+ F E 
Sbjct  874  MRKRFSEEERQKLYHKWGIELNSKQRRLQLVNQLWSNNKDMNHVTESAAIVAKLIRFVEQ  933

Query  360  GNMSREMFELNFVIPNDKRSWFIGW-DQIADLL  265
            G   +EMF L+F  P  +R  + GW + +A LL
Sbjct  934  GRALKEMFGLSFTPPRPRRRSY-GWKNSMASLL  965



>gb|KDP27640.1| hypothetical protein JCGZ_19645 [Jatropha curcas]
Length=965

 Score =   165 bits (417),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 130/208 (63%), Gaps = 11/208 (5%)
 Frame = -2

Query  891  EANEAAGYTLENEENI-----PEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFY  727
            E + +AG   +N +++      E  E+   W +TF  Q ++I++LW  C VS++HR+ F+
Sbjct  755  ETDPSAGSCKKNAKDVGLDPMSEALETFNDWPLTFERQRREILELWQACNVSLVHRTYFF  814

Query  726  LLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFL  547
            LLFKGD  D IY+EVE+RRL++L + L++ GN     LG   T +L+SSIKAL RE+  L
Sbjct  815  LLFKGDPTDSIYMEVELRRLSFLTETLSQ-GN---QDLGGGQTFTLASSIKALHRERGML  870

Query  546  AKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGF  370
            +K +  RL+ EER  LY KW + L  K RRL   N+LW   +D  ++ ESA IVAKLV F
Sbjct  871  SKLMQKRLSEEERKRLYQKWGIELNSKRRRLQLANRLWCNTKDINNIMESAAIVAKLVRF  930

Query  369  CESGNMSREMFELNFVIPNDKRSWFIGW  286
             E G   +EMF L+F  P+ +R   +GW
Sbjct  931  VEQGQALKEMFGLSFTPPSTRRRS-LGW  957



>dbj|BAJ94998.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=873

 Score =   164 bits (415),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 118/176 (67%), Gaps = 2/176 (1%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +  +SP+ W + F  + Q+IIDLW  C+ S++HR+ F+LLFKGD AD IY+EVEIRRL
Sbjct  679  IMDALQSPSRWPLEFERKQQEIIDLWHACYASLVHRTYFFLLFKGDPADSIYMEVEIRRL  738

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   A  G  S    G+  T SL SS + L+RE+E L +++  RL+ EER+++Y KW
Sbjct  739  SFLKDTYANGGMESKVVAGSLNT-SLVSSARKLQREREMLCRQMQKRLSIEERESMYTKW  797

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             V L  K RRL    +LWT+ ++ +HV+ESA +VA+L+G  E G   REMF L+F 
Sbjct  798  GVSLSSKRRRLQVARRLWTETKNLEHVRESASLVARLIGLLEPGKALREMFGLSFA  853



>gb|KHN17757.1| hypothetical protein glysoja_005954 [Glycine soja]
Length=143

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 111/145 (77%), Gaps = 3/145 (2%)
 Frame = -2

Query  690  IEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEE  514
            +EVE+RRLT L+QHLAE+GNA+    G+EP  S+S+SI+AL++E+E LA+++ T+LT EE
Sbjct  1    MEVELRRLTRLEQHLAEVGNATLLG-GDEPAGSVSASIRALKQEREHLARKVNTKLTAEE  59

Query  513  RDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFE  334
            R+ LY K EVP  GK RRL F+NKLWT P + +HVQESAEIVAKL+ F  S   S+++ E
Sbjct  60   RELLYAKLEVPPVGKQRRLQFVNKLWTDPYNMQHVQESAEIVAKLIDFSVSDENSKDLIE  119

Query  333  LNFVIPNDKRSWFIGWDQIADLLHL  259
            LNF  P +K+ W  GW+ I++LL+L
Sbjct  120  LNFSSPFNKKQW-AGWNFISNLLNL  143



>gb|EMS68002.1| Kinesin-related protein 11 [Triticum urartu]
Length=928

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 118/176 (67%), Gaps = 2/176 (1%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +  +SP+ W + F  + Q+IIDLW  C+ S++HR+ F+LLFKGD AD IY+EVEIRRL
Sbjct  734  IMDALQSPSRWPLEFERKQQEIIDLWHACYASLVHRTYFFLLFKGDPADSIYMEVEIRRL  793

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   A  G  S    G+  T SL SS + L+RE+E L +++  RL+ EER+++Y KW
Sbjct  794  SFLKDTYANGGMESKVVAGSLNT-SLVSSARKLQREREMLCRQMQKRLSIEERESMYTKW  852

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             V L  K RRL    +LWT+ ++ +HV+ESA +VA+L+G  E G   REMF L+F 
Sbjct  853  GVSLSSKRRRLQVARRLWTETKNLEHVRESASLVARLIGLLEPGKALREMFGLSFA  908



>dbj|BAJ95863.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=936

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 118/176 (67%), Gaps = 2/176 (1%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +  +SP+ W + F  + Q+IIDLW  C+ S++HR+ F+LLFKGD AD IY+EVEIRRL
Sbjct  742  IMDALQSPSRWPLEFERKQQEIIDLWHACYASLVHRTYFFLLFKGDPADSIYMEVEIRRL  801

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   A  G  S    G+  T SL SS + L+RE+E L +++  RL+ EER+++Y KW
Sbjct  802  SFLKDTYANGGMESKVVAGSLNT-SLVSSARKLQREREMLCRQMQKRLSIEERESMYTKW  860

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             V L  K RRL    +LWT+ ++ +HV+ESA +VA+L+G  E G   REMF L+F 
Sbjct  861  GVSLSSKRRRLQVARRLWTETKNLEHVRESASLVARLIGLLEPGKALREMFGLSFA  916



>ref|XP_002452843.1| hypothetical protein SORBIDRAFT_04g033456 [Sorghum bicolor]
 gb|EES05819.1| hypothetical protein SORBIDRAFT_04g033456 [Sorghum bicolor]
Length=584

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 120/176 (68%), Gaps = 2/176 (1%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +  +SP+ W + F ++ Q+II LW  C +S++HR+ F+LLFKGD AD IY+EVE+RRL
Sbjct  387  IADASQSPSRWPLEFEKKQQEIIGLWHACSISLVHRTYFFLLFKGDQADSIYMEVELRRL  446

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   +     S A +G+  +  ++S+ K L+RE+E LA+++  RLT EER+ LY KW
Sbjct  447  SFLRDTYSRGSTPSNAVVGSLNSSPVASA-KKLQREREMLARQMQKRLTAEEREHLYTKW  505

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             + L+ K R+L    +LWT  +D +HV++SA +VAKL+G  E G + REMF L+F 
Sbjct  506  GISLDSKKRKLQVARRLWTNTEDLEHVRDSASLVAKLIGLQEPGQVLREMFGLSFA  561



>ref|XP_008444776.1| PREDICTED: kinesin-like protein NACK1 [Cucumis melo]
Length=948

 Score =   163 bits (412),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 122/180 (68%), Gaps = 6/180 (3%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            ++ + W + F  Q + II+LWD C V ++HRS F++LFKGD +D +Y+EVE+RRL ++++
Sbjct  763  QAHSEWMLEFEGQQRDIIELWDACNVPLVHRSYFFILFKGDPSDAVYMEVELRRLFFIRE  822

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
             ++   N S    G   TV+ +SS+KAL RE+E LA+R+  + + +ERDALY+KW + L+
Sbjct  823  AISRSANGS----GRGDTVTQTSSLKALNREREMLARRMKKKFSAKERDALYVKWGIDLK  878

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPN-DKRSW  298
             K R +     LW++ +D  H+ ESA +VAKL+GF E   +SREMF L+F + + D RS+
Sbjct  879  TKQRSIQVARMLWSRTKDFDHINESAALVAKLIGFVEPNQVSREMFGLSFSLQSLDHRSF  938



>gb|AAK91812.1|AF272749_1 kinesin heavy chain [Zea mays]
Length=766

 Score =   161 bits (408),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 121/176 (69%), Gaps = 2/176 (1%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +  +SP+ W + F ++ Q+II LW  C +S++HR+ F+LLFKG+ AD IY+EVE+RRL
Sbjct  569  IADASQSPSRWPLEFEKKQQEIIGLWHACCISLVHRTYFFLLFKGEQADSIYMEVELRRL  628

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   +     S A +G+  + S ++S K L+RE+E LA+++  RLT EER+ LY KW
Sbjct  629  SFLRDTYSRGNTPSNAVVGSLNS-SPAASAKKLQREREMLARQMQKRLTAEERERLYTKW  687

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             + L+ K R+L    +LWT+ +D +HV+ESA +VAKL+G  E G + REMF L+F 
Sbjct  688  GISLDSKKRKLQVARRLWTEAEDLEHVRESASLVAKLIGLQEPGQVLREMFGLSFA  743



>ref|XP_002448243.1| hypothetical protein SORBIDRAFT_06g023880 [Sorghum bicolor]
 gb|EES12571.1| hypothetical protein SORBIDRAFT_06g023880 [Sorghum bicolor]
Length=941

 Score =   162 bits (411),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 118/177 (67%), Gaps = 2/177 (1%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +  +SP+ W + F ++ Q+IIDLW  C VS++HR+ F+LLFKGD AD IY+EVE+RRL
Sbjct  745  IMDALQSPSRWPLEFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRL  804

Query  666  TWLQQHLAELGN-ASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIK  493
            ++L+      G+      +   P+ SL SS K L+RE+E L +++  RLT +ER++LY K
Sbjct  805  SFLKNTTYSNGSMGRNVVVAGSPSTSLVSSAKKLQREREMLCRQMQKRLTIQERESLYTK  864

Query  492  WEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
            W V L  K RRL    +LWT+ ++ +HV+ESA +VA+L+G  E G   REMF L+F 
Sbjct  865  WGVSLSSKRRRLQVARRLWTETKNLEHVRESASLVARLIGLLEPGKALREMFGLSFA  921



>gb|EEE57467.1| hypothetical protein OsJ_07707 [Oryza sativa Japonica Group]
Length=659

 Score =   160 bits (405),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 128/191 (67%), Gaps = 6/191 (3%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I  + +SP+ W + F ++ Q+II+LW  C +S++HR+ F+LLFKG++AD IY+EVE+RRL
Sbjct  463  IEGVSQSPSRWPLEFEKKQQEIIELWQACSISLVHRTYFFLLFKGEAADSIYMEVELRRL  522

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   +     S A +G+  T  ++S+ K L+RE+E LA+++  RL+ EER+  Y KW
Sbjct  523  SFLRDTYSRGSTPSNAIVGSLSTSPVASA-KKLQREREMLARQMQKRLSTEEREHTYTKW  581

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVI---  319
             V L+ K R+L    +LWT+ +D +HV+ESA +VAKL+G  E G + +EMF L+F     
Sbjct  582  GVSLDSKRRKLQVARRLWTETKDLEHVRESASLVAKLIGLQEPGQVLKEMFGLSFAPQQQ  641

Query  318  PNDKRSWFIGW  286
            P  +RS   GW
Sbjct  642  PTRRRSSN-GW  651



>dbj|BAF00479.1| hypothetical protein [Arabidopsis thaliana]
Length=231

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 114/183 (62%), Gaps = 7/183 (4%)
 Frame = -2

Query  840  EIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTW  661
            E+  +  +W   F  Q +QI+ LW  C VS++HR+ F+LLF GD AD IYI VE+RRL++
Sbjct  42   EVSGTMTNWSEEFERQREQILGLWQTCHVSLVHRTYFFLLFTGDQADSIYIGVELRRLSF  101

Query  660  LQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLT-RLTPEERDALYIKWEV  484
            +++  ++  +A         T++++SS+KAL RE+  L+K +  R T EER  LY K+ +
Sbjct  102  MKESFSQGNHA----FERGQTLTIASSLKALHRERRMLSKLVGKRFTGEERKRLYQKFGI  157

Query  483  PLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV--IPND  310
             +  K RRL   N+LW+KP D  H  ESA +VAKLV F E G   +EMF L+F   +P  
Sbjct  158  AVNSKRRRLQLANQLWSKPNDITHAVESAAVVAKLVRFVEQGRAMKEMFGLSFTPPLPTT  217

Query  309  KRS  301
            +RS
Sbjct  218  RRS  220



>ref|XP_008678883.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Zea mays]
Length=850

 Score =   161 bits (408),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 121/176 (69%), Gaps = 2/176 (1%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +  +SP+ W + F ++ Q+II LW  C +S++HR+ F+LLFKG+ AD IY+EVE+RRL
Sbjct  653  IADASQSPSRWPLEFEKKQQEIIGLWHACCISLVHRTYFFLLFKGEQADSIYMEVELRRL  712

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   +     S A +G+  + S ++S K L+RE+E LA+++  RLT EER+ LY KW
Sbjct  713  SFLRDTYSRGNTPSNAVVGSLNS-SPAASAKKLQREREMLARQMQKRLTAEERERLYTKW  771

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             + L+ K R+L    +LWT+ +D +HV+ESA +VAKL+G  E G + REMF L+F 
Sbjct  772  GISLDSKKRKLQVARRLWTEAEDLEHVRESASLVAKLIGLQEPGQVLREMFGLSFA  827



>ref|XP_002305465.1| kinesin motor family protein [Populus trichocarpa]
 gb|EEE85976.1| kinesin motor family protein [Populus trichocarpa]
Length=842

 Score =   161 bits (408),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 120/184 (65%), Gaps = 6/184 (3%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            E+P +W + F  Q + I++LW  C VS++HR+ F+LLF+GD  D IY+EVE+RRL++L++
Sbjct  655  ETPRNWPLEFERQQRAILELWQTCNVSLVHRTYFFLLFQGDPTDSIYMEVELRRLSFLKE  714

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLT-RLTPEERDALYIKWEVPLE  475
              ++ GN     +G   T++L+SSIKAL RE+  L+K +  R + EER+ LY KW + L 
Sbjct  715  TFSQ-GNQG---VGGGRTLTLASSIKALHRERGMLSKMMNKRFSEEERNRLYKKWGIGLS  770

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIP-NDKRSW  298
             K RRL   N++W+  +D  HV ESA +VAKLV F E G   +EMF L+F  P +  +  
Sbjct  771  SKRRRLQLANRIWSNTKDIDHVMESAAVVAKLVRFVEQGQALKEMFGLSFTPPTSSTKRR  830

Query  297  FIGW  286
             +GW
Sbjct  831  SLGW  834



>dbj|BAD25802.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
 dbj|BAD25793.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
Length=650

 Score =   160 bits (404),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 128/191 (67%), Gaps = 6/191 (3%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I  + +SP+ W + F ++ Q+II+LW  C +S++HR+ F+LLFKG++AD IY+EVE+RRL
Sbjct  454  IEGVSQSPSRWPLEFEKKQQEIIELWQACSISLVHRTYFFLLFKGEAADSIYMEVELRRL  513

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   +     S A +G+  T  ++S+ K L+RE+E LA+++  RL+ EER+  Y KW
Sbjct  514  SFLRDTYSRGSTPSNAIVGSLSTSPVASA-KKLQREREMLARQMQKRLSTEEREHTYTKW  572

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVI---  319
             V L+ K R+L    +LWT+ +D +HV+ESA +VAKL+G  E G + +EMF L+F     
Sbjct  573  GVSLDSKRRKLQVARRLWTETKDLEHVRESASLVAKLIGLQEPGQVLKEMFGLSFAPQQQ  632

Query  318  PNDKRSWFIGW  286
            P  +RS   GW
Sbjct  633  PTRRRSSN-GW  642



>gb|EEC77720.1| hypothetical protein OsI_16807 [Oryza sativa Indica Group]
Length=945

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 120/188 (64%), Gaps = 7/188 (4%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +  +SP+ W + F ++ Q+IID W  C VS++HR+ F+LLFKGD AD IY+EVE+RRL
Sbjct  756  ITDALQSPSRWPLEFEKKQQEIIDFWHACNVSLVHRTYFFLLFKGDPADSIYMEVELRRL  815

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLT-RLTPEERDALYIKW  490
            ++L+   +   N + A +   P  SL SS K L+RE+E L +++  RL+ EER+++Y KW
Sbjct  816  SFLKDTYS---NGAIASI---PNTSLVSSAKKLQREREMLCRQMQRRLSIEERESMYTKW  869

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPND  310
             V L  K RRL     LWT+ +D +HV+ESA +VA+L+G  E G   REMF L+F     
Sbjct  870  GVSLASKRRRLQVARCLWTETKDLEHVRESASLVARLIGLLEPGKALREMFGLSFAPQQF  929

Query  309  KRSWFIGW  286
             R  +  W
Sbjct  930  TRRSYNSW  937



>emb|CAE03025.3| OSJNBa0091D06.23 [Oryza sativa Japonica Group]
Length=915

 Score =   161 bits (408),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 120/188 (64%), Gaps = 7/188 (4%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +  +SP+ W + F ++ Q+IID W  C VS++HR+ F+LLFKGD AD IY+EVE+RRL
Sbjct  726  ITDALQSPSRWPLEFEKKQQEIIDFWHACNVSLVHRTYFFLLFKGDPADSIYMEVELRRL  785

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLT-RLTPEERDALYIKW  490
            ++L+   +   N + A +   P  SL SS K L+RE+E L +++  RL+ EER+++Y KW
Sbjct  786  SFLKDTYS---NGAIASI---PNTSLVSSAKKLQREREMLCRQMQRRLSIEERESMYTKW  839

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPND  310
             V L  K RRL     LWT+ +D +HV+ESA +VA+L+G  E G   REMF L+F     
Sbjct  840  GVSLASKRRRLQVARCLWTETKDLEHVRESASLVARLIGLLEPGKALREMFGLSFAPQQF  899

Query  309  KRSWFIGW  286
             R  +  W
Sbjct  900  TRRSYNSW  907



>ref|NP_001053433.1| Os04g0538800 [Oryza sativa Japonica Group]
 emb|CAE02777.2| OSJNBa0011L07.1 [Oryza sativa Japonica Group]
 dbj|BAF15347.1| Os04g0538800 [Oryza sativa Japonica Group]
 dbj|BAG95469.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61418.1| hypothetical protein OsJ_15615 [Oryza sativa Japonica Group]
Length=945

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 120/188 (64%), Gaps = 7/188 (4%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +  +SP+ W + F ++ Q+IID W  C VS++HR+ F+LLFKGD AD IY+EVE+RRL
Sbjct  756  ITDALQSPSRWPLEFEKKQQEIIDFWHACNVSLVHRTYFFLLFKGDPADSIYMEVELRRL  815

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLT-RLTPEERDALYIKW  490
            ++L+   +   N + A +   P  SL SS K L+RE+E L +++  RL+ EER+++Y KW
Sbjct  816  SFLKDTYS---NGAIASI---PNTSLVSSAKKLQREREMLCRQMQRRLSIEERESMYTKW  869

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPND  310
             V L  K RRL     LWT+ +D +HV+ESA +VA+L+G  E G   REMF L+F     
Sbjct  870  GVSLASKRRRLQVARCLWTETKDLEHVRESASLVARLIGLLEPGKALREMFGLSFAPQQF  929

Query  309  KRSWFIGW  286
             R  +  W
Sbjct  930  TRRSYNSW  937



>ref|XP_008678882.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Zea mays]
 gb|AFW63203.1| kinesin heavy chain [Zea mays]
Length=880

 Score =   161 bits (408),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 121/176 (69%), Gaps = 2/176 (1%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +  +SP+ W + F ++ Q+II LW  C +S++HR+ F+LLFKG+ AD IY+EVE+RRL
Sbjct  683  IADASQSPSRWPLEFEKKQQEIIGLWHACCISLVHRTYFFLLFKGEQADSIYMEVELRRL  742

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   +     S A +G+  + S ++S K L+RE+E LA+++  RLT EER+ LY KW
Sbjct  743  SFLRDTYSRGNTPSNAVVGSLNS-SPAASAKKLQREREMLARQMQKRLTAEERERLYTKW  801

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             + L+ K R+L    +LWT+ +D +HV+ESA +VAKL+G  E G + REMF L+F 
Sbjct  802  GISLDSKKRKLQVARRLWTEAEDLEHVRESASLVAKLIGLQEPGQVLREMFGLSFA  857



>gb|KHF98979.1| Kinesin-related 11 [Gossypium arboreum]
Length=949

 Score =   161 bits (407),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 124/186 (67%), Gaps = 6/186 (3%)
 Frame = -2

Query  840  EIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTW  661
            +   +P  W   F    + I++LW  C VS++HR+ F+LLFKGD AD IY+EVE+RRLT+
Sbjct  761  DASSTPLHWPQEFERLQRAILELWQACNVSLVHRTYFFLLFKGDPADSIYMEVELRRLTF  820

Query  660  LQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEV  484
            L++  +E GN + A+ G   T++L+SS+++L REK+ L++ L  R T EER+ LY KW +
Sbjct  821  LKESFSE-GNQA-AEDGR--TLTLASSVRSLHREKQTLSRLLRKRFTEEEREKLYKKWGI  876

Query  483  PLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPNDKR  304
             L  K RRL  +N+LW+  +D  HV++SA IVAKL+ F E G   +EMF L+F  P+ +R
Sbjct  877  ELNSKQRRLQLVNQLWSNNKDMSHVKDSAAIVAKLIRFVEQGKALKEMFGLSFTPPHPRR  936

Query  303  SWFIGW  286
              + GW
Sbjct  937  RSY-GW  941



>ref|XP_004148539.1| PREDICTED: kinesin-like protein KIN12B-like [Cucumis sativus]
 ref|XP_004167100.1| PREDICTED: kinesin-like protein KIN12B-like [Cucumis sativus]
Length=930

 Score =   161 bits (407),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 115/177 (65%), Gaps = 5/177 (3%)
 Frame = -2

Query  822  ASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQHLA  643
            + W   F+ Q + IIDLW  C VSI+HR+ F+LLF+GD AD IY+EVE+RRLT+L+Q   
Sbjct  748  SDWKEEFQRQQRMIIDLWQTCNVSIVHRTYFFLLFQGDPADSIYMEVEVRRLTFLKQTFY  807

Query  642  ELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLEGKN  466
              GN++   + +   VS SSSI+ LRRE+E L+K +  R+T +ER  L+ KW + L  K 
Sbjct  808  -YGNSA---MDDGRKVSFSSSIRDLRRERETLSKLMQKRITEDERKRLFQKWGIALNSKR  863

Query  465  RRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPNDKRSWF  295
            RRL  +++LWT P++  HV ESA IVAKLV F E G   +  F L+F+ P  K   F
Sbjct  864  RRLQLMSQLWTDPKNMNHVTESAAIVAKLVKFAEQGQALKGNFGLSFITPPQKSRSF  920



>ref|XP_011083601.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
 ref|XP_011083602.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=913

 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/202 (41%), Positives = 126/202 (62%), Gaps = 7/202 (3%)
 Frame = -2

Query  897  ELEANEAAGYTLENEENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLF  718
            E E ++A   T    +   + ++S + W   F+ Q ++II+LWD C   ++HR+ F+LLF
Sbjct  707  EREPDDAKQTTDGGSDKTQDTEQSASDWQTEFQRQKKEIIELWDACHTPLVHRTYFFLLF  766

Query  717  KGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKR  538
            KGD +D +Y+EVE+RRL +L+  L        A L ++ +   ++S+KAL RE+E L+KR
Sbjct  767  KGDPSDAVYLEVELRRLQFLKNTL-----HGGAVLKDDQSFKQAASVKALNREREMLSKR  821

Query  537  -LTRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCES  361
             L + + +ER+AL+ KW + ++ K RR+    +LWT P D  H+ ESA IVAKLVGF E 
Sbjct  822  MLKKYSVKEREALFEKWGIDIKSKQRRVQLCRQLWTDPTDMDHINESATIVAKLVGFKEP  881

Query  360  GNMSREMFELNFVI-PNDKRSW  298
            G   +EMF L+F   P D +S+
Sbjct  882  GQAPKEMFGLSFSPRPADVKSF  903



>gb|EEC73693.1| hypothetical protein OsI_08272 [Oryza sativa Indica Group]
Length=854

 Score =   160 bits (404),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 128/191 (67%), Gaps = 6/191 (3%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I  + +SP+ W + F ++ Q+II+LW  C +S++HR+ F+LLFKG++AD IY+EVE+RRL
Sbjct  658  IEGVSQSPSRWPLEFEKKQQEIIELWQACSISLVHRTYFFLLFKGEAADSIYMEVELRRL  717

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   +     S A +G+  T  ++S+ K L+RE+E LA+++  RL+ EER+  Y KW
Sbjct  718  SFLRDTYSRGSTPSNAIVGSLSTSPVASA-KKLQREREMLARQMQKRLSTEEREHTYTKW  776

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVI---  319
             V L+ K R+L    +LWT+ +D +HV+ESA +VAKL+G  E G + +EMF L+F     
Sbjct  777  GVSLDSKRRKLQVARRLWTETKDLEHVRESASLVAKLIGLQEPGQVLKEMFGLSFAPQQQ  836

Query  318  PNDKRSWFIGW  286
            P  +RS   GW
Sbjct  837  PTRRRSSN-GW  846



>ref|XP_004976382.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Setaria 
italica]
 ref|XP_004976383.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Setaria 
italica]
Length=946

 Score =   160 bits (405),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 115/171 (67%), Gaps = 2/171 (1%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            +SP+ W + F ++ Q+IIDLW  C VS++HR+ F+LLFKGD AD IY+EVE+RRL++L+ 
Sbjct  758  QSPSRWPLEFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRLSFLKD  817

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
              +  G+     +      SL SS K L+RE+E L +++  RLT +ER+++Y KW + L 
Sbjct  818  TYSN-GSMGRNVVAGSLNTSLVSSAKKLQREREMLCRQMQKRLTIQERESMYTKWGISLS  876

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             K RRL    +LWT+ +D +HV+ESA +VA+L+G  E G   REMF L+F 
Sbjct  877  SKRRRLQVARRLWTETKDLEHVRESASLVARLIGLLEPGKALREMFGLSFA  927



>ref|XP_008663418.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Zea mays]
 gb|AFW59005.1| hypothetical protein ZEAMMB73_363128 [Zea mays]
Length=944

 Score =   160 bits (405),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 120/192 (63%), Gaps = 5/192 (3%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +I +SP+ W + F ++ Q+IIDLW  C VS++HR+ F+LLFKGD AD IY+EVE+RRL
Sbjct  745  IMDILQSPSRWPLEFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRL  804

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSS----SIKALRREKEFLAKRL-TRLTPEERDAL  502
            ++L+   +          G+  T  +SS    S K L+RE+E L +++  RLT +ER++L
Sbjct  805  SFLKNTYSNGSMGYDMVAGSLSTSLVSSDLLCSAKKLQREREMLCRQMQKRLTIQERESL  864

Query  501  YIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
            Y KW V L  K RRL    +LWT+ +D +HV+ESA +VA+L+G  E G   REMF L+F 
Sbjct  865  YTKWGVSLSSKRRRLQVARRLWTETRDLEHVRESASLVARLIGLLEPGKALREMFGLSFA  924

Query  321  IPNDKRSWFIGW  286
                 R     W
Sbjct  925  PQQSTRRSHSSW  936



>ref|NP_001047571.1| Os02g0645100 [Oryza sativa Japonica Group]
 dbj|BAD25811.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
 dbj|BAF09485.1| Os02g0645100 [Oryza sativa Japonica Group]
 dbj|BAG94862.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01337.1| unnamed protein product [Oryza sativa Japonica Group]
Length=884

 Score =   160 bits (404),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 128/191 (67%), Gaps = 6/191 (3%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I  + +SP+ W + F ++ Q+II+LW  C +S++HR+ F+LLFKG++AD IY+EVE+RRL
Sbjct  688  IEGVSQSPSRWPLEFEKKQQEIIELWQACSISLVHRTYFFLLFKGEAADSIYMEVELRRL  747

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   +     S A +G+  T  ++S+ K L+RE+E LA+++  RL+ EER+  Y KW
Sbjct  748  SFLRDTYSRGSTPSNAIVGSLSTSPVASA-KKLQREREMLARQMQKRLSTEEREHTYTKW  806

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVI---  319
             V L+ K R+L    +LWT+ +D +HV+ESA +VAKL+G  E G + +EMF L+F     
Sbjct  807  GVSLDSKRRKLQVARRLWTETKDLEHVRESASLVAKLIGLQEPGQVLKEMFGLSFAPQQQ  866

Query  318  PNDKRSWFIGW  286
            P  +RS   GW
Sbjct  867  PTRRRSSN-GW  876



>ref|XP_009389113.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389114.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=947

 Score =   160 bits (404),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 121/187 (65%), Gaps = 6/187 (3%)
 Frame = -2

Query  840  EIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTW  661
            ++ +SP+ W + F ++ Q+II LW  C VS++HR+ FY+LFKGD  D IY+EVE+RRL++
Sbjct  757  DVLQSPSVWSLEFEKKQQEIIKLWHDCNVSLVHRTYFYMLFKGDPTDSIYMEVELRRLSF  816

Query  660  LQQHLAELGNAS-PAQLGNEPTVSLSSSIKALRREKEFLAKRLTR-LTPEERDALYIKWE  487
            L+ +L+ LGNA   A+LG   T   +SS+K LRRE++ L + + + L   ER++LYIKW 
Sbjct  817  LKSNLS-LGNADKTAELGQSST--YASSLKLLRRERDMLCREMQKSLCAAERESLYIKWG  873

Query  486  VPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPNDK  307
            + L  K RRL     LW+  +D +HV+ESA +VA+++G  E G   +EMF L F  P   
Sbjct  874  IALSSKQRRLQLARSLWSDRKDLEHVRESASVVARVIGLFEQGQALKEMFGLTFS-PQRS  932

Query  306  RSWFIGW  286
               F  W
Sbjct  933  NRRFHNW  939



>ref|XP_010271468.1| PREDICTED: kinesin-like protein NACK2 [Nelumbo nucifera]
Length=976

 Score =   160 bits (404),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 125/190 (66%), Gaps = 4/190 (2%)
 Frame = -2

Query  882  EAAGYTLENEENIP--EIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGD  709
            + +G T++N    P  +  +SP SW + F  Q ++II+LW  C VS+IHR+ F LLF GD
Sbjct  769  DKSGTTVKNVGVDPMQDPSDSPLSWPLEFERQQREIIELWHTCNVSLIHRTYFLLLFGGD  828

Query  708  SADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-T  532
             AD IY++VE+RRL++++   ++ GN +   + ++  ++ +SS++ALRRE+E L+KR+  
Sbjct  829  PADSIYMKVELRRLSFIRDTFSQ-GNLAKHAMIDDWALTPASSMRALRREREMLSKRMPK  887

Query  531  RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNM  352
            R +  ER+ LY KW + L+ K RRL    +LWT  +D  HV ESA IVAKL+GF E G  
Sbjct  888  RFSEGEREQLYKKWGIGLDTKQRRLQLARRLWTDTKDMDHVMESATIVAKLIGFQEPGQA  947

Query  351  SREMFELNFV  322
             +EMF L+F 
Sbjct  948  LKEMFGLSFT  957



>gb|EMS48860.1| Kinesin-related protein 4 [Triticum urartu]
Length=862

 Score =   159 bits (403),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 126/185 (68%), Gaps = 5/185 (3%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            +SP+ W + F ++ Q+II+LW  C +S++HR+ F+LLFKG+SAD IY+EVE+RRL++L+ 
Sbjct  672  QSPSRWPLEFEKKQQEIIELWHACSISLVHRTYFFLLFKGESADSIYMEVELRRLSFLRD  731

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
              +     S   +G+  +  ++S+ K L+RE+E LA+++  RL+ EER+ +Y KW V L+
Sbjct  732  TYSRGSTPSNVTVGSLSSSPVASA-KKLQREREMLARQMQKRLSVEERNHMYTKWSVSLD  790

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVI--PNDKRS  301
             K R+L    +LWT+ +D +HV+ESA +VAKL+G  E G + REMF L+F    P  +RS
Sbjct  791  SKKRKLQVARRLWTESRDLEHVRESASLVAKLIGLQEPGQVLREMFGLSFAPQQPPARRS  850

Query  300  WFIGW  286
               GW
Sbjct  851  SN-GW  854



>gb|EMT03608.1| Kinesin-related protein 4 [Aegilops tauschii]
Length=866

 Score =   159 bits (402),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 126/185 (68%), Gaps = 5/185 (3%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            +SP+ W + F ++ Q+II+LW  C +S++HR+ F+LLFKG+SAD IY+EVE+RRL++L+ 
Sbjct  676  QSPSRWPLEFEKKQQEIIELWHACSISLVHRTYFFLLFKGESADSIYMEVELRRLSFLRD  735

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
              +     S   +G+  +  ++S+ K L+RE+E LA+++  RL+ EER+ +Y KW V L+
Sbjct  736  TYSRGSTPSNVTVGSLSSSPVASA-KKLQREREMLARQMQKRLSVEERNHMYTKWSVSLD  794

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVI--PNDKRS  301
             K R+L    +LWT+ +D +HV+ESA +VAKL+G  E G + REMF L+F    P  +RS
Sbjct  795  SKRRKLQVARRLWTESRDLEHVRESASLVAKLIGLQEPGQVLREMFGLSFAPQQPPTRRS  854

Query  300  WFIGW  286
               GW
Sbjct  855  SN-GW  858



>ref|XP_010933747.1| PREDICTED: kinesin-like protein NACK1 [Elaeis guineensis]
Length=961

 Score =   159 bits (403),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 121/181 (67%), Gaps = 6/181 (3%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            +SP+ W + F  + Q+II+LW  C VS++HR+ F+LLFKGD  D IY+EVE+RRL++L+ 
Sbjct  770  QSPSRWLLEFERKQQEIIELWHACNVSLVHRTYFFLLFKGDPTDSIYMEVELRRLSFLKN  829

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
              ++ GN      G++ T  LSS+ K LRRE++ L +R+  RL+ EER+ LY KW + L+
Sbjct  830  TYSQ-GNLDKTADGSQITAILSST-KKLRRERQMLCRRMQKRLSVEERECLYTKWGIALD  887

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPN--DKRS  301
             K RRL     LWT+  D +H++ESA +VA LVG  E G   +EMF L+F IP   ++RS
Sbjct  888  SKQRRLQLARCLWTETGDLEHIRESASLVASLVGLLEPGQALKEMFGLSF-IPQQFNRRS  946

Query  300  W  298
            +
Sbjct  947  Y  947



>gb|EYU38855.1| hypothetical protein MIMGU_mgv1a000996mg [Erythranthe guttata]
Length=917

 Score =   159 bits (401),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 121/181 (67%), Gaps = 9/181 (5%)
 Frame = -2

Query  852  ENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIR  673
            +   +I++S + W I F  Q ++II+LW+ C + ++HR+ F+LLFKGD +D +Y+EVE+R
Sbjct  734  DKTKDIKKSSSDWQIEFERQKKEIIELWNSCHIPLVHRTYFFLLFKGDPSDSVYLEVELR  793

Query  672  RLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYI  496
            RL++L+         S   + ++ +   +SS KAL+RE+E L++RL  +L+ +ER AL+ 
Sbjct  794  RLSFLKN--------SMHGVTDDKSCKQASSAKALKREREMLSRRLLKKLSAKERQALFE  845

Query  495  KWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIP  316
            KW + ++ K RRL    KLWT+  + +HV ESA IVAKLVGF E+G   +EMF L+F+  
Sbjct  846  KWGIDVKSKQRRLQLSRKLWTETNNMEHVSESAAIVAKLVGFKEAGRAPKEMFGLSFLPA  905

Query  315  N  313
            N
Sbjct  906  N  906



>ref|XP_011037209.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037210.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037211.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037212.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037214.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037215.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
Length=973

 Score =   159 bits (402),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 132/217 (61%), Gaps = 14/217 (6%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQ--------ESPASWHITFREQMQQIIDLWDVCFVS  751
            Q+++ +  E    T E +++  +I         E+P +W + F  Q + I++LW  C VS
Sbjct  753  QLVDAQVQETEAMTGEYDKSSKDIGLDPMHEPLETPRNWPLEFERQQRAILELWQTCNVS  812

Query  750  IIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKA  571
            ++HR+ F+LLF+GD  D IY+EVE+RRL++L++  ++ GN     +G   T++L+SSIKA
Sbjct  813  LVHRTYFFLLFQGDPTDSIYMEVELRRLSFLKETFSQ-GNQG---VGGGRTLTLASSIKA  868

Query  570  LRREKEFLAKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAE  394
            L RE+  L+K +  R + EER+ LY KW + L  K RRL   N++W+  +D  HV ESA 
Sbjct  869  LHRERGMLSKMMNKRFSEEERNRLYKKWGIGLSSKRRRLQLANRIWSNTKDIDHVMESAA  928

Query  393  IVAKLVGFCESGNMSREMFELNFVIP-NDKRSWFIGW  286
            +VAKLV F E G   + MF L+F  P +  +   +GW
Sbjct  929  VVAKLVRFVEQGQALKAMFGLSFTPPTSSTKRRSLGW  965



>ref|XP_006647603.1| PREDICTED: kinesin-like protein NACK1-like [Oryza brachyantha]
Length=868

 Score =   157 bits (398),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 119/171 (70%), Gaps = 2/171 (1%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            +SP+ W + F ++ Q+II+LW  C +S++HR+ F+LLFKG++AD IY+EVE+RRL++L+ 
Sbjct  678  QSPSRWPLEFEKKQQEIIELWQACSISLVHRTYFFLLFKGETADSIYMEVELRRLSFLRD  737

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
              +     S   +G+  T  ++S+ K L+RE+E LA+++  RL+ EER+  Y KW V L+
Sbjct  738  TYSRGSTPSNVIVGSLSTSPVASA-KKLQREREMLARQMQKRLSTEEREHTYTKWGVSLD  796

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             K R+L    +LWT+ +D +HV+ESA +VAKL+G  E G + REMF L+F 
Sbjct  797  SKKRKLQVARRLWTQTKDLEHVRESASLVAKLIGLQEPGQVLREMFGLSFA  847



>ref|XP_004953277.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Setaria 
italica]
 ref|XP_004953278.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Setaria 
italica]
Length=880

 Score =   157 bits (398),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 120/176 (68%), Gaps = 4/176 (2%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I +  +SP+ W + F ++ Q+II+LW  C +S++HR+ F+LLFKGD AD IY+EVE+RRL
Sbjct  685  IADASQSPSRWPLEFEKKQQEIIELWHACSISLVHRTYFFLLFKGDQADSIYMEVELRRL  744

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   +  G  S   +G+  + S ++S K L+RE+E LA+++  RLT  ERD LY KW
Sbjct  745  SFLRDTYSRGGTPSNVVVGSLNS-SPAASAKKLQREREMLARQMQKRLTAVERDHLYSKW  803

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             + L+ K R+L    +LWT+ +D +HV+ESA +VAKL+G  E G   REMF L+F 
Sbjct  804  GISLDSKKRKLQVARRLWTETKDLEHVRESASLVAKLLGLQEPG--LREMFGLSFA  857



>ref|XP_008791670.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Phoenix dactylifera]
 ref|XP_008791671.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Phoenix dactylifera]
Length=975

 Score =   158 bits (399),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 114/171 (67%), Gaps = 3/171 (2%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            +SP+ W + F  + Q+II+LW  C VS++HR+ F+LLFKGD  D IY+EVE+RRL++L+ 
Sbjct  784  QSPSRWPLEFERKQQEIIELWHTCDVSLVHRTYFFLLFKGDPTDSIYMEVELRRLSFLKS  843

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
              +       A  G    ++ SSS+K LRRE+E L +++  RL+ EER++LY KW + L+
Sbjct  844  AFSREDIDKAA--GGGQNITPSSSMKKLRREREMLCRQMQKRLSAEERESLYTKWGIALD  901

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             K RRL    +LWT+  + +HV+ESA +VA+L+G  E G   +EMF L+F 
Sbjct  902  SKQRRLQLARRLWTETGNLEHVRESASLVARLIGLLEPGQALKEMFGLSFT  952



>ref|XP_009398104.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398105.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398106.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=957

 Score =   157 bits (398),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 118/170 (69%), Gaps = 3/170 (2%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            +SP+ W   F ++ Q+II+LW  C VS++HR+ FY+LFKGD  D IY+EVE+RRL++L+ 
Sbjct  770  QSPSRWPQEFEKKQQEIIELWHDCNVSLVHRTYFYMLFKGDPTDSIYMEVELRRLSFLRS  829

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLTR-LTPEERDALYIKWEVPLE  475
            +L + GN   A   ++ T S S S+K LRRE++ L +++ + L+  ER++LYIKW + L+
Sbjct  830  NLFQ-GNVHKAAALDQRTTS-SQSLKLLRRERDMLCRQMQKSLSAAERESLYIKWGISLD  887

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNF  325
             K RRL  +  LW+K +D +HV+ESA ++++++G  E G   +EMF L F
Sbjct  888  SKQRRLQLVRHLWSKTKDLEHVRESASVISRVIGLAEQGQALKEMFGLTF  937



>ref|XP_008796871.1| PREDICTED: kinesin-like protein NACK1 [Phoenix dactylifera]
Length=962

 Score =   156 bits (395),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 127/209 (61%), Gaps = 7/209 (3%)
 Frame = -2

Query  906  QVLELEANEAAGY--TLENEENIPEIQ--ESPASWHITFREQMQQIIDLWDVCFVSIIHR  739
            Q +E  ANE  G   T+++    P +   +SP+ W + F  + Q+II+LW  C VS++HR
Sbjct  742  QEMETNANEDIGMEGTVKSVGLDPILDPLQSPSRWLLEFERKQQEIIELWHACNVSLVHR  801

Query  738  SQFYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRRE  559
            + F+LLFKGD  D IY+EVE+RRL++L+   ++      A  G     +L SS K LRRE
Sbjct  802  TYFFLLFKGDPTDSIYMEVELRRLSFLKNTCSQENFDKTA--GVSQNTTLLSSTKKLRRE  859

Query  558  KEFLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAK  382
            +E L +++  RL+ EER+ LY KW + L+ K RRL     LWT+  D +HV+ESA +VA+
Sbjct  860  REMLCRQMQKRLSAEERECLYTKWGIALDSKQRRLQLARCLWTENGDLEHVRESASLVAR  919

Query  381  LVGFCESGNMSREMFELNFVIPNDKRSWF  295
            L+G  E G   +EMF L+F+     R  F
Sbjct  920  LIGLLEPGQALKEMFGLSFIPQQYNRRSF  948



>ref|XP_006380794.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 ref|XP_006380795.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 ref|XP_006380796.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58591.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58592.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58593.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
Length=998

 Score =   156 bits (394),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 116/177 (66%), Gaps = 6/177 (3%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I E  ES + W + F+ +  +II+LW  C VS++HR+ F+LLFKGD AD  Y+EVEIRR+
Sbjct  806  IQEDAESASKWPLEFKRKQSKIIELWHACDVSLVHRTYFFLLFKGDPADSFYMEVEIRRI  865

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            + L+  L+  G      +     ++ +SS KAL +E++ LA+++  RLT EER+ L++KW
Sbjct  866  SLLKDTLSRGGGT----IVQGQVLTSTSSKKALIQERQMLARQMQKRLTREERENLFLKW  921

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFE-LNFV  322
             + L G NRRL  +++LWTKP D  H+ ESA +VAKLVGF E     +EMF  LNF 
Sbjct  922  GIRLNGTNRRLQLVHRLWTKPADMDHITESATLVAKLVGFDEQEQALKEMFGLLNFT  978



>ref|XP_002313758.2| kinesin motor family protein [Populus trichocarpa]
 gb|EEE87713.2| kinesin motor family protein [Populus trichocarpa]
Length=975

 Score =   156 bits (394),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 131/215 (61%), Gaps = 13/215 (6%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIP------EIQESPASWHITFREQMQQIIDLWDVCFVSII  745
            QV E EA+  A    ++  +I        ++ SP +W + F  Q + +++LW  C VS++
Sbjct  758  QVQETEASTMADKYEKSSRDIGLDPMHESLKTSP-NWPLEFERQQRAMLELWQTCNVSLV  816

Query  744  HRSQFYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALR  565
            HR+ F+LLF+GD  D IY+EVE RRL++L++  ++ GN     +G    ++L+SSIKAL 
Sbjct  817  HRTYFFLLFQGDPTDSIYMEVEHRRLSFLKETFSQ-GNQG---VGGGRALTLASSIKALH  872

Query  564  REKEFLAKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIV  388
            RE+  L+K +  R + EER+ LY KW + L  K RRL   N++W+  +D  HV ESA +V
Sbjct  873  RERGMLSKLMNKRFSVEERNRLYKKWGIALNSKRRRLQLANRVWSNTKDINHVTESAAVV  932

Query  387  AKLVGFCESGNMSREMFELNFVIP-NDKRSWFIGW  286
            AKLVGF E G   +EMF L+F  P +  +   +GW
Sbjct  933  AKLVGFVEQGQALKEMFGLSFTPPTSSTKRRSLGW  967



>ref|XP_003569980.1| PREDICTED: kinesin-like protein NACK2 [Brachypodium distachyon]
Length=866

 Score =   155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 126/190 (66%), Gaps = 5/190 (3%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I ++ +SP+ W + F ++ Q+II+LW  C +S++HR+ F+LLFKG+SAD IY+EVE+RRL
Sbjct  671  IMDVLQSPSRWPLEFEKKQQEIIELWHACSISLVHRTYFFLLFKGESADSIYMEVELRRL  730

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
             +L+   +     S   +G+  +  ++S+ K L RE+E LA+++  R + EER+ +Y KW
Sbjct  731  LFLRDTYSRGSTPSNVVVGSLSSSPVASA-KKLLREREMLARQMQKRFSLEERNRIYTKW  789

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVI--P  316
             V L+ K R+L    +LWT+ +D +HV+ESA +VAKL+G  E G + REMF L+F    P
Sbjct  790  GVSLDSKKRKLQVARRLWTETKDLEHVRESASLVAKLIGLQEPGQVLREMFGLSFAPQQP  849

Query  315  NDKRSWFIGW  286
              +RS   GW
Sbjct  850  PSRRSSN-GW  858



>ref|XP_008236841.1| PREDICTED: kinesin-like protein NACK2 [Prunus mume]
 ref|XP_008236842.1| PREDICTED: kinesin-like protein NACK2 [Prunus mume]
Length=926

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 133/219 (61%), Gaps = 15/219 (7%)
 Frame = -2

Query  891  EANEAAGYTLEN-EENIPEIQESPA-------SWHITFREQMQQIIDLWDVCFVSIIHRS  736
            + ++  G   EN E+N+ ++   P         W + F  Q + I++LW+ C++S++HR+
Sbjct  713  DQDQETGVAAENFEKNVKDVGIDPMLEVSETLDWPLKFERQQRAILELWETCYISVVHRT  772

Query  735  QFYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREK  556
             F+LLFKGD  D IY+EVE+RRL++L++  +   +A    + +   ++L+SSIKA+ RE+
Sbjct  773  YFFLLFKGDPTDSIYMEVELRRLSFLKETFSRGDHA----VEDGQALTLASSIKAIGRER  828

Query  555  EFLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKL  379
            + L+K +  R + EER  L+ KW + L  K RRL   N+LW+   D  HV +SA IVAKL
Sbjct  829  QMLSKLMQKRFSEEERMRLFQKWGIALNSKRRRLQLANRLWSNTNDMNHVTDSAAIVAKL  888

Query  378  VGFCESGNMSREMFELNFVIPNDKRSWFIGW-DQIADLL  265
            V F E G+  + MF L+F  P  +R  F GW + +A L+
Sbjct  889  VMFVEQGHALKGMFGLSFTPPKARRRSF-GWKNSMASLI  926



>ref|XP_004152764.1| PREDICTED: uncharacterized protein LOC101212680 [Cucumis sativus]
 gb|KGN62654.1| hypothetical protein Csa_2G365120 [Cucumis sativus]
Length=956

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 120/180 (67%), Gaps = 6/180 (3%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            ++ + W + F+ Q + II+LWD C V ++HRS F++LFKGD  D +Y+EVE+RRL ++++
Sbjct  771  QAHSEWILEFQGQQRDIIELWDACNVPLVHRSYFFILFKGDPTDAVYMEVELRRLFFIRE  830

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
             ++   N S    G    V+ +SS+KAL RE++ LA+R+  + T +ERDALY+KW + L+
Sbjct  831  AISRSVNGS----GRGDAVTQTSSLKALNRERDMLARRMKKKFTVKERDALYVKWGIDLK  886

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPN-DKRSW  298
             K R +     LW++ +D  H+ ESA +VAKL+GF E   +SREMF L+  + + D RS+
Sbjct  887  TKQRSIQVARMLWSRTKDFDHINESAALVAKLIGFVEPNQVSREMFGLSISLQSLDHRSF  946



>ref|XP_004167109.1| PREDICTED: uncharacterized LOC101212680 [Cucumis sativus]
Length=956

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 120/180 (67%), Gaps = 6/180 (3%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            ++ + W + F+ Q + II+LWD C V ++HRS F++LFKGD  D +Y+EVE+RRL ++++
Sbjct  771  QAHSEWILEFQGQQRDIIELWDACNVPLVHRSYFFILFKGDPTDAVYMEVELRRLFFIRE  830

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
             ++   N S    G    V+ +SS+KAL RE++ LA+R+  + T +ERDALY+KW + L+
Sbjct  831  AISRSVNGS----GRGDAVTQTSSLKALNRERDMLARRMKKKFTVKERDALYVKWGIDLK  886

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPN-DKRSW  298
             K R +     LW++ +D  H+ ESA +VAKL+GF E   +SREMF L+  + + D RS+
Sbjct  887  TKQRSIQVARMLWSRTKDFDHINESAALVAKLIGFVEPNQVSREMFGLSISLQSLDHRSF  946



>ref|XP_010472110.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010472111.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=862

 Score =   155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 115/183 (63%), Gaps = 7/183 (4%)
 Frame = -2

Query  840  EIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTW  661
            E+  +  +W   F  Q +QI+ LW  C VS++HR+ F+LLF GD AD IYI VE+RRL++
Sbjct  673  EVSGTMTNWSDEFERQREQILGLWQTCHVSLVHRTYFFLLFTGDQADSIYIGVELRRLSF  732

Query  660  LQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLT-RLTPEERDALYIKWEV  484
            +++  ++  +A         T++++SS+KAL RE+  L+K +  R T EER  LY K+ +
Sbjct  733  MKESFSQGNHA----FERGQTLTVASSLKALHRERRMLSKLVGKRFTGEERKRLYQKFGI  788

Query  483  PLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV--IPND  310
             +  K RRL   N+LW+KP D  HV ESA +VAKLV F E G   +EMF L+F   +P  
Sbjct  789  AVNSKRRRLQLANQLWSKPNDITHVVESAAVVAKLVRFVEQGRAMKEMFSLSFTPPLPTT  848

Query  309  KRS  301
            +RS
Sbjct  849  RRS  851



>dbj|BAD93933.1| putative kinesin heavy chain [Arabidopsis thaliana]
Length=619

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 114/183 (62%), Gaps = 7/183 (4%)
 Frame = -2

Query  840  EIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTW  661
            E+  +  +W   F  Q +QI+ LW  C VS++HR+ F+LLF GD AD IYI VE+RRL++
Sbjct  430  EVSGTMTNWSEEFERQREQILGLWQTCHVSLVHRTYFFLLFTGDQADSIYIGVELRRLSF  489

Query  660  LQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLT-RLTPEERDALYIKWEV  484
            +++  ++  +A         T++++SS+KAL RE+  L+K +  R T EER  LY K+ +
Sbjct  490  MKESFSQGNHA----FERGQTLTIASSLKALHRERRMLSKLVGKRFTGEERKRLYQKFGI  545

Query  483  PLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV--IPND  310
             +  K RRL   N+LW+KP D  H  ESA +VAKLV F E G   +EMF L+F   +P  
Sbjct  546  AVNSKRRRLQLANQLWSKPNDITHAVESAAVVAKLVRFVEQGRAMKEMFGLSFTPPLPTT  605

Query  309  KRS  301
            +RS
Sbjct  606  RRS  608



>tpg|DAA36662.1| TPA: hypothetical protein ZEAMMB73_386599 [Zea mays]
Length=808

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 113/171 (66%), Gaps = 2/171 (1%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            +SP+ W + F ++ Q+IIDLW  C VS++HR+ F+LLFKGD AD IY+EVE+RRL++L+ 
Sbjct  619  QSPSRWPLDFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRLSFLKN  678

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
              +  G+     +    + SL  S K L+RE+E L +++  RL  +ER++LY KW V L 
Sbjct  679  TYSN-GSMGRNVVAGSVSASLVLSAKKLQREREMLCRQMQKRLAIQERESLYTKWGVSLS  737

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             K RRL    +LWT+ +D +HV+ESA +VA+L+   E G   REMF L+F 
Sbjct  738  SKRRRLQVARRLWTETKDLEHVRESASLVARLIVLLEPGKALREMFGLSFA  788



>ref|XP_011025920.1| PREDICTED: kinesin-like protein NACK2 [Populus euphratica]
Length=998

 Score =   155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 118/178 (66%), Gaps = 8/178 (4%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            I E  ES + W + F+ +  +II+LW  C VS++HR+ F+LLFKGD AD  Y+EVEIRR+
Sbjct  806  IQEDAESASKWPLEFKRKQSKIIELWHACDVSLVHRTYFFLLFKGDPADSFYMEVEIRRI  865

Query  666  TWLQQHLA-ELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIK  493
            + L+  L+ + G     Q+     ++ +SS KAL +E++ LA+++  RLT EER+ L++K
Sbjct  866  SLLKDTLSRDSGTIVHGQV-----LTSTSSKKALIQERQMLARQMQKRLTREERENLFLK  920

Query  492  WEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFE-LNFV  322
            W + L G NRRL  +++LWTKP D  H+ ESA +VAKLVGF E     +EMF  LNF 
Sbjct  921  WGIRLNGTNRRLQLVHRLWTKPTDMDHITESATLVAKLVGFDEQEQALKEMFGLLNFT  978



>ref|XP_008669086.1| PREDICTED: kinesin-like protein NACK1 isoform X4 [Zea mays]
Length=818

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 113/171 (66%), Gaps = 2/171 (1%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            +SP+ W + F ++ Q+IIDLW  C VS++HR+ F+LLFKGD AD IY+EVE+RRL++L+ 
Sbjct  629  QSPSRWPLDFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRLSFLKN  688

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
              +  G+     +    + SL  S K L+RE+E L +++  RL  +ER++LY KW V L 
Sbjct  689  TYSN-GSMGRNVVAGSVSASLVLSAKKLQREREMLCRQMQKRLAIQERESLYTKWGVSLS  747

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             K RRL    +LWT+ +D +HV+ESA +VA+L+   E G   REMF L+F 
Sbjct  748  SKRRRLQVARRLWTETKDLEHVRESASLVARLIVLLEPGKALREMFGLSFA  798



>ref|XP_010416871.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010416872.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010416873.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=862

 Score =   154 bits (390),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 115/183 (63%), Gaps = 7/183 (4%)
 Frame = -2

Query  840  EIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTW  661
            E+  +  +W   F  Q +QI+ LW  C VS++HR+ F+LLF GD AD IYI VE+RRL++
Sbjct  673  EVSGTMTNWSDEFERQREQILGLWQTCHVSLVHRTYFFLLFTGDQADSIYIGVELRRLSF  732

Query  660  LQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLT-RLTPEERDALYIKWEV  484
            +++  ++  +A         T++++SS+KAL RE+  L+K +  R T EER  LY K+ +
Sbjct  733  MKESFSQGNHA----FERGQTLTVASSLKALHRERRMLSKLVGKRFTGEERKRLYQKFGI  788

Query  483  PLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV--IPND  310
             +  K RRL   N+LW+KP D  HV ESA +VAKLV F E G   +EMF L+F   +P  
Sbjct  789  AVNSKRRRLQLANQLWSKPNDITHVVESAAVVAKLVRFVEQGRAMKEMFGLSFTPPLPTT  848

Query  309  KRS  301
            +RS
Sbjct  849  RRS  851



>ref|XP_010919403.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Elaeis guineensis]
Length=803

 Score =   154 bits (389),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 127/200 (64%), Gaps = 7/200 (4%)
 Frame = -2

Query  906  QVLELEANEAAGY--TLENE--ENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHR  739
            Q +E  ANE  G   TL++   + I +  +SP+ W + F  + Q+II+LW  C VS++HR
Sbjct  583  QEMEQNANEDFGVEGTLKSVGLDPILDSLQSPSRWPLEFERKQQEIIELWHKCDVSLVHR  642

Query  738  SQFYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRRE  559
            + F+LLFKGD  D IY+EVE+RRL++L+   +       A  G   +++  SS+K LRRE
Sbjct  643  TYFFLLFKGDPTDSIYMEVELRRLSFLKSAFSREDIDKAA--GGGQSLTPPSSMKKLRRE  700

Query  558  KEFLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAK  382
            +E L +++  RL+ EER++LY KW + L+ K RRL    +LWT   + +H++ESA +VA+
Sbjct  701  REMLCRQMQKRLSAEERESLYTKWGIALDSKQRRLQLARRLWTDTGNLEHIRESASLVAR  760

Query  381  LVGFCESGNMSREMFELNFV  322
            L+G  E G   +EMF L+F 
Sbjct  761  LIGLLEPGQALKEMFGLSFT  780



>ref|XP_010263900.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Nelumbo nucifera]
Length=972

 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 116/180 (64%), Gaps = 3/180 (2%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            ESP SW + F  Q ++II+LW+ C VS++HR+ F+LLF GD AD IY++VE+RRL++L+ 
Sbjct  791  ESP-SWPLEFERQRKEIIELWNTCNVSLVHRTYFFLLFIGDPADSIYMKVELRRLSFLRD  849

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
              +  GN +   + +   +S +SS +ALRRE+E L+K++  R +  ER+ LY KW + L 
Sbjct  850  IFSS-GNLAKHSMVDGCILSPASSARALRREREMLSKQMQKRFSVAEREQLYQKWGIGLN  908

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPNDKRSWF  295
             K RRL    ++WT  +D  H+ ESA IVAKLVGF E G   +EMF L F      RS F
Sbjct  909  TKQRRLQLARRIWTDAKDMDHITESARIVAKLVGFLEQGQALKEMFGLCFTPELSTRSSF  968



>tpg|DAA36661.1| TPA: hypothetical protein ZEAMMB73_386599 [Zea mays]
Length=937

 Score =   154 bits (390),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 113/171 (66%), Gaps = 2/171 (1%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            +SP+ W + F ++ Q+IIDLW  C VS++HR+ F+LLFKGD AD IY+EVE+RRL++L+ 
Sbjct  748  QSPSRWPLDFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRLSFLKN  807

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
              +  G+     +    + SL  S K L+RE+E L +++  RL  +ER++LY KW V L 
Sbjct  808  TYSN-GSMGRNVVAGSVSASLVLSAKKLQREREMLCRQMQKRLAIQERESLYTKWGVSLS  866

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             K RRL    +LWT+ +D +HV+ESA +VA+L+   E G   REMF L+F 
Sbjct  867  SKRRRLQVARRLWTETKDLEHVRESASLVARLIVLLEPGKALREMFGLSFA  917



>ref|XP_010647602.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647606.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647611.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647615.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647617.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647621.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 emb|CAN75924.1| hypothetical protein VITISV_029516 [Vitis vinifera]
 emb|CBI37987.3| unnamed protein product [Vitis vinifera]
Length=969

 Score =   154 bits (390),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 130/214 (61%), Gaps = 12/214 (6%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIPEIQESPA------SWHITFREQMQQIIDLWDVCFVSII  745
            Q+++ +  E      + E+N+ ++   P        W + F  Q ++II+LW  C VS+I
Sbjct  753  QLVDGQVEETGTRADKLEKNVKDVGLDPMQEGTLPDWPLEFERQQREIIELWQTCNVSLI  812

Query  744  HRSQFYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALR  565
            HR+ F+LLF+GD  D IY+EVE+RRL++L++  ++ GN S   L +  T++ +SSI+ALR
Sbjct  813  HRTYFFLLFRGDPMDSIYMEVELRRLSFLKETFSQ-GNQS---LEDGRTLTQASSIRALR  868

Query  564  REKEFLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIV  388
            RE+E L+K +  R +  ER+ L+ KW + L+ K RRL    +LW+   D  HV ESA IV
Sbjct  869  RERETLSKLMHKRFSEGERNRLFQKWGIKLDSKRRRLQLAQRLWSNTTDMSHVNESAAIV  928

Query  387  AKLVGFCESGNMSREMFELNFVIPNDKRSWFIGW  286
            AKL+ F E G   +EMF L+F  P+  R    GW
Sbjct  929  AKLIKFVEQGQALKEMFGLSFT-PHRTRRRSYGW  961



>ref|XP_007201806.1| hypothetical protein PRUPE_ppa001038mg [Prunus persica]
 gb|EMJ03005.1| hypothetical protein PRUPE_ppa001038mg [Prunus persica]
Length=926

 Score =   154 bits (389),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 127/206 (62%), Gaps = 14/206 (7%)
 Frame = -2

Query  855  EENIPEIQESPA-------SWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQ  697
            E+N+ ++   P         W + F  Q + I++LW+ C++S++HR+ F+LLFKGD  D 
Sbjct  726  EKNVKDVGIDPMLEASETLDWPLKFERQQRAILELWETCYISVVHRTYFFLLFKGDPTDS  785

Query  696  IYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTP  520
            IY+EVE+RRL++L++  +   +A    + +   ++L+SSI+A+ RE++ L+K +  R + 
Sbjct  786  IYMEVELRRLSFLKETFSRGDHA----VEDGQALTLASSIRAIGRERQMLSKLMQKRFSE  841

Query  519  EERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREM  340
            EER  L+ KW V L  K RRL   N+LW+   D  HV ESA IVAKLV F E G+  + M
Sbjct  842  EERMRLFQKWGVALNSKRRRLQLANRLWSDTNDMNHVTESAAIVAKLVMFIEQGHALKGM  901

Query  339  FELNFVIPNDKRSWFIGW-DQIADLL  265
            F L+F  P  +R  F GW + +A L+
Sbjct  902  FGLSFTPPKARRRSF-GWKNSMASLI  926



>ref|XP_008669081.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Zea mays]
 ref|XP_008669082.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Zea mays]
 ref|XP_008669083.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Zea mays]
Length=947

 Score =   154 bits (389),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 113/171 (66%), Gaps = 2/171 (1%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            +SP+ W + F ++ Q+IIDLW  C VS++HR+ F+LLFKGD AD IY+EVE+RRL++L+ 
Sbjct  758  QSPSRWPLDFEKKQQEIIDLWHGCNVSLVHRTYFFLLFKGDPADAIYMEVELRRLSFLKN  817

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
              +  G+     +    + SL  S K L+RE+E L +++  RL  +ER++LY KW V L 
Sbjct  818  TYSN-GSMGRNVVAGSVSASLVLSAKKLQREREMLCRQMQKRLAIQERESLYTKWGVSLS  876

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             K RRL    +LWT+ +D +HV+ESA +VA+L+   E G   REMF L+F 
Sbjct  877  SKRRRLQVARRLWTETKDLEHVRESASLVARLIVLLEPGKALREMFGLSFA  927



>ref|XP_006296345.1| hypothetical protein CARUB_v10025517mg [Capsella rubella]
 gb|EOA29243.1| hypothetical protein CARUB_v10025517mg [Capsella rubella]
Length=862

 Score =   154 bits (388),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 115/183 (63%), Gaps = 7/183 (4%)
 Frame = -2

Query  840  EIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTW  661
            E+  +  +W   F  Q +QI+ LW  C VS++HR+ F+LLF GD AD IYI VE+RRL++
Sbjct  673  ELSGTMTNWSEDFERQREQILGLWQTCHVSLVHRTYFFLLFTGDQADSIYIGVELRRLSF  732

Query  660  LQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLT-RLTPEERDALYIKWEV  484
            +++  ++  +A         T++++SS+KAL RE+  L+K +  R T EER  LY K+ +
Sbjct  733  MKESFSQGNHA----FERGQTLTVASSLKALHRERRMLSKLVGKRFTAEERKRLYQKFGI  788

Query  483  PLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV--IPND  310
             +  K RRL   N+LW+KP D  HV ESA +VAKLV F E G   +EMF L+F   +P  
Sbjct  789  AVNSKRRRLQLANQLWSKPNDITHVVESAAVVAKLVRFVEQGRAMKEMFGLSFTPPLPTT  848

Query  309  KRS  301
            +RS
Sbjct  849  RRS  851



>ref|XP_006383133.1| kinesin motor family protein [Populus trichocarpa]
 gb|ERP60930.1| kinesin motor family protein [Populus trichocarpa]
Length=910

 Score =   154 bits (389),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 116/181 (64%), Gaps = 8/181 (4%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            ES + W + F+    +II+LW  C VS++HR+ F LLFKGD AD  Y+EVEIRR++ L++
Sbjct  723  ESASKWPLEFKNMQSKIIELWHACSVSLVHRTHFLLLFKGDPADSFYLEVEIRRMSLLKE  782

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
             L+         + +   ++ +SS KAL  E++ LA+ +  RLT EER+ L++KW VPL 
Sbjct  783  TLSR----GSRTIVHGQVLTSTSSKKALSHERQMLAREMQKRLTREERENLFLKWGVPLS  838

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFE-LNF--VIPNDKR  304
            G NRRL  +++LWTK  D  H+ ESA +VAKLVGF E     +EMF  LNF    P+ ++
Sbjct  839  GNNRRLQLVHRLWTKTTDMDHITESAALVAKLVGFIEQEQALKEMFGLLNFTPTYPSRRK  898

Query  303  S  301
            S
Sbjct  899  S  899



>ref|XP_010429028.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010429029.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010429030.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=862

 Score =   154 bits (388),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 115/183 (63%), Gaps = 7/183 (4%)
 Frame = -2

Query  840  EIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTW  661
            E+  +  +W   F  Q +QI+ +W  C VS++HR+ F+LLF GD AD IYI VE+RRL++
Sbjct  673  EVSGTMTNWSDEFERQREQILGMWQTCHVSLVHRTYFFLLFTGDQADSIYIGVELRRLSF  732

Query  660  LQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLT-RLTPEERDALYIKWEV  484
            +++  ++  +A         T++++SS+KAL RE+  L+K +  R T EER  LY K+ +
Sbjct  733  MKESFSQGNHA----FERGQTLTVASSLKALHRERRMLSKLVGKRFTGEERKRLYQKFGI  788

Query  483  PLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV--IPND  310
             +  K RRL   N+LW+KP D  HV ESA +VAKLV F E G   +EMF L+F   +P  
Sbjct  789  AVNSKRRRLQLANQLWSKPDDITHVVESAAVVAKLVRFVEQGRAMKEMFGLSFTPPLPTT  848

Query  309  KRS  301
            +RS
Sbjct  849  RRS  851



>ref|XP_010919401.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Elaeis guineensis]
 ref|XP_010919402.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Elaeis guineensis]
Length=966

 Score =   154 bits (389),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 127/200 (64%), Gaps = 7/200 (4%)
 Frame = -2

Query  906  QVLELEANEAAGY--TLENE--ENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHR  739
            Q +E  ANE  G   TL++   + I +  +SP+ W + F  + Q+II+LW  C VS++HR
Sbjct  746  QEMEQNANEDFGVEGTLKSVGLDPILDSLQSPSRWPLEFERKQQEIIELWHKCDVSLVHR  805

Query  738  SQFYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRRE  559
            + F+LLFKGD  D IY+EVE+RRL++L+   +       A  G   +++  SS+K LRRE
Sbjct  806  TYFFLLFKGDPTDSIYMEVELRRLSFLKSAFSREDIDKAA--GGGQSLTPPSSMKKLRRE  863

Query  558  KEFLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAK  382
            +E L +++  RL+ EER++LY KW + L+ K RRL    +LWT   + +H++ESA +VA+
Sbjct  864  REMLCRQMQKRLSAEERESLYTKWGIALDSKQRRLQLARRLWTDTGNLEHIRESASLVAR  923

Query  381  LVGFCESGNMSREMFELNFV  322
            L+G  E G   +EMF L+F 
Sbjct  924  LIGLLEPGQALKEMFGLSFT  943



>ref|NP_179726.2| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 ref|NP_001031385.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEC07157.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEC07158.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=862

 Score =   153 bits (386),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 114/183 (62%), Gaps = 7/183 (4%)
 Frame = -2

Query  840  EIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTW  661
            E+  +  +W   F  Q +QI+ LW  C VS++HR+ F+LLF GD AD IYI VE+RRL++
Sbjct  673  EVSGTMTNWSEEFERQREQILGLWQTCHVSLVHRTYFFLLFTGDQADSIYIGVELRRLSF  732

Query  660  LQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLT-RLTPEERDALYIKWEV  484
            +++  ++  +A         T++++SS+KAL RE+  L+K +  R T EER  LY K+ +
Sbjct  733  MKESFSQGNHA----FERGQTLTIASSLKALHRERRMLSKLVGKRFTGEERKRLYQKFGI  788

Query  483  PLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV--IPND  310
             +  K RRL   N+LW+KP D  H  ESA +VAKLV F E G   +EMF L+F   +P  
Sbjct  789  AVNSKRRRLQLANQLWSKPNDITHAVESAAVVAKLVRFVEQGRAMKEMFGLSFTPPLPTT  848

Query  309  KRS  301
            +RS
Sbjct  849  RRS  851



>ref|XP_002880373.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56632.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
Length=862

 Score =   153 bits (386),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 115/183 (63%), Gaps = 7/183 (4%)
 Frame = -2

Query  840  EIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTW  661
            E+  +  +W   F  Q +QI+ LW  C VS++HR+ F+LLF GD AD IYI VE+R+L++
Sbjct  673  EVSGTMTNWSEEFERQREQILGLWQTCHVSLVHRTYFFLLFTGDQADSIYIGVELRKLSF  732

Query  660  LQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLT-RLTPEERDALYIKWEV  484
            +++  ++  +A         T++++SS+KAL RE+  L+K +  R T EER  LY K+ +
Sbjct  733  MKESFSQGNHA----FERGQTLTIASSLKALHRERRMLSKLVGKRFTGEERKRLYQKFGI  788

Query  483  PLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV--IPND  310
             +  K RRL   N+LW+KP D  HV ESA +VAKLV F E G   +EMF L+F   +P  
Sbjct  789  AVNSKRRRLQLANQLWSKPNDITHVVESAAVVAKLVRFVEQGRAMKEMFGLSFTPPLPTT  848

Query  309  KRS  301
            +RS
Sbjct  849  RRS  851



>ref|XP_008448048.1| PREDICTED: kinesin-like protein NACK2 [Cucumis melo]
 ref|XP_008448049.1| PREDICTED: kinesin-like protein NACK2 [Cucumis melo]
 ref|XP_008448050.1| PREDICTED: kinesin-like protein NACK2 [Cucumis melo]
Length=930

 Score =   153 bits (387),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 113/177 (64%), Gaps = 5/177 (3%)
 Frame = -2

Query  822  ASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQHLA  643
            + W   F+ Q + II+LW  C VSI+HR+ F+LLF+GD AD IY+EVE+RRLT+L+Q   
Sbjct  748  SDWKEEFQRQQRMIIELWQTCNVSIVHRTYFFLLFQGDPADSIYMEVELRRLTFLKQTFY  807

Query  642  ELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLEGKN  466
              GN++   + +   VS SSS + LRRE+E L+K +  R + +ER  L+ KW + L  K 
Sbjct  808  -YGNSA---MDDGRKVSFSSSTRDLRRERETLSKLMQKRFSEDERKRLFQKWGISLNSKR  863

Query  465  RRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPNDKRSWF  295
            RRL  I++LW+ P++  HV ESA IVAK+V F E G   +  F L+F+ P  K   F
Sbjct  864  RRLQLISQLWSDPKNMNHVTESAAIVAKIVKFAEQGQALKGNFGLSFITPPQKSRSF  920



>gb|KHF98716.1| Kinesin-related 11 [Gossypium arboreum]
Length=978

 Score =   153 bits (386),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 115/176 (65%), Gaps = 4/176 (2%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            IP+  ES + W   F+   ++II+LW  C VS++HR+ F+LLFKGD  D IY+EVE RRL
Sbjct  786  IPDNHESSSEWPSEFKRLQREIIELWHACNVSLVHRTYFFLLFKGDPKDYIYMEVEYRRL  845

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLT-RLTPEERDALYIKW  490
            ++L+   +   +A+  ++ NE   + +SS KALRRE+  L+++++ RL+ EER+ L+IKW
Sbjct  846  SFLKSLFS---HANQMEVANEQVENPASSAKALRRERHMLSQQMSKRLSNEERENLFIKW  902

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             + L  K+RRL      WT  +D  H+ ESA IVAKLVGF +     +EMF LNF 
Sbjct  903  GIGLNTKHRRLQLAYCFWTDCKDMDHIAESAAIVAKLVGFVDPEKTFKEMFGLNFT  958



>ref|XP_009140272.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
Length=842

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 121/188 (64%), Gaps = 17/188 (9%)
 Frame = -2

Query  840  EIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTW  661
            E+  +  +W   F  + +QI++LW+ C VS++HR+ F+LLFKGD AD IYI VE+RRL++
Sbjct  653  EVSGTLTNWSEEFERKREQILELWETCNVSLVHRTYFFLLFKGDQADSIYIGVELRRLSF  712

Query  660  LQQHLAELGNASPAQLGNEP-----TVSLSSSIKALRREKEFLAKRL-TRLTPEERDALY  499
            +++  ++         GNE      T++++SS+KAL+RE+  L+K +  R + EER  LY
Sbjct  713  MKESFSQ---------GNEAFERGQTLTVASSLKALQRERRMLSKLVGKRFSGEERKRLY  763

Query  498  IKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV-  322
             K+ + +  K RRL   N+LW+KP+D  HV +SA +VAKLV F E G   +EMF L+F  
Sbjct  764  EKFGIDVNSKRRRLQLANQLWSKPKDIIHVVDSAAVVAKLVRFVEQGRAMKEMFGLSFTP  823

Query  321  -IPNDKRS  301
             +P  +RS
Sbjct  824  PLPTSRRS  831



>ref|XP_011047336.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Populus euphratica]
Length=976

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 129/215 (60%), Gaps = 13/215 (6%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIP------EIQESPASWHITFREQMQQIIDLWDVCFVSII  745
            QV E EA+  A    ++  +I        ++ SP +W + F  Q + +++LW  C VS+I
Sbjct  759  QVQETEASTMADKYEKSSRDIGLDPMHESLKTSP-NWPLEFERQQRAMLELWQTCNVSLI  817

Query  744  HRSQFYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALR  565
            HR+ F+LLF+GD  D +Y+EVE RRL++L++  ++ GN     +G    ++L+SS+KAL 
Sbjct  818  HRTYFFLLFQGDPTDSVYMEVEHRRLSFLKETFSQ-GNQG---VGGGRAITLASSLKALH  873

Query  564  REKEFLAKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIV  388
            RE+  L+K +  R + EER  LY KW + L  K RRL   N++W+  +D  HV ESA +V
Sbjct  874  RERGMLSKLMNKRFSEEERIRLYKKWGIALNSKRRRLQLANRVWSNTKDINHVTESAAVV  933

Query  387  AKLVGFCESGNMSREMFELNFVIPNDK-RSWFIGW  286
            AKLV F E G   +EMF L+F  PN   +   +GW
Sbjct  934  AKLVRFVEQGQALKEMFGLSFTPPNSSTKRRSLGW  968



>ref|XP_011047311.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
 ref|XP_011047320.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
 ref|XP_011047328.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
Length=983

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 129/215 (60%), Gaps = 13/215 (6%)
 Frame = -2

Query  906  QVLELEANEAAGYTLENEENIP------EIQESPASWHITFREQMQQIIDLWDVCFVSII  745
            QV E EA+  A    ++  +I        ++ SP +W + F  Q + +++LW  C VS+I
Sbjct  766  QVQETEASTMADKYEKSSRDIGLDPMHESLKTSP-NWPLEFERQQRAMLELWQTCNVSLI  824

Query  744  HRSQFYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALR  565
            HR+ F+LLF+GD  D +Y+EVE RRL++L++  ++ GN     +G    ++L+SS+KAL 
Sbjct  825  HRTYFFLLFQGDPTDSVYMEVEHRRLSFLKETFSQ-GNQG---VGGGRAITLASSLKALH  880

Query  564  REKEFLAKRLT-RLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIV  388
            RE+  L+K +  R + EER  LY KW + L  K RRL   N++W+  +D  HV ESA +V
Sbjct  881  RERGMLSKLMNKRFSEEERIRLYKKWGIALNSKRRRLQLANRVWSNTKDINHVTESAAVV  940

Query  387  AKLVGFCESGNMSREMFELNFVIPNDK-RSWFIGW  286
            AKLV F E G   +EMF L+F  PN   +   +GW
Sbjct  941  AKLVRFVEQGQALKEMFGLSFTPPNSSTKRRSLGW  975



>emb|CDX99601.1| BnaC04g33580D [Brassica napus]
Length=818

 Score =   152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 121/183 (66%), Gaps = 7/183 (4%)
 Frame = -2

Query  840  EIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTW  661
            E+  +  +W   F  + +QI++LW+ C VS++HR+ F+LLFKGD AD IY+ VE+RRL++
Sbjct  629  EVSGTMTNWSEEFERKREQILELWETCNVSLVHRTYFFLLFKGDQADSIYMGVELRRLSF  688

Query  660  LQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEV  484
            +++  ++ GN +        T++L+SS+KAL+RE+  L+K +  R + EER  LY K+ +
Sbjct  689  MKESFSQ-GNQA---FERGQTLTLASSLKALQRERRMLSKLVGKRFSGEERKRLYEKFGI  744

Query  483  PLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV--IPND  310
             +  K RRL   N+LW+KP+D  HV +SA +VAKLV F E G   +EMF L+F   +P  
Sbjct  745  NVNSKRRRLQLANQLWSKPKDIIHVVDSAAVVAKLVRFVEQGRAMKEMFGLSFTPPLPTS  804

Query  309  KRS  301
            +RS
Sbjct  805  RRS  807



>ref|XP_009393646.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=913

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 112/190 (59%), Gaps = 13/190 (7%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            ESP+ W   F  + ++II LW  C V ++HR+ F+LLF GD AD  Y+EVE RRL++L+ 
Sbjct  735  ESPSRWPREFERKQREIIQLWHACDVPLVHRTCFFLLFDGDPADSFYMEVECRRLSFLRN  794

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
              +  GNA            ++SS + LRRE+E L K++  +++PEER++LY KW V L 
Sbjct  795  TFSR-GNAGDL---------VASSSRCLRREREMLCKQMQKKVSPEERESLYAKWGVALS  844

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPNDKRSWF  295
             K RRL    +LWT   D +HV ESA +VAKL GF E G   +EMFEL+F  P       
Sbjct  845  SKQRRLQLARRLWT-ATDLEHVAESASLVAKLTGFAERGQAMKEMFELSFT-PQQTHKRS  902

Query  294  IGWDQIADLL  265
             GW     LL
Sbjct  903  FGWMHGKSLL  912



>ref|XP_010028653.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Eucalyptus 
grandis]
Length=809

 Score =   152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 128/206 (62%), Gaps = 11/206 (5%)
 Frame = -2

Query  861  ENEENIPEIQE----SPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQI  694
            ++E N+ E+      +P  W + F  + + I+ LW +C V ++HR+ F+LLF+GD AD I
Sbjct  609  DHENNVEEVASDALTNPLDWPLEFERKQRSILVLWQICSVPLVHRTYFFLLFRGDPADSI  668

Query  693  YIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPE  517
            Y+EVE+RRLT+L++  A  G+A    + +   ++ +SS+KAL RE+E L+K +  RL+  
Sbjct  669  YMEVELRRLTFLKETFASGGHA----VADGRVLTPASSLKALHREREKLSKLMRRRLSEA  724

Query  516  ERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMF  337
            ER+ L+ +W + LE K RRL   N+LW+  +D   V ESA +VAKL  F E G   R M 
Sbjct  725  ERERLFQRWGISLESKRRRLQLANRLWSDTEDMDCVMESASVVAKLARFEEQGKALRGML  784

Query  336  ELNFVIPNDKRSWFIGWDQIADLLHL  259
             L+F  P+ +RS+  GW Q + + +L
Sbjct  785  GLSFSSPSMRRSY--GWRQRSAISYL  808



>ref|XP_002868873.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45132.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
Length=836

 Score =   152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 109/165 (66%), Gaps = 5/165 (3%)
 Frame = -2

Query  804  FREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNAS  625
            F  Q Q+I+DLW  C +S++HR+ FYLLFKGD AD IYI VEIRRL +++   ++ GN +
Sbjct  658  FERQRQEILDLWQTCNISLVHRTYFYLLFKGDEADSIYIGVEIRRLLFMKDSFSQ-GNQA  716

Query  624  PAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFI  448
               L    T++L+SS KAL RE++ L+K +  R + EER  +Y K+ + +  K RRL  +
Sbjct  717  ---LEGGETLTLASSRKALHRERKMLSKLVGKRFSEEERKRIYHKFGIAVNSKRRRLQLV  773

Query  447  NKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPN  313
            N+LW+ P+D   V ESA++VAKLV F E G   +EMF L F  P+
Sbjct  774  NELWSNPKDTTQVVESADVVAKLVRFAEQGRAMKEMFGLTFTPPS  818



>ref|XP_009338641.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Pyrus x bretschneideri]
Length=945

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 119/180 (66%), Gaps = 6/180 (3%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            +P   E+P+ W   F +  ++II+LWD C VS++HR+ F+LLFKGD +D IY+EVE+RRL
Sbjct  753  MPIDDENPSRWTSEFNKLQREIIELWDACNVSLVHRTYFFLLFKGDPSDSIYMEVELRRL  812

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   +  GN +     +  T++ +SS+KAL  E++ L+K++  RL+ +ER+ LY+KW
Sbjct  813  SFLKDTFSR-GNQT---FEDGQTLTPASSMKALTSERDLLSKQMRRRLSEDERNNLYLKW  868

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPND  310
             + L  K+RRL   N LW+K Q+  H+ +SA IVAKLVG  E     +EMF L F  P D
Sbjct  869  GISLHSKHRRLQLANLLWSKTQNLDHIMDSATIVAKLVGSVEPEQAFKEMFGLRFA-PRD  927



>ref|XP_004512117.1| PREDICTED: kinesin-related protein 4-like isoform X1 [Cicer arietinum]
Length=948

 Score =   152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 112/171 (65%), Gaps = 5/171 (3%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            E+ + W   F+   + II+LWD C VS++HR+ F+LLFKGD +D IY+EVE+RRL++L Q
Sbjct  761  ENNSDWPSKFKRLQKDIIELWDACNVSLVHRTYFFLLFKGDPSDSIYMEVELRRLSYLNQ  820

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
              ++  N     LG+  T +  SS+  LRRE++ L K++  +L+  +R+ LY+KW + L 
Sbjct  821  TFSQGNNT----LGDGRTNTPESSMGDLRRERQMLCKQMQKKLSKSDRENLYLKWGIRLS  876

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             K+RRL   ++LWT   D +H++ESA +VAKLVG  E     +EMF LNF 
Sbjct  877  SKHRRLQLTHQLWTNTNDIEHIRESAAVVAKLVGPIEPEQALKEMFGLNFA  927



>ref|XP_004512118.1| PREDICTED: kinesin-related protein 4-like isoform X2 [Cicer arietinum]
Length=937

 Score =   152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 112/171 (65%), Gaps = 5/171 (3%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            E+ + W   F+   + II+LWD C VS++HR+ F+LLFKGD +D IY+EVE+RRL++L Q
Sbjct  750  ENNSDWPSKFKRLQKDIIELWDACNVSLVHRTYFFLLFKGDPSDSIYMEVELRRLSYLNQ  809

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
              ++  N     LG+  T +  SS+  LRRE++ L K++  +L+  +R+ LY+KW + L 
Sbjct  810  TFSQGNNT----LGDGRTNTPESSMGDLRRERQMLCKQMQKKLSKSDRENLYLKWGIRLS  865

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             K+RRL   ++LWT   D +H++ESA +VAKLVG  E     +EMF LNF 
Sbjct  866  SKHRRLQLTHQLWTNTNDIEHIRESAAVVAKLVGPIEPEQALKEMFGLNFA  916



>ref|XP_010028651.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW55426.1| hypothetical protein EUGRSUZ_I01329 [Eucalyptus grandis]
Length=928

 Score =   152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 128/206 (62%), Gaps = 11/206 (5%)
 Frame = -2

Query  861  ENEENIPEIQE----SPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQI  694
            ++E N+ E+      +P  W + F  + + I+ LW +C V ++HR+ F+LLF+GD AD I
Sbjct  728  DHENNVEEVASDALTNPLDWPLEFERKQRSILVLWQICSVPLVHRTYFFLLFRGDPADSI  787

Query  693  YIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPE  517
            Y+EVE+RRLT+L++  A  G+A    + +   ++ +SS+KAL RE+E L+K +  RL+  
Sbjct  788  YMEVELRRLTFLKETFASGGHA----VADGRVLTPASSLKALHREREKLSKLMRRRLSEA  843

Query  516  ERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMF  337
            ER+ L+ +W + LE K RRL   N+LW+  +D   V ESA +VAKL  F E G   R M 
Sbjct  844  ERERLFQRWGISLESKRRRLQLANRLWSDTEDMDCVMESASVVAKLARFEEQGKALRGML  903

Query  336  ELNFVIPNDKRSWFIGWDQIADLLHL  259
             L+F  P+ +RS+  GW Q + + +L
Sbjct  904  GLSFSSPSMRRSY--GWRQRSAISYL  927



>ref|XP_009338640.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Pyrus x bretschneideri]
Length=976

 Score =   152 bits (383),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 119/180 (66%), Gaps = 6/180 (3%)
 Frame = -2

Query  846  IPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRL  667
            +P   E+P+ W   F +  ++II+LWD C VS++HR+ F+LLFKGD +D IY+EVE+RRL
Sbjct  784  MPIDDENPSRWTSEFNKLQREIIELWDACNVSLVHRTYFFLLFKGDPSDSIYMEVELRRL  843

Query  666  TWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKW  490
            ++L+   +  GN +     +  T++ +SS+KAL  E++ L+K++  RL+ +ER+ LY+KW
Sbjct  844  SFLKDTFSR-GNQT---FEDGQTLTPASSMKALTSERDLLSKQMRRRLSEDERNNLYLKW  899

Query  489  EVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPND  310
             + L  K+RRL   N LW+K Q+  H+ +SA IVAKLVG  E     +EMF L F  P D
Sbjct  900  GISLHSKHRRLQLANLLWSKTQNLDHIMDSATIVAKLVGSVEPEQAFKEMFGLRFA-PRD  958



>ref|XP_008775730.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Phoenix dactylifera]
Length=1022

 Score =   152 bits (384),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 116/179 (65%), Gaps = 3/179 (2%)
 Frame = -2

Query  852   ENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIR  673
             + I    E P  WH+ F ++ Q+I++LW  C VS+IHR+ F++LFKGD AD IY+EVE R
Sbjct  826   DTISNSLEVPFQWHMEFEKKQQEIVELWHTCNVSLIHRTYFFILFKGDPADSIYMEVEHR  885

Query  672   RLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYI  496
             RL++L+  ++   N   A  G+    +L+SS++ +RRE+E L +++  R+  EER++LY 
Sbjct  886   RLSFLKNTISH-ENLDKADAGDGHKRTLASSLRNIRREREMLYRQMFKRIPAEERESLYT  944

Query  495   KWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVI  319
              W + L  K RRL    +LWTK  + +HV+ESA +VAKL+G  E     +EMF L+F +
Sbjct  945   NWGIALNSKKRRLQLAQRLWTKT-NVEHVRESASLVAKLIGLSEPEQALKEMFGLHFTV  1002



>ref|XP_010526578.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526579.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526580.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526581.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
Length=840

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 114/174 (66%), Gaps = 4/174 (2%)
 Frame = -2

Query  822  ASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQHLA  643
             +W   F  Q ++II+LW  C VS++HR+ F+LLFKGD AD IYI VE+RRL++L++  +
Sbjct  663  TNWSEEFERQRKEIIELWQSCHVSLVHRTYFFLLFKGDQADSIYIGVELRRLSYLKESFS  722

Query  642  ELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRLT-RLTPEERDALYIKWEVPLEGKN  466
            + GN   A  G   T++L+SS+K L+RE+  + K +  R + EER  LY  + + L  K 
Sbjct  723  Q-GNR--AIEGGGRTLTLASSMKELKRERRMMKKLMGKRFSEEERKRLYDTFGIALNSKG  779

Query  465  RRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPNDKR  304
            RR+   N+LW+  +D  HV+ESA ++AKLV F E+G+  +EMF L+F  P  +R
Sbjct  780  RRMQLANRLWSNTKDMNHVKESASVIAKLVRFLENGSGIKEMFGLSFTPPPTRR  833



>emb|CDY15900.1| BnaA04g12110D [Brassica napus]
Length=844

 Score =   151 bits (381),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 121/188 (64%), Gaps = 17/188 (9%)
 Frame = -2

Query  840  EIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTW  661
            E+  +  +W   F  + +QI++LW+ C VS++HR+ F+LLFKGD AD IY+ VE+RRL++
Sbjct  655  EVSGTMTNWSEEFERKREQILELWETCNVSLVHRTYFFLLFKGDQADSIYMGVELRRLSF  714

Query  660  LQQHLAELGNASPAQLGNEP-----TVSLSSSIKALRREKEFLAKRL-TRLTPEERDALY  499
            +++  ++         GNE      T++++SS+KAL+RE+  L+K +  R + EER  LY
Sbjct  715  MKESFSQ---------GNEAFERGQTLTVASSLKALQRERRMLSKLVGKRFSGEERKRLY  765

Query  498  IKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV-  322
             K+ + +  K RRL   N+LW+KP+D  HV +SA +VAKLV F E G   +EMF L+F  
Sbjct  766  EKFGIDVNSKRRRLQLANQLWSKPKDIIHVVDSAAVVAKLVRFVEQGRAMKEMFGLSFTP  825

Query  321  -IPNDKRS  301
             +P  +RS
Sbjct  826  PLPTSRRS  833



>ref|XP_009791027.1| PREDICTED: kinesin-like protein NACK1 [Nicotiana sylvestris]
Length=1028

 Score =   152 bits (383),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 116/186 (62%), Gaps = 7/186 (4%)
 Frame = -2

Query  852   ENIPEIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIR  673
             E + +  +S  SW + F+   ++II+LW  C VS+ HR+ F+LLF+GDS D IY+EVEIR
Sbjct  839   EPVEDDYKSRYSWPLEFKRLQKEIIELWHACNVSLAHRAYFFLLFQGDSTDAIYMEVEIR  898

Query  672   RLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYI  496
             RLT+L+   +         + N  T+SL  S K LR E+  L+K++  +L+  ERD+LY+
Sbjct  899   RLTFLKDTFSR----GEKTVVNGRTLSLEGSKKDLREERRMLSKQMQKKLSEAERDSLYL  954

Query  495   KWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIP  316
             KW + +  K RRL    +LWTK  D  H+ +SA +VAKLVG  E G   +EMF L+F  P
Sbjct  955   KWGIGINSKRRRLQLAQQLWTKTDDMNHIADSAYLVAKLVGLMEPGKGPKEMFGLDF--P  1012

Query  315   NDKRSW  298
             N  R++
Sbjct  1013  NTSRNY  1018



>gb|KDP38590.1| hypothetical protein JCGZ_04515 [Jatropha curcas]
Length=941

 Score =   151 bits (382),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 119/187 (64%), Gaps = 5/187 (3%)
 Frame = -2

Query  822  ASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQHLA  643
            ++W + F    ++IIDLW  C V ++HRS F+LLFKGD +D +Y+EVE+RRL +L+   A
Sbjct  759  SNWAVKFERYRRKIIDLWVKCNVPLVHRSYFFLLFKGDPSDNVYMEVELRRLYFLKDTSA  818

Query  642  ELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLEGKN  466
               NA    + +   VS +SS+KAL RE+E+LA+++  + T  ER+ LY++W + L+ K 
Sbjct  819  RGTNA----MIDTKIVSPASSLKALNREREYLARQIQKKFTKREREELYLRWGIDLDTKQ  874

Query  465  RRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPNDKRSWFIGW  286
            R L    +LWT  +D KH++ES+  VAKLVGF E     +EMF L+F+ P+  +      
Sbjct  875  RSLQLTRRLWTDTKDMKHMRESSLFVAKLVGFVEPRYAPKEMFGLSFITPSSTQKSSSWR  934

Query  285  DQIADLL  265
            D ++ LL
Sbjct  935  DNMSSLL  941



>ref|XP_009386197.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=941

 Score =   151 bits (381),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 115/185 (62%), Gaps = 4/185 (2%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            ESP+   + F  + Q+II+LW  C V ++HR+ F+L+FKGD AD IY+EVE RRL++L+ 
Sbjct  759  ESPSRRPLEFERKRQEIIELWHACNVPLVHRTCFFLVFKGDPADSIYMEVECRRLSFLRN  818

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
              +  G A      +   VSL+SS + LRRE+E L +++  +L+P++R  LY KW V L 
Sbjct  819  AFSH-GKAGGVVAEDGHRVSLASSSRYLRREREMLCRQMQKKLSPDDRVRLYAKWGVALN  877

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPNDKRSWF  295
             K R+L    +LWTK  D +HV+ESA +VAKL+GF E G   +EMF L+F  P       
Sbjct  878  SKQRKLQLGQRLWTKT-DLEHVKESASLVAKLIGFVEQGRAMKEMFGLSFT-PQQTHKRS  935

Query  294  IGWDQ  280
              W Q
Sbjct  936  FSWMQ  940



>ref|XP_010909958.1| PREDICTED: kinesin-like protein NACK1 [Elaeis guineensis]
Length=970

 Score =   151 bits (382),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 113/172 (66%), Gaps = 3/172 (2%)
 Frame = -2

Query  831  ESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQQ  652
            E P  W + F ++ Q+I++LW  C VS+IHR+ F++LFKGD AD IY+EVE RRL++L+ 
Sbjct  781  EVPLQWPMEFEKKQQEIVELWQACNVSLIHRTYFFILFKGDPADSIYMEVEHRRLSFLKN  840

Query  651  HLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPLE  475
             ++  GN      G+   ++L SS++ +RRE+E L +++  R+  EER++LY  W + L 
Sbjct  841  TISH-GNLDKEDAGDGHDLTLVSSLRNIRREREMLYRQMFKRIPAEERESLYTNWGIALN  899

Query  474  GKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVI  319
             K RRL    +LWTK  D +HV+ESA +VAKL+G  E     +EMF L+F +
Sbjct  900  SKKRRLQLAQQLWTKT-DMEHVRESASLVAKLIGLTEPEQALKEMFGLSFTV  950



>ref|XP_007131749.1| hypothetical protein PHAVU_011G038800g [Phaseolus vulgaris]
 gb|ESW03743.1| hypothetical protein PHAVU_011G038800g [Phaseolus vulgaris]
Length=891

 Score =   151 bits (381),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 115/174 (66%), Gaps = 6/174 (3%)
 Frame = -2

Query  840  EIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTW  661
            E   +P  W + F  Q ++II+LW  C V + HR+ F+LLF+GD  D IY+EVE+RRL++
Sbjct  703  ETSGTPLDWSLQFSRQQKEIIELWQSCCVPLTHRTYFFLLFRGDPTDSIYMEVELRRLSF  762

Query  660  LQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEV  484
            L++  ++ GN S   + +  T++L+SS+KALRRE+  L K +  RL+ +ER  LY +W +
Sbjct  763  LKETFSD-GNQS---VRDSQTITLASSVKALRRERGMLVKLMHRRLSDKERIRLYEEWGI  818

Query  483  PLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             L+ K RRL  +N+LW++  D  HV +SA IVAKLV F E G   +EMF L+F 
Sbjct  819  SLDSKRRRLQLVNRLWSE-NDTNHVMQSATIVAKLVRFWERGKALKEMFGLSFT  871



>ref|XP_010531480.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
 ref|XP_010531481.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
 ref|XP_010531482.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
Length=830

 Score =   150 bits (380),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 117/184 (64%), Gaps = 8/184 (4%)
 Frame = -2

Query  834  QESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTWLQ  655
            +E   +W   F  + Q+I++LW  C VS++HR+ F+LLFKGD AD IY+ VE+RRL++L+
Sbjct  646  EEMSGNWSEEFERKRQEILELWQSCHVSLVHRTYFFLLFKGDEADSIYVGVELRRLSFLK  705

Query  654  QHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEVPL  478
               ++    + A  G   T++LSSS+K L RE+  ++K +  R + EER  LY K+ + L
Sbjct  706  DSFSQ---GTQAVEGGR-TLTLSSSLKELHRERRTMSKLIGKRFSGEERRRLYEKFGIGL  761

Query  477  EGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFVIPNDKRSW  298
              K RRL   N+LW+ P+D  HV+ESA ++AKLV F E G   +EMF L+F  P  +RS 
Sbjct  762  NSKRRRLQLANQLWSNPKDMSHVKESAAVIAKLVRFVEQGTAFKEMFGLSFTPPT-RRSH  820

Query  297  FIGW  286
              GW
Sbjct  821  --GW  822



>ref|XP_007131750.1| hypothetical protein PHAVU_011G038800g [Phaseolus vulgaris]
 gb|ESW03744.1| hypothetical protein PHAVU_011G038800g [Phaseolus vulgaris]
Length=892

 Score =   151 bits (381),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 115/174 (66%), Gaps = 6/174 (3%)
 Frame = -2

Query  840  EIQESPASWHITFREQMQQIIDLWDVCFVSIIHRSQFYLLFKGDSADQIYIEVEIRRLTW  661
            E   +P  W + F  Q ++II+LW  C V + HR+ F+LLF+GD  D IY+EVE+RRL++
Sbjct  704  ETSGTPLDWSLQFSRQQKEIIELWQSCCVPLTHRTYFFLLFRGDPTDSIYMEVELRRLSF  763

Query  660  LQQHLAELGNASPAQLGNEPTVSLSSSIKALRREKEFLAKRL-TRLTPEERDALYIKWEV  484
            L++  ++ GN S   + +  T++L+SS+KALRRE+  L K +  RL+ +ER  LY +W +
Sbjct  764  LKETFSD-GNQS---VRDSQTITLASSVKALRRERGMLVKLMHRRLSDKERIRLYEEWGI  819

Query  483  PLEGKNRRLNFINKLWTKPQDPKHVQESAEIVAKLVGFCESGNMSREMFELNFV  322
             L+ K RRL  +N+LW++  D  HV +SA IVAKLV F E G   +EMF L+F 
Sbjct  820  SLDSKRRRLQLVNRLWSE-NDTNHVMQSATIVAKLVRFWERGKALKEMFGLSFT  872



>gb|KDO49884.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
Length=841

 Score =   150 bits (379),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 134/222 (60%), Gaps = 15/222 (7%)
 Frame = -2

Query  897  ELEANEAAGYTLEN-EENIPEIQ--------ESPASWHITFREQMQQIIDLWDVCFVSII  745
            ++  N+  G   +N E+N+ ++         E+P +W + F  Q +++  LW  C VS++
Sbjct  624  KMAKNQETGLQADNSEKNVKDVGLDPMHEALETPENWPVEFERQRRELFQLWQTCNVSLV  683

Query  744  HRSQFYLLFKGDSADQIYIEVEIRRLTWLQQHLAELGNASPAQLGNEPTVSLSSSIKALR  565
            HR+ F+LLF+GD +D IY+ VE++RL++L++  ++ GN +   + +   +SL+SS +ALR
Sbjct  684  HRTYFFLLFRGDPSDSIYMGVELKRLSFLKESFSQ-GNMA---MQDGRVLSLASSERALR  739

Query  564  REKEFLAKRL-TRLTPEERDALYIKWEVPLEGKNRRLNFINKLWTKPQDPKHVQESAEIV  388
            RE+E L+K +  RL+ +ER+ LY KW + L  K RRL   N LW+  +D   + ESA I+
Sbjct  740  RERETLSKLMRRRLSADERNKLYQKWGIGLNSKRRRLQLANHLWSNSKDMNRITESAAII  799

Query  387  AKLVGFCESGNMSREMFELNFVIPNDKRSWFIGWDQ-IADLL  265
            AKL+ F E G+  + MF L+F      R   +GW   +A LL
Sbjct  800  AKLIRFVEQGDALKGMFGLSFTPLTTPRRRSLGWKHSMASLL  841



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1875420020936