BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15876_g1_i1 len=720 path=[712:0-719]

Length=720
                                                                      Score     E

ref|XP_006346746.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    115   3e-27   
ref|XP_002306552.2|  hypothetical protein POPTR_0005s17620g             114   6e-27   Populus trichocarpa [western balsam poplar]
ref|XP_009619186.1|  PREDICTED: zinc-finger homeodomain protein 2...    113   1e-26   
ref|XP_004236700.1|  PREDICTED: zinc-finger homeodomain protein 2...    113   2e-26   
ref|XP_009802158.1|  PREDICTED: zinc-finger homeodomain protein 2...    112   2e-26   
gb|KDP29745.1|  hypothetical protein JCGZ_18680                         113   2e-26   
ref|XP_006426297.1|  hypothetical protein CICLE_v10027024mg             112   3e-26   
ref|XP_009769511.1|  PREDICTED: zinc-finger homeodomain protein 2...    111   6e-26   
ref|XP_009769508.1|  PREDICTED: zinc-finger homeodomain protein 2...    111   8e-26   
gb|KHG22175.1|  hypothetical protein F383_07505                         110   2e-25   
ref|XP_009596949.1|  PREDICTED: zinc-finger homeodomain protein 2...    109   4e-25   
ref|XP_010266504.1|  PREDICTED: zinc-finger homeodomain protein 1...    109   5e-25   
ref|XP_010060081.1|  PREDICTED: zinc-finger homeodomain protein 2...    110   5e-25   
ref|XP_010272957.1|  PREDICTED: zinc-finger homeodomain protein 1...    108   9e-25   
ref|XP_003635057.1|  PREDICTED: zinc-finger homeodomain protein 2...    108   2e-24   
ref|XP_009802157.1|  PREDICTED: zinc-finger homeodomain protein 2...    107   3e-24   
ref|XP_009772007.1|  PREDICTED: zinc-finger homeodomain protein 2...    106   6e-24   
ref|XP_009624224.1|  PREDICTED: zinc-finger homeodomain protein 2...    105   8e-24   
ref|XP_004143449.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    106   9e-24   
ref|XP_008440565.1|  PREDICTED: zinc-finger homeodomain protein 1...    105   1e-23   
ref|XP_007205692.1|  hypothetical protein PRUPE_ppa009712mg             105   2e-23   
ref|XP_006338094.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    105   2e-23   
ref|XP_010060080.1|  PREDICTED: zinc-finger homeodomain protein 2...    106   2e-23   
ref|XP_009758154.1|  PREDICTED: zinc-finger homeodomain protein 2...    105   3e-23   
ref|XP_009596948.1|  PREDICTED: zinc-finger homeodomain protein 2...    104   3e-23   
ref|XP_007158386.1|  hypothetical protein PHAVU_002G148900g             104   3e-23   
ref|XP_008235400.1|  PREDICTED: zinc-finger homeodomain protein 1...    102   4e-23   
ref|XP_006433874.1|  hypothetical protein CICLE_v10002355mg             103   5e-23   
gb|EYU34567.1|  hypothetical protein MIMGU_mgv1a012253mg                103   6e-23   
emb|CDP01539.1|  unnamed protein product                                103   6e-23   
ref|XP_008338536.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...    104   6e-23   
ref|XP_004299701.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    103   6e-23   
gb|EEE69868.1|  hypothetical protein OsJ_29679                          103   7e-23   Oryza sativa Japonica Group [Japonica rice]
gb|ADE77597.1|  unknown                                                 103   7e-23   
ref|XP_002285709.1|  PREDICTED: zinc-finger homeodomain protein 1       103   7e-23   Vitis vinifera
ref|XP_004288462.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    103   8e-23   
ref|XP_009602563.1|  PREDICTED: zinc-finger homeodomain protein 2...    103   1e-22   
ref|XP_011100018.1|  PREDICTED: zinc-finger homeodomain protein 1...    102   1e-22   
gb|ADE76551.1|  unknown                                                 103   1e-22   
ref|NP_001063419.1|  Os09g0466400                                       103   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010243316.1|  PREDICTED: zinc-finger homeodomain protein 1...    102   1e-22   
sp|A2Z259.1|ZHD1_ORYSI  RecName: Full=Zinc-finger homeodomain pro...    103   1e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_004237971.1|  PREDICTED: zinc-finger homeodomain protein 2       102   2e-22   
ref|XP_006660717.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    103   2e-22   
ref|XP_006660219.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    103   2e-22   
ref|XP_008385681.1|  PREDICTED: zinc-finger homeodomain protein 1...    102   2e-22   
emb|CAN75153.1|  hypothetical protein VITISV_035994                     102   2e-22   Vitis vinifera
ref|XP_003519839.2|  PREDICTED: ZF-HD homeobox protein At4g24660-...    102   2e-22   
ref|XP_002460367.1|  hypothetical protein SORBIDRAFT_02g027040          103   2e-22   Sorghum bicolor [broomcorn]
ref|XP_008378554.1|  PREDICTED: zinc-finger homeodomain protein 2...    102   2e-22   
ref|XP_003551238.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    102   2e-22   
ref|XP_007018165.1|  Transcription factor, putative                     102   3e-22   
ref|XP_006342245.1|  PREDICTED: uncharacterized protein LOC102578167  99.8    5e-22   
ref|XP_003576623.1|  PREDICTED: zinc-finger homeodomain protein 1       102   5e-22   
ref|XP_011010389.1|  PREDICTED: zinc-finger homeodomain protein 2...    101   5e-22   
gb|EMT05330.1|  ZF-HD homeobox protein                                97.1    5e-22   
ref|XP_007047820.1|  ZF-HD homeobox protein, putative                   101   5e-22   
ref|XP_003574645.1|  PREDICTED: zinc-finger homeodomain protein 1...    102   6e-22   
ref|XP_004957068.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...    101   8e-22   
ref|XP_009393647.1|  PREDICTED: zinc-finger homeodomain protein 2...    101   8e-22   
ref|XP_004489767.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...    100   9e-22   
ref|XP_010939727.1|  PREDICTED: zinc-finger homeodomain protein 2       101   9e-22   
ref|XP_002302329.1|  hypothetical protein POPTR_0002s10330g             100   1e-21   Populus trichocarpa [western balsam poplar]
ref|XP_010098663.1|  hypothetical protein L484_026038                   100   1e-21   
ref|XP_011097503.1|  PREDICTED: zinc-finger homeodomain protein 2...    100   1e-21   
gb|EPS61017.1|  hypothetical protein M569_13783                       99.8    2e-21   
gb|ABY61018.1|  zinc finger-homeodomain protein 1                       100   2e-21   Welwitschia mirabilis
gb|ABY61020.1|  zinc finger-homeodomain protein 1                       100   2e-21   Eschscholzia californica
ref|XP_001785616.1|  predicted protein                                  100   2e-21   
ref|XP_010321484.1|  PREDICTED: zinc-finger homeodomain protein 1...  97.8    2e-21   
ref|NP_001062055.1|  Os08g0479400                                       100   3e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007136351.1|  hypothetical protein PHAVU_009G037900g             100   3e-21   
emb|CDY03431.1|  BnaC01g16510D                                        99.0    3e-21   
ref|XP_009410127.1|  PREDICTED: zinc-finger homeodomain protein 2...  99.4    4e-21   
gb|ABY61023.1|  zinc finger homeodomain protein 1                     99.0    4e-21   Saruma henryi
ref|XP_009381483.1|  PREDICTED: zinc-finger homeodomain protein 2...  99.4    4e-21   
gb|KDP41452.1|  hypothetical protein JCGZ_15859                       99.8    4e-21   
ref|XP_008385682.1|  PREDICTED: zinc-finger homeodomain protein 1...  99.0    4e-21   
gb|KHN07994.1|  ZF-HD homeobox protein                                98.2    4e-21   
ref|XP_006581501.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  99.0    5e-21   
ref|XP_010433740.1|  PREDICTED: zinc-finger homeodomain protein 2...  98.2    5e-21   
ref|XP_006286279.1|  hypothetical protein CARUB_v10007856mg           98.2    5e-21   
tpg|DAA48505.1|  TPA: putative homeobox DNA-binding domain superf...  99.4    5e-21   
gb|KHN07995.1|  ZF-HD homeobox protein                                98.2    5e-21   
ref|XP_002514009.1|  transcription factor, putative                   99.0    5e-21   Ricinus communis
ref|XP_008385680.1|  PREDICTED: zinc-finger homeodomain protein 1...  99.0    6e-21   
ref|XP_004973708.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  99.0    6e-21   
ref|XP_009393645.1|  PREDICTED: zinc-finger homeodomain protein 2...  98.6    6e-21   
ref|XP_006573021.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  98.2    6e-21   
ref|XP_010438998.1|  PREDICTED: zinc-finger homeodomain protein 2...  97.8    6e-21   
ref|XP_006878601.1|  hypothetical protein AMTR_s00011p00255340        98.2    7e-21   
gb|KHN07993.1|  ZF-HD homeobox protein                                97.8    7e-21   
emb|CAC34447.1|  ZF-HD homeobox protein                               97.8    8e-21   Flaveria bidentis
ref|XP_009138327.1|  PREDICTED: zinc-finger homeodomain protein 2     97.4    9e-21   
emb|CDY34299.1|  BnaA01g14020D                                        97.4    9e-21   
ref|XP_003602944.1|  Zinc finger-homeodomain protein                  98.2    1e-20   
ref|XP_006413402.1|  hypothetical protein EUTSA_v10026163mg           97.4    1e-20   
emb|CAN60614.1|  hypothetical protein VITISV_003253                   95.5    1e-20   Vitis vinifera
gb|AES96050.2|  homeobox domain, ZF-HD class protein                  97.8    1e-20   
ref|XP_002445649.1|  hypothetical protein SORBIDRAFT_07g023360        98.2    1e-20   Sorghum bicolor [broomcorn]
ref|NP_194197.1|  ZF-HD homeobox protein                              97.1    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867654.1|  ATHB22/MEE68                                     97.1    1e-20   
ref|XP_003530620.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  97.8    1e-20   
ref|XP_009373696.1|  PREDICTED: zinc-finger homeodomain protein 2...  98.2    1e-20   
ref|XP_006859182.1|  hypothetical protein AMTR_s00070p00154800        97.1    1e-20   
ref|NP_001151888.1|  ZF-HD protein dimerisation region containing...  97.8    1e-20   Zea mays [maize]
ref|XP_010448536.1|  PREDICTED: zinc-finger homeodomain protein 2     97.1    1e-20   
ref|NP_001149424.1|  LOC100283050                                     97.8    2e-20   Zea mays [maize]
gb|KHG07143.1|  hypothetical protein F383_33189                       97.4    2e-20   
emb|CDP11470.1|  unnamed protein product                              97.4    2e-20   
ref|XP_010263641.1|  PREDICTED: zinc-finger homeodomain protein 5     97.8    2e-20   
ref|XP_009393644.1|  PREDICTED: zinc-finger homeodomain protein 2...  97.4    2e-20   
ref|XP_003526539.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  97.4    2e-20   
ref|XP_009395689.1|  PREDICTED: zinc-finger homeodomain protein 5...  97.8    2e-20   
ref|XP_009399684.1|  PREDICTED: zinc-finger homeodomain protein 1...  97.4    2e-20   
ref|XP_004501619.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  97.1    2e-20   
ref|XP_011087615.1|  PREDICTED: zinc-finger homeodomain protein 4     97.1    2e-20   
ref|XP_003518249.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  96.7    2e-20   
ref|XP_008338913.1|  PREDICTED: zinc-finger homeodomain protein 2...  97.1    3e-20   
ref|XP_010254805.1|  PREDICTED: zinc-finger homeodomain protein 5...  97.4    3e-20   
ref|XP_008810728.1|  PREDICTED: zinc-finger homeodomain protein 6...  97.4    3e-20   
ref|XP_007222197.1|  hypothetical protein PRUPE_ppa009679mg           97.1    3e-20   
ref|XP_001778248.1|  predicted protein                                96.7    3e-20   
ref|XP_008219382.1|  PREDICTED: zinc-finger homeodomain protein 2     96.7    3e-20   
ref|XP_009421143.1|  PREDICTED: zinc-finger homeodomain protein 4...  96.7    4e-20   
ref|XP_008338912.1|  PREDICTED: zinc-finger homeodomain protein 2...  96.7    4e-20   
gb|AAZ07989.1|  zinc finger homeodomain protein 1                     97.1    4e-20   Physcomitrella patens
gb|ABY61024.1|  zinc finger-homeodomain protein 2                     96.3    4e-20   Saruma henryi
ref|XP_009405659.1|  PREDICTED: zinc-finger homeodomain protein 6...  97.1    4e-20   
gb|ABR16776.1|  unknown                                               96.7    4e-20   Picea sitchensis
ref|XP_011016887.1|  PREDICTED: zinc-finger homeodomain protein 2     96.3    4e-20   
ref|XP_007154109.1|  hypothetical protein PHAVU_003G091100g           96.3    4e-20   
ref|XP_008806398.1|  PREDICTED: zinc-finger homeodomain protein 1...  94.4    5e-20   
ref|XP_010682105.1|  PREDICTED: zinc-finger homeodomain protein 3...  96.7    5e-20   
emb|CBI19232.3|  unnamed protein product                              95.9    5e-20   
ref|XP_009403385.1|  PREDICTED: zinc-finger homeodomain protein 4...  95.9    5e-20   
ref|XP_010681042.1|  PREDICTED: zinc-finger homeodomain protein 1...  96.3    5e-20   
ref|XP_003530619.2|  PREDICTED: ZF-HD homeobox protein At4g24660-...  95.9    5e-20   
ref|XP_003522760.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  96.3    5e-20   
ref|XP_009407034.1|  PREDICTED: zinc-finger homeodomain protein 2...  96.3    6e-20   
ref|XP_006578270.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  96.3    6e-20   
ref|XP_001777987.1|  predicted protein                                94.0    6e-20   
ref|XP_010925945.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  96.3    7e-20   
ref|XP_009396485.1|  PREDICTED: zinc-finger homeodomain protein 6...  96.7    7e-20   
ref|XP_008812231.1|  PREDICTED: zinc-finger homeodomain protein 2...  95.9    7e-20   
ref|XP_008444884.1|  PREDICTED: zinc-finger homeodomain protein 2     95.1    7e-20   
ref|XP_004152612.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  95.1    7e-20   
gb|ABK22835.1|  unknown                                               95.1    7e-20   Picea sitchensis
ref|XP_006836924.1|  hypothetical protein AMTR_s00099p00145100        95.5    7e-20   
ref|XP_002994344.1|  hypothetical protein SELMODRAFT_236945           93.2    8e-20   
ref|XP_010936702.1|  PREDICTED: zinc-finger homeodomain protein 6...  95.9    8e-20   
emb|CDP02013.1|  unnamed protein product                              96.3    8e-20   
ref|XP_008670258.1|  PREDICTED: zinc-finger homeodomain protein 1...  95.5    8e-20   
ref|XP_010438996.1|  PREDICTED: zinc-finger homeodomain protein 2...  95.1    8e-20   
emb|CDY08945.1|  BnaC08g11750D                                        94.4    8e-20   
ref|XP_004152776.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  95.5    9e-20   
pdb|1WH7|A  Chain A, Solution Structure Of Homeobox Domain Of Ara...  90.9    9e-20   
gb|EPS61775.1|  hypothetical protein M569_13018                       95.5    9e-20   
emb|CDX88950.1|  BnaA04g02360D                                        94.4    9e-20   
ref|XP_010554331.1|  PREDICTED: zinc-finger homeodomain protein 4     95.5    1e-19   
ref|XP_002966118.1|  hypothetical protein SELMODRAFT_85536            93.2    1e-19   
ref|XP_008444722.1|  PREDICTED: zinc-finger homeodomain protein 2     95.5    1e-19   
ref|XP_006383190.1|  hypothetical protein POPTR_0005s12420g           95.5    1e-19   
ref|XP_010527865.1|  PREDICTED: zinc-finger homeodomain protein 4     95.5    1e-19   
ref|XP_007046919.1|  Homeobox protein 24, putative                    95.9    1e-19   
ref|XP_010438997.1|  PREDICTED: zinc-finger homeodomain protein 2...  94.4    1e-19   
ref|XP_003633412.1|  PREDICTED: zinc-finger homeodomain protein 4     95.1    1e-19   
ref|XP_010252306.1|  PREDICTED: zinc-finger homeodomain protein 4     94.7    1e-19   
ref|XP_004165400.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  95.5    1e-19   
ref|XP_003613092.1|  Zinc finger-homeodomain protein                  95.5    1e-19   
ref|XP_006380765.1|  hypothetical protein POPTR_0007s12970g           95.5    1e-19   
ref|XP_002310240.2|  zinc finger family protein                       95.1    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_001752347.1|  predicted protein                                95.1    1e-19   
ref|XP_010527155.1|  PREDICTED: zinc-finger homeodomain protein 1     93.2    2e-19   
ref|XP_006291509.1|  hypothetical protein CARUB_v10017657mg           95.1    2e-19   
ref|XP_008789175.1|  PREDICTED: zinc-finger homeodomain protein 4...  94.4    2e-19   
ref|XP_004230410.1|  PREDICTED: zinc-finger homeodomain protein 4     94.7    2e-19   
ref|XP_007156483.1|  hypothetical protein PHAVU_003G289700g           93.6    2e-19   
ref|XP_002965557.1|  hypothetical protein SELMODRAFT_68508            92.8    2e-19   
ref|XP_001772697.1|  predicted protein                                93.2    2e-19   
ref|XP_008808961.1|  PREDICTED: zinc-finger homeodomain protein 4...  94.4    2e-19   
ref|XP_006431432.1|  hypothetical protein CICLE_v10003702mg           94.7    2e-19   
ref|XP_006853040.1|  hypothetical protein AMTR_s00038p00027320        94.0    2e-19   
gb|KDO42061.1|  hypothetical protein CISIN_1g048741mg                 94.7    2e-19   
ref|XP_006470838.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  94.7    2e-19   
ref|XP_003544235.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  94.0    2e-19   
ref|XP_010930367.1|  PREDICTED: zinc-finger homeodomain protein 4...  94.4    2e-19   
gb|KEH32742.1|  homeobox domain, ZF-HD class protein                  94.7    2e-19   
gb|KHG11042.1|  hypothetical protein F383_15979                       94.4    3e-19   
ref|XP_004143516.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  94.4    3e-19   
ref|XP_003530618.2|  PREDICTED: ZF-HD homeobox protein At4g24660-...  94.0    3e-19   
ref|XP_004499360.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  94.4    3e-19   
ref|XP_002981261.1|  hypothetical protein SELMODRAFT_59934            89.0    3e-19   
ref|XP_004287891.1|  PREDICTED: uncharacterized protein LOC101298828  94.7    3e-19   
emb|CDY24844.1|  BnaA08g14660D                                        92.8    3e-19   
ref|XP_010095248.1|  hypothetical protein L484_014588                 94.0    3e-19   
ref|XP_008440716.1|  PREDICTED: zinc-finger homeodomain protein 2     94.4    3e-19   
ref|XP_008388052.1|  PREDICTED: zinc-finger homeodomain protein 2     94.4    3e-19   
ref|XP_006349273.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  94.0    3e-19   
emb|CDO97666.1|  unnamed protein product                              94.0    3e-19   
ref|XP_008392268.1|  PREDICTED: zinc-finger homeodomain protein 6...  94.0    3e-19   
ref|XP_007023152.1|  Homeobox protein 31                              94.0    3e-19   
ref|XP_002977929.1|  hypothetical protein SELMODRAFT_59936            88.6    3e-19   
ref|XP_009109241.1|  PREDICTED: zinc-finger homeodomain protein 2...  92.8    3e-19   
ref|XP_010065227.1|  PREDICTED: zinc-finger homeodomain protein 4...  94.0    3e-19   
ref|XP_010530124.1|  PREDICTED: zinc-finger homeodomain protein 2     92.8    4e-19   
ref|XP_010927875.1|  PREDICTED: zinc-finger homeodomain protein 4...  93.6    4e-19   
ref|XP_009613099.1|  PREDICTED: zinc-finger homeodomain protein 4     93.6    4e-19   
gb|KDP40895.1|  hypothetical protein JCGZ_24894                       93.2    4e-19   
ref|XP_002281371.1|  PREDICTED: zinc-finger homeodomain protein 6     93.6    4e-19   Vitis vinifera
ref|XP_010539898.1|  PREDICTED: zinc-finger homeodomain protein 5...  93.2    5e-19   
ref|XP_006841247.1|  hypothetical protein AMTR_s00135p00085840        92.8    5e-19   
ref|XP_010099792.1|  hypothetical protein L484_010980                 93.6    5e-19   
ref|XP_007017558.1|  Homeobox protein 33 isoform 1                    93.2    6e-19   
ref|XP_011028421.1|  PREDICTED: zinc-finger homeodomain protein 4     93.2    6e-19   
gb|KHN08326.1|  ZF-HD homeobox protein                                92.8    6e-19   
gb|KHN40205.1|  ZF-HD homeobox protein                                92.0    6e-19   
gb|ABY61025.1|  zinc finger-homeodomain protein 3                     92.0    6e-19   Saruma henryi
ref|XP_004142854.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  93.2    6e-19   
ref|XP_004156724.1|  PREDICTED: LOW QUALITY PROTEIN: ZF-HD homeob...  93.2    7e-19   
ref|XP_008460585.1|  PREDICTED: zinc-finger homeodomain protein 4     93.2    7e-19   
ref|XP_010425030.1|  PREDICTED: zinc-finger homeodomain protein 3...  93.2    7e-19   
ref|XP_009762783.1|  PREDICTED: zinc-finger homeodomain protein 4...  93.2    7e-19   
ref|XP_010912718.1|  PREDICTED: zinc-finger homeodomain protein 4...  92.8    8e-19   
gb|EYU30955.1|  hypothetical protein MIMGU_mgv1a026983mg              92.4    8e-19   
ref|XP_009416998.1|  PREDICTED: zinc-finger homeodomain protein 4...  92.4    8e-19   
ref|XP_002525870.1|  transcription factor, putative                   92.8    9e-19   Ricinus communis
ref|XP_008782488.1|  PREDICTED: zinc-finger homeodomain protein 6...  92.4    9e-19   
ref|XP_006385095.1|  hypothetical protein POPTR_0004s23860g           92.8    9e-19   
ref|XP_010502266.1|  PREDICTED: zinc-finger homeodomain protein 3...  92.8    9e-19   
ref|XP_010940074.1|  PREDICTED: zinc-finger homeodomain protein 6...  92.8    9e-19   
ref|XP_011003723.1|  PREDICTED: zinc-finger homeodomain protein 6     92.8    9e-19   
ref|XP_003529692.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  92.4    1e-18   
gb|EPS70696.1|  hypothetical protein M569_04063                       92.0    1e-18   
ref|XP_011085755.1|  PREDICTED: zinc-finger homeodomain protein 9     92.8    1e-18   
emb|CBI19706.3|  unnamed protein product                              92.8    1e-18   
ref|XP_010029792.1|  PREDICTED: zinc-finger homeodomain protein 6     92.8    1e-18   
ref|XP_006360403.1|  PREDICTED: uncharacterized protein LOC102604466  96.3    1e-18   
ref|XP_008220815.1|  PREDICTED: zinc-finger homeodomain protein 5...  92.8    1e-18   
ref|XP_007224511.1|  hypothetical protein PRUPE_ppa023369mg           92.4    1e-18   
ref|XP_008220812.1|  PREDICTED: zinc-finger homeodomain protein 5...  92.8    1e-18   
ref|XP_009130511.1|  PREDICTED: zinc-finger homeodomain protein 1...  92.0    1e-18   
gb|AFW79306.1|  ZF-HD homeobox protein                                91.7    1e-18   
ref|NP_001152263.1|  ZF-HD homeobox protein                           91.7    1e-18   Zea mays [maize]
ref|XP_001773676.1|  predicted protein                                87.0    1e-18   
ref|XP_009404830.1|  PREDICTED: zinc-finger homeodomain protein 4...  91.3    2e-18   
ref|XP_004961117.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  91.7    2e-18   
gb|ABY61028.1|  zinc finger-homeodomain protein 1                     91.3    2e-18   Yucca filamentosa [Adam's-needle]
ref|XP_009406459.1|  PREDICTED: zinc-finger homeodomain protein 4...  91.7    2e-18   
ref|XP_009763792.1|  PREDICTED: zinc-finger homeodomain protein 5...  91.7    2e-18   
ref|XP_010102085.1|  hypothetical protein L484_009028                 92.4    2e-18   
ref|XP_004293203.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  92.0    2e-18   
ref|XP_006340630.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  92.0    2e-18   
ref|XP_007141241.1|  hypothetical protein PHAVU_008G179200g           91.7    2e-18   
emb|CDY33960.1|  BnaC02g43770D                                        91.7    2e-18   
ref|XP_009365549.1|  PREDICTED: zinc-finger homeodomain protein 2...  92.0    2e-18   
ref|XP_007048627.1|  Homeobox protein 21, putative                    91.3    2e-18   
ref|XP_004232414.1|  PREDICTED: zinc-finger homeodomain protein 5     91.7    2e-18   
ref|XP_009385760.1|  PREDICTED: zinc-finger homeodomain protein 2...  91.7    2e-18   
ref|XP_008344270.1|  PREDICTED: zinc-finger homeodomain protein 6...  91.7    2e-18   
ref|XP_011025804.1|  PREDICTED: zinc-finger homeodomain protein 6     91.7    2e-18   
ref|XP_009403138.1|  PREDICTED: zinc-finger homeodomain protein 2...  91.3    2e-18   
ref|XP_002510399.1|  transcription factor, putative                   91.3    2e-18   Ricinus communis
ref|XP_009371603.1|  PREDICTED: zinc-finger homeodomain protein 6...  91.7    2e-18   
ref|XP_008357201.1|  PREDICTED: zinc-finger homeodomain protein 5...  91.7    2e-18   
ref|XP_009607017.1|  PREDICTED: zinc-finger homeodomain protein 4...  91.3    2e-18   
ref|NP_178358.1|  homeobox protein 21                                 91.7    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAM10791.1|  hypothetical protein At2g02540/T822.16                91.7    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007226172.1|  hypothetical protein PRUPE_ppa015411mg           91.7    3e-18   
ref|XP_006395776.1|  hypothetical protein EUTSA_v10004643mg           91.3    3e-18   
gb|KHN11103.1|  ZF-HD homeobox protein                                91.3    3e-18   
gb|ABK25080.1|  unknown                                               91.3    3e-18   Picea sitchensis
ref|XP_008218634.1|  PREDICTED: zinc-finger homeodomain protein 4...  91.7    3e-18   
ref|XP_004490406.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  90.9    3e-18   
gb|ABK25143.1|  unknown                                               90.9    3e-18   Picea sitchensis
ref|XP_006599376.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  91.3    3e-18   
ref|XP_010908151.1|  PREDICTED: zinc-finger homeodomain protein 4...  90.9    3e-18   
ref|XP_003550152.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  90.9    3e-18   
ref|XP_002982727.1|  hypothetical protein SELMODRAFT_17376            89.0    3e-18   
ref|XP_008443414.1|  PREDICTED: zinc-finger homeodomain protein 9...  90.9    3e-18   
gb|KHN03576.1|  ZF-HD homeobox protein                                90.9    3e-18   
gb|KDP38514.1|  hypothetical protein JCGZ_04439                       90.9    4e-18   
gb|KHN05023.1|  ZF-HD homeobox protein                                89.4    4e-18   
ref|XP_011098625.1|  PREDICTED: zinc-finger homeodomain protein 9...  90.9    4e-18   
ref|XP_009347543.1|  PREDICTED: zinc-finger homeodomain protein 6...  90.9    4e-18   
ref|XP_011004015.1|  PREDICTED: zinc-finger homeodomain protein 5...  90.9    4e-18   
gb|KHN00536.1|  ZF-HD homeobox protein                                91.3    4e-18   
ref|XP_003520309.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  91.3    4e-18   
emb|CAN64849.1|  hypothetical protein VITISV_004128                   90.5    4e-18   
ref|XP_006431147.1|  hypothetical protein CICLE_v10011968mg           91.7    4e-18   
ref|XP_009630982.1|  PREDICTED: zinc-finger homeodomain protein 5...  90.9    4e-18   
gb|KHN13618.1|  ZF-HD homeobox protein                                88.6    4e-18   
ref|XP_008781669.1|  PREDICTED: zinc-finger homeodomain protein 8...  90.1    4e-18   
ref|XP_010930757.1|  PREDICTED: zinc-finger homeodomain protein 2...  90.5    4e-18   
ref|XP_010246039.1|  PREDICTED: zinc-finger homeodomain protein 1...  90.9    4e-18   
ref|XP_003555538.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  89.4    4e-18   
ref|XP_010665240.1|  PREDICTED: zinc-finger homeodomain protein 2...  90.5    4e-18   
ref|XP_010257380.1|  PREDICTED: zinc-finger homeodomain protein 9     90.5    4e-18   
emb|CBI18514.3|  unnamed protein product                              90.5    4e-18   
emb|CDX85886.1|  BnaC06g22480D                                        90.5    4e-18   
ref|XP_009392577.1|  PREDICTED: zinc-finger homeodomain protein 4...  90.1    4e-18   
emb|CDX81284.1|  BnaC09g06950D                                        90.1    4e-18   
ref|XP_008800713.1|  PREDICTED: zinc-finger homeodomain protein 6...  90.9    5e-18   
ref|XP_004147471.1|  PREDICTED: transcription factor HB29-like        90.5    5e-18   
ref|XP_004301574.1|  PREDICTED: uncharacterized protein LOC101312064  91.3    5e-18   
emb|CBI27705.3|  unnamed protein product                              87.4    5e-18   
ref|XP_009411228.1|  PREDICTED: zinc-finger homeodomain protein 5...  90.9    5e-18   
ref|XP_006425664.1|  hypothetical protein CICLE_v10025926mg           90.9    5e-18   
ref|XP_010463122.1|  PREDICTED: zinc-finger homeodomain protein 1...  90.5    5e-18   
ref|XP_009603276.1|  PREDICTED: zinc-finger homeodomain protein 6...  90.5    6e-18   
ref|XP_010675490.1|  PREDICTED: zinc-finger homeodomain protein 1...  90.5    6e-18   
ref|XP_010258352.1|  PREDICTED: zinc-finger homeodomain protein 9...  90.1    6e-18   
ref|XP_010444532.1|  PREDICTED: zinc-finger homeodomain protein 1     90.1    6e-18   
ref|XP_010086552.1|  hypothetical protein L484_001444                 90.9    6e-18   
ref|XP_009112180.1|  PREDICTED: zinc-finger homeodomain protein 1...  89.7    6e-18   
ref|XP_007157626.1|  hypothetical protein PHAVU_002G085400g           89.7    7e-18   
ref|XP_006394037.1|  hypothetical protein EUTSA_v10005568mg           90.1    7e-18   
gb|EYU40171.1|  hypothetical protein MIMGU_mgv1a008153mg              90.9    7e-18   
ref|XP_009415270.1|  PREDICTED: zinc-finger homeodomain protein 6...  90.5    7e-18   
ref|XP_011083674.1|  PREDICTED: zinc-finger homeodomain protein 5     89.7    7e-18   
ref|XP_009364948.1|  PREDICTED: zinc-finger homeodomain protein 2...  90.5    7e-18   
ref|XP_010484369.1|  PREDICTED: zinc-finger homeodomain protein 1...  89.7    7e-18   
ref|XP_006655627.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  87.0    8e-18   
ref|XP_008378952.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  90.5    8e-18   
ref|XP_009336904.1|  PREDICTED: zinc-finger homeodomain protein 2...  90.5    8e-18   
gb|EYU35040.1|  hypothetical protein MIMGU_mgv1a014453mg              88.6    8e-18   
ref|XP_006280898.1|  hypothetical protein CARUB_v10026891mg           89.7    8e-18   
ref|XP_008678040.1|  PREDICTED: zinc-finger homeodomain protein 4...  90.5    8e-18   
ref|XP_007204025.1|  hypothetical protein PRUPE_ppa020272mg           90.1    9e-18   
ref|XP_003615230.1|  Zinc finger-homeodomain protein                  89.7    9e-18   
gb|AAD39591.1|AC007858_5  10A19I.6                                    90.5    9e-18   
ref|XP_009150629.1|  PREDICTED: zinc-finger homeodomain protein 1...  89.7    9e-18   
ref|XP_008678039.1|  PREDICTED: zinc-finger homeodomain protein 4...  90.9    9e-18   
ref|XP_009104712.1|  PREDICTED: zinc-finger homeodomain protein 5...  89.7    9e-18   
gb|KFK28242.1|  hypothetical protein AALP_AA8G490700                  89.7    9e-18   
emb|CDY54719.1|  BnaA09g52500D                                        89.0    1e-17   
ref|XP_009355386.1|  PREDICTED: zinc-finger homeodomain protein 3     90.1    1e-17   
gb|ABY61029.1|  zinc finger-homeodomain protein 1                     89.4    1e-17   
emb|CDY14559.1|  BnaC03g49000D                                        89.4    1e-17   
ref|XP_004148695.1|  PREDICTED: transcription factor HB29-like        89.7    1e-17   
ref|XP_006466561.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  88.6    1e-17   
ref|XP_006482594.1|  PREDICTED: myb-like protein I-like               90.1    1e-17   
ref|XP_006426395.1|  hypothetical protein CICLE_v10027184mg           88.6    1e-17   
ref|XP_002306871.1|  zinc finger family protein                       89.4    1e-17   
ref|XP_009373614.1|  PREDICTED: zinc-finger homeodomain protein 3...  90.1    1e-17   
sp|B8AX53.1|ZHD6_ORYSI  RecName: Full=Zinc-finger homeodomain pro...  89.0    1e-17   
ref|NP_001056419.1|  Os05g0579300                                     89.0    1e-17   
ref|XP_008788352.1|  PREDICTED: zinc-finger homeodomain protein 4...  88.6    1e-17   
ref|XP_008339432.1|  PREDICTED: zinc-finger homeodomain protein 3...  89.7    1e-17   
gb|KDP34399.1|  hypothetical protein JCGZ_12803                       89.4    1e-17   
gb|KHN08325.1|  ZF-HD homeobox protein                                88.2    2e-17   
ref|XP_011099626.1|  PREDICTED: zinc-finger homeodomain protein 6     89.4    2e-17   
ref|XP_004168480.1|  PREDICTED: transcription factor HB29-like        89.0    2e-17   
gb|ABY61027.1|  zinc finger-homeodomain protein 1                     88.6    2e-17   
gb|ABY61030.1|  zinc finger-homeodomain protein 1                     88.6    2e-17   
ref|XP_009341386.1|  PREDICTED: zinc-finger homeodomain protein 3...  89.4    2e-17   
ref|XP_009390407.1|  PREDICTED: zinc-finger homeodomain protein 5...  88.6    2e-17   
emb|CDX68137.1|  BnaA07g21770D                                        88.6    2e-17   
ref|XP_002864955.1|  hypothetical protein ARALYDRAFT_919872           88.2    2e-17   
ref|XP_004238289.1|  PREDICTED: zinc-finger homeodomain protein 5     88.6    2e-17   
ref|XP_008807662.1|  PREDICTED: zinc-finger homeodomain protein 8...  88.2    2e-17   
gb|EPS61290.1|  hypothetical protein M569_13509                       87.4    2e-17   
ref|XP_010514025.1|  PREDICTED: zinc-finger homeodomain protein 3     88.6    2e-17   
ref|XP_006302600.1|  hypothetical protein CARUB_v10020705mg           88.6    3e-17   
gb|EEC67940.1|  hypothetical protein OsI_35664                        89.0    3e-17   
ref|XP_002449277.1|  hypothetical protein SORBIDRAFT_05g007050        89.7    3e-17   
ref|XP_006663328.1|  PREDICTED: uncharacterized protein LOC102703731  89.4    3e-17   
ref|XP_003621193.1|  ZF-HD homeobox protein                           88.6    3e-17   
emb|CAC34410.1|  ZF-HD homeobox protein                               87.8    3e-17   
ref|XP_002267747.1|  PREDICTED: zinc-finger homeodomain protein 3     87.8    3e-17   
ref|XP_002875135.1|  hypothetical protein ARALYDRAFT_484166           88.2    3e-17   
ref|XP_004489395.1|  PREDICTED: transcription factor HB29-like        88.6    3e-17   
ref|XP_010674293.1|  PREDICTED: zinc-finger homeodomain protein 1...  87.0    3e-17   
ref|XP_009340987.1|  PREDICTED: zinc-finger homeodomain protein 1...  88.2    3e-17   
ref|XP_009394611.1|  PREDICTED: zinc-finger homeodomain protein 2...  88.6    3e-17   
ref|XP_003618493.1|  Zinc finger-homeodomain protein                  87.4    3e-17   
ref|XP_010088163.1|  hypothetical protein L484_013608                 87.0    3e-17   
ref|XP_006363398.1|  PREDICTED: transcription factor HB29-like        88.6    3e-17   
ref|XP_009405919.1|  PREDICTED: zinc-finger homeodomain protein 8...  87.8    3e-17   
emb|CBI22215.3|  unnamed protein product                              87.4    4e-17   
ref|XP_010428533.1|  PREDICTED: zinc-finger homeodomain protein 5     88.2    4e-17   
ref|XP_009376317.1|  PREDICTED: zinc-finger homeodomain protein 9     88.2    4e-17   
ref|XP_008467057.1|  PREDICTED: zinc-finger homeodomain protein 1...  88.2    4e-17   
ref|XP_011003997.1|  PREDICTED: zinc-finger homeodomain protein 2...  87.8    4e-17   
ref|XP_002273802.1|  PREDICTED: zinc-finger homeodomain protein 11    88.2    4e-17   
ref|XP_002283533.1|  PREDICTED: zinc-finger homeodomain protein 9     88.2    4e-17   
ref|XP_010471631.1|  PREDICTED: zinc-finger homeodomain protein 5...  87.8    4e-17   
emb|CDY45419.1|  BnaA07g31990D                                        87.8    4e-17   
ref|XP_003576116.2|  PREDICTED: zinc-finger homeodomain protein 4...  88.6    4e-17   
ref|XP_004978993.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  88.6    4e-17   
emb|CAC34409.1|  ZF-HD homeobox protein                               88.2    4e-17   
ref|XP_006602909.1|  PREDICTED: transcription factor HB29-like        88.2    4e-17   
ref|XP_009106180.1|  PREDICTED: zinc-finger homeodomain protein 5     87.8    4e-17   
ref|XP_008656066.1|  PREDICTED: zinc-finger homeodomain protein 6...  87.4    5e-17   
ref|XP_008795929.1|  PREDICTED: zinc-finger homeodomain protein 6...  87.4    5e-17   
ref|XP_006390329.1|  hypothetical protein EUTSA_v10018892mg           87.8    5e-17   
ref|XP_007139577.1|  hypothetical protein PHAVU_008G041300g           87.8    5e-17   
ref|XP_002887580.1|  hypothetical protein ARALYDRAFT_895391           87.8    5e-17   
ref|XP_002324056.2|  hypothetical protein POPTR_0017s11920g           87.8    5e-17   
ref|XP_011012906.1|  PREDICTED: zinc-finger homeodomain protein 4...  87.4    5e-17   
ref|XP_010937133.1|  PREDICTED: zinc-finger homeodomain protein 9...  87.4    5e-17   
ref|XP_007156052.1|  hypothetical protein PHAVU_003G254200g           87.8    5e-17   
ref|XP_010693250.1|  PREDICTED: zinc-finger homeodomain protein 9...  88.6    5e-17   
ref|XP_010489538.1|  PREDICTED: zinc-finger homeodomain protein 6...  87.4    5e-17   
ref|XP_006341952.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  87.4    5e-17   
emb|CDP07504.1|  unnamed protein product                              87.4    5e-17   
ref|NP_565106.1|  homeobox protein 33                                 87.4    5e-17   
ref|XP_010912536.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  87.0    6e-17   
ref|XP_006299733.1|  hypothetical protein CARUB_v10015926mg           87.0    6e-17   
ref|XP_006434579.1|  hypothetical protein CICLE_v10004050mg           86.3    6e-17   
ref|XP_010414224.1|  PREDICTED: zinc-finger homeodomain protein 6...  87.0    6e-17   
gb|KDO36261.1|  hypothetical protein CISIN_1g048824mg                 86.3    6e-17   
gb|ACG39295.1|  hypothetical protein                                  87.8    6e-17   
ref|NP_001144285.1|  uncharacterized protein LOC100277167             87.8    6e-17   
ref|NP_201344.1|  homeobox protein 25                                 87.0    6e-17   
ref|XP_009393811.1|  PREDICTED: zinc-finger homeodomain protein 8...  87.0    6e-17   
emb|CDX73152.1|  BnaC06g36000D                                        87.4    6e-17   
ref|XP_006473167.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  86.3    7e-17   
gb|AES74711.2|  transcription factor HB29-like protein                87.4    7e-17   
ref|XP_010467646.1|  PREDICTED: zinc-finger homeodomain protein 6     86.7    7e-17   
ref|XP_002886165.1|  ATHB24                                           86.7    7e-17   
ref|XP_006376247.1|  hypothetical protein POPTR_0013s11330g           86.7    7e-17   
ref|XP_003543789.1|  PREDICTED: transcription factor HB29-like        87.4    7e-17   
emb|CDP02232.1|  unnamed protein product                              87.4    8e-17   
gb|KHN01227.1|  ZF-HD homeobox protein                                84.0    8e-17   
ref|XP_008221618.1|  PREDICTED: zinc-finger homeodomain protein 1...  87.4    8e-17   
ref|XP_004953622.1|  PREDICTED: ZF-HD homeobox protein At5g65410-...  88.2    8e-17   
ref|XP_008379353.1|  PREDICTED: zinc-finger homeodomain protein 9...  87.4    9e-17   
ref|XP_011001095.1|  PREDICTED: zinc-finger homeodomain protein 2...  86.7    9e-17   
ref|XP_006376248.1|  hypothetical protein POPTR_0013s11330g           86.7    9e-17   
emb|CAC34413.1|  ZF-HD homeobox protein                               86.7    9e-17   
ref|XP_002443023.1|  hypothetical protein SORBIDRAFT_08g006490        87.0    9e-17   
ref|XP_004512050.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  86.7    9e-17   
emb|CDY62531.1|  BnaA02g35950D                                        86.7    9e-17   
ref|XP_002521573.1|  transcription factor, putative                   87.0    9e-17   
ref|XP_010416393.1|  PREDICTED: zinc-finger homeodomain protein 5...  86.7    9e-17   
ref|XP_002534012.1|  conserved hypothetical protein                   87.0    1e-16   
gb|ABO92969.1|  ZF-HD homeobox domain-containing protein              86.7    1e-16   
gb|EAZ19969.1|  hypothetical protein OsJ_35560                        84.0    1e-16   
ref|XP_004495441.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  85.5    1e-16   
ref|XP_007224765.1|  hypothetical protein PRUPE_ppa024080mg           87.0    1e-16   
emb|CAC34408.1|  ZF-HD homeobox protein                               85.9    1e-16   
ref|XP_010238617.1|  PREDICTED: zinc-finger homeodomain protein 3...  86.7    1e-16   
gb|KDP34832.1|  hypothetical protein JCGZ_11194                       85.5    1e-16   
emb|CDY37252.1|  BnaCnng08060D                                        86.3    1e-16   
ref|XP_003517228.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  86.7    1e-16   
ref|XP_010655937.1|  PREDICTED: zinc-finger homeodomain protein 1...  85.1    1e-16   
pdb|1WH5|A  Chain A, Solution Structure Of Homeobox Domain Of Ara...  82.4    1e-16   
ref|XP_004304301.1|  PREDICTED: uncharacterized protein LOC101291847  87.0    1e-16   
gb|KHN07843.1|  ZF-HD homeobox protein                                84.7    1e-16   
ref|XP_008802616.1|  PREDICTED: zinc-finger homeodomain protein 9...  86.3    1e-16   
gb|KHN33985.1|  ZF-HD homeobox protein                                85.1    1e-16   
ref|XP_009804697.1|  PREDICTED: zinc-finger homeodomain protein 6     86.3    1e-16   
ref|XP_006827241.1|  hypothetical protein AMTR_s00010p00261450        85.5    1e-16   
ref|XP_008792837.1|  PREDICTED: zinc-finger homeodomain protein 9...  86.3    1e-16   
ref|XP_008339904.1|  PREDICTED: zinc-finger homeodomain protein 1...  86.3    1e-16   
gb|KDO84585.1|  hypothetical protein CISIN_1g021941mg                 86.3    1e-16   
ref|XP_007151228.1|  hypothetical protein PHAVU_004G028600g           86.7    1e-16   
ref|XP_011074552.1|  PREDICTED: zinc-finger homeodomain protein 5...  85.9    2e-16   
ref|XP_006473514.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  86.3    2e-16   
gb|AAP44426.1|  ZF-HD homeobox protein-like protein                   83.6    2e-16   
gb|EPS58358.1|  hypothetical protein M569_16456                       84.7    2e-16   
gb|EAY87240.1|  hypothetical protein OsI_08642                        83.2    2e-16   
ref|XP_011010066.1|  PREDICTED: zinc-finger homeodomain protein 9...  86.3    2e-16   
gb|AGT17348.1|  ZF-HD homeobox protein                                85.9    2e-16   
ref|XP_003612025.1|  Zinc finger-homeodomain protein                  85.9    2e-16   
ref|XP_002534484.1|  transcription factor, putative                   85.5    2e-16   
ref|XP_003537589.1|  PREDICTED: ZF-HD homeobox protein At4g24660-...  86.3    2e-16   
ref|XP_010550403.1|  PREDICTED: zinc-finger homeodomain protein 7...  85.5    2e-16   
gb|AAT39967.1|  Putative ZF-HD homeobox protein, identical            85.9    2e-16   
ref|XP_009128086.1|  PREDICTED: zinc-finger homeodomain protein 5...  85.9    2e-16   
gb|AES94983.2|  homeobox domain, ZF-HD class protein                  85.9    2e-16   
ref|XP_006435006.1|  hypothetical protein CICLE_v10001952mg           85.9    2e-16   
ref|XP_010679737.1|  PREDICTED: zinc-finger homeodomain protein 6     85.9    2e-16   
gb|ACU20045.1|  unknown                                               86.3    2e-16   
ref|XP_008341574.1|  PREDICTED: zinc-finger homeodomain protein 1...  85.9    2e-16   
ref|XP_006366102.1|  PREDICTED: transcription factor HB29-like        85.9    2e-16   
gb|KHN36110.1|  ZF-HD homeobox protein                                85.9    2e-16   
ref|XP_009129138.1|  PREDICTED: zinc-finger homeodomain protein 3     85.5    2e-16   
ref|XP_002325543.2|  hypothetical protein POPTR_0019s11070g           85.1    2e-16   
ref|XP_010060955.1|  PREDICTED: zinc-finger homeodomain protein 5     85.5    2e-16   
ref|XP_009403170.1|  PREDICTED: zinc-finger homeodomain protein 9...  85.9    2e-16   
ref|XP_003517792.1|  PREDICTED: transcription factor HB29-like        85.5    3e-16   
gb|KHN41119.1|  ZF-HD homeobox protein                                81.6    3e-16   
ref|XP_002870762.1|  hypothetical protein ARALYDRAFT_494014           85.5    3e-16   
gb|ABY61021.1|  zinc finger-homeodomain protein 2                     85.1    3e-16   
ref|XP_008353097.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  85.5    3e-16   
sp|Q2QW44.3|ZHD3_ORYSJ  RecName: Full=Zinc-finger homeodomain pro...  85.5    3e-16   
ref|XP_007143929.1|  hypothetical protein PHAVU_007G114300g           84.3    3e-16   
sp|Q53N87.2|ZHD4_ORYSJ  RecName: Full=Zinc-finger homeodomain pro...  86.7    3e-16   
ref|XP_010926548.1|  PREDICTED: zinc-finger homeodomain protein 9...  85.1    3e-16   
tpg|DAA40076.1|  TPA: ZF-HD homeobox protein                          85.9    3e-16   
ref|XP_009340741.1|  PREDICTED: LOW QUALITY PROTEIN: zinc-finger ...  85.5    3e-16   
ref|XP_009620302.1|  PREDICTED: zinc-finger homeodomain protein 9...  84.7    3e-16   
ref|XP_009788342.1|  PREDICTED: zinc-finger homeodomain protein 9...  84.7    4e-16   
ref|XP_009410002.1|  PREDICTED: zinc-finger homeodomain protein 9     85.1    4e-16   
gb|AAP44422.1|  ZF-HD homeobox protein-like protein                   82.4    4e-16   
ref|XP_011028851.1|  PREDICTED: zinc-finger homeodomain protein 5...  85.1    4e-16   
ref|XP_007156949.1|  hypothetical protein PHAVU_002G031000g           85.5    4e-16   
gb|EEE68874.1|  hypothetical protein OsJ_27685                        84.7    4e-16   



>ref|XP_006346746.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Solanum tuberosum]
Length=243

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 76/104 (73%), Gaps = 9/104 (9%)
 Frame = +1

Query  25   APLQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVEL  204
            AP QRPLALPS SG  YRE+ E+       + PN  GG  K  RFRTKF++VQKEKM EL
Sbjct  148  APHQRPLALPSTSG-GYREDQED------ISNPNYSGGSKK--RFRTKFSQVQKEKMQEL  198

Query  205  AERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            A++LGWRIQ+E EE V+Q C E G+ R VFKVWMHNNKHT+ KK
Sbjct  199  ADKLGWRIQREDEELVQQLCNETGITRQVFKVWMHNNKHTLGKK  242



>ref|XP_002306552.2| hypothetical protein POPTR_0005s17620g [Populus trichocarpa]
 gb|EEE93548.2| hypothetical protein POPTR_0005s17620g [Populus trichocarpa]
Length=257

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = +1

Query  28   PLQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELA  207
            P  RPLALP+ SG  Y  E E++     +     GGG S  KRFRTKF++ QKEKMV  A
Sbjct  154  PQPRPLALPAASGGGYSREEEDVSNPSSSGGGGGGGGSSSKKRFRTKFSQEQKEKMVAFA  213

Query  208  ERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTV  327
            ERLGWRIQK  E AVEQFC E GV+RHV KVWMHNNKHT+
Sbjct  214  ERLGWRIQKHDEAAVEQFCAENGVKRHVLKVWMHNNKHTI  253



>ref|XP_009619186.1| PREDICTED: zinc-finger homeodomain protein 2-like [Nicotiana 
tomentosiformis]
Length=241

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 76/104 (73%), Gaps = 7/104 (7%)
 Frame = +1

Query  25   APLQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVEL  204
            AP QRPLALPS SG  YRE+ E++         N+ GG    KRFRTKF++ QKEKM EL
Sbjct  144  APQQRPLALPSTSG-GYREDQEDMSNL------NNSGGSGSNKRFRTKFSQEQKEKMQEL  196

Query  205  AERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            A++LGWRIQ+E EE V+Q C E GVRR VFKVWMHNNK+T+ KK
Sbjct  197  ADKLGWRIQREDEELVQQLCNETGVRRQVFKVWMHNNKNTLGKK  240



>ref|XP_004236700.1| PREDICTED: zinc-finger homeodomain protein 2-like [Solanum lycopersicum]
Length=247

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 76/104 (73%), Gaps = 9/104 (9%)
 Frame = +1

Query  25   APLQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVEL  204
            AP QRPLALPS SG  YRE+ E+       + PN  GG  K  RFRTKF++VQK+KM EL
Sbjct  152  APNQRPLALPSTSG-GYREDQED------ISHPNYSGGSKK--RFRTKFSQVQKDKMQEL  202

Query  205  AERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            A++LGWRIQ+E EE V+Q C E G+ R VFKVWMHNNKHT+ KK
Sbjct  203  ADKLGWRIQREDEELVQQLCNETGITRQVFKVWMHNNKHTLGKK  246



>ref|XP_009802158.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X2 
[Nicotiana sylvestris]
Length=235

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 74/106 (70%), Gaps = 10/106 (9%)
 Frame = +1

Query  28   PLQRPLALPSISGSA-YReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVEL  204
            P QRPLALPS SG   YRE+ EE+    ++ T          KRFRT+F + QKEKM+EL
Sbjct  124  PPQRPLALPSTSGGGGYREDQEEMCNPNNSGT---------KKRFRTRFNQEQKEKMLEL  174

Query  205  AERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKKTL  342
            AE LGWRIQ++ E  V+Q C E G++RHVFKVWMHNNK T+ KKTL
Sbjct  175  AENLGWRIQRQDEGVVQQLCNEIGIKRHVFKVWMHNNKLTLGKKTL  220



>gb|KDP29745.1| hypothetical protein JCGZ_18680 [Jatropha curcas]
Length=246

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 73/103 (71%), Gaps = 2/103 (2%)
 Frame = +1

Query  28   PLQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELA  207
            P QRPLALPS SG   RE+ E++            GGGS  KRFRTKFT+ QKE+M+ LA
Sbjct  145  PQQRPLALPSTSGGQSREDQEDVSNPSGGGF--GSGGGSSRKRFRTKFTQDQKERMLSLA  202

Query  208  ERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            ERLGWRIQK  E  V+QFC E GV+RHV KVWMHNNKHT+ KK
Sbjct  203  ERLGWRIQKHDEAVVQQFCNETGVKRHVLKVWMHNNKHTLGKK  245



>ref|XP_006426297.1| hypothetical protein CICLE_v10027024mg [Citrus clementina]
 ref|XP_006466284.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Citrus sinensis]
 gb|ESR39537.1| hypothetical protein CICLE_v10027024mg [Citrus clementina]
 gb|KDO60627.1| hypothetical protein CISIN_1g026161mg [Citrus sinensis]
Length=242

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 71/104 (68%), Gaps = 7/104 (7%)
 Frame = +1

Query  25   APLQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVEL  204
            A   RPLALPS SG  +  E +E          N GG G   KRFRTKFT  QK++M+EL
Sbjct  145  AAHHRPLALPSTSGGGHSREDQEDAS-------NLGGSGGSRKRFRTKFTPEQKDRMLEL  197

Query  205  AERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            AE+LGWRIQK  EE V+QFC + GV+RHV KVWMHNNKHT+ KK
Sbjct  198  AEKLGWRIQKHDEEVVQQFCNDTGVKRHVLKVWMHNNKHTLGKK  241



>ref|XP_009769511.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X2 
[Nicotiana sylvestris]
Length=241

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 72/104 (69%), Gaps = 5/104 (5%)
 Frame = +1

Query  25   APLQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVEL  204
            AP QRPLALPS SG          +   D +  N+ GG    KRFRTKF++ QKEKM EL
Sbjct  142  APQQRPLALPSTSGGG-----GYWEDQEDMSNLNNSGGSGSKKRFRTKFSQEQKEKMQEL  196

Query  205  AERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            A++LGWRIQ+E EE V+Q C E GVRR VFKVWMHNNK+T+ KK
Sbjct  197  ADKLGWRIQREDEELVQQLCNETGVRRQVFKVWMHNNKNTLGKK  240



>ref|XP_009769508.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X1 
[Nicotiana sylvestris]
Length=242

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 72/104 (69%), Gaps = 4/104 (4%)
 Frame = +1

Query  25   APLQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVEL  204
            AP QRPLALPS SG          D +  +   NSG G    KRFRTKF++ QKEKM EL
Sbjct  142  APQQRPLALPSTSGGG----GYWEDQEDMSNLNNSGAGSGSKKRFRTKFSQEQKEKMQEL  197

Query  205  AERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            A++LGWRIQ+E EE V+Q C E GVRR VFKVWMHNNK+T+ KK
Sbjct  198  ADKLGWRIQREDEELVQQLCNETGVRRQVFKVWMHNNKNTLGKK  241



>gb|KHG22175.1| hypothetical protein F383_07505 [Gossypium arboreum]
Length=251

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 68/104 (65%), Gaps = 9/104 (9%)
 Frame = +1

Query  25   APLQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVEL  204
            A  QRPLALPS SG       ++ D     ++          KRFRTKFT+ QKEKM+ L
Sbjct  144  AGQQRPLALPSTSGGGGHSREDQEDASNQGSS---------RKRFRTKFTQEQKEKMLSL  194

Query  205  AERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            AERLGWRIQK  EE V+QFC E GV+R V KVWMHNNKHT+A K
Sbjct  195  AERLGWRIQKHDEEIVQQFCNETGVKRQVLKVWMHNNKHTLALK  238



>ref|XP_009596949.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X2 
[Nicotiana tomentosiformis]
Length=227

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 74/107 (69%), Gaps = 11/107 (10%)
 Frame = +1

Query  28   PLQRPLALPSISGSA--YReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVE  201
            P QRPLALPS SG    YRE+ EEL    ++ T          KRFRT+F + QKEKM+E
Sbjct  124  PPQRPLALPSTSGGGGGYREDQEELCNPNNSVT---------KKRFRTRFNQEQKEKMLE  174

Query  202  LAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKKTL  342
            LAE+LGWRIQ++ E  V+Q C E  ++RHVFKVWMHNNK T+ KKTL
Sbjct  175  LAEKLGWRIQRQDEGVVQQLCNEICIKRHVFKVWMHNNKLTLGKKTL  221



>ref|XP_010266504.1| PREDICTED: zinc-finger homeodomain protein 1-like [Nelumbo nucifera]
Length=226

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 65/102 (64%), Gaps = 5/102 (5%)
 Frame = +1

Query  25   APLQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVEL  204
            AP  RPLALPS SG       ++ D+   +             RFRTKFT+ QK+KM+  
Sbjct  123  APHHRPLALPSTSGGGAHSREDQEDVSNPSGGGGVSKK-----RFRTKFTQEQKDKMLAF  177

Query  205  AERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVA  330
            AERLGWRIQK  E AV+QFC E  V+RHV KVWMHNNKHT+A
Sbjct  178  AERLGWRIQKHDEAAVQQFCTETCVKRHVLKVWMHNNKHTLA  219



>ref|XP_010060081.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X2 
[Eucalyptus grandis]
 gb|KCW66609.1| hypothetical protein EUGRSUZ_F00403 [Eucalyptus grandis]
Length=330

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = +1

Query  34   QRPLALPSISGSAY-ReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAE  210
             RPLALP+ SG  + REE+E++     +     GGG    KRFRTKFT  QKEKM+  AE
Sbjct  228  HRPLALPAASGGGHSREELEDMSNPSSSGGGGGGGGSGLKKRFRTKFTPEQKEKMLGFAE  287

Query  211  RLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            RLGWRIQK  E AVEQFC E GV+RHV KVWMHNNKHT+ KK
Sbjct  288  RLGWRIQKHDETAVEQFCAETGVKRHVLKVWMHNNKHTLGKK  329



>ref|XP_010272957.1| PREDICTED: zinc-finger homeodomain protein 1-like [Nelumbo nucifera]
Length=225

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 72/104 (69%), Gaps = 2/104 (2%)
 Frame = +1

Query  25   APLQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVEL  204
            AP  RPLALPS SG          D + D + P+ GGG SK  RFRTKFT+ QK+KM+  
Sbjct  123  APHHRPLALPSTSGGG-GGAQSREDQEDDVSNPSGGGGSSKK-RFRTKFTQEQKDKMLAF  180

Query  205  AERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            AE+LGWRIQK  E AV+QFC E  V+RHV KVWMHNNKHT+ KK
Sbjct  181  AEKLGWRIQKHDEAAVQQFCTETCVKRHVLKVWMHNNKHTLGKK  224



>ref|XP_003635057.1| PREDICTED: zinc-finger homeodomain protein 2-like [Vitis vinifera]
Length=244

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 65/105 (62%), Gaps = 5/105 (5%)
 Frame = +1

Query  25   APLQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVEL  204
            A   RPLALPS SG            D      N  G GS  KRFRTKFT+ QK+KM  L
Sbjct  128  AAHHRPLALPSTSGGG-----GTHSRDDQEDVSNPSGAGSSKKRFRTKFTQEQKDKMFGL  182

Query  205  AERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKKT  339
            AERLGWRIQK  E  V+QFC E GV+RHV KVWMHNNKHT+   T
Sbjct  183  AERLGWRIQKHDEAVVQQFCSETGVKRHVLKVWMHNNKHTLGLPT  227



>ref|XP_009802157.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X1 
[Nicotiana sylvestris]
Length=238

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 74/109 (68%), Gaps = 13/109 (12%)
 Frame = +1

Query  28   PLQRPLALPSISGSA----YReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKM  195
            P QRPLALPS SG      YRE+ EE+    ++ T          KRFRT+F + QKEKM
Sbjct  124  PPQRPLALPSTSGGGGGGGYREDQEEMCNPNNSGT---------KKRFRTRFNQEQKEKM  174

Query  196  VELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKKTL  342
            +ELAE LGWRIQ++ E  V+Q C E G++RHVFKVWMHNNK T+ KKTL
Sbjct  175  LELAENLGWRIQRQDEGVVQQLCNEIGIKRHVFKVWMHNNKLTLGKKTL  223



>ref|XP_009772007.1| PREDICTED: zinc-finger homeodomain protein 2-like [Nicotiana 
sylvestris]
Length=228

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 72/102 (71%), Gaps = 6/102 (6%)
 Frame = +1

Query  31   LQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAE  210
            LQRPLALPS+S        E+++  +   T + GGG    KRFRTKFT+ QKEKM   AE
Sbjct  132  LQRPLALPSVS------SREDIEDYVSNPTSSGGGGSGSRKRFRTKFTQDQKEKMFAFAE  185

Query  211  RLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
             LGWRIQKE++ AV+QFC E  +RR VFKVWMHNNKHT+ KK
Sbjct  186  GLGWRIQKENDAAVQQFCAETNIRRQVFKVWMHNNKHTLGKK  227



>ref|XP_009624224.1| PREDICTED: zinc-finger homeodomain protein 2-like [Nicotiana 
tomentosiformis]
Length=226

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 70/101 (69%), Gaps = 8/101 (8%)
 Frame = +1

Query  34   QRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAER  213
            QRPLALPSIS           D++   + P+S GG    KRFRTKFT+ QKEKM   AE 
Sbjct  133  QRPLALPSIS--------SREDIEEYVSNPSSSGGSGSRKRFRTKFTQDQKEKMFAFAEG  184

Query  214  LGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            LGWRIQKE+E AV+QFC E  +RR VFKVWMHNNK+T+ KK
Sbjct  185  LGWRIQKENEAAVQQFCAETNIRRQVFKVWMHNNKNTLGKK  225



>ref|XP_004143449.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
 ref|XP_004160918.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
 gb|KGN48718.1| Zinc finger homeodomain protein 1 [Cucumis sativus]
Length=248

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = +1

Query  25   APLQRPLALPSISGSA-YReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVE  201
            AP  RPLALPS SG        E+ D+   +     G      KRFRTKFT+ QK++M+ 
Sbjct  143  APHHRPLALPSTSGGGGTHSREEQEDMSNPSGGGGGGSSSFGKKRFRTKFTQEQKDRMLG  202

Query  202  LAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            LAE LGWRIQK  E  V+QFC + GV+RHV KVWMHNNKHT+ KK
Sbjct  203  LAETLGWRIQKHDEAVVQQFCNDTGVKRHVLKVWMHNNKHTLGKK  247



>ref|XP_008440565.1| PREDICTED: zinc-finger homeodomain protein 1-like [Cucumis melo]
Length=248

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = +1

Query  25   APLQRPLALPSISGSA-YReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVE  201
            AP  RPLALPS SG        E+ D+   +     G      KRFRTKFT+ QK++M+ 
Sbjct  143  APHHRPLALPSTSGGGGTHSREEQEDMSNPSGGGGGGSSSFGKKRFRTKFTQEQKDRMLG  202

Query  202  LAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            LAE LGWRIQK  E  V+QFC + GV+RHV KVWMHNNKHT+ KK
Sbjct  203  LAETLGWRIQKHDEAVVQQFCNDTGVKRHVLKVWMHNNKHTLGKK  247



>ref|XP_007205692.1| hypothetical protein PRUPE_ppa009712mg [Prunus persica]
 gb|EMJ06891.1| hypothetical protein PRUPE_ppa009712mg [Prunus persica]
Length=281

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 71/119 (60%), Gaps = 16/119 (13%)
 Frame = +1

Query  25   APLQRPLALPSISGSAYReemeeldldmdTATPNsg---------------gggskgkRF  159
            AP  RPLALPS SG          + + D + P+ G                  S  KRF
Sbjct  163  APHHRPLALPSTSGGG-GTHSRGEEQEDDVSNPSGGGGGGGDLGMGGGLHGTASSGKKRF  221

Query  160  RTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            RTKFT  QKE+M+ LAE LGWRIQK+ E A++QFC E GV+RHV KVWMHNNKHT+ KK
Sbjct  222  RTKFTAEQKERMLTLAETLGWRIQKQDEPAIQQFCNETGVKRHVLKVWMHNNKHTLGKK  280



>ref|XP_006338094.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Solanum tuberosum]
Length=240

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 70/103 (68%), Gaps = 4/103 (4%)
 Frame = +1

Query  28   PLQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELA  207
            P QRPLALPS S    R++ +  +         SGG G   KRFRTKFT  QK+KM+  A
Sbjct  141  PHQRPLALPSTS----RDDEDMSNPSSSGGGGGSGGVGGSRKRFRTKFTGDQKDKMLAFA  196

Query  208  ERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            ERLGWR+QK+ E  V+QFC E  ++RHVFKVWMHNNKHT+ KK
Sbjct  197  ERLGWRMQKQDEALVQQFCAETNIKRHVFKVWMHNNKHTLGKK  239



>ref|XP_010060080.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X1 
[Eucalyptus grandis]
Length=348

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = +1

Query  34   QRPLALPSISGSAY-ReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAE  210
             RPLALP+ SG  + REE+E++     +     GGG    KRFRTKFT  QKEKM+  AE
Sbjct  228  HRPLALPAASGGGHSREELEDMSNPSSSGGGGGGGGSGLKKRFRTKFTPEQKEKMLGFAE  287

Query  211  RLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTV  327
            RLGWRIQK  E AVEQFC E GV+RHV KVWMHNNKHT+
Sbjct  288  RLGWRIQKHDETAVEQFCAETGVKRHVLKVWMHNNKHTL  326



>ref|XP_009758154.1| PREDICTED: zinc-finger homeodomain protein 2-like [Nicotiana 
sylvestris]
Length=254

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 71/103 (69%), Gaps = 4/103 (4%)
 Frame = +1

Query  28   PLQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELA  207
            P QRPLALPS S    RE+ +  +        + G GGS  KRFRTKFT  QK+KM+  A
Sbjct  155  PHQRPLALPSTS----REDEDMSNPSSSGGGGSGGVGGSSRKRFRTKFTADQKDKMLAFA  210

Query  208  ERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            ERLGWR+QK+ E  V+QFC E  V+RHVFKVWMHNNKHT+ KK
Sbjct  211  ERLGWRMQKQDEALVQQFCAETNVQRHVFKVWMHNNKHTLGKK  253



>ref|XP_009596948.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X1 
[Nicotiana tomentosiformis]
Length=229

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 74/109 (68%), Gaps = 13/109 (12%)
 Frame = +1

Query  28   PLQRPLALPSISGSA----YReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKM  195
            P QRPLALPS SG      YRE+ EEL    ++ T          KRFRT+F + QKEKM
Sbjct  124  PPQRPLALPSTSGGGGGGGYREDQEELCNPNNSVT---------KKRFRTRFNQEQKEKM  174

Query  196  VELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKKTL  342
            +ELAE+LGWRIQ++ E  V+Q C E  ++RHVFKVWMHNNK T+ KKTL
Sbjct  175  LELAEKLGWRIQRQDEGVVQQLCNEICIKRHVFKVWMHNNKLTLGKKTL  223



>ref|XP_007158386.1| hypothetical protein PHAVU_002G148900g [Phaseolus vulgaris]
 gb|ESW30380.1| hypothetical protein PHAVU_002G148900g [Phaseolus vulgaris]
Length=236

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 69/98 (70%), Gaps = 3/98 (3%)
 Frame = +1

Query  43   LALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAERLGW  222
            LALPS SG          +   D + P++GG GSK  RFRTKFT+ QK+KM+ELAE+LGW
Sbjct  141  LALPSTSGGG--GTQSTREDQEDVSNPSAGGTGSKK-RFRTKFTQEQKDKMLELAEKLGW  197

Query  223  RIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            RIQK  E  V+ FC E GV+RHV KVWMHNNKHT+ KK
Sbjct  198  RIQKHDEGVVQAFCNETGVKRHVLKVWMHNNKHTLGKK  235



>ref|XP_008235400.1| PREDICTED: zinc-finger homeodomain protein 1-like [Prunus mume]
Length=159

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 70/122 (57%), Gaps = 16/122 (13%)
 Frame = +1

Query  25   APLQRPLALPSISGSAYReemeeldldmdTATPNsg---------------gggskgkRF  159
            AP  RPLALPS SG          + + D + P+ G                  S  KRF
Sbjct  35   APHHRPLALPSTSGGG-GTHSRGEEQEDDMSNPSGGGGGGGDLGMGGGLHGTASSGKKRF  93

Query  160  RTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKKT  339
            RTKFT  QKE+M+ LAE LGWRIQK+ E A++QFC E GV+RHV KVWMHNNKHT+    
Sbjct  94   RTKFTAEQKERMLTLAETLGWRIQKQDEPAIQQFCNETGVKRHVLKVWMHNNKHTLGPSN  153

Query  340  LE  345
             E
Sbjct  154  DE  155



>ref|XP_006433874.1| hypothetical protein CICLE_v10002355mg [Citrus clementina]
 ref|XP_006472516.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Citrus sinensis]
 gb|ESR47114.1| hypothetical protein CICLE_v10002355mg [Citrus clementina]
 gb|KDO81100.1| hypothetical protein CISIN_1g043261mg [Citrus sinensis]
Length=233

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 67/100 (67%), Gaps = 4/100 (4%)
 Frame = +1

Query  37   RPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAERL  216
            RPLALPS S   Y       + D+   + + GG G   KR RTKFT  QKEKM+  AE+L
Sbjct  137  RPLALPSSSAGGY----SREEEDVSNPSSSGGGSGGTKKRHRTKFTAEQKEKMLGFAEQL  192

Query  217  GWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            GWRIQK  E +VEQFC E GV+RHV KVWMHNNKHT+ KK
Sbjct  193  GWRIQKHDEASVEQFCAETGVKRHVLKVWMHNNKHTLGKK  232



>gb|EYU34567.1| hypothetical protein MIMGU_mgv1a012253mg [Erythranthe guttata]
Length=256

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QK+KM+  AERLGWRIQK+ EE V+QFC E G++RHV KVWMHNNKHT+ K
Sbjct  195  RFRTKFTAEQKDKMLNFAERLGWRIQKQEEEMVQQFCGEMGIKRHVLKVWMHNNKHTLGK  254

Query  334  KT  339
            KT
Sbjct  255  KT  256



>emb|CDP01539.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 71/102 (70%), Gaps = 2/102 (2%)
 Frame = +1

Query  37   RPLALPSISGSAYReemeeldldmdTATPNsggggsk--gkRFRTKFTEVQKEKMVELAE  210
            RPLALPSISG    E+M  ++      +   GGG      KRFRTKF++ QKEKM +LAE
Sbjct  150  RPLALPSISGGGEHEDMSNMNTSGGGGSGGGGGGFVGSSKKRFRTKFSQEQKEKMSDLAE  209

Query  211  RLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            +LGW+IQK+ EE V+Q C E G++R V KVWMHNNKHT+ KK
Sbjct  210  KLGWKIQKQDEEVVQQLCNELGIKRQVLKVWMHNNKHTLGKK  251



>ref|XP_008338536.1| PREDICTED: LOW QUALITY PROTEIN: zinc-finger homeodomain protein 
1-like [Malus domestica]
Length=278

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QKE+M+ LAERLGWRIQK+ E AV+QFC E GV+RHV KVWMHNNKHT+ K
Sbjct  217  RFRTKFSQEQKERMLSLAERLGWRIQKQDEPAVQQFCNETGVKRHVLKVWMHNNKHTLGK  276

Query  334  K  336
            K
Sbjct  277  K  277



>ref|XP_004299701.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Fragaria vesca 
subsp. vesca]
Length=254

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 70/103 (68%), Gaps = 2/103 (2%)
 Frame = +1

Query  34   QRPLALPSISGS--AYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELA  207
            QRPLALP+ +GS  ++  E  +   +  ++     G G   KRFRTKFT  QKEKMVE A
Sbjct  151  QRPLALPAAAGSGGSHSREELDDVSNPSSSGGGGSGVGLLRKRFRTKFTAEQKEKMVEFA  210

Query  208  ERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            E++GWRIQK  E AVE+FC   GV+R V KVWMHNNKHT+ KK
Sbjct  211  EKVGWRIQKHDEAAVEEFCAVTGVKRQVLKVWMHNNKHTIGKK  253



>gb|EEE69868.1| hypothetical protein OsJ_29679 [Oryza sativa Japonica Group]
Length=247

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 68/111 (61%), Gaps = 10/111 (9%)
 Frame = +1

Query  34   QRPLALPSISGSAYReemeeldldmdTATPNsggggsk----------gkRFRTKFTEVQ  183
            QRPLALPS S S   +  +   +    +      G S            KRFRTKFT+ Q
Sbjct  135  QRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQ  194

Query  184  KEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            K+KM+  AER+GWRIQK  E AV+QFC E GV+RHV KVWMHNNKHT+ KK
Sbjct  195  KDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKK  245



>gb|ADE77597.1| unknown [Picea sitchensis]
Length=249

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM   AE+LGWRIQK  E AV+QFC+E GV+RHV KVWMHNNKHT+ K
Sbjct  188  RFRTKFTQEQKDKMCSFAEKLGWRIQKHDEAAVQQFCMELGVKRHVLKVWMHNNKHTLGK  247

Query  334  K  336
            K
Sbjct  248  K  248



>ref|XP_002285709.1| PREDICTED: zinc-finger homeodomain protein 1 [Vitis vinifera]
Length=230

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 73/106 (69%), Gaps = 2/106 (2%)
 Frame = +1

Query  25   APLQ-RPLALPSISGSA-YReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMV  198
            AP Q RPLALPS SG   +  E +E   +  ++    GG GS  KRFRTKFT+ QK+KM+
Sbjct  124  APSQYRPLALPSTSGGGGHSREDQEDVSNPSSSGGGGGGSGSLKKRFRTKFTQEQKDKML  183

Query  199  ELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
              AE LGWRIQK  E AV+QFC E  V+RHV KVWMHNNKHT+ KK
Sbjct  184  AFAETLGWRIQKHDEAAVQQFCQETCVKRHVLKVWMHNNKHTLGKK  229



>ref|XP_004288462.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Fragaria vesca 
subsp. vesca]
Length=267

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = +1

Query  34   QRPLALPSISGSAYReemeeldl---dmdTATPNsggggskgkRFRTKFTEVQKEKMVEL  204
             RPLALPS SG    ++ +++          +    G  S  KRFRTKF++ QKE+M+EL
Sbjct  163  HRPLALPSTSGGGGTDQDDDMSNPSGGGGGGSGFGMGTTSSKKRFRTKFSQEQKERMLEL  222

Query  205  AERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            AERLGWRIQK+ E AV+ FC E GV+RHV KVWMHNNKHT+ KK
Sbjct  223  AERLGWRIQKQDEAAVQSFCDETGVKRHVLKVWMHNNKHTLGKK  266



>ref|XP_009602563.1| PREDICTED: zinc-finger homeodomain protein 2-like [Nicotiana 
tomentosiformis]
Length=254

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 70/101 (69%), Gaps = 4/101 (4%)
 Frame = +1

Query  34   QRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAER  213
            QRPLALPS S    RE+ +  +        N G GGS  KRFRTKFT  QK+KM+  AER
Sbjct  157  QRPLALPSTS----REDEDMSNPSSSGGGGNGGVGGSSRKRFRTKFTADQKDKMLAFAER  212

Query  214  LGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            LGWR+QK+ E  V+QFC E  V+RHVFKVWMHNNKHT+ KK
Sbjct  213  LGWRMQKQDEALVQQFCAETNVQRHVFKVWMHNNKHTLGKK  253



>ref|XP_011100018.1| PREDICTED: zinc-finger homeodomain protein 1-like [Sesamum indicum]
Length=215

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+ LAERL W+IQK+ EE V+QFC E GV+RHV KVWMHNNKHT+ K
Sbjct  154  RFRTKFTQEQKDKMLNLAERLDWKIQKQDEELVQQFCSEVGVKRHVLKVWMHNNKHTLGK  213

Query  334  KT  339
            KT
Sbjct  214  KT  215



>gb|ADE76551.1| unknown [Picea sitchensis]
Length=283

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM   AE+LGWRIQK  + AV+QFC++ GV+RHV KVWMHNNKHT+AK
Sbjct  222  RFRTKFTQEQKDKMCAFAEKLGWRIQKHDDLAVQQFCMDVGVKRHVLKVWMHNNKHTLAK  281

Query  334  K  336
            K
Sbjct  282  K  282



>ref|NP_001063419.1| Os09g0466400 [Oryza sativa Japonica Group]
 sp|Q6YXH5.1|ZHD1_ORYSJ RecName: Full=Zinc-finger homeodomain protein 1; Short=OsZHD1 
[Oryza sativa Japonica Group]
 dbj|BAD17515.1| putative ZF-HD homeobox protein [Oryza sativa Japonica Group]
 dbj|BAF25333.1| Os09g0466400 [Oryza sativa Japonica Group]
 dbj|BAG98341.1| unnamed protein product [Oryza sativa Japonica Group]
Length=279

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 68/111 (61%), Gaps = 10/111 (9%)
 Frame = +1

Query  34   QRPLALPSISGSAYReemeeldldmdTATPNsggggsk----------gkRFRTKFTEVQ  183
            QRPLALPS S S   +  +   +    +      G S            KRFRTKFT+ Q
Sbjct  167  QRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQ  226

Query  184  KEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            K+KM+  AER+GWRIQK  E AV+QFC E GV+RHV KVWMHNNKHT+ KK
Sbjct  227  KDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKK  277



>ref|XP_010243316.1| PREDICTED: zinc-finger homeodomain protein 1-like [Nelumbo nucifera]
Length=226

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 63/102 (62%), Gaps = 5/102 (5%)
 Frame = +1

Query  25   APLQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVEL  204
            AP  RPLALPS SG       ++ D+   +             RFRTKFT  QK+ M+  
Sbjct  123  APHHRPLALPSTSGGGVHSWEDQEDVLNPSGGGEVSKK-----RFRTKFTLEQKDXMLAF  177

Query  205  AERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVA  330
            AERLGWRIQK  E A++QFC E  V+RHV KVWMHNNKHT+A
Sbjct  178  AERLGWRIQKHDEAAMQQFCTETCVKRHVLKVWMHNNKHTLA  219



>sp|A2Z259.1|ZHD1_ORYSI RecName: Full=Zinc-finger homeodomain protein 1 [Oryza sativa 
Indica Group]
 gb|EAZ09420.1| hypothetical protein OsI_31693 [Oryza sativa Indica Group]
Length=279

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 68/111 (61%), Gaps = 10/111 (9%)
 Frame = +1

Query  34   QRPLALPSISGSAYReemeeldldmdTATPNsggggsk----------gkRFRTKFTEVQ  183
            QRPLALPS S S   +  +   +    +      G S            KRFRTKFT+ Q
Sbjct  167  QRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQ  226

Query  184  KEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            K+KM+  AER+GWRIQK  E AV+QFC E GV+RHV KVWMHNNKHT+ KK
Sbjct  227  KDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKK  277



>ref|XP_004237971.1| PREDICTED: zinc-finger homeodomain protein 2 [Solanum lycopersicum]
Length=243

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 67/103 (65%), Gaps = 3/103 (3%)
 Frame = +1

Query  28   PLQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELA  207
            P QRPLALPS S     +E              SGG G   KRFRTKFT  QK+KM+  A
Sbjct  143  PHQRPLALPSTS---RDDEDMSNPSSSGGGGGGSGGVGGSRKRFRTKFTGDQKDKMLAFA  199

Query  208  ERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            ERLGWR+QK+ E  V+QFC E  V+RHVFKVWMHNNKHT+ KK
Sbjct  200  ERLGWRMQKQDEALVQQFCAETNVKRHVFKVWMHNNKHTLGKK  242



>ref|XP_006660717.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Oryza brachyantha]
Length=285

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 68/111 (61%), Gaps = 10/111 (9%)
 Frame = +1

Query  34   QRPLALPSISGSAYReemeeldldmdTATPNsggggsk----------gkRFRTKFTEVQ  183
            QRPLALPS S S   +  +   +    +      G S            KRFRTKFT+ Q
Sbjct  173  QRPLALPSTSHSGRDDVDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQ  232

Query  184  KEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            K+KM+  AER+GWRIQK  E AV+QFC E GV+RHV KVWMHNNKHT+ KK
Sbjct  233  KDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKK  283



>ref|XP_006660219.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Oryza brachyantha]
Length=290

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 69/113 (61%), Gaps = 16/113 (14%)
 Frame = +1

Query  34   QRPLALPSISGSAYReemeeldl------------dmdTATPNsggggskgkRFRTKFTE  177
            QRPLALPS S S   E  +   +             + +A P+  G      RFRTKFT+
Sbjct  181  QRPLALPSTSHSGRDEGDDMSGMVGPMVIGPMVGMSLGSAGPSGSGKK----RFRTKFTQ  236

Query  178  VQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
             QK+KM+  AERLGWRIQK  E AV+QFC E  V+RHV KVWMHNNKHT+ KK
Sbjct  237  EQKDKMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTLGKK  289



>ref|XP_008385681.1| PREDICTED: zinc-finger homeodomain protein 1-like isoform X2 
[Malus domestica]
Length=274

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QKE+M+ LAERLGWRIQK+ E AV+QFC E GV RHV KVWMHNNKHT+ K
Sbjct  213  RFRTKFSQEQKERMLSLAERLGWRIQKQDEPAVQQFCNETGVNRHVLKVWMHNNKHTLGK  272

Query  334  K  336
            K
Sbjct  273  K  273



>emb|CAN75153.1| hypothetical protein VITISV_035994 [Vitis vinifera]
Length=284

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 73/106 (69%), Gaps = 2/106 (2%)
 Frame = +1

Query  25   APLQ-RPLALPSISGSA-YReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMV  198
            AP Q RPLALPS SG   +  E +E   +  ++    GG GS  KRFRTKFT+ QK+KM+
Sbjct  178  APSQYRPLALPSTSGGGGHSREDQEDVSNPSSSGGGGGGSGSLKKRFRTKFTQEQKDKML  237

Query  199  ELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
              AE LGWRIQK  E AV+QFC E  V+RHV KVWMHNNKHT+ KK
Sbjct  238  AFAETLGWRIQKHDEAAVQQFCQETCVKRHVLKVWMHNNKHTLGKK  283



>ref|XP_003519839.2| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=295

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 65/98 (66%), Gaps = 2/98 (2%)
 Frame = +1

Query  43   LALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAERLGW  222
            LALPS SG          +   D +   S GG    KRFRTKFT  QKEKM+ELAE+LGW
Sbjct  199  LALPSTSGGG--GTQSTREDQEDISNNPSAGGTGSKKRFRTKFTVEQKEKMLELAEKLGW  256

Query  223  RIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            RIQK+ E  V+ FC E GV+RHV KVWMHNNKHT+ KK
Sbjct  257  RIQKQDEAVVQAFCNETGVKRHVLKVWMHNNKHTLGKK  294



>ref|XP_002460367.1| hypothetical protein SORBIDRAFT_02g027040 [Sorghum bicolor]
 gb|EER96888.1| hypothetical protein SORBIDRAFT_02g027040 [Sorghum bicolor]
Length=302

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AER+GWRIQK  E AV+QFC E GV+RHV KVWMHNNKHT+ K
Sbjct  241  RFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGK  300

Query  334  K  336
            K
Sbjct  301  K  301



>ref|XP_008378554.1| PREDICTED: zinc-finger homeodomain protein 2-like [Malus domestica]
Length=270

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 76/112 (68%), Gaps = 6/112 (5%)
 Frame = +1

Query  25   APLQRP-LALPSIS-----GSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQK  186
            +P  RP LALP+ S     GS  REE E++     +     GG G   KR RTKFT+ QK
Sbjct  158  SPHARPTLALPAASIGGRGGSHSREEGEDVSNPSSSGGGGGGGFGMSKKRHRTKFTQEQK  217

Query  187  EKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKKTL  342
            EKM+E AE++GWRIQK  E A+E+FC E GV+RHVFKVWMHNNKHT+ KK +
Sbjct  218  EKMLEFAEKVGWRIQKHDEAAIEEFCGETGVKRHVFKVWMHNNKHTLGKKLV  269



>ref|XP_003551238.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=250

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 68/107 (64%), Gaps = 3/107 (3%)
 Frame = +1

Query  25   APLQRPLALPSISGSAYRee---meeldldmdTATPNsggggskgkRFRTKFTEVQKEKM  195
             P    LALPS SG    +     +    D  T+   + GG S  KRFRTKFT+ QK+KM
Sbjct  143  GPQHATLALPSTSGGGGTQSPREDQGDLSDPPTSGATTHGGSSSKKRFRTKFTQQQKDKM  202

Query  196  VELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            +  AE+LGWRIQK  E  V++FC E GV+RHV KVWMHNNKHT+ KK
Sbjct  203  LAFAEKLGWRIQKHDEGVVQEFCSETGVQRHVLKVWMHNNKHTLGKK  249



>ref|XP_007018165.1| Transcription factor, putative [Theobroma cacao]
 gb|EOY15390.1| Transcription factor, putative [Theobroma cacao]
Length=254

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTV  327
            RFRTKFT  QKEKM+E AERLGWRIQK  E AVEQFC E GV+RHV KVWMHNNKHT+
Sbjct  192  RFRTKFTSEQKEKMLEFAERLGWRIQKHDEAAVEQFCEETGVKRHVLKVWMHNNKHTL  249



>ref|XP_006342245.1| PREDICTED: uncharacterized protein LOC102578167 [Solanum tuberosum]
Length=164

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++VQKEKM ELA++LGWRIQ+E EE V+Q C E G+ R VFKVWMHNNKHT+ K
Sbjct  103  RFRTKFSQVQKEKMQELADKLGWRIQREDEELVQQLCNETGITRQVFKVWMHNNKHTLGK  162

Query  334  K  336
            K
Sbjct  163  K  163



>ref|XP_003576623.1| PREDICTED: zinc-finger homeodomain protein 1 [Brachypodium distachyon]
Length=290

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK++M+  AER+GWRIQK  E AV+QFC E GV+RHV KVWMHNNKHT+ K
Sbjct  227  RFRTKFTQEQKDRMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGK  286

Query  334  K  336
            K
Sbjct  287  K  287



>ref|XP_011010389.1| PREDICTED: zinc-finger homeodomain protein 2-like [Populus euphratica]
Length=259

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 69/99 (70%), Gaps = 2/99 (2%)
 Frame = +1

Query  37   RPLALPSISGSA--YReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAE  210
            RPLALP+ SG    Y  E E++     +     GGG S  KRFRTKF++ QKEKM+  AE
Sbjct  157  RPLALPAASGGGGGYSREEEDVSNPSSSGGGGGGGGSSSKKRFRTKFSQEQKEKMLAFAE  216

Query  211  RLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTV  327
            RLGWRIQK  E AVEQFC E G++RHV KVWMHNNKHT+
Sbjct  217  RLGWRIQKHDEAAVEQFCAENGLKRHVLKVWMHNNKHTI  255



>gb|EMT05330.1| ZF-HD homeobox protein [Aegilops tauschii]
Length=84

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AER+GWRIQK  E AV QFC E GV+RHV KVWMHNNKHT+ K
Sbjct  20   RFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVLQFCDEVGVKRHVLKVWMHNNKHTLGK  79

Query  334  K  336
            K
Sbjct  80   K  80



>ref|XP_007047820.1| ZF-HD homeobox protein, putative [Theobroma cacao]
 gb|EOX91977.1| ZF-HD homeobox protein, putative [Theobroma cacao]
Length=259

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 64/98 (65%), Gaps = 8/98 (8%)
 Frame = +1

Query  34   QRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAER  213
            QRPLALPS SG       ++ +   +  +          KRFRTKFT+ QK+KM+ LAE 
Sbjct  145  QRPLALPSTSGGGGGHSRDDQEDVSNQGS--------SRKRFRTKFTQEQKDKMLGLAES  196

Query  214  LGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTV  327
            LGWRIQK  E  V+QFC E GV+RHV KVWMHNNKHT+
Sbjct  197  LGWRIQKHDEAVVQQFCNENGVKRHVLKVWMHNNKHTL  234



>ref|XP_003574645.1| PREDICTED: zinc-finger homeodomain protein 1-like [Brachypodium 
distachyon]
Length=304

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QKE+M   A+RLGWRIQK  E AV+QFC E GV+RHV KVWMHNNKHT+ K
Sbjct  241  RFRTKFSQEQKERMQAFADRLGWRIQKHDEAAVQQFCEEVGVKRHVLKVWMHNNKHTLGK  300

Query  334  KTL  342
            K L
Sbjct  301  KPL  303



>ref|XP_004957068.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Setaria italica]
Length=281

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK++M+  AER+GWRIQK  E AV+QFC E GV+RHV KVWMHNNKHT+ K
Sbjct  220  RFRTKFTQEQKDRMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGK  279

Query  334  K  336
            K
Sbjct  280  K  280



>ref|XP_009393647.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=281

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 64/103 (62%), Gaps = 4/103 (4%)
 Frame = +1

Query  40   PLALPSISGSAYReemeeldldmdT----ATPNsggggskgkRFRTKFTEVQKEKMVELA  207
            PLALPS SG       +  D+   T           G    KRFRTKFT+ QKEKM+  A
Sbjct  178  PLALPSTSGVGGHSREDHDDVSNPTMGGGGGGTRASGSGVRKRFRTKFTQEQKEKMLAFA  237

Query  208  ERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            ERLGWRIQK  E AV+QFC E  ++RHV KVWMHNNKHT+ KK
Sbjct  238  ERLGWRIQKHDEAAVQQFCEETCIKRHVLKVWMHNNKHTLGKK  280



>ref|XP_004489767.1| PREDICTED: ZF-HD homeobox protein At5g65410-like [Cicer arietinum]
Length=259

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 67/98 (68%), Gaps = 0/98 (0%)
 Frame = +1

Query  43   LALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAERLGW  222
            LALPS SG       +    D +  T    GGGS  KR RTKFT+ QK+KM+ELAE+LGW
Sbjct  161  LALPSTSGGGGDGGTQSPREDQEDVTNPPSGGGSSKKRHRTKFTQEQKDKMLELAEKLGW  220

Query  223  RIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            RIQK  E  V++FC E GV+RHV KVWMHNNKHT+ KK
Sbjct  221  RIQKHDEGLVQEFCNESGVKRHVLKVWMHNNKHTLGKK  258



>ref|XP_010939727.1| PREDICTED: zinc-finger homeodomain protein 2 [Elaeis guineensis]
Length=281

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 68/106 (64%), Gaps = 7/106 (7%)
 Frame = +1

Query  40   PLALPSISGSAYReemeeldldm-------dTATPNsggggskgkRFRTKFTEVQKEKMV  198
            PLALPS SG       ++ D+            +   G  GS  KRFRTKFT+ QK+KM+
Sbjct  175  PLALPSTSGGGGHSRDDQEDISNPMIGGGGIGVSGGGGASGSGKKRFRTKFTQEQKDKML  234

Query  199  ELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
              AER+GWRIQK  E AV+QFC E G++RHV KVWMHNNKHT+ KK
Sbjct  235  AFAERVGWRIQKHDEAAVQQFCNEAGIKRHVLKVWMHNNKHTLGKK  280



>ref|XP_002302329.1| hypothetical protein POPTR_0002s10330g [Populus trichocarpa]
 gb|EEE81602.1| hypothetical protein POPTR_0002s10330g [Populus trichocarpa]
Length=262

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 69/109 (63%), Gaps = 6/109 (6%)
 Frame = +1

Query  28   PLQRPLALPSISGSAYReemeeldldmdTATPNsggggsk------gkRFRTKFTEVQKE  189
            P  RPLALP+ SG            + D + P+S GGG         KR RTKFT+ QKE
Sbjct  153  PQSRPLALPAASGGGAAAAAGYSREEEDVSNPSSSGGGGGGGGSSSKKRHRTKFTQEQKE  212

Query  190  KMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            KM+  AE LGWRIQK  E AVEQFC E GV+RHV KVWMHNNKHT+ KK
Sbjct  213  KMLAFAESLGWRIQKHDEAAVEQFCAETGVKRHVLKVWMHNNKHTLGKK  261



>ref|XP_010098663.1| hypothetical protein L484_026038 [Morus notabilis]
 gb|EXB75566.1| hypothetical protein L484_026038 [Morus notabilis]
Length=258

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 65/101 (64%), Gaps = 1/101 (1%)
 Frame = +1

Query  37   RPLALPSISGSAYReemeeldl-dmdTATPNsggggskgkRFRTKFTEVQKEKMVELAER  213
            RPLALP + G    E  + +            GGG S  KRFRTKFT+ QKEKM+  AE 
Sbjct  157  RPLALPGVCGGGREEGEDHMSNPSSSGGGGGGGGGSSSKKRFRTKFTQEQKEKMLAFAES  216

Query  214  LGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            +GWRIQK  E AVEQFC E GVRR V KVWMHNNKHT+ KK
Sbjct  217  VGWRIQKHDEAAVEQFCAETGVRRPVLKVWMHNNKHTLGKK  257



>ref|XP_011097503.1| PREDICTED: zinc-finger homeodomain protein 2-like [Sesamum indicum]
Length=249

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AERLGW+IQK+ EE V+QFC E G++RHV KVWMHNNKHT+  
Sbjct  186  RFRTKFTQEQKDKMLNFAERLGWKIQKQDEEMVQQFCSELGIKRHVLKVWMHNNKHTLGG  245

Query  334  KT  339
            ++
Sbjct  246  ES  247



>gb|EPS61017.1| hypothetical protein M569_13783, partial [Genlisea aurea]
Length=244

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  +ERLGWRIQK+ EE V+QFC E G++RHV KVWMHNNKHT+ +
Sbjct  184  RFRTKFTQEQKDKMLNFSERLGWRIQKQDEELVQQFCHEVGIKRHVLKVWMHNNKHTLGE  243

Query  334  K  336
            K
Sbjct  244  K  244



>gb|ABY61018.1| zinc finger-homeodomain protein 1 [Welwitschia mirabilis]
Length=316

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  157  FRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            FRTKFT  QKEKM   A+RLGWRIQK+ E AV+QFC E GV+RHV KVWMHNNKHT+ KK
Sbjct  256  FRTKFTAEQKEKMQNFADRLGWRIQKQDESAVQQFCNEVGVKRHVLKVWMHNNKHTLGKK  315

Query  337  T  339
            +
Sbjct  316  S  316



>gb|ABY61020.1| zinc finger-homeodomain protein 1 [Eschscholzia californica]
Length=267

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AERLGWRIQK  EE V+QFC E GVRR V KVWMHNNKHT+ K
Sbjct  206  RFRTKFTQEQKDKMIVFAERLGWRIQKHDEEIVQQFCNETGVRRQVLKVWMHNNKHTLGK  265

Query  334  K  336
            K
Sbjct  266  K  266



>ref|XP_001785616.1| predicted protein [Physcomitrella patens]
 gb|EDQ49563.1| predicted protein [Physcomitrella patens]
Length=315

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QK+KM   AE+LGWRIQK  E AV++FC   GV+RHV KVWMHNNKHTV K
Sbjct  254  RFRTKFTTEQKDKMCAFAEKLGWRIQKHDEAAVQEFCTTVGVKRHVLKVWMHNNKHTVGK  313

Query  334  K  336
            K
Sbjct  314  K  314



>ref|XP_010321484.1| PREDICTED: zinc-finger homeodomain protein 1-like [Solanum lycopersicum]
Length=167

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 71/106 (67%), Gaps = 6/106 (6%)
 Frame = +1

Query  28   PLQRPLALPSIS-GSAYReemeeldldmdTATPNsgg-ggskgkRFRTKFTEVQKEKMVE  201
            P +R L LPS S G  +RE+ E L+       PN    G    KRFRTKF++  K+KM+ 
Sbjct  64   PRRRSLVLPSTSRGGGFREDQELLE----MCNPNKNIIGTLLKKRFRTKFSQEHKDKMLR  119

Query  202  LAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKKT  339
            LAE+LGW++Q+  E  V+Q C E G++RHVFKVW+HNNKHT+ KKT
Sbjct  120  LAEKLGWKLQRHDEGVVQQLCNEIGIKRHVFKVWLHNNKHTLGKKT  165



>ref|NP_001062055.1| Os08g0479400 [Oryza sativa Japonica Group]
 sp|Q6ZB90.1|ZHD2_ORYSJ RecName: Full=Zinc-finger homeodomain protein 2; Short=OsZHD2 
[Oryza sativa Japonica Group]
 sp|A2YWA6.1|ZHD2_ORYSI RecName: Full=Zinc-finger homeodomain protein 2 [Oryza sativa 
Indica Group]
 dbj|BAD09750.1| putative ZF-HD homeobox protein [Oryza sativa Japonica Group]
 dbj|BAF23969.1| Os08g0479400 [Oryza sativa Japonica Group]
 gb|EAZ07367.1| hypothetical protein OsI_29618 [Oryza sativa Indica Group]
 dbj|BAG98791.1| unnamed protein product [Oryza sativa Japonica Group]
Length=290

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AERLGWRIQK  E AV+QFC E  V+RHV KVWMHNNKHT+ K
Sbjct  228  RFRTKFTQEQKDKMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTLGK  287

Query  334  KT  339
            K 
Sbjct  288  KA  289



>ref|XP_007136351.1| hypothetical protein PHAVU_009G037900g [Phaseolus vulgaris]
 gb|ESW08345.1| hypothetical protein PHAVU_009G037900g [Phaseolus vulgaris]
Length=305

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 67/102 (66%), Gaps = 2/102 (2%)
 Frame = +1

Query  34   QRPLALPSI-SGSAY-ReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELA  207
             RPLALP + SG  + REE +  +          G G    KRFRTKFT+ QK+KM+  A
Sbjct  175  HRPLALPPLASGGVFSREEEDMSNPSSSGGGFGGGSGSGTKKRFRTKFTQEQKDKMLAFA  234

Query  208  ERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            E+LGWRIQK  E AVEQFC E  V+RHV KVWMHNNKHT+A 
Sbjct  235  EKLGWRIQKHDEAAVEQFCAETCVKRHVLKVWMHNNKHTLAN  276



>emb|CDY03431.1| BnaC01g16510D [Brassica napus]
Length=223

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = +1

Query  43   LALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAERLGW  222
            L  P+ +G  YR      + D  T+ P+S GG     RFRTKFT  QKEKM+  AERLGW
Sbjct  128  LTSPAAAGQPYRPPASGDEED--TSNPSSSGGTRAK-RFRTKFTAEQKEKMLAFAERLGW  184

Query  223  RIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            RIQK  + AVEQFC E GVRR V K+WMHNNK+++ KK
Sbjct  185  RIQKHDDAAVEQFCAETGVRRQVLKIWMHNNKNSLGKK  222



>ref|XP_009410127.1| PREDICTED: zinc-finger homeodomain protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=271

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 65/101 (64%), Gaps = 2/101 (2%)
 Frame = +1

Query  40   PLALPSISGSAYReemeeldl--dmdTATPNsggggskgkRFRTKFTEVQKEKMVELAER  213
            PLALPS SG   R+E E++               G    KRFRTKFT  QK+KM+  AER
Sbjct  170  PLALPSTSGGHSRDEQEDVSNPMMGGGGGGMVASGSGSRKRFRTKFTPEQKDKMLAFAER  229

Query  214  LGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            LGWRIQK  E AV++FC E  V+RHV KVWMHNNKHT+ KK
Sbjct  230  LGWRIQKHDEAAVQEFCEESCVKRHVLKVWMHNNKHTLGKK  270



>gb|ABY61023.1| zinc finger homeodomain protein 1 [Saruma henryi]
Length=242

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AER+GWRIQK+ E  V+QFC+E  V+RHV KVWMHNNKHT+ K
Sbjct  181  RFRTKFTQEQKDKMLGFAERVGWRIQKQDEAVVQQFCMETNVKRHVLKVWMHNNKHTLGK  240

Query  334  K  336
            K
Sbjct  241  K  241



>ref|XP_009381483.1| PREDICTED: zinc-finger homeodomain protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=281

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 69/105 (66%), Gaps = 6/105 (6%)
 Frame = +1

Query  40   PLALPSISGSAYReemeeldldmdTATPNsggggskg------kRFRTKFTEVQKEKMVE  201
            PLALPS SG   +   E+ D+   T    + GGG         KRFRTKFT+ QK+KM+ 
Sbjct  176  PLALPSTSGGGAQSREEQEDMSNPTMGGGASGGGMAASGSGARKRFRTKFTQEQKDKMLA  235

Query  202  LAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
             AERLGWRIQK  E AV+QFC E  ++RHV KVWMHNNK+T+ KK
Sbjct  236  FAERLGWRIQKHDEAAVQQFCEETCIKRHVLKVWMHNNKNTLGKK  280



>gb|KDP41452.1| hypothetical protein JCGZ_15859 [Jatropha curcas]
Length=329

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVA  330
            RFRTKFT+ QK+KM++ AERLGWRIQK  E AVEQFC E GV+RHV KVWMHNNKHT+ 
Sbjct  207  RFRTKFTQEQKDKMLDFAERLGWRIQKHDEVAVEQFCGENGVKRHVLKVWMHNNKHTLG  265



>ref|XP_008385682.1| PREDICTED: zinc-finger homeodomain protein 1-like isoform X3 
[Malus domestica]
Length=271

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTV  327
            RFRTKF++ QKE+M+ LAERLGWRIQK+ E AV+QFC E GV RHV KVWMHNNKHT+
Sbjct  213  RFRTKFSQEQKERMLSLAERLGWRIQKQDEPAVQQFCNETGVNRHVLKVWMHNNKHTL  270



>gb|KHN07994.1| ZF-HD homeobox protein [Glycine soja]
Length=214

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 67/101 (66%), Gaps = 3/101 (3%)
 Frame = +1

Query  43   LALPSISGSAYRe---emeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAER  213
            LA PS+SG    +   E  E       AT + G G S  KRFRTKFT+ QK+KM+  AE+
Sbjct  113  LAHPSLSGGGGPQPPLEDLEDSDPTSGATTHDGSGSSSKKRFRTKFTQHQKDKMLVFAEK  172

Query  214  LGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            LGWR+QK  +  V++FC E GV+RHV KVWMHNNKHT+ KK
Sbjct  173  LGWRMQKNDDSVVQEFCSEIGVQRHVLKVWMHNNKHTLGKK  213



>ref|XP_006581501.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform X2 [Glycine 
max]
Length=275

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AE+LGWRIQK  E AVEQFC E  ++RHV KVWMHNNKHT+ K
Sbjct  214  RFRTKFTQEQKDKMLAFAEKLGWRIQKHDEAAVEQFCAETCIKRHVLKVWMHNNKHTLGK  273

Query  334  K  336
            K
Sbjct  274  K  274



>ref|XP_010433740.1| PREDICTED: zinc-finger homeodomain protein 2-like [Camelina sativa]
Length=225

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +1

Query  43   LALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAERLGW  222
            LA P  +G  YR  +   D +  T+ P+S GG +   RFRTKFT  QKEKM+  AERLGW
Sbjct  129  LASPVATGQPYRPPVGSADEED-TSNPSSSGGTTAK-RFRTKFTAEQKEKMLAFAERLGW  186

Query  223  RIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            RIQK  + AVEQFC E GVRR V K+WMHNNK+++ KK
Sbjct  187  RIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSLGKK  224



>ref|XP_006286279.1| hypothetical protein CARUB_v10007856mg [Capsella rubella]
 gb|EOA19177.1| hypothetical protein CARUB_v10007856mg [Capsella rubella]
Length=224

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +1

Query  43   LALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAERLGW  222
            L  P+ +G  YR  M   D +  T+ P+S GG +   RFRTKFT  QKEKM+  AERLGW
Sbjct  128  LTSPTAAGQPYRPPMASADEED-TSNPSSSGGNTAK-RFRTKFTAEQKEKMLAFAERLGW  185

Query  223  RIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            RIQK  + AVEQFC E GVRR V K+WMHNNK+++ KK
Sbjct  186  RIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSLGKK  223



>tpg|DAA48505.1| TPA: putative homeobox DNA-binding domain superfamily protein 
[Zea mays]
Length=308

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK++M+  AERLGWRIQK  E AV+QFC E  V+RHV KVWMHNNKHT+ K
Sbjct  247  RFRTKFTQEQKDRMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTLGK  306

Query  334  K  336
            K
Sbjct  307  K  307



>gb|KHN07995.1| ZF-HD homeobox protein [Glycine soja]
Length=234

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 67/101 (66%), Gaps = 3/101 (3%)
 Frame = +1

Query  43   LALPSISGSAYRe---emeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAER  213
            LA PS+SG    +   E  E       AT + G G S  KRFRTKFT+ QK+KM+  AE+
Sbjct  133  LAHPSLSGGGGAQPPLEDLEDSDPTSGATTHDGSGSSSKKRFRTKFTQHQKDKMLVFAEK  192

Query  214  LGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            LGWR+QK  +  V++FC E GV+RHV KVWMHNNKHT+ KK
Sbjct  193  LGWRMQKNDDSVVQEFCSEIGVQRHVLKVWMHNNKHTLGKK  233



>ref|XP_002514009.1| transcription factor, putative [Ricinus communis]
 gb|EEF48592.1| transcription factor, putative [Ricinus communis]
Length=270

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QK+KM++ +ERLGWRIQK  E AVEQFC + G++R V KVWMHNNKHT+ K
Sbjct  209  RFRTKFSQEQKDKMLDFSERLGWRIQKHDEAAVEQFCSDNGIKRQVLKVWMHNNKHTLGK  268

Query  334  K  336
            K
Sbjct  269  K  269



>ref|XP_008385680.1| PREDICTED: zinc-finger homeodomain protein 1-like isoform X1 
[Malus domestica]
Length=289

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTV  327
            RFRTKF++ QKE+M+ LAERLGWRIQK+ E AV+QFC E GV RHV KVWMHNNKHT+
Sbjct  213  RFRTKFSQEQKERMLSLAERLGWRIQKQDEPAVQQFCNETGVNRHVLKVWMHNNKHTL  270



>ref|XP_004973708.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Setaria italica]
Length=298

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 70/111 (63%), Gaps = 9/111 (8%)
 Frame = +1

Query  31   LQRPLALPSISGSAYReeme---------eldldmdTATPNsggggskgkRFRTKFTEVQ  183
            +QRPLALPS S S   +             + + +  +     G GS  KRFRTKFT+ Q
Sbjct  187  MQRPLALPSTSHSEGDDMSGLIGPMVVAPMVGMSLGGSGGGPSGSGSGKKRFRTKFTQEQ  246

Query  184  KEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            K++M+  AERLGWRIQK  E AV+QFC E  V+RHV KVWMHNNKHT+ KK
Sbjct  247  KDRMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTLGKK  297



>ref|XP_009393645.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=284

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +1

Query  40   PLALPSISGSAYReemeeldldmdT----ATPNsggggskgkRFRTKFTEVQKEKMVELA  207
            PLALPS SG       +  D+   T           G    KRFRTKFT+ QKEKM+  A
Sbjct  178  PLALPSTSGVGGHSREDHDDVSNPTMGGGGGGTRASGSGVRKRFRTKFTQEQKEKMLAFA  237

Query  208  ERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVA  330
            ERLGWRIQK  E AV+QFC E  ++RHV KVWMHNNKHT+A
Sbjct  238  ERLGWRIQKHDEAAVQQFCEETCIKRHVLKVWMHNNKHTLA  278



>ref|XP_006573021.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=254

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = +1

Query  43   LALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAERLGW  222
            LALPS SG     +    D +  +  P++GG GSK  RFRTKFT  QK+KM+ELAE+LGW
Sbjct  155  LALPSTSGGG-GTQSTREDQEDISNNPSAGGTGSKK-RFRTKFTVEQKDKMLELAEKLGW  212

Query  223  RIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTV  327
            RIQK  E  V+ FC E GV+RHV KVWMHNNKHT+
Sbjct  213  RIQKHDEAVVQAFCDETGVKRHVLKVWMHNNKHTL  247



>ref|XP_010438998.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X3 
[Camelina sativa]
Length=225

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 67/98 (68%), Gaps = 2/98 (2%)
 Frame = +1

Query  43   LALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAERLGW  222
            LA P  +G  YR  +   D +  T+ P+S GG +   RFRTKFT  QKEKM+  AERLGW
Sbjct  129  LASPVGTGQPYRPPVGSADEED-TSNPSSSGGTTAK-RFRTKFTAEQKEKMLAFAERLGW  186

Query  223  RIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            RIQK  + AVEQFC E GVRR V K+WMHNNK+++ KK
Sbjct  187  RIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSLGKK  224



>ref|XP_006878601.1| hypothetical protein AMTR_s00011p00255340 [Amborella trichopoda]
 gb|ERM94746.1| hypothetical protein AMTR_s00011p00255340 [Amborella trichopoda]
Length=242

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKE+M+  AER+GWRIQK+ E AV++FC E GV+RHV KVWMHNNK+T+ K
Sbjct  179  RFRTKFTQEQKERMLGFAERVGWRIQKQDEGAVQRFCDEVGVKRHVLKVWMHNNKNTLGK  238

Query  334  KT  339
            K+
Sbjct  239  KS  240



>gb|KHN07993.1| ZF-HD homeobox protein [Glycine soja]
Length=234

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 67/101 (66%), Gaps = 3/101 (3%)
 Frame = +1

Query  43   LALPSISGSAYRe---emeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAER  213
            LA PS+SG    +   E  E       AT + G G S  KRFRTKFT+ QK+KM+  AE+
Sbjct  133  LAHPSLSGGGGPQPPLEDLEDSDPTSGATTHDGSGSSSKKRFRTKFTQHQKDKMLVFAEK  192

Query  214  LGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            LGWR+QK  +  V++FC E GV+RHV KVWMHNNKHT+ KK
Sbjct  193  LGWRMQKNDDSVVQEFCSEIGVQRHVLKVWMHNNKHTLGKK  233



>emb|CAC34447.1| ZF-HD homeobox protein [Flaveria bidentis]
Length=237

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK++M+  +E LGWRIQK  E AV+QFC E GV+RHV KVWMHNNKHT+ K
Sbjct  176  RFRTKFTQDQKDRMLAFSEALGWRIQKHDEAAVQQFCNETGVKRHVLKVWMHNNKHTIGK  235

Query  334  K  336
            K
Sbjct  236  K  236



>ref|XP_009138327.1| PREDICTED: zinc-finger homeodomain protein 2 [Brassica rapa]
Length=225

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = +1

Query  43   LALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAERLGW  222
            L  P+ +G  YR      D +  T+ P+S GG     RFRTKFT  QKEKM+  AERLGW
Sbjct  129  LTSPAAAGQPYRPPAASGDEED-TSNPSSSGGTRAK-RFRTKFTAEQKEKMLAFAERLGW  186

Query  223  RIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            RIQK  +  VEQFC E GVRR V K+WMHNNK+++ KK
Sbjct  187  RIQKHDDATVEQFCAETGVRRQVLKIWMHNNKNSLGKK  224



>emb|CDY34299.1| BnaA01g14020D [Brassica napus]
Length=225

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QK+KM+  AERLGWRIQK  + AVEQFC E GVRR V K+WMHNNK+++ K
Sbjct  164  RFRTKFTAEQKDKMLAFAERLGWRIQKHDDAAVEQFCAETGVRRQVLKIWMHNNKNSLGK  223

Query  334  K  336
            K
Sbjct  224  K  224



>ref|XP_003602944.1| Zinc finger-homeodomain protein [Medicago truncatula]
 gb|AES73195.1| homeobox domain, ZF-HD class protein [Medicago truncatula]
Length=274

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AE++GWRIQKE E A+EQFC E  ++RHV KVWMHNNKHT+ K
Sbjct  213  RFRTKFTQEQKDKMLAFAEKIGWRIQKEDEGAIEQFCAENFIKRHVLKVWMHNNKHTLGK  272

Query  334  K  336
            K
Sbjct  273  K  273



>ref|XP_006413402.1| hypothetical protein EUTSA_v10026163mg [Eutrema salsugineum]
 dbj|BAJ34347.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54855.1| hypothetical protein EUTSA_v10026163mg [Eutrema salsugineum]
Length=227

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 66/98 (67%), Gaps = 2/98 (2%)
 Frame = +1

Query  43   LALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAERLGW  222
            L  P+ +G  YR      D +  T+ P+S GG +   RFRTKFT  QKEKM+  AERLGW
Sbjct  131  LTSPATAGQPYRPPAASADQED-TSNPSSSGGTTAK-RFRTKFTAEQKEKMLIFAERLGW  188

Query  223  RIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            RIQK  + AVEQFC E GVRR V K+WMHNNK+++ KK
Sbjct  189  RIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSLGKK  226



>emb|CAN60614.1| hypothetical protein VITISV_003253 [Vitis vinifera]
Length=155

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QKEKM+  AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  87   RFRTKFSQEQKEKMLSFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  146

Query  334  KT  339
            KT
Sbjct  147  KT  148



>gb|AES96050.2| homeobox domain, ZF-HD class protein [Medicago truncatula]
Length=272

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            R RTKFT+ QK+KM+ELAE+LGWRIQK  E  V++FC E GV+RHV KVWMHNNKHT+ K
Sbjct  211  RHRTKFTQEQKDKMLELAEKLGWRIQKHDEGLVQEFCNESGVKRHVLKVWMHNNKHTLGK  270

Query  334  K  336
            K
Sbjct  271  K  271



>ref|XP_002445649.1| hypothetical protein SORBIDRAFT_07g023360 [Sorghum bicolor]
 gb|EES15144.1| hypothetical protein SORBIDRAFT_07g023360 [Sorghum bicolor]
Length=311

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK++M+  AERLGWRIQK  E AV+QFC E  V+RHV KVWMHNNKHT+ K
Sbjct  250  RFRTKFTQEQKDRMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTLGK  309

Query  334  K  336
            K
Sbjct  310  K  310



>ref|NP_194197.1| ZF-HD homeobox protein [Arabidopsis thaliana]
 sp|Q9SB61.1|ZHD2_ARATH RecName: Full=Zinc-finger homeodomain protein 2; Short=AtZHD2; 
AltName: Full=Homeobox protein 22; Short=AtHB-22; AltName: 
Full=Protein MATERNAL EFFECT EMBRYO ARREST 68 [Arabidopsis 
thaliana]
 gb|AAL27510.1|AF439841_1 AT4g24660/F22K18_140 [Arabidopsis thaliana]
 emb|CAA22997.1| putative protein [Arabidopsis thaliana]
 emb|CAB79376.1| putative protein [Arabidopsis thaliana]
 gb|AAM78073.1| AT4g24660/F22K18_140 [Arabidopsis thaliana]
 gb|AEE84939.1| ZF-HD homeobox protein [Arabidopsis thaliana]
Length=220

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +1

Query  118  TPNsggggskgkRFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFK  297
            T N    G   KRFRTKFT  QKEKM+  AERLGWRIQK  + AVEQFC E GVRR V K
Sbjct  147  TSNPSSSGGTTKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLK  206

Query  298  VWMHNNKHTVAKK  336
            +WMHNNK+++ KK
Sbjct  207  IWMHNNKNSLGKK  219



>ref|XP_002867654.1| ATHB22/MEE68 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43913.1| ATHB22/MEE68 [Arabidopsis lyrata subsp. lyrata]
Length=214

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  AERLGWRIQK  + AVEQFC E GVRR V K+WMHNNK+++ K
Sbjct  153  RFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSLGK  212

Query  334  K  336
            K
Sbjct  213  K  213



>ref|XP_003530620.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=261

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 67/101 (66%), Gaps = 3/101 (3%)
 Frame = +1

Query  43   LALPSISGSAYRe---emeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAER  213
            LA PS+SG    +   E  E       AT + G G S  KRFRTKFT+ QK+KM+  AE+
Sbjct  160  LAHPSLSGGGGPQPPLEDLEDSDPTSGATTHDGSGSSSKKRFRTKFTQHQKDKMLVFAEK  219

Query  214  LGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            LGWR+QK  +  V++FC E GV+RHV KVWMHNNKHT+ KK
Sbjct  220  LGWRMQKNDDSVVQEFCSEIGVQRHVLKVWMHNNKHTLGKK  260



>ref|XP_009373696.1| PREDICTED: zinc-finger homeodomain protein 2-like [Pyrus x bretschneideri]
Length=285

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTV  327
            R RTKFT+ QKEKM+E AE++GWRIQK  E A+E+FC E GV+RHVFKVWMHNNKHT+
Sbjct  209  RHRTKFTQEQKEKMLEFAEKVGWRIQKHDEAAIEEFCSETGVKRHVFKVWMHNNKHTL  266



>ref|XP_006859182.1| hypothetical protein AMTR_s00070p00154800 [Amborella trichopoda]
 gb|ERN20649.1| hypothetical protein AMTR_s00070p00154800 [Amborella trichopoda]
Length=218

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            R+RTKFT+ QKEKM   A++LGWRIQK+ + A++QFC+E GV+RHV KVWMHNNK+T+ K
Sbjct  151  RYRTKFTQDQKEKMQAFADKLGWRIQKQDDVALQQFCMEVGVKRHVLKVWMHNNKNTLGK  210

Query  334  K  336
            K
Sbjct  211  K  211



>ref|NP_001151888.1| ZF-HD protein dimerisation region containing protein [Zea mays]
 gb|ACG44773.1| ZF-HD protein dimerisation region containing protein [Zea mays]
Length=273

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 71/114 (62%), Gaps = 14/114 (12%)
 Frame = +1

Query  37   RPLALPSISGSAYReemeeldldmdTATP--------------NsggggskgkRFRTKFT  174
            RPLALPS S S   +  + L   M  A P               SG GGS  KRFRTKFT
Sbjct  159  RPLALPSTSHSWRDDGDDYLSGGMAAAGPVSALGPLGLGGGAGPSGSGGSGKKRFRTKFT  218

Query  175  EVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            + QK++M+  AER+GWRIQK  E AV+QFC E  V+RHV KVWMHNNKHT+ KK
Sbjct  219  QEQKDRMLAFAERVGWRIQKHDEAAVQQFCDEVCVKRHVLKVWMHNNKHTLGKK  272



>ref|XP_010448536.1| PREDICTED: zinc-finger homeodomain protein 2 [Camelina sativa]
Length=224

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 66/98 (67%), Gaps = 2/98 (2%)
 Frame = +1

Query  43   LALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAERLGW  222
            L  P  +G  YR  +   D +  T+ P+S GG +   RFRTKFT  QKEKM+  AERLGW
Sbjct  128  LTSPPAAGQPYRPPVGSADEED-TSNPSSSGGTTAK-RFRTKFTAEQKEKMLAFAERLGW  185

Query  223  RIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            RIQK  + AVEQFC E GVRR V K+WMHNNK+++ KK
Sbjct  186  RIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSLGKK  223



>ref|NP_001149424.1| LOC100283050 [Zea mays]
 gb|ACG35395.1| ZF-HD protein dimerisation region containing protein [Zea mays]
Length=308

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK +M+  AERLGWRIQK  E AV+QFC E  V+RHV KVWMHNNKHT+ K
Sbjct  247  RFRTKFTQEQKXRMLAFAERLGWRIQKHDEAAVQQFCEEVCVKRHVLKVWMHNNKHTLGK  306

Query  334  K  336
            K
Sbjct  307  K  307



>gb|KHG07143.1| hypothetical protein F383_33189 [Gossypium arboreum]
Length=281

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKH  321
            RFRTKFT+ QK+KM+ELAE+LGWRI K+ E+ VE+FC EYGV+R VFKVWMHNNK+
Sbjct  218  RFRTKFTQEQKDKMLELAEKLGWRINKQDEDEVEKFCAEYGVKRQVFKVWMHNNKN  273



>emb|CDP11470.1| unnamed protein product [Coffea canephora]
Length=268

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  AERLGWRIQK+ E  V+QFC E  V+RHV KVWMHNNKH++ K
Sbjct  207  RFRTKFTPDQKEKMLAFAERLGWRIQKQDEALVQQFCAETNVKRHVLKVWMHNNKHSLGK  266

Query  334  K  336
            K
Sbjct  267  K  267



>ref|XP_010263641.1| PREDICTED: zinc-finger homeodomain protein 5 [Nelumbo nucifera]
Length=356

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK++M+E AE++GWRIQK+ E  V+QFC E GV+R V KVWMHNNKH+  K
Sbjct  294  RFRTKFTQEQKDRMLEFAEKVGWRIQKQDEPEVQQFCAEVGVKRQVLKVWMHNNKHSAKK  353

Query  334  KTL  342
            K L
Sbjct  354  KQL  356



>ref|XP_009393644.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=288

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 62/100 (62%), Gaps = 4/100 (4%)
 Frame = +1

Query  40   PLALPSISGSAYReemeeldldmdT----ATPNsggggskgkRFRTKFTEVQKEKMVELA  207
            PLALPS SG       +  D+   T           G    KRFRTKFT+ QKEKM+  A
Sbjct  178  PLALPSTSGVGGHSREDHDDVSNPTMGGGGGGTRASGSGVRKRFRTKFTQEQKEKMLAFA  237

Query  208  ERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTV  327
            ERLGWRIQK  E AV+QFC E  ++RHV KVWMHNNKHT+
Sbjct  238  ERLGWRIQKHDEAAVQQFCEETCIKRHVLKVWMHNNKHTL  277



>ref|XP_003526539.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform X1 [Glycine 
max]
Length=298

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AE+LGWRIQK  E AVEQFC E  ++RHV KVWMHNNKHT+A 
Sbjct  214  RFRTKFTQEQKDKMLAFAEKLGWRIQKHDEAAVEQFCAETCIKRHVLKVWMHNNKHTLAN  273



>ref|XP_009395689.1| PREDICTED: zinc-finger homeodomain protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=359

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QK+KM+  AER GWRIQ++    VEQFC E GVRR V KVWMHNNKHTV +
Sbjct  274  RFRTKFTAEQKDKMLAFAERAGWRIQRQDSAMVEQFCAEIGVRRQVLKVWMHNNKHTVTR  333

Query  334  K  336
            K
Sbjct  334  K  334



>ref|XP_009399684.1| PREDICTED: zinc-finger homeodomain protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=289

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AER+GWRIQK+ E AV+QFC E  V+RHV KVWMHNNKHT+ K
Sbjct  228  RFRTKFTQDQKDKMLVFAERVGWRIQKQDEAAVQQFCDETCVKRHVLKVWMHNNKHTLGK  287

Query  334  K  336
            K
Sbjct  288  K  288



>ref|XP_004501619.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cicer arietinum]
Length=271

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 71/102 (70%), Gaps = 4/102 (4%)
 Frame = +1

Query  34   QRPLALP-SISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAE  210
             RPLALP + SG  +  E +++     +     GGG    KRFRTKFT+ QK++M+  AE
Sbjct  172  HRPLALPPTASGGGFSREDDDVSNPSSSGG---GGGSGTKKRFRTKFTQEQKDRMLAFAE  228

Query  211  RLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            ++GWRIQK+ E A+EQFC+E  ++R+V KVWMHNNKHT+ KK
Sbjct  229  QIGWRIQKQDEAAIEQFCVENCIKRNVLKVWMHNNKHTLGKK  270



>ref|XP_011087615.1| PREDICTED: zinc-finger homeodomain protein 4 [Sesamum indicum]
Length=291

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM+  AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  220  RFRTKFTQEQKEKMLSFAEKVGWKIQKQEESVVQQFCQEVGVKRRVLKVWMHNNKHNLAK  279

Query  334  KTL  342
            K L
Sbjct  280  KNL  282



>ref|XP_003518249.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=258

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +1

Query  34   QRPLALPSI-SGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAE  210
             RPLALP+  SG     E E++     +     GGGG   KRFRTKFT+ QK+KM+  AE
Sbjct  156  HRPLALPAAASGGGLSREEEDMSNPSSSGGGGGGGGGGSKKRFRTKFTQEQKDKMLAFAE  215

Query  211  RLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            +LGWRIQK  E AVEQFC E  V+R+V KVWMHNNK T+ KK
Sbjct  216  QLGWRIQKHDESAVEQFCAEINVKRNVLKVWMHNNKSTLGKK  257



>ref|XP_008338913.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X2 
[Malus domestica]
Length=276

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTV  327
            R RTKFT+ QKEKM+E AE++GWRIQK  E A+E+FC E GV+RHVFKVWMHNNKHT+
Sbjct  210  RHRTKFTQEQKEKMLEFAEKVGWRIQKHEEAAIEEFCEETGVKRHVFKVWMHNNKHTL  267



>ref|XP_010254805.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
 ref|XP_010254806.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
 ref|XP_010254807.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nelumbo nucifera]
Length=363

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK++M+E AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH++ K
Sbjct  301  RFRTKFTQEQKDRMLEFAEKIGWKIQKQDEPEVQQFCAEVGVKRQVLKVWMHNNKHSMKK  360

Query  334  KTL  342
            K L
Sbjct  361  KQL  363



>ref|XP_008810728.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
Length=344

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTV  327
            RFRTKFT  QKEKM+  AER+GWRI K+ E  VEQFC E GVRR V KVWMHNNKHT+
Sbjct  260  RFRTKFTAEQKEKMLAFAERVGWRIHKQDEALVEQFCAEVGVRRQVLKVWMHNNKHTI  317



>ref|XP_007222197.1| hypothetical protein PRUPE_ppa009679mg [Prunus persica]
 gb|EMJ23396.1| hypothetical protein PRUPE_ppa009679mg [Prunus persica]
Length=282

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            R RTKFT+ QKEKM+E AE++GWRIQK  E AVE+FC E GV+R V KVWMHNNKHT+ K
Sbjct  219  RHRTKFTQEQKEKMLEFAEKVGWRIQKHDEAAVEEFCGETGVKRQVLKVWMHNNKHTLGK  278

Query  334  K  336
            K
Sbjct  279  K  279



>ref|XP_001778248.1| predicted protein [Physcomitrella patens]
 gb|EDQ56915.1| predicted protein [Physcomitrella patens]
Length=268

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF+  QK++M   AE LGWRIQK  E AV++FC   GV+RHV KVWMHNNKHTV K
Sbjct  207  RFRTKFSTEQKDQMCAFAEELGWRIQKHDEAAVQEFCTTVGVKRHVLKVWMHNNKHTVGK  266

Query  334  K  336
            K
Sbjct  267  K  267



>ref|XP_008219382.1| PREDICTED: zinc-finger homeodomain protein 2 [Prunus mume]
Length=282

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            R RTKFT+ QKEKM+E AE++GWRIQK  E AVE+FC E GV+R V KVWMHNNKHT+ K
Sbjct  219  RHRTKFTQEQKEKMLEFAEKVGWRIQKHDEAAVEEFCGETGVKRQVLKVWMHNNKHTLGK  278

Query  334  K  336
            K
Sbjct  279  K  279



>ref|XP_009421143.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=282

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  AE+ GWR+QK+ E AV+QFC E GV+R V KVWMHNNKH +AK
Sbjct  216  RFRTKFTAEQKEKMLHFAEKAGWRLQKQEESAVQQFCQEIGVKRRVLKVWMHNNKHNLAK  275

Query  334  KT  339
            KT
Sbjct  276  KT  277



>ref|XP_008338912.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X1 
[Malus domestica]
Length=286

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTV  327
            R RTKFT+ QKEKM+E AE++GWRIQK  E A+E+FC E GV+RHVFKVWMHNNKHT+
Sbjct  210  RHRTKFTQEQKEKMLEFAEKVGWRIQKHEEAAIEEFCEETGVKRHVFKVWMHNNKHTL  267



>gb|AAZ07989.1| zinc finger homeodomain protein 1 [Physcomitrella patens]
Length=340

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF+  QK++M   AE LGWRIQK  E AV++FC   GV+RHV KVWMHNNKHTV K
Sbjct  279  RFRTKFSTEQKDQMCAFAEELGWRIQKHDEAAVQEFCTTVGVKRHVLKVWMHNNKHTVGK  338

Query  334  K  336
            K
Sbjct  339  K  339



>gb|ABY61024.1| zinc finger-homeodomain protein 2 [Saruma henryi]
Length=258

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM+  AE++GWRIQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  192  RFRTKFTQEQKEKMLSFAEKVGWRIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  251

Query  334  KT  339
            K 
Sbjct  252  KN  253



>ref|XP_009405659.1| PREDICTED: zinc-finger homeodomain protein 6-like [Musa acuminata 
subsp. malaccensis]
Length=361

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  AER+GWRIQK+ E  VEQFC E GVRR V KVWMHNNKH   K
Sbjct  277  RFRTKFTAEQKEKMLAFAERVGWRIQKQEEAVVEQFCAEVGVRRQVLKVWMHNNKHANTK  336



>gb|ABR16776.1| unknown [Picea sitchensis]
Length=289

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QKEKM   A++LGWRIQK  E AV QFC E GVRRHV KVWMHNNK+T+ K
Sbjct  228  RFRTKFSQEQKEKMHAFADQLGWRIQKHDEAAVHQFCNEAGVRRHVLKVWMHNNKNTLGK  287

Query  334  KT  339
            K+
Sbjct  288  KS  289



>ref|XP_011016887.1| PREDICTED: zinc-finger homeodomain protein 2 [Populus euphratica]
Length=265

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            R+RTKFT+ QKEK +  AERLGW IQK  E AV QFC E GV+RHV KVWMHNNKHT+ K
Sbjct  204  RYRTKFTQEQKEKTLAFAERLGWGIQKHDEAAVGQFCAETGVKRHVLKVWMHNNKHTLGK  263

Query  334  K  336
            K
Sbjct  264  K  264



>ref|XP_007154109.1| hypothetical protein PHAVU_003G091100g [Phaseolus vulgaris]
 gb|ESW26103.1| hypothetical protein PHAVU_003G091100g [Phaseolus vulgaris]
Length=271

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM+  AER+GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  204  RFRTKFTQEQKEKMLNFAERVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  263

Query  334  KT  339
            K 
Sbjct  264  KN  265



>ref|XP_008806398.1| PREDICTED: zinc-finger homeodomain protein 1-like [Phoenix dactylifera]
Length=176

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AE++GWRIQK  E AV+QFC E  V+RHV KVWMHNNKHT+ K
Sbjct  115  RFRTKFTQEQKDKMLAFAEKVGWRIQKHDEAAVQQFCEETCVKRHVLKVWMHNNKHTLGK  174

Query  334  K  336
            K
Sbjct  175  K  175



>ref|XP_010682105.1| PREDICTED: zinc-finger homeodomain protein 3-like [Beta vulgaris 
subsp. vulgaris]
Length=342

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QKEKM+E AE++GW+IQK+ EE V+QFC E GV+R V KVWMHNNKH + K
Sbjct  270  RFRTKFSQEQKEKMMEFAEKVGWKIQKQEEEVVQQFCQEIGVKRRVLKVWMHNNKHNLGK  329

Query  334  KT  339
            K+
Sbjct  330  KS  331



>emb|CBI19232.3| unnamed protein product [Vitis vinifera]
Length=246

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AE LGWRIQK  E AV+QFC E  V+RHV KVWMHNNKHT+ K
Sbjct  185  RFRTKFTQEQKDKMLAFAETLGWRIQKHDEAAVQQFCQETCVKRHVLKVWMHNNKHTLGK  244

Query  334  K  336
            K
Sbjct  245  K  245



>ref|XP_009403385.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403391.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403399.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=259

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  AE+LGWR+QK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  193  RFRTKFTPEQKEKMLSFAEKLGWRLQKQEESMVQQFCQEIGVKRRVLKVWMHNNKHHLAK  252

Query  334  KT  339
            KT
Sbjct  253  KT  254



>ref|XP_010681042.1| PREDICTED: zinc-finger homeodomain protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=284

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM++LAE+LGW+IQK+ E  V QFC E GV+RHV KVWMHNNK T+ K
Sbjct  223  RFRTKFTQEQKDKMLDLAEKLGWKIQKQDELVVHQFCHETGVKRHVLKVWMHNNKLTLGK  282

Query  334  K  336
            K
Sbjct  283  K  283



>ref|XP_003530619.2| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=265

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 66/98 (67%), Gaps = 3/98 (3%)
 Frame = +1

Query  43   LALPSISGSAYRe---emeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAER  213
            LA PS+SG    +   E  E       AT + G G S  KRFRTKFT+ QK+KM+  AE+
Sbjct  156  LAHPSLSGGGGPQPPLEDLEDSDPTSGATTHDGSGSSSKKRFRTKFTQHQKDKMLVFAEK  215

Query  214  LGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTV  327
            LGWR+QK  + AV++FC E GV+RHV KVWMHNNKHT+
Sbjct  216  LGWRMQKNDDSAVQEFCSEIGVQRHVLKVWMHNNKHTL  253



>ref|XP_003522760.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform X1 [Glycine 
max]
Length=293

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AE LGWRIQK  E AVEQFC E  V+RHV KVWMHNNKHT+A 
Sbjct  209  RFRTKFTQEQKDKMLAFAEELGWRIQKHDEVAVEQFCAETCVKRHVLKVWMHNNKHTLAN  268



>ref|XP_009407034.1| PREDICTED: zinc-finger homeodomain protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=296

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  AER+GWRIQK+ E  VEQFC E GVRR V KVWMHNNKH + K
Sbjct  208  RFRTKFTMEQKEKMLAFAERMGWRIQKQDEGLVEQFCAETGVRRQVLKVWMHNNKHLIRK  267



>ref|XP_006578270.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform X2 [Glycine 
max]
Length=286

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVA  330
            RFRTKFT+ QK+KM+  AE LGWRIQK  E AVEQFC E  V+RHV KVWMHNNKHT+A
Sbjct  209  RFRTKFTQEQKDKMLAFAEELGWRIQKHDEVAVEQFCAETCVKRHVLKVWMHNNKHTLA  267



>ref|XP_001777987.1| predicted protein [Physcomitrella patens]
 gb|EDQ57200.1| predicted protein [Physcomitrella patens]
Length=165

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM   AE+LGW+IQK  E AV++FC E GV+RHV KVWMHNNK+T+ K
Sbjct  103  RFRTKFTNEQKEKMGVFAEKLGWKIQKHDEAAVQEFCAEVGVKRHVLKVWMHNNKNTIGK  162

Query  334  K  336
            K
Sbjct  163  K  163



>ref|XP_010925945.1| PREDICTED: LOW QUALITY PROTEIN: zinc-finger homeodomain protein 
6-like [Elaeis guineensis]
Length=342

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTV  327
            RFRTKFT  QKEKM+  AER+GWRI K+ E  VEQFC E GVRR V KVWMHNNKHT+
Sbjct  256  RFRTKFTVEQKEKMLAFAERVGWRIHKQDEALVEQFCAEAGVRRQVLKVWMHNNKHTI  313



>ref|XP_009396485.1| PREDICTED: zinc-finger homeodomain protein 6-like [Musa acuminata 
subsp. malaccensis]
Length=380

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QK KM+  AER+GW IQ++  E +EQFC E GVRR V KVWMHNNKHT+ +
Sbjct  284  RFRTKFTAEQKNKMLAFAERIGWTIQRQDSEMIEQFCAEIGVRRQVLKVWMHNNKHTIIR  343

Query  334  K  336
            K
Sbjct  344  K  344



>ref|XP_008812231.1| PREDICTED: zinc-finger homeodomain protein 2-like [Phoenix dactylifera]
Length=279

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 67/106 (63%), Gaps = 7/106 (7%)
 Frame = +1

Query  40   PLALPSISGSAYReemeeldldm-------dTATPNsggggskgkRFRTKFTEVQKEKMV  198
            PLALPS SG       ++ D+            +   G  GS  KRFRTKFT+ QK++M+
Sbjct  173  PLALPSTSGGGGHSRDDQEDISNPMMGGGGIGVSGGGGASGSGKKRFRTKFTQEQKDQML  232

Query  199  ELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
              AER+GWRIQK  E AV+QFC E  ++RHV KVWMHNNKHT+ KK
Sbjct  233  AFAERVGWRIQKHDEAAVQQFCNETCIKRHVLKVWMHNNKHTLGKK  278



>ref|XP_008444884.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
Length=238

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF+  QKEKM+E AE++GW IQK  E  VE+FC+E GVRR V KVWMHNNKHT+ K
Sbjct  177  RFRTKFSSEQKEKMLEFAEKVGWTIQKHDEADVERFCMETGVRRQVLKVWMHNNKHTLGK  236

Query  334  K  336
            K
Sbjct  237  K  237



>ref|XP_004152612.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
 ref|XP_004170820.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
 gb|KGN62731.1| hypothetical protein Csa_2G369820 [Cucumis sativus]
Length=238

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF+  QKEKM+E AE++GW IQK  E  VE+FC+E GVRR V KVWMHNNKHT+ K
Sbjct  177  RFRTKFSSEQKEKMLEFAEKVGWTIQKHDEADVERFCMETGVRRQVLKVWMHNNKHTLGK  236

Query  334  K  336
            K
Sbjct  237  K  237



>gb|ABK22835.1| unknown [Picea sitchensis]
Length=249

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK++M++ AE++GWRIQK  E+AV+QFC + GV+R V KVWMHNNK+T+ K
Sbjct  187  RFRTKFTQEQKDRMLDFAEKVGWRIQKHDEQAVQQFCQDIGVKRRVLKVWMHNNKNTLGK  246

Query  334  KT  339
            K+
Sbjct  247  KS  248



>ref|XP_006836924.1| hypothetical protein AMTR_s00099p00145100 [Amborella trichopoda]
 gb|ERM99777.1| hypothetical protein AMTR_s00099p00145100 [Amborella trichopoda]
Length=267

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM+  AE++GWRIQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  204  RFRTKFTQEQKEKMLSFAEKVGWRIQKQEEGVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  263

Query  334  K  336
            K
Sbjct  264  K  264



>ref|XP_002994344.1| hypothetical protein SELMODRAFT_236945 [Selaginella moellendorffii]
 gb|EFJ04587.1| hypothetical protein SELMODRAFT_236945 [Selaginella moellendorffii]
Length=161

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKE+M+  A+++GW+IQK  E  V+QFC E GV+RHV KVWMHNNKHT+ K
Sbjct  100  RFRTKFTGDQKERMLAFADKVGWKIQKHDEAEVQQFCNEVGVKRHVLKVWMHNNKHTLGK  159

Query  334  K  336
            K
Sbjct  160  K  160



>ref|XP_010936702.1| PREDICTED: zinc-finger homeodomain protein 6-like [Elaeis guineensis]
Length=293

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKE+M++ AER+GWRIQK+ E  VE FC E GV R V KVWMHNNKHT+ K
Sbjct  223  RFRTKFTAEQKERMLDFAERMGWRIQKQDEALVEDFCAEVGVSRQVLKVWMHNNKHTIRK  282

Query  334  K  336
            +
Sbjct  283  Q  283



>emb|CDP02013.1| unnamed protein product [Coffea canephora]
Length=356

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK++M E AE+LGW+IQK+ E+ V+QFC E GV+R VFKVWMHNNK  + K
Sbjct  294  RFRTKFTQQQKDRMNEFAEKLGWKIQKQDEQEVQQFCSEVGVKRQVFKVWMHNNKQAMKK  353

Query  334  KTL  342
            K +
Sbjct  354  KQM  356



>ref|XP_008670258.1| PREDICTED: zinc-finger homeodomain protein 1-like [Zea mays]
 tpg|DAA40283.1| TPA: putative homeobox DNA-binding domain superfamily protein 
[Zea mays]
Length=286

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QK++M+  AER+GWR+QK  E AV+QFC E  V+RHV KVWMHNNKHT+ K
Sbjct  225  RFRTKFSQEQKDRMLAFAERVGWRVQKHDEAAVQQFCDEVCVKRHVLKVWMHNNKHTLGK  284

Query  334  K  336
            K
Sbjct  285  K  285



>ref|XP_010438996.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X1 
[Camelina sativa]
Length=259

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 66/96 (69%), Gaps = 2/96 (2%)
 Frame = +1

Query  43   LALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAERLGW  222
            LA P  +G  YR  +   D +  T+ P+S GG +   RFRTKFT  QKEKM+  AERLGW
Sbjct  129  LASPVGTGQPYRPPVGSADEED-TSNPSSSGGTTAK-RFRTKFTAEQKEKMLAFAERLGW  186

Query  223  RIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVA  330
            RIQK  + AVEQFC E GVRR V K+WMHNNK+++A
Sbjct  187  RIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSLA  222



>emb|CDY08945.1| BnaC08g11750D [Brassica napus]
Length=210

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM   AERLGWR+QK  + AVEQFC E GVRR V K+WMHNNK+++ K
Sbjct  149  RFRTKFTAEQKEKMFAFAERLGWRMQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSLGK  208

Query  334  K  336
            K
Sbjct  209  K  209



>ref|XP_004152776.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
Length=276

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK++M+E AE++GWRIQK+ EE VE+FC E GV+R V KVWMHNNK+TV K
Sbjct  195  RFRTKFTQEQKDRMLEFAEKVGWRIQKQDEEEVERFCTEVGVKRQVLKVWMHNNKNTVKK  254

Query  334  KT  339
            + 
Sbjct  255  QN  256



>pdb|1WH7|A Chain A, Solution Structure Of Homeobox Domain Of Arabidopsis 
Thaliana Hypothetical Protein F22k18.140
Length=80

 Score = 90.9 bits (224),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHT  324
            RFRTKFT  QKEKM+  AERLGWRIQK  + AVEQFC E GVRR V K+WMHNNK++
Sbjct  19   RFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNS  75



>gb|EPS61775.1| hypothetical protein M569_13018, partial [Genlisea aurea]
Length=276

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM+  AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKHT+AK
Sbjct  215  RFRTKFTQEQKEKMLIFAEKVGWKIQKQEESVVQQFCQEVGVKRRVLKVWMHNNKHTLAK  274

Query  334  K  336
            K
Sbjct  275  K  275



>emb|CDX88950.1| BnaA04g02360D [Brassica napus]
Length=210

 Score = 94.4 bits (233),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM   AERLGWR+QK  + AVEQFC E GVRR V K+WMHNNK+++ K
Sbjct  149  RFRTKFTAEQKEKMFAFAERLGWRMQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSLGK  208

Query  334  K  336
            K
Sbjct  209  K  209



>ref|XP_010554331.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554332.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554333.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554334.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554335.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010554336.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
Length=322

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM+  AER+GW+IQ++ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  234  RFRTKFTQEQKEKMMNFAERVGWKIQRQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  293

Query  334  K  336
            K
Sbjct  294  K  294



>ref|XP_002966118.1| hypothetical protein SELMODRAFT_85536, partial [Selaginella moellendorffii]
 gb|EFJ32145.1| hypothetical protein SELMODRAFT_85536, partial [Selaginella moellendorffii]
Length=170

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKE+M+  A+++GW+IQK  E  V+QFC E GV+RHV KVWMHNNKHT+ K
Sbjct  109  RFRTKFTGDQKERMLAFADKVGWKIQKHDEAEVQQFCNEVGVKRHVLKVWMHNNKHTLGK  168

Query  334  K  336
            K
Sbjct  169  K  169



>ref|XP_008444722.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
Length=314

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK++M+E AE++GWRIQK+ EE VE+FC E GV+R V KVWMHNNK+TV K
Sbjct  232  RFRTKFTQEQKDRMLEFAEKVGWRIQKQDEEEVERFCTEVGVKRQVLKVWMHNNKNTVKK  291

Query  334  KT  339
            + 
Sbjct  292  QN  293



>ref|XP_006383190.1| hypothetical protein POPTR_0005s12420g [Populus trichocarpa]
 gb|ERP60987.1| hypothetical protein POPTR_0005s12420g [Populus trichocarpa]
Length=339

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRT+F+E QK+KM+E AE+LGWRIQK+ E+ V+QFC + GV+R VFKVWMHNNK ++ K
Sbjct  277  RFRTRFSEEQKDKMMEFAEKLGWRIQKQDEQEVQQFCSQVGVKRKVFKVWMHNNKQSMKK  336

Query  334  K  336
            K
Sbjct  337  K  337



>ref|XP_010527865.1| PREDICTED: zinc-finger homeodomain protein 4 [Tarenaya hassleriana]
Length=316

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM+  AER+GW+IQ++ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  224  RFRTKFTQEQKEKMLNFAERVGWKIQRQEESVVQQFCQEVGVKRRVLKVWMHNNKHNLAK  283

Query  334  KT  339
            K 
Sbjct  284  KN  285



>ref|XP_007046919.1| Homeobox protein 24, putative [Theobroma cacao]
 gb|EOX91076.1| Homeobox protein 24, putative [Theobroma cacao]
Length=385

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QK+KM+E AE+LGWRIQK+ E+ V+QFC + GV+R VFKVWMHNNK  + K
Sbjct  309  RFRTKFSQEQKDKMMEFAEKLGWRIQKQDEQEVQQFCAQVGVKRQVFKVWMHNNKQAMKK  368

Query  334  KTL  342
            K +
Sbjct  369  KQI  371



>ref|XP_010438997.1| PREDICTED: zinc-finger homeodomain protein 2-like isoform X2 
[Camelina sativa]
Length=239

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 65/96 (68%), Gaps = 2/96 (2%)
 Frame = +1

Query  43   LALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAERLGW  222
            LA P  +G  YR  +   D +  T+ P+S GG +   RFRTKFT  QKEKM+  AERLGW
Sbjct  129  LASPVGTGQPYRPPVGSADEED-TSNPSSSGGTTAK-RFRTKFTAEQKEKMLAFAERLGW  186

Query  223  RIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVA  330
            RIQK  + AVEQFC E GVRR V K+WMHNNK+++ 
Sbjct  187  RIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSLG  222



>ref|XP_003633412.1| PREDICTED: zinc-finger homeodomain protein 4 [Vitis vinifera]
Length=281

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QKEKM+  AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  213  RFRTKFSQEQKEKMLSFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  272

Query  334  KT  339
            KT
Sbjct  273  KT  274



>ref|XP_010252306.1| PREDICTED: zinc-finger homeodomain protein 4 [Nelumbo nucifera]
Length=271

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM+  AE++GWRIQK+ E  V+QFC E G++R V KVWMHNNKH +AK
Sbjct  206  RFRTKFTQEQKEKMLGFAEKVGWRIQKQEEAVVQQFCQEIGIKRRVLKVWMHNNKHNMAK  265

Query  334  KT  339
            K 
Sbjct  266  KN  267



>ref|XP_004165400.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
 gb|KGN62606.1| hypothetical protein Csa_2G361700 [Cucumis sativus]
Length=320

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK++M+E AE++GWRIQK+ EE VE+FC E GV+R V KVWMHNNK+TV K
Sbjct  239  RFRTKFTQEQKDRMLEFAEKVGWRIQKQDEEEVERFCTEVGVKRQVLKVWMHNNKNTVKK  298

Query  334  KT  339
            + 
Sbjct  299  QN  300



>ref|XP_003613092.1| Zinc finger-homeodomain protein [Medicago truncatula]
Length=358

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            R RTKFT+ QK+KM+ELAE+LGWRIQK  E  V++FC E GV+RHV KVWMHNNKHT+ K
Sbjct  211  RHRTKFTQEQKDKMLELAEKLGWRIQKHDEGLVQEFCNESGVKRHVLKVWMHNNKHTLGK  270

Query  334  K  336
             
Sbjct  271  N  271



>ref|XP_006380765.1| hypothetical protein POPTR_0007s12970g [Populus trichocarpa]
 gb|ERP58562.1| hypothetical protein POPTR_0007s12970g [Populus trichocarpa]
Length=331

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QK+KM E AE+LGWRIQK+ E+ V+QFC + GV+R VFKVWMHNNK  + K
Sbjct  269  RFRTKFSQDQKDKMTEFAEKLGWRIQKQDEQEVQQFCSQVGVKRKVFKVWMHNNKQAMKK  328

Query  334  KTL  342
            K +
Sbjct  329  KQV  331



>ref|XP_002310240.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE90690.2| zinc finger family protein [Populus trichocarpa]
Length=296

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QK+KM E AE+LGWRIQK+ E+ V+QFC + GV+R VFKVWMHNNK  + K
Sbjct  234  RFRTKFSQDQKDKMTEFAEKLGWRIQKQDEQEVQQFCSQVGVKRKVFKVWMHNNKQAMKK  293

Query  334  KTL  342
            K +
Sbjct  294  KQV  296



>ref|XP_001752347.1| predicted protein [Physcomitrella patens]
 gb|EDQ83080.1| predicted protein [Physcomitrella patens]
Length=298

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QK++M   AE++GWRIQK  E +V++FC   G++RHV KVWMHNNKHT+ K
Sbjct  236  RFRTKFTNEQKDQMCAFAEKVGWRIQKHDEASVQEFCATAGIKRHVLKVWMHNNKHTMGK  295

Query  334  K  336
            K
Sbjct  296  K  296



>ref|XP_010527155.1| PREDICTED: zinc-finger homeodomain protein 1 [Tarenaya hassleriana]
Length=179

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKE+M+ LAER+GWRIQ++ EE V++FC E GV R V KVW+HNNKHT+ K
Sbjct  101  RFRTKFTAEQKERMLGLAERIGWRIQRQDEELVQRFCEETGVSRQVLKVWLHNNKHTLGK  160

Query  334  KTL  342
            + L
Sbjct  161  RPL  163



>ref|XP_006291509.1| hypothetical protein CARUB_v10017657mg [Capsella rubella]
 gb|EOA24407.1| hypothetical protein CARUB_v10017657mg [Capsella rubella]
Length=320

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKMV  AER+GW++Q++ E AV++FC E G+RR V KVWMHNNKH ++K
Sbjct  227  RFRTKFTQEQKEKMVSFAERVGWKMQRQEESAVQEFCQEIGIRRRVLKVWMHNNKHNLSK  286

Query  334  K  336
            K
Sbjct  287  K  287



>ref|XP_008789175.1| PREDICTED: zinc-finger homeodomain protein 4-like [Phoenix dactylifera]
Length=253

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  A+R+GWR+Q++ E  V+QFC E GV+R V KVWMHNNKH++AK
Sbjct  188  RFRTKFTPEQKEKMLNFADRIGWRLQRQEESMVQQFCQEIGVKRRVLKVWMHNNKHSLAK  247

Query  334  KTL  342
            K L
Sbjct  248  KEL  250



>ref|XP_004230410.1| PREDICTED: zinc-finger homeodomain protein 4 [Solanum lycopersicum]
Length=290

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH++AK
Sbjct  217  RFRTKFTQEQKDKMLNFAEKVGWKIQKQEEGVVQQFCQEVGVKRRVLKVWMHNNKHSLAK  276

Query  334  KTL  342
            K +
Sbjct  277  KNI  279



>ref|XP_007156483.1| hypothetical protein PHAVU_003G289700g [Phaseolus vulgaris]
 gb|ESW28477.1| hypothetical protein PHAVU_003G289700g [Phaseolus vulgaris]
Length=219

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = +1

Query  43   LALPSISGSAYReemeeldldmdT-ATPNsggggskgkRFRTKFTEVQKEKMVELAERLG  219
            LALPS SG+    +    + +  +  +   GG GS  KRFRTKF+  QK+KM+  AE+LG
Sbjct  120  LALPSTSGAGGGAQSPGEEQENVSEPSGGGGGCGSHKKRFRTKFSLEQKDKMLAFAEKLG  179

Query  220  WRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAKK  336
            WRIQK  E  V++FC + G++RHV KVWMHNNKHT+ KK
Sbjct  180  WRIQKHDESLVQEFCSQTGLQRHVLKVWMHNNKHTLGKK  218



>ref|XP_002965557.1| hypothetical protein SELMODRAFT_68508, partial [Selaginella moellendorffii]
 ref|XP_002983043.1| hypothetical protein SELMODRAFT_48444, partial [Selaginella moellendorffii]
 gb|EFJ15852.1| hypothetical protein SELMODRAFT_48444, partial [Selaginella moellendorffii]
 gb|EFJ32977.1| hypothetical protein SELMODRAFT_68508, partial [Selaginella moellendorffii]
Length=184

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM   A RLGW+IQK  E  V+QFC + GV+RHV KVWMHNNK+T  K
Sbjct  124  RFRTKFTNEQKEKMFHFAHRLGWKIQKHDEGEVQQFCADVGVKRHVLKVWMHNNKNTFGK  183

Query  334  K  336
            K
Sbjct  184  K  184



>ref|XP_001772697.1| predicted protein [Physcomitrella patens]
 gb|EDQ62561.1| predicted protein [Physcomitrella patens]
Length=192

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  Q+EKM   +E+LGWRIQK  E AV++FC + GV+RHV KVWMHNNK+T+ K
Sbjct  127  RFRTKFTSNQREKMGAFSEKLGWRIQKHDEPAVQEFCSDVGVKRHVLKVWMHNNKNTLGK  186

Query  334  K  336
            K
Sbjct  187  K  187



>ref|XP_008808961.1| PREDICTED: zinc-finger homeodomain protein 4-like [Phoenix dactylifera]
Length=274

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  AE++GWR+QK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  207  RFRTKFTPEQKEKMLSFAEKVGWRLQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  266

Query  334  KT  339
            K+
Sbjct  267  KS  268



>ref|XP_006431432.1| hypothetical protein CICLE_v10003702mg [Citrus clementina]
 gb|ESR44672.1| hypothetical protein CICLE_v10003702mg [Citrus clementina]
Length=314

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM   AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  243  RFRTKFTQEQKEKMFNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  302

Query  334  KT  339
            K 
Sbjct  303  KN  304



>ref|XP_006853040.1| hypothetical protein AMTR_s00038p00027320 [Amborella trichopoda]
 gb|ERN14507.1| hypothetical protein AMTR_s00038p00027320 [Amborella trichopoda]
Length=237

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AE++GWRIQK+ E  V++FC+E  ++RHV KVWMHNNKHT+ K
Sbjct  168  RFRTKFTQEQKDKMLAFAEKVGWRIQKQDEAEVQRFCMEACIKRHVLKVWMHNNKHTLGK  227

Query  334  K  336
            K
Sbjct  228  K  228



>gb|KDO42061.1| hypothetical protein CISIN_1g048741mg [Citrus sinensis]
Length=314

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM   AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  243  RFRTKFTQEQKEKMFNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  302

Query  334  KT  339
            K 
Sbjct  303  KN  304



>ref|XP_006470838.1| PREDICTED: ZF-HD homeobox protein At5g65410-like [Citrus sinensis]
Length=314

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM   AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  243  RFRTKFTQEQKEKMFNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  302

Query  334  KT  339
            K 
Sbjct  303  KN  304



>ref|XP_003544235.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=260

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AE+LGWRIQK  E AVEQFC E  V+R+V KVWMHNNK T+ K
Sbjct  199  RFRTKFTQEQKDKMLAFAEQLGWRIQKHDESAVEQFCAETNVKRNVLKVWMHNNKSTLGK  258

Query  334  K  336
            K
Sbjct  259  K  259



>ref|XP_010930367.1| PREDICTED: zinc-finger homeodomain protein 4-like [Elaeis guineensis]
Length=277

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  AE++GWR+QK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  210  RFRTKFTPEQKEKMLSFAEKVGWRLQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  269

Query  334  KT  339
            K+
Sbjct  270  KS  271



>gb|KEH32742.1| homeobox domain, ZF-HD class protein [Medicago truncatula]
Length=365

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM+  AE++GW+ QK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  286  RFRTKFTQEQKEKMLNFAEKVGWKFQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  345

Query  334  KTLE  345
            K L+
Sbjct  346  KQLQ  349



>gb|KHG11042.1| hypothetical protein F383_15979 [Gossypium arboreum]
Length=299

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNK  318
            RFRTKFT  QK+KM+ELAE++GWRI K+ EE V++FC EYGV+R VFKVWMHNNK
Sbjct  237  RFRTKFTHEQKDKMLELAEKVGWRINKQDEEEVQKFCAEYGVKRQVFKVWMHNNK  291



>ref|XP_004143516.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform 1 [Cucumis 
sativus]
 ref|XP_004143517.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform 2 [Cucumis 
sativus]
 ref|XP_004162318.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform 1 [Cucumis 
sativus]
 ref|XP_004162319.1| PREDICTED: ZF-HD homeobox protein At4g24660-like isoform 2 [Cucumis 
sativus]
 gb|KGN48833.1| hypothetical protein Csa_6G502710 [Cucumis sativus]
Length=337

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM E AE+LGW+IQK  E  V+QFC E GVRR VFKVWMHNNK  + K
Sbjct  275  RFRTKFTQGQKDKMEEFAEKLGWKIQKHDELEVQQFCAEVGVRRQVFKVWMHNNKQAMKK  334

Query  334  KTL  342
            K +
Sbjct  335  KQM  337



>ref|XP_003530618.2| PREDICTED: ZF-HD homeobox protein At4g24660-like [Glycine max]
Length=269

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = +1

Query  43   LALPSISGSAYRe---emeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAER  213
            LA PS+SG    +   E  E       AT + G G S  KRFRTKFT+ QK+KM+  AE+
Sbjct  160  LAHPSLSGGGGPQPPLEDLEDSDPTSGATTHDGSGSSSKKRFRTKFTQHQKDKMLVFAEK  219

Query  214  LGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTV  327
            LGWR+QK  +  V++FC E GV+RHV KVWMHNNKHT+
Sbjct  220  LGWRMQKNDDNVVQEFCSEIGVQRHVLKVWMHNNKHTL  257



>ref|XP_004499360.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cicer arietinum]
Length=318

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AE++GW+IQK+ E  V+QFC E GVRR V KVWMHNNKH +AK
Sbjct  247  RFRTKFTQEQKDKMLSFAEKVGWKIQKQEESLVQQFCQEIGVRRRVLKVWMHNNKHNLAK  306

Query  334  K  336
            K
Sbjct  307  K  307



>ref|XP_002981261.1| hypothetical protein SELMODRAFT_59934, partial [Selaginella moellendorffii]
 gb|EFJ17962.1| hypothetical protein SELMODRAFT_59934, partial [Selaginella moellendorffii]
Length=58

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHT  324
            RFRTKF+  QKEKM   AE++GWRIQK  E AV+ FC E GV+RHV KVWMHNNKHT
Sbjct  2    RFRTKFSMDQKEKMYMFAEKVGWRIQKHDEAAVQHFCAEVGVKRHVLKVWMHNNKHT  58



>ref|XP_004287891.1| PREDICTED: uncharacterized protein LOC101298828 [Fragaria vesca 
subsp. vesca]
Length=358

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QK+KM+E+AE+LGWRIQK  E  V+Q C E GV+R VFKVWMHNNK  + K
Sbjct  296  RFRTKFSQEQKDKMMEVAEKLGWRIQKHDEHEVQQLCSELGVKRQVFKVWMHNNKQAMKK  355

Query  334  KTL  342
            K L
Sbjct  356  KQL  358



>emb|CDY24844.1| BnaA08g14660D [Brassica napus]
Length=210

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM   AERLGWR+QK  + AVEQFC E G+RR V K+WMHNNK+++ K
Sbjct  149  RFRTKFTAEQKEKMFAFAERLGWRMQKHDDVAVEQFCGETGIRRQVIKIWMHNNKNSLGK  208

Query  334  K  336
            K
Sbjct  209  K  209



>ref|XP_010095248.1| hypothetical protein L484_014588 [Morus notabilis]
 gb|EXB59094.1| hypothetical protein L484_014588 [Morus notabilis]
Length=311

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF + QKEKM+ELAE+LGWRIQK  ++ V++FC E GV+R VFKVWMHNNK  + K
Sbjct  249  RFRTKFNQEQKEKMMELAEKLGWRIQKHDDQEVQRFCSEVGVKRQVFKVWMHNNKQAMKK  308

Query  334  KTL  342
            K +
Sbjct  309  KQV  311



>ref|XP_008440716.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
 ref|XP_008440717.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
 ref|XP_008440718.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
 ref|XP_008440719.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
 ref|XP_008440720.1| PREDICTED: zinc-finger homeodomain protein 2 [Cucumis melo]
Length=336

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM E AE+LGW+IQK  E  V+QFC E GVRR VFKVWMHNNK  + K
Sbjct  274  RFRTKFTQGQKDKMEEFAEKLGWKIQKHDELEVQQFCAEVGVRRQVFKVWMHNNKQGMKK  333

Query  334  KTL  342
            K +
Sbjct  334  KQM  336



>ref|XP_008388052.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
 ref|XP_008388053.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
 ref|XP_008388054.1| PREDICTED: zinc-finger homeodomain protein 2 [Malus domestica]
Length=350

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKE+M+E AER+GWRIQK+ EE VE+FC E GV+R V +VWMHNNK+T+ K
Sbjct  258  RFRTKFTVEQKERMMEFAERVGWRIQKQDEEEVERFCAEVGVKRQVLRVWMHNNKNTIKK  317

Query  334  K  336
            +
Sbjct  318  Q  318



>ref|XP_006349273.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Solanum tuberosum]
Length=287

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+  AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH++AK
Sbjct  217  RFRTKFTQEQKDKMLNFAEKVGWKIQKQEEGVVQQFCQEVGVKRRVLKVWMHNNKHSLAK  276

Query  334  KT  339
            K 
Sbjct  277  KN  278



>emb|CDO97666.1| unnamed protein product [Coffea canephora]
Length=299

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  224  RFRTKFTPEQKEKMLNFAEKVGWKIQKQEEAVVQQFCQEVGVKRRVLKVWMHNNKHNLAK  283

Query  334  KT  339
            K 
Sbjct  284  KN  285



>ref|XP_008392268.1| PREDICTED: zinc-finger homeodomain protein 6-like [Malus domestica]
Length=311

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QKEKM E+AE+LGWRIQK  E+ VE+ C E G++R VFKVWMHNNK  + K
Sbjct  249  RFRTKFSQEQKEKMTEVAEKLGWRIQKHDEQEVEKLCSEVGIKRQVFKVWMHNNKQAMKK  308

Query  334  KTL  342
            K +
Sbjct  309  KQM  311



>ref|XP_007023152.1| Homeobox protein 31 [Theobroma cacao]
 gb|EOY25774.1| Homeobox protein 31 [Theobroma cacao]
Length=292

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM+  A+++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  217  RFRTKFTQEQKEKMLNFADKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  276

Query  334  KT  339
            K 
Sbjct  277  KN  278



>ref|XP_002977929.1| hypothetical protein SELMODRAFT_59936, partial [Selaginella moellendorffii]
 ref|XP_002986956.1| hypothetical protein SELMODRAFT_49899, partial [Selaginella moellendorffii]
 gb|EFJ12038.1| hypothetical protein SELMODRAFT_49899, partial [Selaginella moellendorffii]
 gb|EFJ21267.1| hypothetical protein SELMODRAFT_59936, partial [Selaginella moellendorffii]
Length=58

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHT  324
            RFRTKFT  QKE+M  L+E+LGWRIQK  E  V QFC + GV+RHV KVWMHNNKHT
Sbjct  2    RFRTKFTNEQKERMFVLSEKLGWRIQKHDEAEVAQFCADTGVKRHVLKVWMHNNKHT  58



>ref|XP_009109241.1| PREDICTED: zinc-finger homeodomain protein 2-like [Brassica rapa]
Length=210

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM   AERLGWR+QK  + AVEQFC E G+RR V K+WMHNNK+++ K
Sbjct  149  RFRTKFTAEQKEKMFAFAERLGWRMQKHDDVAVEQFCGETGIRRQVIKIWMHNNKNSLGK  208

Query  334  K  336
            K
Sbjct  209  K  209



>ref|XP_010065227.1| PREDICTED: zinc-finger homeodomain protein 4-like [Eucalyptus 
grandis]
 gb|KCW62572.1| hypothetical protein EUGRSUZ_G00066 [Eucalyptus grandis]
Length=332

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM   AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  260  RFRTKFTQEQKEKMFSFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  319

Query  334  KT  339
            K 
Sbjct  320  KN  321



>ref|XP_010530124.1| PREDICTED: zinc-finger homeodomain protein 2 [Tarenaya hassleriana]
Length=225

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  AE+LGWRIQ+  + AVEQFC E GV+R+V K+WMHNNK+T+ K
Sbjct  164  RFRTKFTAEQKEKMLWFAEKLGWRIQRHDDAAVEQFCAETGVKRNVLKIWMHNNKNTLGK  223

Query  334  K  336
            K
Sbjct  224  K  224



>ref|XP_010927875.1| PREDICTED: zinc-finger homeodomain protein 4-like [Elaeis guineensis]
Length=263

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  A R+GWR+Q++ E  V+QFC E GV+R V KVWMHNNKH++AK
Sbjct  198  RFRTKFTPEQKEKMLNFAHRIGWRLQRQEEGMVQQFCQEIGVKRRVLKVWMHNNKHSLAK  257

Query  334  KTL  342
            K L
Sbjct  258  KEL  260



>ref|XP_009613099.1| PREDICTED: zinc-finger homeodomain protein 4 [Nicotiana tomentosiformis]
Length=304

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM   AE++GW+IQK+ E  V+QFC E G++R V KVWMHNNKH++AK
Sbjct  233  RFRTKFTQEQKEKMFNFAEKVGWKIQKQEETVVQQFCQELGIKRRVLKVWMHNNKHSLAK  292

Query  334  KT  339
            K 
Sbjct  293  KN  294



>gb|KDP40895.1| hypothetical protein JCGZ_24894 [Jatropha curcas]
Length=262

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM   AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  183  RFRTKFTQEQKEKMHNFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  242

Query  334  KT  339
            K+
Sbjct  243  KS  244



>ref|XP_002281371.1| PREDICTED: zinc-finger homeodomain protein 6 [Vitis vinifera]
Length=316

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM+E AE++GWR+QK+ EE V+Q C E GV+R VFKVWMHNNK+T+ K
Sbjct  246  RFRTKFTQEQKEKMLEYAEKVGWRMQKQYEEQVQQLCAEVGVKRQVFKVWMHNNKNTLKK  305



>ref|XP_010539898.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539899.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010539900.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X1 [Tarenaya 
hassleriana]
Length=271

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKE+M+E AE+LGWR+ K+ EE +E+FC E GV+R VFKVWMHNNK+ V K
Sbjct  208  RFRTKFTSEQKERMMEFAEKLGWRMNKQDEEELERFCAEIGVKRQVFKVWMHNNKNNVKK  267

Query  334  K  336
            +
Sbjct  268  Q  268



>ref|XP_006841247.1| hypothetical protein AMTR_s00135p00085840 [Amborella trichopoda]
 gb|ERN02922.1| hypothetical protein AMTR_s00135p00085840 [Amborella trichopoda]
Length=231

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QK+KM+  AE++GWRIQK+ E  V++FC E  V+RHV KVWMHNNKHT+ K
Sbjct  166  RFRTKFSQEQKDKMLAFAEKVGWRIQKQDEAEVQRFCAEACVKRHVLKVWMHNNKHTLGK  225

Query  334  K  336
            K
Sbjct  226  K  226



>ref|XP_010099792.1| hypothetical protein L484_010980 [Morus notabilis]
 gb|EXB80410.1| hypothetical protein L484_010980 [Morus notabilis]
Length=336

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            R RTKFT+ QKEKM+  AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  268  RIRTKFTQEQKEKMLNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  327

Query  334  KTL  342
            K +
Sbjct  328  KII  330



>ref|XP_007017558.1| Homeobox protein 33 isoform 1 [Theobroma cacao]
 ref|XP_007017559.1| Homeobox protein 33 isoform 1 [Theobroma cacao]
 gb|EOY14783.1| Homeobox protein 33 isoform 1 [Theobroma cacao]
 gb|EOY14784.1| Homeobox protein 33 isoform 1 [Theobroma cacao]
Length=296

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKH  321
            RFRTKFT+ QK+KM+E AE+LGWRI K+ EE VE+FC E GV+R VFKVWMHNNK+
Sbjct  234  RFRTKFTQEQKDKMLEFAEKLGWRINKQDEEEVEKFCAEVGVKRQVFKVWMHNNKN  289



>ref|XP_011028421.1| PREDICTED: zinc-finger homeodomain protein 4 [Populus euphratica]
Length=296

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QKEKM+  AE++GW++QK+ E  V+QFC E GV+R V KVWMHNNKH++AK
Sbjct  224  RFRTKFSQEQKEKMLNFAEKVGWKLQKQEETVVQQFCQEIGVKRRVLKVWMHNNKHSLAK  283

Query  334  KT  339
            K 
Sbjct  284  KN  285



>gb|KHN08326.1| ZF-HD homeobox protein [Glycine soja]
Length=273

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 65/99 (66%), Gaps = 3/99 (3%)
 Frame = +1

Query  43   LALPSISGSAYRe---emeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELAER  213
            LA PS+SG    +   E  E       AT + G G S  KRFRTKFT+ QK+KM+  AE+
Sbjct  127  LAHPSLSGRGGPQPPWEDLEDSDPTSGATTHDGSGSSSKKRFRTKFTQHQKDKMLVFAEK  186

Query  214  LGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVA  330
            LGWR+QK  E  V++FC E GV+RHV KVWMHNNKH +A
Sbjct  187  LGWRMQKNDESIVQEFCSEIGVQRHVLKVWMHNNKHILA  225



>gb|KHN40205.1| ZF-HD homeobox protein [Glycine soja]
Length=204

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QK+KM+  AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  133  RFRTKFSQEQKDKMLNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  192

Query  334  KT  339
            K 
Sbjct  193  KN  194



>gb|ABY61025.1| zinc finger-homeodomain protein 3, partial [Saruma henryi]
Length=211

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF + QKEKMV  AE+LGWRIQKE++  +E+FC E GV+R V KVWMHNNK+T+ K
Sbjct  139  RFRTKFMQEQKEKMVAFAEKLGWRIQKENDVELEKFCSEIGVKRQVLKVWMHNNKNTLGK  198

Query  334  K  336
            K
Sbjct  199  K  199



>ref|XP_004142854.1| PREDICTED: ZF-HD homeobox protein At4g24660-like [Cucumis sativus]
 gb|KGN51402.1| hypothetical protein Csa_5G527900 [Cucumis sativus]
Length=301

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  227  RFRTKFTAEQKEKMLRFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  286

Query  334  K  336
            K
Sbjct  287  K  287



>ref|XP_004156724.1| PREDICTED: LOW QUALITY PROTEIN: ZF-HD homeobox protein At5g65410-like 
[Cucumis sativus]
Length=301

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  227  RFRTKFTAEQKEKMLRFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  286

Query  334  K  336
            K
Sbjct  287  K  287



>ref|XP_008460585.1| PREDICTED: zinc-finger homeodomain protein 4 [Cucumis melo]
Length=298

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  224  RFRTKFTTEQKEKMLRFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  283

Query  334  K  336
            K
Sbjct  284  K  284



>ref|XP_010425030.1| PREDICTED: zinc-finger homeodomain protein 3-like [Camelina sativa]
Length=321

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM+  AER+GW++Q++ E AV+Q C E G+RR V KVWMHNNKH ++K
Sbjct  231  RFRTKFTQEQKEKMMSFAERVGWKMQRQEESAVQQLCQEIGIRRRVLKVWMHNNKHHLSK  290

Query  334  KT  339
            K+
Sbjct  291  KS  292



>ref|XP_009762783.1| PREDICTED: zinc-finger homeodomain protein 4-like [Nicotiana 
sylvestris]
Length=306

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM   AE++GW+IQK+ E  V+QFC E G++R V KVWMHNNKH +AK
Sbjct  235  RFRTKFTQEQKEKMFNFAEKVGWKIQKQEETVVQQFCQELGIKRRVLKVWMHNNKHNLAK  294

Query  334  KT  339
            K 
Sbjct  295  KN  296



>ref|XP_010912718.1| PREDICTED: zinc-finger homeodomain protein 4-like [Elaeis guineensis]
 ref|XP_010912719.1| PREDICTED: zinc-finger homeodomain protein 4-like [Elaeis guineensis]
 ref|XP_010912720.1| PREDICTED: zinc-finger homeodomain protein 4-like [Elaeis guineensis]
Length=276

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  AE++GWR+QK+ E  V+Q C E GV+R V KVWMHNNKH +AK
Sbjct  209  RFRTKFTPEQKEKMLSFAEKVGWRLQKQEESVVQQLCQEIGVKRRVLKVWMHNNKHNLAK  268

Query  334  KT  339
            K+
Sbjct  269  KS  270



>gb|EYU30955.1| hypothetical protein MIMGU_mgv1a026983mg [Erythranthe guttata]
Length=261

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            R RTKFT  QKEKM+ LAERL WRIQK+ EE V+Q C E G++RHV KVWMHNNK T+ K
Sbjct  200  RARTKFTAEQKEKMLNLAERLEWRIQKQDEEMVQQLCGEMGIKRHVLKVWMHNNKVTLGK  259

Query  334  KT  339
            KT
Sbjct  260  KT  261



>ref|XP_009416998.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416999.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=267

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  AE++GWR+QK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  201  RFRTKFTPEQKEKMLSFAEKVGWRLQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHHLAK  260

Query  334  KT  339
            K 
Sbjct  261  KN  262



>ref|XP_002525870.1| transcription factor, putative [Ricinus communis]
 gb|EEF36564.1| transcription factor, putative [Ricinus communis]
Length=311

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            R+RTKF++ QKEKM+  AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  231  RYRTKFSQEQKEKMLNFAEKVGWKIQKQEEAVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  290

Query  334  KT  339
            K+
Sbjct  291  KS  292



>ref|XP_008782488.1| PREDICTED: zinc-finger homeodomain protein 6-like [Phoenix dactylifera]
Length=259

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF+  QKE+M++ AER+GWRIQK+ E  VE+FC E GV R V KVWMHNNKH++ K
Sbjct  189  RFRTKFSAEQKERMLDFAERVGWRIQKQDEALVEEFCAEVGVSRQVLKVWMHNNKHSIRK  248

Query  334  K  336
            +
Sbjct  249  Q  249



>ref|XP_006385095.1| hypothetical protein POPTR_0004s23860g, partial [Populus trichocarpa]
 gb|ERP62892.1| hypothetical protein POPTR_0004s23860g, partial [Populus trichocarpa]
Length=312

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QKEKM+  AE++GW++QK+ E  V+QFC E GV+R V KVWMHNNKH++AK
Sbjct  241  RFRTKFSQEQKEKMLNFAEKVGWKLQKQEETVVQQFCQEIGVKRRVLKVWMHNNKHSLAK  300

Query  334  KT  339
            K 
Sbjct  301  KN  302



>ref|XP_010502266.1| PREDICTED: zinc-finger homeodomain protein 3-like [Camelina sativa]
 ref|XP_010502267.1| PREDICTED: zinc-finger homeodomain protein 3-like [Camelina sativa]
Length=313

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM+  AER+GW++Q++ E AV+Q C E G+RR V KVWMHNNKH ++K
Sbjct  224  RFRTKFTQEQKEKMMSFAERVGWKMQRQEESAVQQLCQEIGIRRRVLKVWMHNNKHHLSK  283

Query  334  KT  339
            K+
Sbjct  284  KS  285



>ref|XP_010940074.1| PREDICTED: zinc-finger homeodomain protein 6-like [Elaeis guineensis]
Length=302

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKE+M++ AERLGWRIQK+ E  V++FC E GV R V KVW+HNNKH+V K
Sbjct  232  RFRTKFTTEQKERMLDFAERLGWRIQKQDEALVDEFCAEVGVSRQVLKVWIHNNKHSVRK  291



>ref|XP_011003723.1| PREDICTED: zinc-finger homeodomain protein 6 [Populus euphratica]
 ref|XP_011003724.1| PREDICTED: zinc-finger homeodomain protein 6 [Populus euphratica]
 ref|XP_011003725.1| PREDICTED: zinc-finger homeodomain protein 6 [Populus euphratica]
 ref|XP_011003726.1| PREDICTED: zinc-finger homeodomain protein 6 [Populus euphratica]
 ref|XP_011003727.1| PREDICTED: zinc-finger homeodomain protein 6 [Populus euphratica]
 ref|XP_011003728.1| PREDICTED: zinc-finger homeodomain protein 6 [Populus euphratica]
Length=338

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRT+F+E QK+KM+E AE+LGWRIQK+ E+ V+QFC +  V+R VFKVWMHNNK  + K
Sbjct  276  RFRTRFSEEQKDKMMEFAEKLGWRIQKQDEQEVQQFCSQVDVKRKVFKVWMHNNKQAMKK  335

Query  334  K  336
            K
Sbjct  336  K  336



>ref|XP_003529692.1| PREDICTED: ZF-HD homeobox protein At5g65410-like isoform X1 [Glycine 
max]
 ref|XP_006584131.1| PREDICTED: ZF-HD homeobox protein At5g65410-like isoform X2 [Glycine 
max]
Length=283

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF++ QK+KM+  AE++GW+IQK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  212  RFRTKFSQEQKDKMLNFAEKVGWKIQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHNLAK  271

Query  334  KT  339
            K 
Sbjct  272  KN  273



>gb|EPS70696.1| hypothetical protein M569_04063, partial [Genlisea aurea]
Length=242

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+ELAE++GW++QK  E+ + QFC + GV + VF+VWMHNNK+T  K
Sbjct  181  RFRTKFTQFQKDKMLELAEKVGWKMQKRDEDLIAQFCCDIGVDKAVFRVWMHNNKNTFGK  240

Query  334  K  336
            K
Sbjct  241  K  241



>ref|XP_011085755.1| PREDICTED: zinc-finger homeodomain protein 9 [Sesamum indicum]
Length=345

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM E AER+GW++QK  E+ + +FC E GV + VFKVWMHNNK+T  K
Sbjct  203  RFRTKFTQDQKEKMFEFAERVGWKMQKRDEDVISEFCSEIGVDKGVFKVWMHNNKNTFGK  262

Query  334  K  336
            K
Sbjct  263  K  263



>emb|CBI19706.3| unnamed protein product [Vitis vinifera]
Length=321

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM+E AE++GWR+QK+ EE V+Q C E GV+R VFKVWMHNNK+T+ K
Sbjct  220  RFRTKFTQEQKEKMLEYAEKVGWRMQKQYEEQVQQLCAEVGVKRQVFKVWMHNNKNTLKK  279



>ref|XP_010029792.1| PREDICTED: zinc-finger homeodomain protein 6 [Eucalyptus grandis]
 gb|KCW56751.1| hypothetical protein EUGRSUZ_I02434 [Eucalyptus grandis]
Length=343

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QK+KM+E AE+LGWRIQK+ E+ V QFC E GV R  FKVWMHNNK  + K
Sbjct  281  RFRTKFTQQQKDKMMECAEKLGWRIQKQDEQEVTQFCAEAGVTRKAFKVWMHNNKQAMKK  340

Query  334  K  336
            +
Sbjct  341  Q  341



>ref|XP_006360403.1| PREDICTED: uncharacterized protein LOC102604466 [Solanum tuberosum]
Length=1625

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 49/101 (49%), Positives = 67/101 (66%), Gaps = 0/101 (0%)
 Frame = +1

Query  28   PLQRPLALPSISGSAYReemeeldldmdTATPNsggggskgkRFRTKFTEVQKEKMVELA  207
            P +RPLALP  SG       E+ +L    +  N+  G    KRFRTKF++  K+KM+ LA
Sbjct  107  PRERPLALPLTSGGTGGGFREDQELLEMCSPNNNINGTLLKKRFRTKFSQEHKDKMLALA  166

Query  208  ERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVA  330
            E+LGW++Q+  E  V+Q C E G++RHVFKVW+HNNKHT+ 
Sbjct  167  EKLGWKLQRHDEGVVQQLCNEIGIKRHVFKVWIHNNKHTLG  207



>ref|XP_008220815.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X2 [Prunus 
mume]
 ref|XP_008220816.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X2 [Prunus 
mume]
Length=350

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKE+M E AE++GWRIQK+ EE VE+FC E GV+R V +VWMHNNK++  K
Sbjct  258  RFRTKFTQEQKERMTEFAEKVGWRIQKQDEEEVERFCSEVGVKRQVLRVWMHNNKNSAKK  317

Query  334  KT  339
            ++
Sbjct  318  QS  319



>ref|XP_007224511.1| hypothetical protein PRUPE_ppa023369mg [Prunus persica]
 gb|EMJ25710.1| hypothetical protein PRUPE_ppa023369mg [Prunus persica]
Length=310

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKE+M+E AE++GWRIQK+ EE VE+FC E GV+R V +VWMHNNK++  K
Sbjct  246  RFRTKFTQEQKERMMEFAEKVGWRIQKQDEEEVERFCAEVGVKRQVLRVWMHNNKNSAKK  305

Query  334  KTLE  345
            +  E
Sbjct  306  QRDE  309



>ref|XP_008220812.1| PREDICTED: zinc-finger homeodomain protein 5 isoform X1 [Prunus 
mume]
Length=356

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKE+M E AE++GWRIQK+ EE VE+FC E GV+R V +VWMHNNK++  K
Sbjct  264  RFRTKFTQEQKERMTEFAEKVGWRIQKQDEEEVERFCSEVGVKRQVLRVWMHNNKNSAKK  323

Query  334  KT  339
            ++
Sbjct  324  QS  325



>ref|XP_009130511.1| PREDICTED: zinc-finger homeodomain protein 1-like [Brassica rapa]
 emb|CDY37827.1| BnaAnng04880D [Brassica napus]
Length=272

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKE+M+ LAER+GWRIQ++ +E +++FC E GV R V KVW+HNNKHT+ K
Sbjct  185  RFRTKFTAEQKERMLGLAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHNNKHTLGK  244

Query  334  KT  339
             +
Sbjct  245  SS  246



>gb|AFW79306.1| ZF-HD homeobox protein [Zea mays]
 gb|AIB04296.1| ZF-HD transcription factor, partial [Zea mays]
Length=242

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHT  324
            RFRTKFT  QKE+M+  AERLGWR+QK+ +  V+ FC + GVRR VFKVWMHNNKHT
Sbjct  164  RFRTKFTPEQKEQMLAFAERLGWRLQKQDDALVQHFCDQVGVRRQVFKVWMHNNKHT  220



>ref|NP_001152263.1| ZF-HD homeobox protein [Zea mays]
 gb|ACG46677.1| ZF-HD homeobox protein [Zea mays]
Length=242

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHT  324
            RFRTKFT  QKE+M+  AERLGWR+QK+ +  V+ FC + GVRR VFKVWMHNNKHT
Sbjct  164  RFRTKFTPEQKEQMLAFAERLGWRLQKQDDALVQHFCDQVGVRRQVFKVWMHNNKHT  220



>ref|XP_001773676.1| predicted protein [Physcomitrella patens]
 gb|EDQ61564.1| predicted protein [Physcomitrella patens]
Length=58

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHT  324
            RFRT+F   QKEKM   AE+LGW+IQK  E AV++FC E GV+RHV KVWMHNNKHT
Sbjct  2    RFRTRFNNEQKEKMGVFAEKLGWKIQKHDEAAVQEFCAEVGVKRHVLKVWMHNNKHT  58



>ref|XP_009404830.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=244

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            R RTKFT  QKEKM+  AE++GWR+QK+ E AV+Q C E GVRR V KVWMHNNKH +AK
Sbjct  178  RLRTKFTPEQKEKMLCFAEKVGWRLQKQEESAVQQLCQEIGVRRRVLKVWMHNNKHHLAK  237

Query  334  KT  339
            K+
Sbjct  238  KS  239



>ref|XP_004961117.1| PREDICTED: ZF-HD homeobox protein At5g65410-like [Setaria italica]
Length=269

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHT  324
            RFRTKFT  QKE+M+  AERLGWR+QK+ E  V+QFC + GVRR VFKVWMHNNKH+
Sbjct  181  RFRTKFTPEQKEQMLAFAERLGWRMQKQDEALVQQFCEQVGVRRQVFKVWMHNNKHS  237



>gb|ABY61028.1| zinc finger-homeodomain protein 1 [Yucca filamentosa]
Length=247

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKF+  QKEKM+  AER GW++QK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  170  RFRTKFSAEQKEKMLAFAERAGWKLQKQEESVVQQFCEEIGVKRRVLKVWMHNNKHNLAK  229

Query  334  K  336
            K
Sbjct  230  K  230



>ref|XP_009406459.1| PREDICTED: zinc-finger homeodomain protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=271

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT  QKEKM+  AE++GW++QK+ E  V+QFC E GV+R V KVWMHNNKH +AK
Sbjct  205  RFRTKFTPEQKEKMLSFAEKVGWKLQKQEESVVQQFCQEIGVKRRVLKVWMHNNKHHLAK  264

Query  334  KT  339
            K 
Sbjct  265  KN  266



>ref|XP_009763792.1| PREDICTED: zinc-finger homeodomain protein 5-like [Nicotiana 
sylvestris]
Length=289

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  154  RFRTKFTEVQKEKMVELAERLGWRIQKESEEAVEQFCIEYGVRRHVFKVWMHNNKHTVAK  333
            RFRTKFT+ QKEKM+E AE+LGWRI +E +  V++FC + GV+R VFKVWMHNNK+  AK
Sbjct  223  RFRTKFTQDQKEKMLEFAEKLGWRIPREDDTEVQRFCSQVGVKRQVFKVWMHNNKNPSAK  282

Query  334  KT  339
            K 
Sbjct  283  KN  284



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1173402497230