BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1586_g1_i1 len=2647 path=[1:0-2646]

Length=2647
                                                                      Score     E

gb|EYU39037.1|  hypothetical protein MIMGU_mgv1a021904mg                870   0.0      
ref|XP_002509668.1|  Xylem serine proteinase 1 precursor, putative      858   0.0      Ricinus communis
ref|XP_006477335.1|  PREDICTED: subtilisin-like protease-like           854   0.0      
ref|XP_006440472.1|  hypothetical protein CICLE_v10018976mg             851   0.0      
gb|KDP25552.1|  hypothetical protein JCGZ_20708                         845   0.0      
ref|XP_002275429.1|  PREDICTED: subtilisin-like protease                839   0.0      Vitis vinifera
ref|XP_010325680.1|  PREDICTED: subtilisin-like protease                856   0.0      
gb|EYU39036.1|  hypothetical protein MIMGU_mgv1a026993mg                835   0.0      
ref|XP_011071709.1|  PREDICTED: subtilisin-like protease                850   0.0      
ref|XP_007040055.1|  Subtilase family protein                           843   0.0      
ref|XP_007208895.1|  hypothetical protein PRUPE_ppa026788mg             828   0.0      
ref|XP_009781097.1|  PREDICTED: subtilisin-like protease                827   0.0      
ref|XP_002303550.2|  hypothetical protein POPTR_0003s11860g             825   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008238738.1|  PREDICTED: subtilisin-like protease                823   0.0      
gb|EYU39035.1|  hypothetical protein MIMGU_mgv1a001882mg                822   0.0      
ref|XP_009781098.1|  PREDICTED: subtilisin-like protease                822   0.0      
ref|XP_006440471.1|  hypothetical protein CICLE_v10024346mg             822   0.0      
gb|KDO63675.1|  hypothetical protein CISIN_1g048043mg                   821   0.0      
ref|XP_004300734.1|  PREDICTED: subtilisin-like protease-like           820   0.0      
ref|XP_009629566.1|  PREDICTED: subtilisin-like protease                819   0.0      
ref|XP_009781099.1|  PREDICTED: subtilisin-like protease                826   0.0      
ref|XP_006477585.1|  PREDICTED: subtilisin-like protease-like           818   0.0      
ref|XP_008238728.1|  PREDICTED: subtilisin-like protease SDD1           819   0.0      
gb|EYU39034.1|  hypothetical protein MIMGU_mgv1a019276mg                815   0.0      
ref|XP_004300737.1|  PREDICTED: subtilisin-like protease SDD1-like      815   0.0      
ref|XP_008238739.1|  PREDICTED: subtilisin-like protease                815   0.0      
ref|XP_011081167.1|  PREDICTED: subtilisin-like protease SDD1           827   0.0      
ref|XP_002275471.2|  PREDICTED: uncharacterized protein LOC100242816    840   0.0      Vitis vinifera
ref|XP_010053378.1|  PREDICTED: subtilisin-like protease SDD1           814   0.0      
ref|XP_007208831.1|  hypothetical protein PRUPE_ppa025337mg             813   0.0      
ref|XP_011071279.1|  PREDICTED: subtilisin-like protease                811   0.0      
ref|XP_011034012.1|  PREDICTED: uncharacterized protein LOC105132300    837   0.0      
ref|XP_010053374.1|  PREDICTED: subtilisin-like protease SDD1           811   0.0      
gb|KDP25551.1|  hypothetical protein JCGZ_20707                         811   0.0      
ref|XP_007208859.1|  hypothetical protein PRUPE_ppa025839mg             809   0.0      
gb|KDO47505.1|  hypothetical protein CISIN_1g042259mg                   810   0.0      
ref|XP_006358907.1|  PREDICTED: subtilisin-like protease-like           804   0.0      
ref|XP_011071267.1|  PREDICTED: subtilisin-like protease SDD1           806   0.0      
gb|KCW77772.1|  hypothetical protein EUGRSUZ_D02072                     808   0.0      
ref|XP_009776158.1|  PREDICTED: subtilisin-like protease                804   0.0      
ref|XP_010108074.1|  Subtilisin-like protease SDD1                      806   0.0      
ref|XP_003525747.1|  PREDICTED: subtilisin-like protease SDD1-like      804   0.0      
emb|CDP09846.1|  unnamed protein product                                801   0.0      
ref|XP_009629568.1|  PREDICTED: subtilisin-like protease                802   0.0      
ref|XP_009362845.1|  PREDICTED: subtilisin-like protease                801   0.0      
ref|XP_011071248.1|  PREDICTED: subtilisin-like protease                800   0.0      
ref|XP_009599111.1|  PREDICTED: subtilisin-like protease                799   0.0      
ref|XP_004300738.1|  PREDICTED: subtilisin-like protease SDD1-like      799   0.0      
ref|XP_008381953.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    803   0.0      
ref|XP_011033844.1|  PREDICTED: subtilisin-like protease SDD1           798   0.0      
ref|XP_008381935.1|  PREDICTED: subtilisin-like protease SDD1           797   0.0      
gb|KCW77656.1|  hypothetical protein EUGRSUZ_D01954                     794   0.0      
ref|XP_009767058.1|  PREDICTED: subtilisin-like protease                797   0.0      
emb|CDP11959.1|  unnamed protein product                                796   0.0      
ref|XP_006358904.1|  PREDICTED: subtilisin-like protease-like           796   0.0      
gb|EYU39033.1|  hypothetical protein MIMGU_mgv1a001909mg                795   0.0      
ref|XP_004147596.1|  PREDICTED: subtilisin-like protease SDD1-like      794   0.0      
ref|XP_004244591.1|  PREDICTED: subtilisin-like protease                793   0.0      
gb|KCW77653.1|  hypothetical protein EUGRSUZ_D01951                     790   0.0      
ref|XP_008437181.1|  PREDICTED: subtilisin-like protease                793   0.0      
ref|XP_006428960.1|  hypothetical protein CICLE_v10011144mg             792   0.0      
ref|XP_006480601.1|  PREDICTED: subtilisin-like protease-like           792   0.0      
dbj|BAF95754.1|  subtilase                                              792   0.0      Lotus japonicus
ref|XP_002303551.2|  hypothetical protein POPTR_0003s11870g             793   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011081071.1|  PREDICTED: subtilisin-like protease                790   0.0      
ref|XP_004246134.2|  PREDICTED: subtilisin-like protease                790   0.0      
ref|XP_002275410.2|  PREDICTED: subtilisin-like protease SDD1           790   0.0      Vitis vinifera
ref|XP_007211044.1|  hypothetical protein PRUPE_ppa019040mg             789   0.0      
ref|XP_003550884.1|  PREDICTED: subtilisin-like protease SDD1-like      788   0.0      
ref|XP_006358147.1|  PREDICTED: subtilisin-like protease SDD1-like      787   0.0      
ref|XP_006358961.1|  PREDICTED: subtilisin-like protease-like           788   0.0      
ref|XP_002299578.1|  hypothetical protein POPTR_0001s08340g             786   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009776224.1|  PREDICTED: subtilisin-like protease                786   0.0      
ref|XP_008238737.1|  PREDICTED: subtilisin-like protease                787   0.0      
ref|XP_010108071.1|  Subtilisin-like protease SDD1                      789   0.0      
gb|KHN34449.1|  Subtilisin-like protease SDD1                           783   0.0      
ref|XP_002509669.1|  Cucumisin precursor, putative                      786   0.0      Ricinus communis
ref|XP_009760563.1|  PREDICTED: subtilisin-like protease                783   0.0      
ref|XP_003538718.1|  PREDICTED: subtilisin-like protease-like           784   0.0      
gb|ADY38794.1|  serine protease                                         784   0.0      
gb|KCW72062.1|  hypothetical protein EUGRSUZ_E00506                     783   0.0      
ref|XP_006440474.1|  hypothetical protein CICLE_v10023558mg             783   0.0      
gb|KDP25559.1|  hypothetical protein JCGZ_20715                         782   0.0      
ref|XP_006477586.1|  PREDICTED: subtilisin-like protease SDD1-like      782   0.0      
ref|XP_007155580.1|  hypothetical protein PHAVU_003G214100g             782   0.0      
gb|EYU28956.1|  hypothetical protein MIMGU_mgv1a023117mg                781   0.0      
gb|EYU28961.1|  hypothetical protein MIMGU_mgv1a020058mg                781   0.0      
ref|XP_007158428.1|  hypothetical protein PHAVU_002G152400g             781   0.0      
ref|XP_004245672.2|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    806   0.0      
gb|EYU29563.1|  hypothetical protein MIMGU_mgv1a022413mg                781   0.0      
ref|XP_009629567.1|  PREDICTED: subtilisin-like protease                777   0.0      
dbj|BAF95755.1|  subtilase                                              780   0.0      Lotus japonicus
gb|KEH31683.1|  subtilisin-like serine protease                         781   0.0      
ref|XP_003611191.1|  Subtilisin-like serine protease                    780   0.0      
gb|ADZ55305.1|  serine protease                                         780   0.0      
dbj|BAF95753.1|  subtilase                                              780   0.0      Lotus japonicus
ref|XP_004244588.1|  PREDICTED: subtilisin-like protease                779   0.0      
ref|XP_006358842.1|  PREDICTED: subtilisin-like protease-like           775   0.0      
ref|XP_004244715.1|  PREDICTED: subtilisin-like protease                778   0.0      
gb|KHN09747.1|  Subtilisin-like protease SDD1                           776   0.0      
ref|XP_006358408.1|  PREDICTED: subtilisin-like protease-like           778   0.0      
gb|ABZ89187.1|  putative protein                                        778   0.0      Coffea canephora [robusta coffee]
ref|XP_006358146.1|  PREDICTED: subtilisin-like protease SDD1-like      777   0.0      
ref|XP_006358406.1|  PREDICTED: subtilisin-like protease-like           777   0.0      
emb|CDP11276.1|  unnamed protein product                                777   0.0      
ref|XP_003517445.1|  PREDICTED: subtilisin-like protease SDD1-like      776   0.0      
gb|EPS72428.1|  serine protease                                         775   0.0      
ref|XP_009609835.1|  PREDICTED: subtilisin-like protease SDD1           769   0.0      
gb|EYU29562.1|  hypothetical protein MIMGU_mgv1a001898mg                775   0.0      
ref|XP_011081166.1|  PREDICTED: subtilisin-like protease SDD1           793   0.0      
ref|XP_011029125.1|  PREDICTED: subtilisin-like protease SDD1           776   0.0      
ref|XP_003611185.1|  Subtilisin-like serine protease                    775   0.0      
gb|ABG37022.1|  serine protease                                         775   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009614059.1|  PREDICTED: subtilisin-like protease                775   0.0      
emb|CDP09844.1|  unnamed protein product                                775   0.0      
ref|XP_010910929.1|  PREDICTED: subtilisin-like protease SDD1           774   0.0      
ref|XP_006358372.1|  PREDICTED: subtilisin-like protease-like           773   0.0      
ref|XP_002303548.2|  hypothetical protein POPTR_0003s11840g             773   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003611195.1|  Subtilisin-like serine protease                    773   0.0      
ref|XP_004300736.1|  PREDICTED: subtilisin-like protease SDD1-like      773   0.0      
ref|XP_006363697.1|  PREDICTED: subtilisin-like protease-like           772   0.0      
ref|XP_010918673.1|  PREDICTED: subtilisin-like protease SDD1           772   0.0      
ref|XP_009604592.1|  PREDICTED: subtilisin-like protease                771   0.0      
ref|XP_004300735.1|  PREDICTED: subtilisin-like protease-like           772   0.0      
ref|XP_004244590.1|  PREDICTED: subtilisin-like protease                771   0.0      
gb|EYU28957.1|  hypothetical protein MIMGU_mgv1a020114mg                771   0.0      
ref|XP_003611198.1|  Subtilisin-like serine protease                    771   0.0      
ref|XP_002325705.1|  hypothetical protein POPTR_0019s00970g             769   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009608769.1|  PREDICTED: subtilisin-like protease SDD1           770   0.0      
ref|XP_003549875.1|  PREDICTED: subtilisin-like protease SDD1-like      770   0.0      
ref|XP_009762964.1|  PREDICTED: subtilisin-like protease SDD1           770   0.0      
gb|EYU22359.1|  hypothetical protein MIMGU_mgv1a023284mg                769   0.0      
ref|XP_008238729.1|  PREDICTED: subtilisin-like protease                769   0.0      
ref|XP_006358405.1|  PREDICTED: subtilisin-like protease-like           768   0.0      
gb|AES94159.2|  subtilisin-like serine protease                         769   0.0      
ref|XP_003611201.1|  Subtilisin-like serine protease                    768   0.0      
ref|XP_002509656.1|  Xylem serine proteinase 1 precursor, putative      768   0.0      Ricinus communis
gb|EYU39031.1|  hypothetical protein MIMGU_mgv1a025139mg                766   0.0      
ref|XP_006358905.1|  PREDICTED: subtilisin-like protease SDD1-like      763   0.0      
ref|XP_003611190.1|  Subtilisin-like serine protease                    768   0.0      
gb|EYU39032.1|  hypothetical protein MIMGU_mgv1a023804mg                766   0.0      
ref|XP_003611196.1|  Subtilisin-like serine protease                    767   0.0      
ref|XP_002509665.1|  Xylem serine proteinase 1 precursor, putative      767   0.0      Ricinus communis
ref|XP_011081168.1|  PREDICTED: subtilisin-like protease SDD1           766   0.0      
ref|XP_002509661.1|  Xylem serine proteinase 1 precursor, putative      766   0.0      Ricinus communis
ref|XP_003538510.1|  PREDICTED: subtilisin-like protease-like           766   0.0      
ref|XP_008804041.1|  PREDICTED: subtilisin-like protease SDD1           766   0.0      
ref|XP_004515784.1|  PREDICTED: subtilisin-like protease SDD1-like      766   0.0      
ref|XP_002509658.1|  Xylem serine proteinase 1 precursor, putative      765   0.0      Ricinus communis
ref|XP_004147599.1|  PREDICTED: subtilisin-like protease-like           764   0.0      
ref|XP_006358407.1|  PREDICTED: subtilisin-like protease-like           765   0.0      
ref|XP_006363698.1|  PREDICTED: subtilisin-like protease-like           764   0.0      
ref|XP_006358371.1|  PREDICTED: subtilisin-like protease-like           765   0.0      
ref|XP_009614060.1|  PREDICTED: subtilisin-like protease SDD1           764   0.0      
ref|XP_009373361.1|  PREDICTED: subtilisin-like protease                765   0.0      
ref|XP_007210956.1|  hypothetical protein PRUPE_ppa023717mg             763   0.0      
gb|EYU39026.1|  hypothetical protein MIMGU_mgv1a019074mg                762   0.0      
gb|KHN09746.1|  Subtilisin-like protease SDD1                           760   0.0      
ref|XP_009608768.1|  PREDICTED: subtilisin-like protease SDD1           763   0.0      
gb|KDO63673.1|  hypothetical protein CISIN_1g039265mg                   761   0.0      
ref|XP_004244716.2|  PREDICTED: subtilisin-like protease                763   0.0      
ref|XP_004245680.1|  PREDICTED: subtilisin-like protease                762   0.0      
ref|NP_001233982.1|  subtilisin-like protease precursor                 761   0.0      
emb|CDP10007.1|  unnamed protein product                                761   0.0      
ref|XP_009762965.1|  PREDICTED: subtilisin-like protease SDD1           760   0.0      
ref|XP_009767059.1|  PREDICTED: subtilisin-like protease                760   0.0      
emb|CAA76727.1|  P69D protein                                           759   0.0      Solanum lycopersicum
ref|XP_009776157.1|  PREDICTED: subtilisin-like protease                759   0.0      
ref|XP_004166925.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    758   0.0      
emb|CAA07250.1|  serine protease                                        759   0.0      Solanum lycopersicum
ref|XP_008437177.1|  PREDICTED: subtilisin-like protease                759   0.0      
ref|XP_007158429.1|  hypothetical protein PHAVU_002G152500g             759   0.0      
ref|XP_009760953.1|  PREDICTED: subtilisin-like protease                758   0.0      
gb|KDP25554.1|  hypothetical protein JCGZ_20710                         756   0.0      
ref|XP_007210332.1|  hypothetical protein PRUPE_ppa002068mg             754   0.0      
ref|XP_006363699.1|  PREDICTED: subtilisin-like protease SDD1-like      754   0.0      
gb|EYU39029.1|  hypothetical protein MIMGU_mgv1a019332mg                752   0.0      
ref|XP_004511627.1|  PREDICTED: subtilisin-like protease-like           754   0.0      
ref|XP_010317341.1|  PREDICTED: subtilisin-like protease                751   0.0      
gb|KDP25558.1|  hypothetical protein JCGZ_20714                         751   0.0      
ref|XP_004245677.2|  PREDICTED: subtilisin-like protease                751   0.0      
gb|EYU29564.1|  hypothetical protein MIMGU_mgv1a023796mg                750   0.0      
ref|XP_003611192.1|  Subtilisin-like serine protease                    750   0.0      
ref|XP_004308725.1|  PREDICTED: subtilisin-like protease SDD1-like      750   0.0      
ref|XP_003525749.1|  PREDICTED: subtilisin-like protease SDD1-like      749   0.0      
gb|AES94150.2|  subtilisin-like serine protease                         750   0.0      
ref|XP_002509660.1|  Xylem serine proteinase 1 precursor, putative      749   0.0      Ricinus communis
ref|XP_006358840.1|  PREDICTED: subtilisin-like protease SDD1-like      748   0.0      
ref|XP_004512194.1|  PREDICTED: subtilisin-like protease-like           748   0.0      
ref|XP_006358841.1|  PREDICTED: subtilisin-like protease-like           747   0.0      
ref|XP_004511628.1|  PREDICTED: subtilisin-like protease-like           747   0.0      
ref|XP_010058211.1|  PREDICTED: subtilisin-like protease SDD1           746   0.0      
gb|KDP25555.1|  hypothetical protein JCGZ_20711                         744   0.0      
emb|CAA06413.1|  P69E protein                                           744   0.0      Solanum lycopersicum
gb|EYU39027.1|  hypothetical protein MIMGU_mgv1a019149mg                742   0.0      
ref|XP_006358144.1|  PREDICTED: subtilisin-like protease SDD1-like      742   0.0      
ref|XP_008437722.1|  PREDICTED: subtilisin-like protease                743   0.0      
gb|EYU28960.1|  hypothetical protein MIMGU_mgv1a018215mg                738   0.0      
ref|XP_009616445.1|  PREDICTED: subtilisin-like protease                739   0.0      
gb|KCW87517.1|  hypothetical protein EUGRSUZ_B03965                     739   0.0      
ref|XP_006464862.1|  PREDICTED: subtilisin-like protease SDD1-like      738   0.0      
gb|KHN34450.1|  Subtilisin-like protease SDD1                           736   0.0      
ref|XP_006427879.1|  hypothetical protein CICLE_v10027438mg             738   0.0      
ref|XP_010046741.1|  PREDICTED: subtilisin-like protease SDD1           738   0.0      
ref|XP_010034346.1|  PREDICTED: subtilisin-like protease SDD1           738   0.0      
ref|XP_009411516.1|  PREDICTED: subtilisin-like protease                738   0.0      
ref|XP_004244717.1|  PREDICTED: subtilisin-like protease                736   0.0      
ref|XP_010041553.1|  PREDICTED: subtilisin-like protease SDD1           736   0.0      
ref|XP_004245675.2|  PREDICTED: subtilisin-like protease                736   0.0      
emb|CAB67119.1|  subtilisin-like protease                               736   0.0      Solanum lycopersicum
ref|XP_008381959.1|  PREDICTED: subtilisin-like protease SDD1           754   0.0      
gb|KCW51739.1|  hypothetical protein EUGRSUZ_J01198                     733   0.0      
ref|XP_004245678.1|  PREDICTED: subtilisin-like protease SDD1           734   0.0      
ref|XP_009382355.1|  PREDICTED: subtilisin-like protease                733   0.0      
gb|KCW72066.1|  hypothetical protein EUGRSUZ_E00511                     730   0.0      
gb|EPS72026.1|  serine protease                                         731   0.0      
ref|XP_002509667.1|  Xylem serine proteinase 1 precursor, putative      732   0.0      Ricinus communis
ref|XP_006468883.1|  PREDICTED: subtilisin-like protease-like           731   0.0      
ref|XP_011081245.1|  PREDICTED: subtilisin-like protease SDD1           728   0.0      
gb|KDP25553.1|  hypothetical protein JCGZ_20709                         731   0.0      
ref|NP_001234257.1|  subtilisin-like endoprotease precursor             730   0.0      
ref|XP_006358906.1|  PREDICTED: subtilisin-like protease SDD1-like      726   0.0      
ref|XP_010058417.1|  PREDICTED: subtilisin-like protease                747   0.0      
ref|XP_004245674.1|  PREDICTED: subtilisin-like protease                728   0.0      
gb|KDP25556.1|  hypothetical protein JCGZ_20712                         728   0.0      
ref|XP_010051224.1|  PREDICTED: subtilisin-like protease                726   0.0      
ref|XP_006446036.1|  hypothetical protein CICLE_v10018202mg             726   0.0      
gb|KCW51741.1|  hypothetical protein EUGRSUZ_J01200                     724   0.0      
emb|CDP10008.1|  unnamed protein product                                748   0.0      
emb|CDO99977.1|  unnamed protein product                                724   0.0      
gb|KCW51742.1|  hypothetical protein EUGRSUZ_J01202                     724   0.0      
ref|XP_006493680.1|  PREDICTED: subtilisin-like protease-like           725   0.0      
ref|XP_002275381.2|  PREDICTED: subtilisin-like protease SDD1           736   0.0      Vitis vinifera
ref|XP_006358145.1|  PREDICTED: subtilisin-like protease-like           720   0.0      
ref|XP_006469111.1|  PREDICTED: subtilisin-like protease-like           723   0.0      
ref|XP_009586892.1|  PREDICTED: subtilisin-like protease SDD1           723   0.0      
ref|XP_010058207.1|  PREDICTED: subtilisin-like protease                740   0.0      
ref|XP_006446947.1|  hypothetical protein CICLE_v10014389mg             722   0.0      
ref|XP_006446945.1|  hypothetical protein CICLE_v10017946mg             722   0.0      
gb|EYU29357.1|  hypothetical protein MIMGU_mgv1a021077mg                719   0.0      
ref|XP_010317342.1|  PREDICTED: subtilisin-like protease                715   0.0      
gb|EYU29361.1|  hypothetical protein MIMGU_mgv1a026567mg                716   0.0      
gb|KCW81559.1|  hypothetical protein EUGRSUZ_C02917                     714   0.0      
ref|XP_010051225.1|  PREDICTED: subtilisin-like protease                714   0.0      
ref|XP_008811118.1|  PREDICTED: subtilisin-like protease SDD1           710   0.0      
ref|XP_010942947.1|  PREDICTED: subtilisin-like protease SDD1           708   0.0      
gb|EYU39028.1|  hypothetical protein MIMGU_mgv1a002635mg                702   0.0      
gb|KCW81560.1|  hypothetical protein EUGRSUZ_C02918                     703   0.0      
ref|XP_009775744.1|  PREDICTED: subtilisin-like protease                699   0.0      
gb|EYU37178.1|  hypothetical protein MIMGU_mgv1a001832mg                704   0.0      
ref|XP_010918181.1|  PREDICTED: subtilisin-like protease                704   0.0      
ref|XP_006446946.1|  hypothetical protein CICLE_v10017639mg             703   0.0      
gb|EYU28634.1|  hypothetical protein MIMGU_mgv1a024623mg                701   0.0      
gb|EYU37168.1|  hypothetical protein MIMGU_mgv1a026826mg                703   0.0      
gb|EYU18559.1|  hypothetical protein MIMGU_mgv1a019487mg                701   0.0      
gb|EYU29555.1|  hypothetical protein MIMGU_mgv1a022042mg                700   0.0      
ref|XP_009412853.1|  PREDICTED: subtilisin-like protease SDD1           699   0.0      
ref|XP_004249616.1|  PREDICTED: subtilisin-like protease                697   0.0      
gb|EYU29561.1|  hypothetical protein MIMGU_mgv1a018614mg                693   0.0      
emb|CAA76726.1|  P69C protein                                           690   0.0      Solanum lycopersicum
ref|XP_011081104.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    688   0.0      
ref|XP_010905124.1|  PREDICTED: subtilisin-like protease                696   0.0      
ref|XP_006347484.1|  PREDICTED: subtilisin-like protease SDD1-like      692   0.0      
ref|XP_006339269.1|  PREDICTED: subtilisin-like protease-like           689   0.0      
ref|XP_006857970.1|  hypothetical protein AMTR_s00069p00178060          687   0.0      
ref|XP_010042392.1|  PREDICTED: subtilisin-like protease SDD1           683   0.0      
ref|XP_009625523.1|  PREDICTED: subtilisin-like protease SDD1           677   0.0      
ref|XP_010909887.1|  PREDICTED: subtilisin-like protease SDD1           681   0.0      
ref|XP_010920351.1|  PREDICTED: subtilisin-like protease                680   0.0      
ref|XP_008802434.1|  PREDICTED: subtilisin-like protease SDD1           679   0.0      
gb|EYU33439.1|  hypothetical protein MIMGU_mgv1a026748mg                678   0.0      
gb|EYU33438.1|  hypothetical protein MIMGU_mgv1a026511mg                677   0.0      
gb|EYU28633.1|  hypothetical protein MIMGU_mgv1a023843mg                676   0.0      
gb|EYU33437.1|  hypothetical protein MIMGU_mgv1a001845mg                676   0.0      
gb|EYU28958.1|  hypothetical protein MIMGU_mgv1a020772mg                671   0.0      
ref|XP_006339268.1|  PREDICTED: subtilisin-like protease-like           672   0.0      
ref|XP_010920352.1|  PREDICTED: subtilisin-like protease SDD1           674   0.0      
ref|XP_009391775.1|  PREDICTED: subtilisin-like protease                673   0.0      
gb|KCW72825.1|  hypothetical protein EUGRSUZ_E01269                     669   0.0      
gb|EYU33441.1|  hypothetical protein MIMGU_mgv1a022698mg                671   0.0      
ref|XP_010227224.1|  PREDICTED: subtilisin-like protease                670   0.0      
ref|XP_008802988.1|  PREDICTED: subtilisin-like protease SDD1           671   0.0      
ref|XP_008669035.1|  PREDICTED: subtilisin-like protease                669   0.0      
ref|XP_006857977.1|  hypothetical protein AMTR_s00069p00178740          671   0.0      
ref|XP_004249825.2|  PREDICTED: subtilisin-like protease                665   0.0      
ref|XP_006857969.1|  hypothetical protein AMTR_s00069p00177600          671   0.0      
ref|XP_006339270.1|  PREDICTED: subtilisin-like protease-like           664   0.0      
ref|XP_002448316.1|  hypothetical protein SORBIDRAFT_06g025110          667   0.0      
gb|EYU29364.1|  hypothetical protein MIMGU_mgv1a022867mg                665   0.0      
ref|XP_007210344.1|  hypothetical protein PRUPE_ppa001885mg             667   0.0      
ref|XP_010910904.1|  PREDICTED: subtilisin-like protease                665   0.0      
ref|XP_004978176.1|  PREDICTED: subtilisin-like protease-like           665   0.0      
ref|XP_003580717.1|  PREDICTED: subtilisin-like protease                665   0.0      
emb|CDP09941.1|  unnamed protein product                                659   0.0      
gb|EMT25192.1|  Subtilisin-like protease                                663   0.0      
ref|XP_010919425.1|  PREDICTED: subtilisin-like protease                662   0.0      
ref|XP_010919426.1|  PREDICTED: subtilisin-like protease SDD1           659   0.0      
ref|XP_009385240.1|  PREDICTED: subtilisin-like protease                659   0.0      
gb|KHN25749.1|  Subtilisin-like protease SDD1                           651   0.0      
ref|XP_009383068.1|  PREDICTED: subtilisin-like protease SDD1           656   0.0      
emb|CDP20400.1|  unnamed protein product                                652   0.0      
ref|XP_006339267.1|  PREDICTED: subtilisin-like protease-like           652   0.0      
tpg|DAA36487.1|  TPA: putative subtilase family protein                 654   0.0      
ref|XP_009383070.1|  PREDICTED: subtilisin-like protease                669   0.0      
ref|XP_008669034.1|  PREDICTED: subtilisin-like protease                653   0.0      
ref|XP_006857959.1|  hypothetical protein AMTR_s00069p00172550          651   0.0      
ref|XP_010240233.1|  PREDICTED: subtilisin-like protease SDD1           646   0.0      
ref|XP_009383069.1|  PREDICTED: subtilisin-like protease                646   0.0      
ref|XP_010915125.1|  PREDICTED: subtilisin-like protease SDD1           645   0.0      
ref|XP_008780363.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    643   0.0      
gb|EYU29014.1|  hypothetical protein MIMGU_mgv1a001970mg                643   0.0      
ref|NP_001048778.1|  Os03g0119300                                       643   0.0      
ref|XP_004985590.1|  PREDICTED: subtilisin-like protease-like           641   0.0      
ref|XP_010919428.1|  PREDICTED: subtilisin-like protease                643   0.0      
ref|XP_006650980.1|  PREDICTED: subtilisin-like protease SDD1-like      639   0.0      
ref|XP_002459999.1|  hypothetical protein SORBIDRAFT_02g020470          640   0.0      
gb|EYU39048.1|  hypothetical protein MIMGU_mgv1a002011mg                635   0.0      
ref|XP_004985952.1|  PREDICTED: subtilisin-like protease SDD1-like      635   0.0      
ref|XP_008652529.1|  PREDICTED: subtilisin-like protease                634   0.0      
ref|XP_008671366.1|  PREDICTED: subtilisin-like protease                633   0.0      
ref|NP_001053537.1|  Os04g0559000                                       630   0.0      
ref|XP_010942946.1|  PREDICTED: subtilisin-like protease SDD1           632   0.0      
ref|XP_004977944.1|  PREDICTED: subtilisin-like protease-like           634   0.0      
ref|XP_003579422.1|  PREDICTED: subtilisin-like protease                629   0.0      
gb|EAY95140.1|  hypothetical protein OsI_16958                          629   0.0      
ref|XP_010925147.1|  PREDICTED: subtilisin-like protease                630   0.0      
emb|CAH68048.1|  B0103C08-B0602B01.5                                    629   0.0      
gb|EAY79268.1|  hypothetical protein OsI_34383                          625   0.0      
ref|XP_009380222.1|  PREDICTED: subtilisin-like protease                624   0.0      
ref|XP_002465976.1|  hypothetical protein SORBIDRAFT_01g049280          625   0.0      
ref|XP_010906821.1|  PREDICTED: subtilisin-like protease SDD1           625   0.0      
ref|NP_001065109.1|  Os10g0524600                                       625   0.0      
ref|XP_006661975.1|  PREDICTED: subtilisin-like protease-like           624   0.0      
dbj|BAK05599.1|  predicted protein                                      624   0.0      
ref|XP_006652630.1|  PREDICTED: subtilisin-like protease-like           623   0.0      
ref|XP_003571590.1|  PREDICTED: subtilisin-like protease                622   0.0      
ref|XP_008804292.1|  PREDICTED: subtilisin-like protease SDD1           622   0.0      
ref|XP_002465042.1|  hypothetical protein SORBIDRAFT_01g031090          620   0.0      
ref|XP_004983865.1|  PREDICTED: subtilisin-like protease SDD1-like      616   0.0      
tpg|DAA42972.1|  TPA: putative subtilase family protein                 615   0.0      
ref|XP_003580309.1|  PREDICTED: subtilisin-like protease SDD1           615   0.0      
ref|XP_008809520.1|  PREDICTED: subtilisin-like protease                616   0.0      
gb|EMT17822.1|  Subtilisin-like protease                                611   0.0      
gb|ACG29187.1|  subtilisin-like protease precursor                      611   0.0      
ref|XP_002442286.1|  hypothetical protein SORBIDRAFT_08g017490          605   0.0      
ref|XP_010918054.1|  PREDICTED: subtilisin-like protease                598   0.0      
gb|AFW89785.1|  putative subtilase family protein                       602   0.0      
gb|ACN30792.1|  unknown                                                 602   0.0      
ref|NP_001148151.1|  xylem serine proteinase 1 precursor                601   0.0      
ref|XP_004964076.1|  PREDICTED: subtilisin-like protease-like           597   0.0      
ref|XP_010919951.1|  PREDICTED: subtilisin-like protease                596   0.0      
ref|XP_009768778.1|  PREDICTED: subtilisin-like protease                588   0.0      
ref|XP_002441813.1|  hypothetical protein SORBIDRAFT_08g002720          593   0.0      
ref|NP_001167816.1|  putative subtilase family protein precursor        591   0.0      
ref|XP_010906822.1|  PREDICTED: subtilisin-like protease SDD1           590   0.0      
ref|XP_006664000.1|  PREDICTED: subtilisin-like protease SDD1-like      586   0.0      
ref|XP_004962635.1|  PREDICTED: subtilisin-like protease SDD1-like      585   0.0      
ref|XP_009410172.1|  PREDICTED: subtilisin-like protease                583   0.0      
ref|NP_001066666.2|  Os12g0427600                                       583   0.0      
ref|XP_002443309.1|  hypothetical protein SORBIDRAFT_08g017330          583   0.0      
ref|XP_010937154.1|  PREDICTED: subtilisin-like protease SDD1           583   0.0      
ref|XP_004964095.1|  PREDICTED: subtilisin-like protease-like           581   0.0      
ref|XP_010915013.1|  PREDICTED: subtilisin-like protease                582   0.0      
ref|XP_009383056.1|  PREDICTED: subtilisin-like protease SDD1           579   0.0      
ref|XP_010943371.1|  PREDICTED: subtilisin-like protease SDD1           578   0.0      
ref|XP_010919952.1|  PREDICTED: subtilisin-like protease SDD1           578   0.0      
ref|XP_010906967.1|  PREDICTED: subtilisin-like protease SDD1           578   0.0      
ref|XP_008787169.1|  PREDICTED: subtilisin-like protease SDD1           577   0.0      
gb|EEE53126.1|  hypothetical protein OsJ_35920                          573   0.0      
ref|XP_004953387.1|  PREDICTED: subtilisin-like protease SDD1-like      576   0.0      
ref|XP_008796316.1|  PREDICTED: subtilisin-like protease SDD1           572   0.0      
dbj|BAK05043.1|  predicted protein                                      572   0.0      
ref|XP_008805738.1|  PREDICTED: subtilisin-like protease SDD1           572   0.0      
gb|EEC69176.1|  hypothetical protein OsI_38146                          570   0.0      
ref|XP_010937155.1|  PREDICTED: subtilisin-like protease SDD1           570   0.0      
ref|XP_010915012.1|  PREDICTED: subtilisin-like protease                570   0.0      
gb|KCW72823.1|  hypothetical protein EUGRSUZ_E01266                     563   0.0      
gb|EAY86991.1|  hypothetical protein OsI_08385                          566   0.0      
ref|XP_003572795.2|  PREDICTED: subtilisin-like protease SDD1           565   0.0      
ref|NP_001047665.1|  Os02g0665300                                       564   0.0      
ref|XP_003520616.1|  PREDICTED: subtilisin-like protease SDD1-like      560   0.0      
gb|EMT05795.1|  Subtilisin-like protease                                559   0.0      
ref|XP_009403478.1|  PREDICTED: subtilisin-like protease SDD1           560   0.0      
gb|EMT05796.1|  Subtilisin-like protease                                559   0.0      
ref|XP_008235585.1|  PREDICTED: subtilisin-like protease SDD1           558   0.0      
ref|XP_007040056.1|  Subtilase family protein, putative                 547   0.0      
gb|EMT05794.1|  Subtilisin-like protease                                556   0.0      
ref|XP_002526537.1|  Cucumisin precursor, putative                      556   0.0      
ref|XP_003554304.1|  PREDICTED: subtilisin-like protease SDD1-like      555   0.0      
ref|XP_007201801.1|  hypothetical protein PRUPE_ppa001773mg             554   0.0      
ref|XP_004493834.1|  PREDICTED: subtilisin-like protease SDD1-like      553   0.0      
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease                553   1e-180   
ref|XP_004242535.1|  PREDICTED: subtilisin-like protease SDD1           553   1e-180   
ref|XP_010262465.1|  PREDICTED: subtilisin-like protease SDD1           552   1e-180   
dbj|BAB03290.1|  subtilisin-like serine protease                        553   1e-180   
gb|EYU39344.1|  hypothetical protein MIMGU_mgv1a024295mg                544   5e-180   
gb|EAZ05187.1|  hypothetical protein OsI_27385                          551   7e-180   
gb|EMS46560.1|  Subtilisin-like protease                                550   7e-180   
gb|EMS46561.1|  Subtilisin-like protease                                550   8e-180   
ref|XP_009590434.1|  PREDICTED: subtilisin-like protease SDD1           550   9e-180   
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                550   1e-179   
ref|XP_004963825.1|  PREDICTED: subtilisin-like protease-like           549   2e-179   
ref|NP_001060680.1|  Os07g0685900                                       550   2e-179   
ref|XP_006355907.1|  PREDICTED: subtilisin-like protease SDD1-like      550   2e-179   
ref|XP_006647650.1|  PREDICTED: subtilisin-like protease SDD1-like      550   2e-179   
ref|XP_009335230.1|  PREDICTED: subtilisin-like protease SDD1           549   2e-179   
dbj|BAC10341.1|  putative serine protease                               549   3e-179   
ref|XP_009370534.1|  PREDICTED: subtilisin-like protease SDD1           548   3e-179   
ref|XP_006352831.1|  PREDICTED: subtilisin-like protease SDD1-like      548   6e-179   
ref|XP_009616743.1|  PREDICTED: subtilisin-like protease SDD1           547   1e-178   
ref|XP_009790648.1|  PREDICTED: subtilisin-like protease SDD1 iso...    546   2e-178   
gb|EMT04348.1|  Subtilisin-like protease                                545   7e-178   
ref|XP_008356216.1|  PREDICTED: subtilisin-like protease SDD1           545   1e-177   
ref|XP_010233022.1|  PREDICTED: subtilisin-like protease                544   1e-177   
ref|XP_002272769.1|  PREDICTED: subtilisin-like protease                544   2e-177   
gb|EYU46392.1|  hypothetical protein MIMGU_mgv1a001666mg                544   2e-177   
ref|XP_010652423.1|  PREDICTED: subtilisin-like protease SDD1           544   2e-177   
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease                544   3e-177   
ref|XP_010933213.1|  PREDICTED: subtilisin-like protease SDD1           543   4e-177   
ref|XP_004247312.2|  PREDICTED: subtilisin-like protease SDD1           543   5e-177   
ref|XP_009403290.1|  PREDICTED: subtilisin-like protease                543   7e-177   
ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like           543   1e-176   
gb|AES81608.2|  subtilisin-like serine protease                         546   1e-176   
gb|EMT24443.1|  Subtilisin-like protease                                543   1e-176   
gb|EMS49460.1|  Subtilisin-like protease SDD1                           543   2e-176   
ref|XP_003528890.1|  PREDICTED: subtilisin-like protease-like iso...    541   2e-176   
ref|XP_004289987.1|  PREDICTED: subtilisin-like protease SDD1-like      541   2e-176   
ref|XP_009398828.1|  PREDICTED: subtilisin-like protease SDD1           541   2e-176   
gb|KHN10783.1|  Subtilisin-like protease SDD1                           539   2e-176   
ref|XP_008447369.1|  PREDICTED: subtilisin-like protease SDD1           541   3e-176   
ref|XP_002454511.1|  hypothetical protein SORBIDRAFT_04g032460          557   3e-176   
ref|XP_008810058.1|  PREDICTED: subtilisin-like protease SDD1           541   4e-176   
ref|XP_003625390.1|  Subtilisin-like protease                           546   5e-176   
ref|XP_006479431.1|  PREDICTED: subtilisin-like protease SDD1-like      541   6e-176   
ref|XP_008813818.1|  PREDICTED: subtilisin-like protease SDD1           532   6e-176   
ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1     540   7e-176   
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease                540   8e-176   
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease                540   1e-175   
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease                540   1e-175   
ref|XP_006490976.1|  PREDICTED: subtilisin-like protease-like           539   1e-175   
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4     540   1e-175   
ref|XP_011099335.1|  PREDICTED: subtilisin-like protease                539   2e-175   
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864             538   2e-175   
ref|XP_010068435.1|  PREDICTED: subtilisin-like protease SDD1           538   5e-175   
gb|AFW72701.1|  putative subtilase family protein                       538   5e-175   
ref|XP_008382710.1|  PREDICTED: subtilisin-like protease SDD1           538   6e-175   
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease                538   6e-175   
ref|XP_003632775.1|  PREDICTED: subtilisin-like protease                538   9e-175   
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg             536   2e-174   
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                    536   2e-174   
gb|KGN58306.1|  hypothetical protein Csa_3G610820                       536   3e-174   
ref|XP_009803381.1|  PREDICTED: subtilisin-like protease SDD1           536   3e-174   
ref|XP_010547540.1|  PREDICTED: subtilisin-like protease                536   3e-174   
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease                535   3e-174   
ref|XP_004152066.1|  PREDICTED: subtilisin-like protease SDD1-like      536   3e-174   
ref|XP_008646040.1|  PREDICTED: subtilisin-like protease SDD1           539   4e-174   
ref|XP_008454764.1|  PREDICTED: subtilisin-like protease                535   5e-174   
dbj|BAK08126.1|  predicted protein                                      536   5e-174   
gb|KHN04600.1|  Subtilisin-like protease                                534   6e-174   
ref|XP_003575756.1|  PREDICTED: subtilisin-like protease SDD1           534   8e-174   
ref|XP_007050153.1|  Subtilase family protein isoform 1                 535   9e-174   
dbj|BAK05709.1|  predicted protein                                      540   9e-174   
ref|XP_004166310.1|  PREDICTED: subtilisin-like protease SDD1-like      535   9e-174   
ref|XP_003559772.1|  PREDICTED: subtilisin-like protease SBT5.3         534   1e-173   
ref|NP_569048.1|  subtilisin-like protease                              534   1e-173   
ref|XP_008653496.1|  PREDICTED: subtilisin-like protease                533   2e-173   
ref|XP_009391664.1|  PREDICTED: subtilisin-like protease SDD1           534   2e-173   
ref|XP_011035007.1|  PREDICTED: subtilisin-like protease                534   2e-173   
ref|XP_002301847.2|  STOMATAL DENSITY AND DISTRIBUTION family pro...    534   2e-173   
emb|CDP03800.1|  unnamed protein product                                533   3e-173   
ref|XP_009770992.1|  PREDICTED: subtilisin-like protease                533   6e-173   
ref|XP_003608462.1|  Subtilisin-like protease                           531   9e-173   
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease                531   1e-172   
ref|XP_002320086.2|  subtilase family protein                           531   2e-172   
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g             531   2e-172   
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like           531   3e-172   
ref|XP_006426043.1|  hypothetical protein CICLE_v10024951mg             530   3e-172   
emb|CAN75239.1|  hypothetical protein VITISV_014205                     531   3e-172   
gb|KDP26457.1|  hypothetical protein JCGZ_17615                         528   3e-172   
ref|XP_002966443.1|  hypothetical protein SELMODRAFT_143697             530   4e-172   
ref|XP_004171629.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    530   4e-172   
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease                530   4e-172   
ref|XP_009103426.1|  PREDICTED: subtilisin-like protease                530   5e-172   
gb|KHG16003.1|  Subtilisin-like protease                                530   5e-172   
gb|KDO79000.1|  hypothetical protein CISIN_1g004301mg                   530   6e-172   
ref|XP_006466502.1|  PREDICTED: subtilisin-like protease-like           530   6e-172   
ref|XP_010091819.1|  Subtilisin-like protease SDD1                      530   7e-172   
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                529   7e-172   
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           530   7e-172   
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg             530   7e-172   
emb|CDY57437.1|  BnaAnng14520D                                          529   8e-172   
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease                530   8e-172   
ref|XP_007139243.1|  hypothetical protein PHAVU_008G013300g             530   9e-172   
gb|AAM10321.1|  AT5g67360/K8K14_8                                       529   9e-172   
ref|XP_002982080.1|  hypothetical protein SELMODRAFT_233912             529   1e-171   
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like           529   1e-171   
ref|XP_009790649.1|  PREDICTED: subtilisin-like protease SDD1 iso...    527   1e-171   
emb|CDY12840.1|  BnaC07g15930D                                          528   2e-171   
ref|XP_010684867.1|  PREDICTED: subtilisin-like protease SDD1           529   2e-171   
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g             528   2e-171   



>gb|EYU39037.1| hypothetical protein MIMGU_mgv1a021904mg [Erythranthe guttata]
Length=724

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/714 (67%), Positives = 564/714 (79%), Gaps = 12/714 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFV----SESGDEGERSRIVHSYRHVASGFAAKL  2177
             +T+IVH+S P   +    ++ +S++ SF+    + +GD    SR+VHSYR+VA+GFAAKL
Sbjct  14    ETFIVHLSLPEGRVFVDPDEQKSWYGSFLPTTATAAGDV--SSRLVHSYRNVATGFAAKL  71

Query  2176  SPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTG  1997
             SPE V EM KK GFI AR Q+   L+TTH+PNFLGL+QN G WR S YG+GVIVG+LDTG
Sbjct  72    SPEEVKEMEKKDGFIFARPQKKLALHTTHTPNFLGLHQNLGVWRGSHYGEGVIVGLLDTG  131

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGT  1817
             I P HPSF+DE MPPPPAKWKGKCEF GT+CNNKLIGARNFV        PPVD+EGHGT
Sbjct  132   IAPGHPSFDDEGMPPPPAKWKGKCEFNGTSCNNKLIGARNFVG---GSTGPPVDDEGHGT  188

Query  1816  HTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddg  1637
             HTASTAAGNFV +A VFG A GTAVGMAP AH+++YKVC+EDGC+++DILAAMDAA++DG
Sbjct  189   HTASTAAGNFVPSANVFGMANGTAVGMAPRAHIAMYKVCSEDGCSDADILAAMDAAVEDG  248

Query  1636  vdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGA  1457
             VDVLSLSLGGGS  FF D IAIGAFAA++KGIFVSC+AGN GP   +LSNEAPW+LTVGA
Sbjct  249   VDVLSLSLGGGSVDFFNDGIAIGAFAAIQKGIFVSCSAGNSGPFNASLSNEAPWILTVGA  308

Query  1456  STIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvd  1280
             STIDR I A AVLGN     GES FQ  +FP   +PLI  G+  +  A LCGPGSLD +D
Sbjct  309   STIDRKIVAAAVLGNKDFYTGESLFQPSDFPYEYMPLIDAGAGGNVTAGLCGPGSLDNID  368

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
             VKGK+VLC RGGGIAR+ KGQTVKDAGGAAMIL N + + Y  +AD+HVLPAT +SY+ G
Sbjct  369   VKGKIVLCQRGGGIARIAKGQTVKDAGGAAMILTNDEPNAYDTIADSHVLPATHVSYDAG  428

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
             +K++ YINSTS P A I F+GT IG+ +AP+VASFSSRGPS ASPGILKPDI+GPGV+IL
Sbjct  429   VKIRAYINSTSTPWAAIYFEGTVIGSPSAPTVASFSSRGPSLASPGILKPDIIGPGVSIL  488

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAWPV       +  ATFN+ISGTSM+ PHL GIA LLKSAHPDWSPAAIKSAI+TTA Q
Sbjct  489   AAWPVSVENKTNDK-ATFNMISGTSMSCPHLGGIAALLKSAHPDWSPAAIKSAIMTTAGQ  547

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              +L G  I DER +PAD+FA G GHVNPS A+DPGL+YDLQ +DYIPYLCGL YTDQEIQ
Sbjct  548   LDLEGGPIEDERHLPADIFALGAGHVNPSSANDPGLVYDLQPEDYIPYLCGLGYTDQEIQ  607

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGV  380
              IV + V CS  TSIPEAQLNYPSF++ LG  + TY+RTVTNVGEANS Y V++    GV
Sbjct  608   VIVGQHVSCSNTTSIPEAQLNYPSFSVELGPATKTYTRTVTNVGEANSTYAVEIKT-QGV  666

Query  379   DVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIA  218
              V VTP TL FTEVNQ++TY ISFS S+TPV+  + QGAI W S +H V+SPI+
Sbjct  667   HVEVTPTTLSFTEVNQKMTYQISFSKSTTPVNGSYAQGAIVWRSAKHAVRSPIS  720



>ref|XP_002509668.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51055.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=758

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/747 (62%), Positives = 571/747 (76%), Gaps = 12/747 (2%)
 Frame = -1

Query  2419  PNMAYISVVVCLT-LVFHSVASAKYE------DTYIVHVSPPAAAINGVSEDYRSYFRSF  2261
             P MA ++ +VCL+  +     S K        +TYIV V+ P    +  S+   ++++SF
Sbjct  10    PVMA-VTFLVCLSSFLGEGAESTKVTGASSNLETYIVFVTKPPVGASKKSQVIETWYQSF  68

Query  2260  V-SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSP  2084
             + +   +  ++ RI++SYR+V SGFAAKL+ E    M +K GF+SAR Q+++ L+TTHSP
Sbjct  69    LPARKSNSNQQQRILYSYRNVVSGFAAKLTAEEAKFMEEKDGFVSARPQKIFPLHTTHSP  128

Query  2083  NFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTAC  1904
             NFLGL+QN G W NS+YGKGVI+GVLDTGITP+HPSF+DE MP PPAKWKGKCEF GTAC
Sbjct  129   NFLGLHQNLGLWGNSNYGKGVIIGVLDTGITPDHPSFSDEGMPSPPAKWKGKCEFNGTAC  188

Query  1903  NNKLIGARNFVS-EGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPL  1727
             NNKLIGAR F S E  S    P D+ GHGTHTASTAAGNFV  A+VFG+A GTAVGMAPL
Sbjct  189   NNKLIGARTFQSDEHPSGDMEPFDDVGHGTHTASTAAGNFVDGASVFGNANGTAVGMAPL  248

Query  1726  AHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEK  1547
             AHL++YKVC++ GC+ESDILAAMD A+++GVD+LSLSLGGGSA F  D IA+GAF A++ 
Sbjct  249   AHLAMYKVCSDFGCSESDILAAMDTAVEEGVDILSLSLGGGSAPFSADGIAVGAFGAIQN  308

Query  1546  GIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENF  1367
             GIFVSC+AGN GPD YTLSNEAPW+LTVGASTIDR+I+AT  LGN  +  GES FQ +  
Sbjct  309   GIFVSCSAGNSGPDNYTLSNEAPWILTVGASTIDRSIRATVKLGNNEEFFGESLFQPQLS  368

Query  1366  PPTLLPLIYPGSK-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAA  1190
                  PLIYPG   ++ AA+C   SL+  +V+GK+VLCDRGG + RV+KG+ VKDAGG  
Sbjct  369   TQNFWPLIYPGKNGNQSAAVCAEDSLESSEVEGKIVLCDRGGLVGRVEKGKVVKDAGGIG  428

Query  1189  MILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAP  1010
             MIL+N++ DGY+ LAD HVLPA+ +SY+DG+++K+YINSTS PTA  VF+GT IG KTAP
Sbjct  429   MILVNEESDGYSTLADAHVLPASHVSYSDGMRIKNYINSTSSPTAMFVFEGTVIGLKTAP  488

Query  1009  SVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPH  830
              V+SFSSRGPS ASPGILKPDI+GPGV+ILAAWP+          ATFN+ISGTSM+ PH
Sbjct  489   MVSSFSSRGPSFASPGILKPDIIGPGVSILAAWPISVENKTNTK-ATFNMISGTSMSCPH  547

Query  829   LSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSR  650
             LSGIA LLKSAHPDWSPAAIKSAI+TTAD  NL G  I+DERL+ ADV ATG GHVNPS+
Sbjct  548   LSGIAALLKSAHPDWSPAAIKSAIMTTADTVNLGGQPIVDERLLSADVLATGAGHVNPSK  607

Query  649   ASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLG  470
             ASDPGL+YD+Q DDYIPYLCGL YTD++I  IVQ KV+CS+V SIPEAQLNYPSF+I  G
Sbjct  608   ASDPGLVYDIQPDDYIPYLCGLGYTDRDITYIVQYKVKCSEVGSIPEAQLNYPSFSIVFG  667

Query  469   KTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTP  290
               +  Y+RTVTNVG A S YTV V+P  GVDV VTP  + FT+V Q  TY+++F+ +   
Sbjct  668   AKTQIYTRTVTNVGPATSSYTVSVAPPPGVDVTVTPSKIAFTQVKQTATYSVTFTNTGKG  727

Query  289   VDIDFVQGAIAWVSQRHIVKSPIAIIF  209
                  VQG + W S +H V+SPI+++F
Sbjct  728   YSDPSVQGYLKWDSDQHSVRSPISVVF  754



>ref|XP_006477335.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=763

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/755 (61%), Positives = 577/755 (76%), Gaps = 18/755 (2%)
 Frame = -1

Query  2419  PNMAYISVV-VCLTLVFHSVASAKYE------DTYIVHVSPPAAAINGVSEDYRSYFRSF  2261
             P M  I ++ +  T  F    + + E       TYIVH+  P   ++  S +  +++ SF
Sbjct  10    PTMVPICLISLIFTFCFTPTIAKEKESSGSNLQTYIVHIERPEGGVSTDSVELDNWYNSF  69

Query  2260  V-SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSP  2084
             + + +   G++ R+VHSYR++ +GFAAKL+ E V  M  K+GFISA  ++++ L+TTHS 
Sbjct  70    LPASTASSGQKQRMVHSYRNLITGFAAKLTAEEVKIMGNKQGFISAHPEKIFPLHTTHST  129

Query  2083  NFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTAC  1904
              FLGL+++ G W++SSYGKGVI+GVLDTGITP HPSF+D+ MPPPPAKWKGKCEF  TAC
Sbjct  130   QFLGLHKSLGLWKHSSYGKGVIIGVLDTGITPGHPSFSDKGMPPPPAKWKGKCEFNVTAC  189

Query  1903  NNKLIGARNFV-SEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPL  1727
             NNKLIGARNF+ S  +    PP D  GHGTHTASTAAGNFV  A VFG A GTAVG+AP 
Sbjct  190   NNKLIGARNFLPSYETGKIEPPFDLVGHGTHTASTAAGNFVEQANVFGQANGTAVGVAPW  249

Query  1726  AHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEK  1547
             AHL+IY+VC++ GC+ES ILAAMD A++DGVDVLSLSLGGGS+ F+ D IA+GAF A++ 
Sbjct  250   AHLAIYQVCSDFGCSESSILAAMDTAVEDGVDVLSLSLGGGSSPFYADGIAVGAFGAIQN  309

Query  1546  GIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENF  1367
             G+FVSC+AGN GP   +LSNEAPW+LTVGASTIDR+I ATA LGNGA L+GES FQ ++F
Sbjct  310   GVFVSCSAGNSGPFNASLSNEAPWILTVGASTIDRSIIATARLGNGADLEGESLFQPKDF  369

Query  1366  PPTLLPLIYPGSK-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAA  1190
             PPTLLPL+Y G+   E +A C PGSL+  DV+GK+VLC+RGG ++R+ KGQTVKD GGAA
Sbjct  370   PPTLLPLVYAGANGKESSAFCEPGSLNGTDVQGKIVLCERGGFVSRIGKGQTVKDVGGAA  429

Query  1189  MILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAP  1010
             MIL+N DI+GY+ LAD HVLPAT +SY  GL++KDYINSTS PTATI+F GT IG  +AP
Sbjct  430   MILMNNDINGYSTLADPHVLPATHVSYAAGLRIKDYINSTSIPTATILFNGTVIGKPSAP  489

Query  1009  SVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPH  830
              V SFSSRGPS ASPGILKPDI+GPGV+ILAAWPV    N     +TFNIISGTSM+ PH
Sbjct  490   EVTSFSSRGPSMASPGILKPDIIGPGVSILAAWPVSVENNTNTK-STFNIISGTSMSCPH  548

Query  829   LSGIA----TLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHV  662
             LSG+A    TLLKS+HPDWSPAAIKSA++TT D  NL G  I+DERL+PAD+FA G GHV
Sbjct  549   LSGVAALLKTLLKSSHPDWSPAAIKSAMMTTTDIVNLEGKPIIDERLLPADIFAIGAGHV  608

Query  661   NPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFA  482
             NPSRA+DPGL++D+Q DDYIPYLCGLNYTD+EI  +VQRKV+CS+++SI EAQLNYPSF+
Sbjct  609   NPSRANDPGLVFDIQPDDYIPYLCGLNYTDREIAILVQRKVKCSEISSIKEAQLNYPSFS  668

Query  481   IWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSP  302
             + LG  + TY+RTVTNVG+ NS+Y   +    GV+V VTP TL F E NQ+ ++ ++F  
Sbjct  669   LTLGSGAQTYTRTVTNVGQPNSLYKSLIFAPQGVEVEVTPSTLQFNEANQKASFAVTFKR  728

Query  301   SS---TPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
             +S      D+ F QG I W S +H V+ P+ +IF+
Sbjct  729   TSYGGNRQDMPFAQGYIKWSSDQHSVRIPLVVIFE  763



>ref|XP_006440472.1| hypothetical protein CICLE_v10018976mg [Citrus clementina]
 gb|ESR53712.1| hypothetical protein CICLE_v10018976mg [Citrus clementina]
Length=759

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/751 (61%), Positives = 574/751 (76%), Gaps = 14/751 (2%)
 Frame = -1

Query  2419  PNMAYISVV-VCLTLVFHSVASAKYE------DTYIVHVSPPAAAINGVSEDYRSYFRSF  2261
             P M  I ++ +  T  F    + + E       TYIVH+  P   ++  S +  +++ SF
Sbjct  10    PTMVPICLISLIFTFCFTPTIAKEKESLGSNLQTYIVHIERPEGGVSTDSVELNNWYNSF  69

Query  2260  V-SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSP  2084
             + + +   G++ R+VHSYR+V +GFAAKL+ E V  M  K+GFISA  ++++ L+TTHS 
Sbjct  70    LPASTASSGQKQRMVHSYRNVITGFAAKLTAEEVKIMGNKQGFISAHPEKIFPLHTTHST  129

Query  2083  NFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTAC  1904
              FLGL+++ G W++SSYGKGVI+GVLDTGITP HPSF+D+ MPPPPAKWKGKCEF  TAC
Sbjct  130   QFLGLHKSLGLWKHSSYGKGVIIGVLDTGITPGHPSFSDKGMPPPPAKWKGKCEFNVTAC  189

Query  1903  NNKLIGARNFV-SEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPL  1727
             NNKLIGARNF  S  +    PP D  GHGTHTASTAAGNFV  A VFG A GTAVG+AP 
Sbjct  190   NNKLIGARNFFPSYETGKIEPPFDLVGHGTHTASTAAGNFVEQANVFGQANGTAVGVAPW  249

Query  1726  AHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEK  1547
             AHL+IY+VC++  C+ES ILAAMDAA++DGVDVLSLSLGGGS+ F+ D IA+GAF A++ 
Sbjct  250   AHLAIYQVCSDFRCSESSILAAMDAAVEDGVDVLSLSLGGGSSPFYADGIAVGAFGAIQN  309

Query  1546  GIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENF  1367
             G+FVSC+AGN GP   +LSNEAPW+LTVGASTIDR+I ATA LGNGA L+GES FQ ++F
Sbjct  310   GVFVSCSAGNTGPFNASLSNEAPWILTVGASTIDRSIIATARLGNGADLEGESLFQPKDF  369

Query  1366  PPTLLPLIYPGSK-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAA  1190
             PPTLLPL+Y G+   E +A C P SL+  DV+GK+VLC+RGG ++R+ KGQTVKDAGGAA
Sbjct  370   PPTLLPLVYAGANGKESSAFCEPASLNGTDVQGKIVLCERGGLVSRIGKGQTVKDAGGAA  429

Query  1189  MILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAP  1010
             MIL+N DI+GY+ LAD HVLPAT +SY  GL++KDYINSTS PTATI+F GT IG  +AP
Sbjct  430   MILMNNDINGYSTLADPHVLPATHVSYAAGLRIKDYINSTSIPTATILFNGTVIGKPSAP  489

Query  1009  SVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPH  830
              V SFSSRGPS ASPGILKPDI+GPGV+ILAAWPV    N     +TFNIISGTSM+ PH
Sbjct  490   EVTSFSSRGPSMASPGILKPDIIGPGVSILAAWPVSVENNTNTK-STFNIISGTSMSCPH  548

Query  829   LSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSR  650
             LSG+A LLKS+HPDWSPAAIKSA++TT D  NL G  I+DERL+PAD+FA G GHVNPSR
Sbjct  549   LSGVAALLKSSHPDWSPAAIKSAMMTTTDIVNLEGKPIIDERLLPADIFAIGAGHVNPSR  608

Query  649   ASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLG  470
             A+DPGL++D+Q DDYIPYLCGLNYTD+E+  +VQRKV+CS+++SI EAQLNYPSF++ LG
Sbjct  609   ANDPGLVFDIQPDDYIPYLCGLNYTDRELAILVQRKVKCSEISSIKEAQLNYPSFSLTLG  668

Query  469   KTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSS--  296
               + TY+RTVTNVG+ NS+Y   +    GV+V +TP  L F E NQ+ ++ ++F  +S  
Sbjct  669   SGAQTYTRTVTNVGQPNSLYKSLIFVPQGVEVEITPSALQFNEANQKASFAVTFRRTSYG  728

Query  295   -TPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
                 D+ F QG I W S +H V+ P+ +IF+
Sbjct  729   GNRQDMPFAQGYIKWSSDQHSVRIPLVVIFE  759



>gb|KDP25552.1| hypothetical protein JCGZ_20708 [Jatropha curcas]
Length=758

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/715 (63%), Positives = 557/715 (78%), Gaps = 6/715 (1%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             DTYIV V+ P   ++ +++D  S++++F+  +    +  RI++SY+HVASGFAAKL+ E 
Sbjct  43    DTYIVFVTKPEGGVSEIAQDLHSWYQTFLPATISNTQH-RIIYSYQHVASGFAAKLTAEE  101

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                M +K GF+SAR Q++  L+TTHSPNFLGL+QN G WR+S+YGKGVI+GVLDTGI P+
Sbjct  102   AKGMEQKDGFVSARPQKILPLHTTHSPNFLGLHQNLGLWRDSNYGKGVIIGVLDTGILPD  161

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVS-EGssppppPVDEEGHGTHT  1811
             HPSF+DE +P PPAKWKGKCEF GTA CNNKLIGAR F S E  S P  P D+ GHGTHT
Sbjct  162   HPSFSDEGIPSPPAKWKGKCEFNGTAACNNKLIGARTFQSFEQPSGPAGPFDDVGHGTHT  221

Query  1810  ASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvd  1631
             ASTAAGN V  A VFG+A GTAVGMAPLAHL+IYKVC++ GC+ESDILAAMD A++DGVD
Sbjct  222   ASTAAGNLVKGANVFGNANGTAVGMAPLAHLAIYKVCSDFGCSESDILAAMDTAVEDGVD  281

Query  1630  vlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAST  1451
             VLSLSLGGGSA FF D IA+GAF AM+ G+FVSC+AGN GP+  +LSNEAPW+LTVGAST
Sbjct  282   VLSLSLGGGSAPFFADGIAVGAFGAMQNGVFVSCSAGNSGPENSSLSNEAPWILTVGAST  341

Query  1450  IDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvk  1274
             IDR+I+AT  LGN  ++ GES FQ +       PLIYPG   +E  A C PG L+ VDVK
Sbjct  342   IDRSIRATVKLGNNLEVFGESLFQPQLSTQNFWPLIYPGKDGNESLAACTPGFLEDVDVK  401

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             GK+VLCDR G + R++KGQ VK+AGG  MIL+NQ+ DGY+ LAD HVLPA+ +SY+DGLK
Sbjct  402   GKIVLCDRDGVVGRIEKGQVVKEAGGVGMILVNQEFDGYSTLADAHVLPASHVSYSDGLK  461

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             +K YINST+ PTA ++F+GT IG KTAP VASFSSRGPS ASPGILKPDI+GPGV+ILAA
Sbjct  462   IKSYINSTATPTAMLLFEGTVIGVKTAPMVASFSSRGPSLASPGILKPDIIGPGVSILAA  521

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             WPV          ATFN+ISGTSM+ PHLSGIA LLKSAHPDWSPAAIKSAI+TTAD  N
Sbjct  522   WPVSVENKTNTK-ATFNMISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTTADLIN  580

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             + G  I+DERL+PAD+ A G GHV PSRASDPGL+YD+Q DDYIPYLCGL Y+D+EI  I
Sbjct  581   VGGQPIVDERLLPADILALGAGHVAPSRASDPGLVYDIQPDDYIPYLCGLGYSDREITYI  640

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDV  374
             VQ+KV+CS+V SIP+ QLNYPSF+   G  + TY+RT+TNVG ANS YT+ V P  GV++
Sbjct  641   VQKKVKCSEVQSIPDTQLNYPSFSFVFGLKTQTYTRTLTNVGPANSSYTLSVFPPPGVEI  700

Query  373   GVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              V+P  +VF++V Q  TY ++F+ +    +    QG + WVS ++ V+SPI ++F
Sbjct  701   AVSPSKIVFSKVKQTATYTVTFTNTVGTTE-SLAQGYLKWVSDQYSVRSPILVLF  754



>ref|XP_002275429.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=740

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/745 (60%), Positives = 564/745 (76%), Gaps = 16/745 (2%)
 Frame = -1

Query  2413  MAYISVVVCLTLVFHSVASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFV--SESGDE  2240
             + ++   +C++    ++A      TY++HV  P       +++  S+++SF+  S + D 
Sbjct  3     IVFLLAFICMSGFSPAIADKTQFKTYVIHVKHPNNEEVAEAQNLESWYKSFMPTSMTADS  62

Query  2239  GERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQN  2060
              ++ RIVHSY+HV +GFAA+L+ + V+ M++K GF+SAR +++++L+TTH+P FLGL++ 
Sbjct  63    DQQPRIVHSYQHVMTGFAARLTEDEVNAMKEKDGFVSARPEKIFHLHTTHTPGFLGLHKG  122

Query  2059  FGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGAR  1880
              GFW+ S+ GKGVI+GVLDTG+ P+H SF+D  MPPPPAKWKGKCEF+GT+CNNKLIGAR
Sbjct  123   SGFWKGSNLGKGVIIGVLDTGVLPDHVSFSDAGMPPPPAKWKGKCEFKGTSCNNKLIGAR  182

Query  1879  NFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVC  1700
             NF SE +  PP   DEEGHGTHTASTAAGNFV +A+VFG+AKGTAVGMAP AHL+IYKVC
Sbjct  183   NFDSESTGTPPS--DEEGHGTHTASTAAGNFVKHASVFGNAKGTAVGMAPHAHLAIYKVC  240

Query  1699  TEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAG  1520
             +E GCA SDILAA+DAAI+DGVDVLSLSLGG S  F ED IA+GAFAA  KGIFVSC+AG
Sbjct  241   SESGCAGSDILAALDAAIEDGVDVLSLSLGGQSFPFHEDPIALGAFAATRKGIFVSCSAG  300

Query  1519  NEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIY  1340
             NEGP   TLSNEAPW+LTV AST+DR+IKA   LGNG   DGES FQ  +FP   LPL+Y
Sbjct  301   NEGPTNSTLSNEAPWILTVAASTMDRSIKAMVKLGNGKNFDGESLFQPRDFPSEQLPLVY  360

Query  1339  PGS-KDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDID  1163
              G+  +  +A CG GSL  +DVKGKVV+CDRGGGI+R+DKG+ VK+AGGAAMIL N   D
Sbjct  361   AGAGSNASSAFCGEGSLKDLDVKGKVVVCDRGGGISRIDKGKEVKNAGGAAMILTNGKPD  420

Query  1162  GYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRG  983
             G++ LAD H LPA  + Y+ GL +K YINS++ PTAT++FKGT IG   AP + SFSSRG
Sbjct  421   GFSTLADPHSLPAAHVGYSAGLSIKAYINSSNKPTATLLFKGTIIGKSAAPEITSFSSRG  480

Query  982   PSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLK  803
             PS ASPGILKPDI GPGV++LAAWP   +    +  A FN+ISGTSM+ PHLSGIA LLK
Sbjct  481   PSLASPGILKPDITGPGVSVLAAWPSSVDNRTDSKVA-FNMISGTSMSCPHLSGIAALLK  539

Query  802   SAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYD  623
             S+HP+WSPAAIKSAI+TTAD  NL G  ILDE   PADVFA G GHVNPSRA+DPGLIYD
Sbjct  540   SSHPEWSPAAIKSAIMTTADVLNLKGDPILDETHEPADVFAVGAGHVNPSRANDPGLIYD  599

Query  622   LQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRT  443
             +Q +DYIPYLCGL Y D +++ I++ KV+CS+ +SIPEAQLNYPSF++ +G ++L   RT
Sbjct  600   IQPNDYIPYLCGLGYNDTQVRAIIRHKVQCSKESSIPEAQLNYPSFSVAMGSSALKLQRT  659

Query  442   VTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPS------STPVDI  281
             VTNVGEA + Y VK+S   GVDV V P  L FT+ NQ+ TY ++F         S P   
Sbjct  660   VTNVGEAKASYIVKISAPQGVDVSVKPRKLDFTQTNQKKTYTVTFERKDDGKTGSKP---  716

Query  280   DFVQGAIAWVSQRHIVKSPIAIIFQ  206
              F QG + WVS +H V+SPI++ F+
Sbjct  717   -FAQGFLEWVSAKHSVRSPISVKFE  740



>ref|XP_010325680.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=1227

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/788 (61%), Positives = 599/788 (76%), Gaps = 19/788 (2%)
 Frame = -1

Query  2551  LQICSDRVIHIYICNAVFVYIYLTRSSCF*SSNHQICIIA---MKGTPNMAYISVVVCLT  2381
             + I   R +HI +     V+  + + + +  +  QI  I    ++G   ++++S  + LT
Sbjct  453   VNITQIRGVHIVVKPTTLVFTKVNQQATYSVTFTQIGDITGHFVQGA--ISWMSNNLHLT  510

Query  2380  LVFHSVASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFVSE--SGDEGERSRIVHSYR  2207
             +   S A      TY+VHV+ P A I   S+D  SY+ SF+ E  +G E E SRI+HSY 
Sbjct  511   VAQRSNAL----QTYLVHVNKPDARILANSDDLESYYSSFLPEVLAGAE-EPSRIIHSYH  565

Query  2206  HVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGK  2027
             HVA GFAA+LS E V+EM KK GF+SAR +++  L+TTH+PNFLGLY+N G W+ S+YGK
Sbjct  566   HVAIGFAARLSAEEVNEMEKKDGFVSARVEKILALHTTHTPNFLGLYRNMGLWQESNYGK  625

Query  2026  GVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVSEGsspp  1850
             GVI+GVLDTGITPNHPSF+DENMP PPAKWKGKCEF G   CN K+IGARN V       
Sbjct  626   GVIIGVLDTGITPNHPSFSDENMPSPPAKWKGKCEFRGNVTCNKKIIGARNLVG---GSS  682

Query  1849  ppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdi  1670
              PP D+EGHGTHT+STAAGNFV +A++FG+A GTA GMAPLAH+++YKVCTE  C++ DI
Sbjct  683   DPPFDDEGHGTHTSSTAAGNFVDDASLFGNANGTAAGMAPLAHIAMYKVCTES-CSDVDI  741

Query  1669  laamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLS  1490
             LAA+D+AIDDGVDVLSLS+GG S  F+ED IA GAFAAM+KGIFVS +AGNEGP   TLS
Sbjct  742   LAALDSAIDDGVDVLSLSIGGFSDPFYEDGIATGAFAAMQKGIFVSVSAGNEGPLNSTLS  801

Query  1489  NEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAAL  1310
             NEAPW+LTVGAST DR I AT VLGNG + DGESAFQ  +FP TLLPL+YPG  D+DAAL
Sbjct  802   NEAPWILTVGASTHDRKIVATTVLGNGQEYDGESAFQPASFPHTLLPLVYPGFSDQDAAL  861

Query  1309  CGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVL  1130
             C  GSL+  DVKGKVV+CDRGG + R++K QTVKDAGGAAMIL N +IDG    AD HVL
Sbjct  862   CSSGSLNNTDVKGKVVVCDRGGDVPRLEKSQTVKDAGGAAMILTNLEIDGDGTFADAHVL  921

Query  1129  PATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKP  950
             PAT + Y  G  +K YINSTS P+A I+FKGT IG K++PSV+SFSSRGP+ ASPGI+KP
Sbjct  922   PATHVGYTAGESIKAYINSTSTPSAGIIFKGTIIGFKSSPSVSSFSSRGPNLASPGIVKP  981

Query  949   DILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAI  770
             DI+GPGVNILAAWP+      G    TFNIISGTSM+ PHLSGIA LLKSAHPDWSPAAI
Sbjct  982   DIIGPGVNILAAWPISVENKTGTDL-TFNIISGTSMSCPHLSGIAALLKSAHPDWSPAAI  1040

Query  769   KSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLC  590
             KSAI+TTADQ+NL G  ILD+R +PAD+FATG GHVNPS+ASDPGLIYD++ ++YI YLC
Sbjct  1041  KSAIMTTADQFNLEGQPILDQRDLPADIFATGAGHVNPSKASDPGLIYDIKVENYIQYLC  1100

Query  589   GLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMY  410
             GL Y D++I+ + Q+ V+CS  +SI EA+LNYPSF+I LG  +  Y+RTVTNVG+A+S Y
Sbjct  1101  GLGYKDKDIELLAQQTVKCSLQSSISEAELNYPSFSIILGPQTQNYTRTVTNVGDASSTY  1160

Query  409   TVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVK  230
             TV ++   GVDV V P TLVFT+VNQQ TY++SF+ +    D  FVQGAI+W+S +++V+
Sbjct  1161  TVNITQIQGVDVVVEPATLVFTQVNQQETYSVSFTQTGLITD-RFVQGAISWISNKYVVR  1219

Query  229   SPIAIIFQ  206
              PI++  +
Sbjct  1220  IPISVKLE  1227


 Score =   229 bits (585),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 140/209 (67%), Gaps = 7/209 (3%)
 Frame = -1

Query  2380  LVFHSVASAKYE--DTYIVHVSPPAAAINGVSEDYRSYFRSFVS-ESGDEGERSRIVHSY  2210
             L+FH V +       TYIVHV+ P   +   S D  SY+ SFV  E     E +RI+HSY
Sbjct  13    LIFHFVVAQPQSSLQTYIVHVNKPDVQVVANSADLESYYNSFVPVEIVGSEEPTRIIHSY  72

Query  2209  RHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYG  2030
              HV SGFAA+LS E V EM  K GF+ AR +++  L+ T +PNFLGLYQN G W+ S+YG
Sbjct  73    HHVVSGFAARLSAEEVKEMEMKDGFVYARVEKILALHITRTPNFLGLYQNVGLWQESNYG  132

Query  2029  KGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEG-TACNNKLIGARNFVSEGssp  1853
             KGVI+GVLDTGI P HP F+D+NMPPPP KWKGKCEF G   CN KLIGARNFV      
Sbjct  133   KGVIIGVLDTGINPGHPCFSDKNMPPPPEKWKGKCEFVGDVTCNKKLIGARNFVR---GS  189

Query  1852  pppPVDEEGHGTHTASTAAGNFVGNAAVF  1766
               P  ++ GHGT T+S AAGNFV +A VF
Sbjct  190   TDPLFEKGGHGTLTSSVAAGNFVDDANVF  218


 Score =   224 bits (571),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 152/202 (75%), Gaps = 8/202 (4%)
 Frame = -1

Query  847  SMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGG  668
            S +TP L+GI  L K      S AAIKSAI+TTADQ+NL G  ILD+R +PAD+FATG G
Sbjct  313  STSTP-LAGI--LFKGT----SIAAIKSAIMTTADQFNLEGQPILDQRNLPADIFATGAG  365

Query  667  HVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPS  488
            HVNPS+A+DPGLIYD+Q  +YI YLCGL YTD++I  IVQ+ ++CSQ ++I EA+LNYPS
Sbjct  366  HVNPSKANDPGLIYDIQPHNYIQYLCGLGYTDKQIGLIVQQTIKCSQQSAILEAELNYPS  425

Query  487  FAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISF  308
            F+I LG  S TY+RTVTNVG+A+S YTV ++   GV + V P TLVFT+VNQQ TY+++F
Sbjct  426  FSIILGPQSQTYTRTVTNVGDASSTYTVNITQIRGVHIVVKPTTLVFTKVNQQATYSVTF  485

Query  307  SPSSTPVDIDFVQGAIAWVSQR  242
            +     +   FVQGAI+W+S  
Sbjct  486  TQIGD-ITGHFVQGAISWMSNN  506


 Score = 85.1 bits (209),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -1

Query  1261  LCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDY  1082
             +CD+ GG+ +++KG+TV+DAGG AM+L N +IDG   LA   +LP T + Y+ G  +K Y
Sbjct  251   VCDKSGGVTKLEKGKTVRDAGGVAMVLANLEIDGDGTLAYVDLLPTTNVGYSAGEIIKAY  310

Query  1081  INSTSWPTATIVFKGTFI  1028
             +NSTS P A I+FKGT I
Sbjct  311   VNSTSTPLAGILFKGTSI  328



>gb|EYU39036.1| hypothetical protein MIMGU_mgv1a026993mg [Erythranthe guttata]
Length=745

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/710 (66%), Positives = 566/710 (80%), Gaps = 5/710 (1%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
             TYIV V+ P   +   S+   S++ SF+  + +E + +R+VHSYR+VA+GFAAKLSPE  
Sbjct  37    TYIVRVNLPRGRVLADSDKLESWYTSFL-PAREEADSARLVHSYRNVATGFAAKLSPEEA  95

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
              EM K +GFI+AR Q+  +L+TTHSP+FLGL+QN G W++S+YG+GVI+G+LDTGI P H
Sbjct  96    KEMEKMEGFITARPQKKLSLHTTHSPSFLGLHQNLGLWKSSNYGEGVIIGLLDTGIAPGH  155

Query  1981  PSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAST  1802
             PSF+D++MPPPP KWKGKCEF G ACNNKLIGAR+F+S+G + PP  VDEEGHGTHTA T
Sbjct  156   PSFDDKDMPPPPKKWKGKCEFTGAACNNKLIGARSFISDGPAGPP--VDEEGHGTHTAGT  213

Query  1801  AAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvls  1622
             AAGNFV  A VFG A GTA GMAP AHL++YKVC+EDGC ++DILAAMD A+DDGVDVLS
Sbjct  214   AAGNFVPGANVFGMANGTAAGMAPRAHLAVYKVCSEDGCGDADILAAMDTAVDDGVDVLS  273

Query  1621  lslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDR  1442
             LSLGGGS  FF+D IA+GAFAA++KGIFVSC+AGN GP   +LSNEAPW+LTVGAST DR
Sbjct  274   LSLGGGSFDFFDDVIAVGAFAAIQKGIFVSCSAGNSGPFNASLSNEAPWILTVGASTTDR  333

Query  1441  TIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvkgkv  1265
              I AT VLGN     GES FQ  NFP   +PLI  G+  +E A LCGPGSLD  DVKGK+
Sbjct  334   RILATTVLGNKDVYTGESLFQPSNFPYESMPLIDAGAGGNETAGLCGPGSLDDTDVKGKI  393

Query  1264  VLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKD  1085
             VLC RGGG+AR++KGQTVKDAGGAAMIL+N ++D Y  +AD HVLPAT +SY+ G K++ 
Sbjct  394   VLCQRGGGVARIEKGQTVKDAGGAAMILMNDELDAYDTVADPHVLPATHVSYDAGEKIRA  453

Query  1084  YINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPV  905
             YINS+S P A I F+GT I   +AP+VASFSSRGPS ASPGILKPDI+GPGV+ILAAWPV
Sbjct  454   YINSSSTPWAAITFQGTVIANPSAPTVASFSSRGPSLASPGILKPDIIGPGVSILAAWPV  513

Query  904   gnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNG  725
               + N     ATFN+ISGTSM+ PHLSGIA LLKS HPDWSPAAIKSAI+TTA Q +L G
Sbjct  514   SVDNNTNEN-ATFNMISGTSMSCPHLSGIAALLKSTHPDWSPAAIKSAIMTTAGQLDLEG  572

Query  724   TKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQR  545
               I DER +PADVFA G GHVNPS A+DPGL+YDLQ +DYIPYLCGL YTD EI+ IVQ+
Sbjct  573   GPIEDERHLPADVFALGAGHVNPSSANDPGLVYDLQPEDYIPYLCGLGYTDDEIRTIVQQ  632

Query  544   KVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVT  365
              V CS +TS+PE QLNYPSF++ LG  + TY+RTVTNVGEANS Y+V+V+   GVDVGVT
Sbjct  633   SVSCSNITSVPEVQLNYPSFSVKLGPATKTYTRTVTNVGEANSTYSVEVNRVKGVDVGVT  692

Query  364   PDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAI  215
             P TL FT+VNQ++TY I FS SST V+  FVQGAI W S++  V+SPI++
Sbjct  693   PGTLSFTKVNQKMTYEIKFSKSSTRVNATFVQGAIVWRSEKRAVRSPISV  742



>ref|XP_011071709.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=1222

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/715 (64%), Positives = 553/715 (77%), Gaps = 9/715 (1%)
 Frame = -1

Query  2347  EDTYIVHVSPPAAAINGVSEDYRSYFRSFVSE-SGDEGERSRIVHSYRHVASGFAAKLSP  2171
               TYIVHV+ PA  + G S D  +++RSF+ E + +  E SRI H YR+V +GFAAKLSP
Sbjct  509   RQTYIVHVNLPADQVPGESRDLETWYRSFLPEATANSEEPSRIRHRYRNVVTGFAAKLSP  568

Query  2170  EMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGIT  1991
             E V EM KK+GF+ AR +++Y L TTHSPNFLGLYQN G W  S YGKGVI+GVLD+GIT
Sbjct  569   EDVKEMEKKEGFLHARPEKMYALKTTHSPNFLGLYQNLGSWPESDYGKGVIIGVLDSGIT  628

Query  1990  PNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHT  1811
             P HPSF+DE +PPPPA+WKGKCE +GTACNNKLIGARNF  +    P PP+D +GHGTHT
Sbjct  629   PGHPSFDDEGVPPPPARWKGKCELKGTACNNKLIGARNFARD---DPGPPIDHDGHGTHT  685

Query  1810  ASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvd  1631
             ASTAAGNFV  A VFG A G A G++PLAHL+IYKVC+E+GC ESDILAA DAAI+DGV+
Sbjct  686   ASTAAGNFVSGANVFGQANGVASGLSPLAHLAIYKVCSEEGCYESDILAAFDAAIEDGVN  745

Query  1630  vlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAST  1451
             +LS+S+GG SA F+ED IA+GAF+AMEKGI VSC+A N+GP+Y++L NEAPW+LTVGAST
Sbjct  746   LLSISIGGISAPFYEDGIALGAFSAMEKGILVSCSANNDGPNYFSLENEAPWILTVGAST  805

Query  1450  IDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDA-ALCGPGSLdkvdvk  1274
             IDR I ATA+LGN  + DG+S +Q+ +FP TLLPLI  GS+   A   C PGSL+ +DVK
Sbjct  806   IDRKIVATALLGNQEEYDGQSLYQIHDFPATLLPLINAGSQGNKADEFCAPGSLNDIDVK  865

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             GKVVLC RGGGIAR+ KGQTVKDAGGAAMIL+N   D Y  LAD HVLPA  +SY DG K
Sbjct  866   GKVVLCVRGGGIARIAKGQTVKDAGGAAMILMNDKPDAYDTLADAHVLPAAHVSYADGEK  925

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             ++ YINSTS P ATI+FKGT IG KTAP VAS+SSRGPS ASP ILKPDI+GPG +ILAA
Sbjct  926   IRAYINSTSNPKATILFKGTVIGDKTAPMVASYSSRGPSLASPLILKPDIIGPGSSILAA  985

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             WP     N  N  ATFN+ISGTSMA PHLSGIA L+KS HPDWSPA IKSAI+T+A Q N
Sbjct  986   WP-KPVDNTTNVKATFNMISGTSMACPHLSGIAALIKSVHPDWSPAMIKSAIMTSATQTN  1044

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             LN + ILD+RL+PAD+FATG GHVNP RA DPGL+YD+++ DYI YLC + YT+ ++  I
Sbjct  1045  LNNSLILDQRLLPADIFATGAGHVNPPRALDPGLVYDIKTRDYISYLCYM-YTENQVAII  1103

Query  553   VQRKVEC--SQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGV  380
             V RK+ C  S+   +P  QLNYPSFAI LG  S TY RTVTNVG+A S Y V++    GV
Sbjct  1104  VNRKINCGGSEYKGVPGPQLNYPSFAIQLGYGSQTYPRTVTNVGDAKSSYYVQIENVPGV  1163

Query  379   DVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAI  215
             DV V P  L F++VNQ+ TY +SFS      +  +VQG+IAW+S +HIV+ P+++
Sbjct  1164  DVTVEPKVLAFSKVNQKKTYTVSFSRQDFTANGSYVQGSIAWISVKHIVRIPVSV  1218


 Score =   248 bits (634),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 152/308 (49%), Positives = 191/308 (62%), Gaps = 60/308 (19%)
 Frame = -1

Query  2416  NMAYISVVVCLTLVFHSVASAKYED-------TYIVHVSPPAAAINGVSEDYRSYFRSFV  2258
             N  +  V++CL L FH   +A+  D       TYIVHV          S+D  S++ SF+
Sbjct  2     NFTFFLVLICL-LNFHQFLTAENLDSPQNTLQTYIVHVELQ-------SDDTESWYNSFL  53

Query  2257  -SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPN  2081
              ++     ++ +I++ YR+V SGFAAKLS + V  M++K GFISAR ++++ L+TTHSPN
Sbjct  54    PTDVAARNDKPQILYRYRNVFSGFAAKLSVDDVKTMQQKAGFISARPEQIFPLHTTHSPN  113

Query  2080  FLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACN  1901
             FLGL QN GFW  S+YGKGVI+GVLDTGI P+HPSFNDE + PPPAKWKG+C+F   ACN
Sbjct  114   FLGLNQNLGFWNASNYGKGVIIGVLDTGILPDHPSFNDEGLLPPPAKWKGECQFSSRACN  173

Query  1900  NKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAH  1721
             NKLIGAR F S        P+DE+GHGTHTASTAAGNF G A +F               
Sbjct  174   NKLIGARYFRS----GSGSPLDEDGHGTHTASTAAGNFAGRANIF---------------  214

Query  1720  LSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGI  1541
                     EDG                  DVLSLSLGG S  F+ D+IA+GA+ A EKGI
Sbjct  215   --------EDGV-----------------DVLSLSLGGPSLPFYIDNIALGAYRATEKGI  249

Query  1540  FVSCAAGN  1517
             FVSC+AGN
Sbjct  250   FVSCSAGN  257


 Score =   219 bits (559),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = -1

Query  787  WSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDD  608
            WSPAAIKSAI+TTA Q NL G  I DER +PAD+FATG GHVNPSRA+DPGLIYD+Q +D
Sbjct  319  WSPAAIKSAIMTTAYQANLGGNPIQDERFLPADIFATGSGHVNPSRANDPGLIYDIQPND  378

Query  607  YIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVG  428
            YIPYLCGLNYT+Q++  IVQ++V+CS+V+SIP++QLNYP+F+I LG T  TY+RTVTNVG
Sbjct  379  YIPYLCGLNYTNQQVSLIVQQRVDCSRVSSIPQSQLNYPAFSIVLGSTPQTYTRTVTNVG  438

Query  427  EANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSS  296
            E  S+Y V++    GV V V P  L F+ + Q+L+Y ++F+ S+
Sbjct  439  EPKSLYNVQIVSPAGVVVKVEPAKLSFSRLGQKLSYRVTFTRSA  482


 Score = 85.5 bits (210),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -1

Query  1222  GQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVF  1043
             G  VK+AGGAAMILLNQ+  GYT  A+ HVLPA ++SY D LK+K Y+NS S PTA I++
Sbjct  256   GNNVKNAGGAAMILLNQEPQGYTTQAEAHVLPAAQISYADALKIKAYLNSASRPTARILY  315

Query  1042  KGTF  1031
             KGT+
Sbjct  316   KGTW  319



>ref|XP_007040055.1| Subtilase family protein [Theobroma cacao]
 gb|EOY24556.1| Subtilase family protein [Theobroma cacao]
Length=1087

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/713 (65%), Positives = 551/713 (77%), Gaps = 12/713 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
             TYIVH+  P      V  D   +++SF+S +    +  RIV+SYR+V +GFAAKL+ E  
Sbjct  384   TYIVHLKKPEGVFTQVV-DLDGWYQSFLSFT--SSQHRRIVYSYRNVITGFAAKLTAEEA  440

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
               M++K+G ISAR ++VY+L+TTHSPNFLGL+QN G W  S+YGKGVI+G+LDTGITP H
Sbjct  441   EAMKRKEGIISARPEKVYSLHTTHSPNFLGLHQNSGVWNQSNYGKGVIIGLLDTGITPGH  500

Query  1981  PSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAST  1802
             PSF+DE MPPPPAKWKGKCEF  T CNNKLIGARNF  +      P  DEEGHGTHTAST
Sbjct  501   PSFSDEGMPPPPAKWKGKCEF-ATGCNNKLIGARNFAED---VAGPATDEEGHGTHTAST  556

Query  1801  AAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvls  1622
             A GN+V  A VFG+A GTAVGMAPLAHL++YKVC E GC+ES ILAAMDAA++DGVDVLS
Sbjct  557   AGGNYVKGANVFGNANGTAVGMAPLAHLAMYKVCGE-GCSESAILAAMDAAVEDGVDVLS  615

Query  1621  lslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDR  1442
             LSLGGGS  FFEDSIA+GAF A++KGIFVSC+AGNEGP Y TLSNEAPW+ TVGASTIDR
Sbjct  616   LSLGGGSVPFFEDSIAVGAFTAIQKGIFVSCSAGNEGPLYGTLSNEAPWIFTVGASTIDR  675

Query  1441  TIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDE-DAALCGPGSLdkvdvkgkv  1265
              I ATA LGNG  +DGES FQ ++FP TLLPL+Y G+  +  +A C P SL  VDVKGKV
Sbjct  676   GIAATAKLGNGLTIDGESLFQPKDFPSTLLPLVYAGANGKASSAFCAPRSLRDVDVKGKV  735

Query  1264  VLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKD  1085
             VLC+RGG I R+DKGQ VKD GGAAMIL+N  ++G++ +AD HVLPAT +S+  GLK++D
Sbjct  736   VLCERGGDIGRIDKGQEVKDNGGAAMILMNDKLNGFSTIADPHVLPATHVSFLAGLKIQD  795

Query  1084  YINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPV  905
             YINSTS PTATI+FKGT IG  +AP V SFSSRGP+  S GILKPDI+GPGV+ILAAWPV
Sbjct  796   YINSTSEPTATILFKGTVIGNPSAPEVTSFSSRGPNRQSFGILKPDIIGPGVSILAAWPV  855

Query  904   gnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNG  725
                       +TFN+ISGTSM+ PHLSGIA LLKS+HPDWSPAAIKSAIITTA   NL G
Sbjct  856   SVENKTNTK-STFNMISGTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIITTATLVNLGG  914

Query  724   TKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQR  545
               I+D+   PAD+FATG GHVNPS+A+DPGLIYD+Q DDYI YLCGLNYTD+E+  IVQR
Sbjct  915   KPIVDQTKAPADIFATGAGHVNPSKANDPGLIYDIQPDDYIAYLCGLNYTDEEVGTIVQR  974

Query  544   KVECSQVTSIPEAQLNYPSFAIWLGKT-SLTYSRTVTNVGEANSMYTVKVSPFLGVDVGV  368
              VECS  + I EA+LNYPSF+I L ++ S TY+RTVTNVG A+S YT +V    GVD+ V
Sbjct  975   TVECSSESIIAEAELNYPSFSIILPESGSQTYTRTVTNVGPASSSYTYEVVAPTGVDISV  1034

Query  367   TPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              PD + FT VNQ+ TY+++FS     V + F QG + W+S +H V +PI  IF
Sbjct  1035  QPDHIAFTAVNQKATYSVTFS-RQKDVSLQFSQGLLTWISAQHNVTTPIVAIF  1086


 Score =   193 bits (490),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -1

Query  787  WSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDD  608
            +S  A+KSAIITTAD+  L+G  ILDE   P++VFA G GHVNPS+A+DPGL+YD+Q DD
Sbjct  192  FSAPAMKSAIITTADRVTLDGLPILDETWSPSNVFAIGAGHVNPSKANDPGLVYDMQPDD  251

Query  607  YIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVG  428
            YIPYLC L YTD +++ IVQ+ V CS  T+I EA+LNYPSF+I LG T+ TY+ TVTNVG
Sbjct  252  YIPYLCSLGYTDDQVRVIVQQSVRCSNDTNIAEAELNYPSFSIVLGSTNRTYTWTVTNVG  311

Query  427  EANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISF  308
             ANS +T+ ++   GVD+ VT + + FTEV Q  T++++F
Sbjct  312  PANSSHTINIAAPPGVDISVTTNIIEFTEVKQNATFSVTF  351


 Score =   126 bits (316),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 74/98 (76%), Gaps = 5/98 (5%)
 Frame = -1

Query  2059  FGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGAR  1880
              GFW+ S++ KGVI+GV DTGITP+HPSF+DE M PPP KWKG+CE     CNNKLIGAR
Sbjct  1     MGFWKQSNFRKGVIIGVQDTGITPSHPSFSDEGM-PPPEKWKGRCEL--VECNNKLIGAR  57

Query  1879  NFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVF  1766
             NF ++       P+D++GH THTAST AGNFV  A+VF
Sbjct  58    NFRND--EQGQAPLDQDGHSTHTASTTAGNFVQGASVF  93


 Score = 92.8 bits (229),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 62/82 (76%), Gaps = 4/82 (5%)
 Frame = -1

Query  1243  GIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSW  1064
             G   + KGQ VKDAGGAAMIL+N D++ ++ LAD HVLPAT +SY  G+ + +YINST+ 
Sbjct  122   GAILICKGQEVKDAGGAAMILMNDDLNKFSTLADPHVLPATHVSYTAGMNILNYINSTAK  181

Query  1063  PTATIVFKGTFIGTKTAPSVAS  998
             PTATI+F+GTF    +AP++ S
Sbjct  182   PTATILFEGTF----SAPAMKS  199



>ref|XP_007208895.1| hypothetical protein PRUPE_ppa026788mg [Prunus persica]
 gb|EMJ10094.1| hypothetical protein PRUPE_ppa026788mg [Prunus persica]
Length=770

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/761 (59%), Positives = 562/761 (74%), Gaps = 21/761 (3%)
 Frame = -1

Query  2440  IIAMKGTPNMAYISVVVC-LTLVFHSVASAKYED----TYIVHVSPPAAA--INGVSEDY  2282
             II + G   M Y+S+ V     V   +A    E     TYIV V  P      +   ED 
Sbjct  11    IIYLLGLSFMLYLSIAVANEEAVLEPLAETNEEQNNMQTYIVWVKKPVQKYFFSKSHEDL  70

Query  2281  RSYFRSFVS---ESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRV  2111
              S++ +F+     S ++ ++ R+VH+YR+VA+GFAAKL+PE V  M  K+GF+SA  +++
Sbjct  71    ESWYHTFLPTTIASSNQLKKPRMVHAYRNVATGFAAKLTPEEVKAMENKEGFLSAHPEQI  130

Query  2110  YNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKG  1931
               L+TTHSPNFLGL+Q  G W+ S+YG+GVI+GVLDTGI+P+HPSF+DE + PPPAKWKG
Sbjct  131   LPLHTTHSPNFLGLHQGLGVWKGSNYGEGVIIGVLDTGISPDHPSFSDEGVAPPPAKWKG  190

Query  1930  KCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKG  1751
             KC+F GT CNNKLIGARNF   G +   PPVD+EGHGTHT+STAAGNFV  A VFG A G
Sbjct  191   KCDFNGTVCNNKLIGARNF-QGGQTTGGPPVDDEGHGTHTSSTAAGNFVKGANVFGMANG  249

Query  1750  TAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAI  1571
             TA GMAP AHL+IYKVC+E+GCAE DILAA+D A++DGVDVLSLSLGG S  F+ D IAI
Sbjct  250   TASGMAPYAHLAIYKVCSEEGCAEGDILAALDTAVEDGVDVLSLSLGGASVPFYADGIAI  309

Query  1570  GAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGE  1391
             GAF A++KGIFVSC+AGN GP Y +L+NEAPW+LTVGASTIDR+IKATA+LGNGA+ DGE
Sbjct  310   GAFGAIQKGIFVSCSAGNSGPFYASLANEAPWILTVGASTIDRSIKATALLGNGAEYDGE  369

Query  1390  SAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQT  1214
             S FQ ++F   LLPL+Y G+   + +A C  GSL  V+      LC+RGGG+AR+DKG  
Sbjct  370   SLFQPKDFSSKLLPLVYAGANGKQSSAFCDAGSLGNVEGAIV--LCERGGGVARIDKGAE  427

Query  1213  VKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGT  1034
             VK AGGAAMIL+N + DG + LAD HVLPAT + Y  G+K+K Y+NSTS P ATI+FKGT
Sbjct  428   VKRAGGAAMILVNAETDGDSTLADPHVLPATHVGYVAGVKIKAYLNSTSSPAATILFKGT  487

Query  1033  FIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIIS  854
              IG   AP + SFSSRGPS AS GILKPDI+GPGV+ILAAWPV  +       ATFN++S
Sbjct  488   VIGDGLAPKITSFSSRGPSIASTGILKPDIIGPGVSILAAWPVSVDNGTEGK-ATFNMVS  546

Query  853   GTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATG  674
             GTSM+ PHLSGIA LLKS+HPDWSPAAIKSAI+TTA+ +NL G  I+DE L PAD+FATG
Sbjct  547   GTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIMTTAEVHNLEGKPIVDETLKPADIFATG  606

Query  673   GGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNY  494
              GHVNPS+A+DPGLIYD + +DYIPYLCGLNYTD++IQ I Q++V CSQV +IPEAQLNY
Sbjct  607   AGHVNPSKANDPGLIYDTKPEDYIPYLCGLNYTDEQIQVITQQRVNCSQVEAIPEAQLNY  666

Query  493   PSFAIWLGKT----SLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQL  326
             PSF+I +G +    S  Y+RTV NVG ANS Y + +     + + V P+ L FTEVNQ++
Sbjct  667   PSFSIIVGSSEDSKSQYYTRTVKNVGPANSTYNLDLFVPRNMGMSVNPEVLKFTEVNQEI  726

Query  325   TYNISF--SPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             T+   F    S+    + F QG + WVS +H V SPI++IF
Sbjct  727   TFEAEFFAEDSAGKDGVPFAQGYLRWVSDQHSVTSPISVIF  767



>ref|XP_009781097.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=754

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/716 (63%), Positives = 544/716 (76%), Gaps = 13/716 (2%)
 Frame = -1

Query  2338  YIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERS--RIVHSYRHVASGFAAKLSPEM  2165
             YIVH   P        +D  S++ SF+  +  +  R   R+++SYR+V +GFAAKLSP+ 
Sbjct  43    YIVHCEFPDGNRTARYQDLDSWYLSFLPATTSDSSREAPRLIYSYRNVLTGFAAKLSPDD  102

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             + EM KK GFISAR ++  +LYTTHS NFLGL+QN GFW +S+YGKGVI+GV+DTGI P+
Sbjct  103   LKEMEKKDGFISARPEKQLDLYTTHSLNFLGLHQNMGFWNDSNYGKGVIIGVIDTGIFPD  162

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             HPSF+D  MPPPPAKWKGKCEF  T CNNKLIGAR F S G+  P    DE GHGTHTAS
Sbjct  163   HPSFSDSGMPPPPAKWKGKCEFNVTKCNNKLIGARYFQSSGNGSPW---DENGHGTHTAS  219

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAGNFV  A +FG+A GTA G+APLAH++IYKVC+   C+ESDILAAMD AI+DGVDVL
Sbjct  220   TAAGNFVPGANIFGNANGTAAGVAPLAHVAIYKVCSYIFCSESDILAAMDMAIEDGVDVL  279

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
             SLSLGG + +F+ED IA+GAF+AMEKGIFVSCAAGN GP  ++ SNEAPW+LTVGASTID
Sbjct  280   SLSLGGVAYNFYEDVIAVGAFSAMEKGIFVSCAAGNSGPYRFSTSNEAPWILTVGASTID  339

Query  1444  RTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDED--AALCGPGSLdkvdvkg  1271
             R IKATAVLGN  + DGESAFQ  +FPPTLLPL YPGS D D  A  C P SL+  +V G
Sbjct  340   RKIKATAVLGNNEEYDGESAFQPSDFPPTLLPLAYPGSNDSDILAKYCYPTSLNNTNVTG  399

Query  1270  kvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKV  1091
             K+VLC+ G   +RV KG+ VK AGGAAMIL+N ++   T  A+ HV+P   +SY DGLK+
Sbjct  400   KIVLCEIGI-TSRVSKGEAVKAAGGAAMILMNTELLANTTPAEAHVIPVAHVSYADGLKI  458

Query  1090  KDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAW  911
             K+YINST  PTATIVF GT IG   AP VA FSSRGPS ASPGILKPDI+GPGVNILAAW
Sbjct  459   KEYINSTLVPTATIVFNGTIIGDDRAPVVAGFSSRGPSYASPGILKPDIIGPGVNILAAW  518

Query  910   PVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNL  731
             PV    N     + FN+ISGTSM+ PHLSG+A LLKS HPDWSPAAIKSAI+TTAD  NL
Sbjct  519   PVSLENNTN---SMFNMISGTSMSCPHLSGVAALLKSVHPDWSPAAIKSAIMTTADVLNL  575

Query  730   NGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIV  551
                 I DE  +PADVFATG GHVNPS+A+DPGLIYD++  DY+ YLCGLNYT++++   +
Sbjct  576   GLNFIEDETYLPADVFATGAGHVNPSKANDPGLIYDIEPADYVSYLCGLNYTNRQVGIFL  635

Query  550   QRKVECSQVTSIPEAQLNYPSFAIWLGKTSL--TYSRTVTNVGEANSMYTVKVSPFLGVD  377
             QRKV CS++TSI E QLNYPSF+I L   S   TYSR VTNVG+ANS Y+V++    GVD
Sbjct  636   QRKVNCSEITSILEGQLNYPSFSIKLSTDSAAKTYSRNVTNVGQANSTYSVEIVSPPGVD  695

Query  376   VGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             V V P TLVF+EVNQ+L+Y ++F+P  +     + QG++ W+S +HIV+SPIA+ F
Sbjct  696   VKVEPTTLVFSEVNQKLSYQVTFTPLPSNPSTGYYQGSLKWISGKHIVRSPIAVRF  751



>ref|XP_002303550.2| hypothetical protein POPTR_0003s11860g [Populus trichocarpa]
 gb|EEE78529.2| hypothetical protein POPTR_0003s11860g [Populus trichocarpa]
Length=755

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/717 (64%), Positives = 551/717 (77%), Gaps = 13/717 (2%)
 Frame = -1

Query  2353  KYEDTYIVHVSPPAAAINGVSEDYRSYFRSFVSES-GDEGERSRIVHSYRHVASGFAAKL  2177
             K+E TYIV V  P   ++  ++D  S+++SF+  +      + R+V+SYRHVA+GFAAKL
Sbjct  46    KFE-TYIVFVQKPEEGVS--ADDLDSWYKSFLPVTIPSSNHQERMVYSYRHVATGFAAKL  102

Query  2176  SPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTG  1997
             + E    M  K GF+SA+ Q++ +L+TTHSPNFLGL  N GFWRNS+YGKGVI+GVLDTG
Sbjct  103   TAEEAKAMEDKDGFLSAKPQKILSLHTTHSPNFLGLQTNLGFWRNSTYGKGVIIGVLDTG  162

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGT  1817
             I+P+HPSF+DE +PPPP KWKGKC F GT CNNKLIGAR+F S       PP DEEGHGT
Sbjct  163   ISPDHPSFSDEGVPPPPTKWKGKCNFNGTVCNNKLIGARDFTSS---KAAPPFDEEGHGT  219

Query  1816  HTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddg  1637
             HTASTAAGNFV +A+VFG+A GTAVGMAPLAHL+IYKVC++ GCA+SDILAAMDAA++DG
Sbjct  220   HTASTAAGNFVNDASVFGNANGTAVGMAPLAHLAIYKVCSDFGCADSDILAAMDAAVEDG  279

Query  1636  vdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGA  1457
             VDVLSLSLGGGSA FFEDSIA+GAF A +KGIFVSC+AGNEGP   +LSNEAPW+LTVGA
Sbjct  280   VDVLSLSLGGGSAPFFEDSIAVGAFGATQKGIFVSCSAGNEGPYNGSLSNEAPWILTVGA  339

Query  1456  STIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvd  1280
             STIDR+I+A  +LGN     GES FQ  N PP  + L+Y G+   + AA C P SL  +D
Sbjct  340   STIDRSIRADVLLGNSNHFFGESLFQ-SNSPP-YMSLVYAGAHGSQSAAFCAPESLTDID  397

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
             VKGK+VLC+RGGGIAR+DKGQ VKDAGGAAMIL+N    GY+ LAD HVLPA+ +SY+ G
Sbjct  398   VKGKIVLCERGGGIARIDKGQAVKDAGGAAMILMNDKDSGYSTLADAHVLPASHVSYSAG  457

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
             L +K YINST  PTATI+F GT IG KTAP+VASFSSRGPS ASPGILKPDI+GPGV+IL
Sbjct  458   LSIKAYINSTQVPTATIMFLGTKIGDKTAPTVASFSSRGPSLASPGILKPDIIGPGVSIL  517

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAWPV          +TFNIISGTSM+ PHLSGIA LLKSAHPDWSPAAIKSAI+TTAD 
Sbjct  518   AAWPVSVENKTDTK-STFNIISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTTADL  576

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              NL    ILDERL+PAD+ ATG G VNPS+ASDPGL+YD+Q DDYIPYLCGL Y D++I 
Sbjct  577   VNLGNQPILDERLLPADILATGAGQVNPSKASDPGLVYDIQPDDYIPYLCGLGYPDKDIS  636

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLGKT--SLTYSRTVTNVGEANSMYTVKVSPFL  386
              IVQR+V CS+ +SI EAQLNYPSF+I  G    + TY+RTVTNVG  NS YT  V P  
Sbjct  637   YIVQRQVNCSEESSILEAQLNYPSFSIVYGPNPATQTYTRTVTNVGPPNSSYTAFVDPPP  696

Query  385   GVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAI  215
             GV+V VTP  ++FT   Q  TY+++F+ +S   +    QG I+  +    + +PI I
Sbjct  697   GVNVTVTPKNIIFTNTEQTATYSVTFTATSESNNDPIGQGYISPNNLCTRLGTPIRI  753



>ref|XP_008238738.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=770

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/761 (59%), Positives = 557/761 (73%), Gaps = 21/761 (3%)
 Frame = -1

Query  2440  IIAMKGTPNMAYISVVVC-LTLVFHSVASAKYED----TYIVHVSPPAAA--INGVSEDY  2282
             II + G   + Y+SV V     V   +A    E     TYIV V  P      +   ED 
Sbjct  11    IIYLLGLSFVLYLSVAVANEEAVLEPLAETHEEQNNMQTYIVWVKKPVQKYFFSKSHEDL  70

Query  2281  RSYFRSFVS---ESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRV  2111
              S++ +F+     S ++ ++ R+VH+YR+VA+GFAAKL PE V  M KK+GF+SA  +++
Sbjct  71    ESWYHTFLPTTIASSNQLKKPRMVHAYRNVATGFAAKLMPEEVKAMEKKEGFLSAHPEQI  130

Query  2110  YNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKG  1931
               L+TTHSPNFLGL+Q  G W+ S+YG+GVI+GVLDTGI+P+HPSF+DE + PPPAKWKG
Sbjct  131   LPLHTTHSPNFLGLHQGLGVWKGSNYGEGVIIGVLDTGISPDHPSFSDEGVAPPPAKWKG  190

Query  1930  KCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKG  1751
             KC F GT CNNKLIGARNF   G +   PPVD EGHGTHT+STAAGNFV  A VFG A G
Sbjct  191   KCNFNGTVCNNKLIGARNF-QGGQTTGGPPVDNEGHGTHTSSTAAGNFVKGANVFGMANG  249

Query  1750  TAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAI  1571
             TA GMAP AHL+IYKVC+E GCAE DILAA+D A++DGVDVLSLSLGG S  F+ D IAI
Sbjct  250   TASGMAPYAHLAIYKVCSEAGCAEGDILAALDTAVEDGVDVLSLSLGGASVPFYADGIAI  309

Query  1570  GAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGE  1391
             GAF A++KGIFVSC+AGN GP Y +L+NEAPW+LTVGASTIDR+IKATA+LGNGA+ DGE
Sbjct  310   GAFGAIQKGIFVSCSAGNSGPFYASLANEAPWILTVGASTIDRSIKATALLGNGAEYDGE  369

Query  1390  SAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQT  1214
             S FQ ++F    LPL+Y G+   + +A C  GSL  V+      LC+RGGG+AR+DKG  
Sbjct  370   SLFQPKDFSSKFLPLVYAGANGKQSSAFCDAGSLGNVEGAIV--LCERGGGVARIDKGAE  427

Query  1213  VKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGT  1034
             VK AGGAAMIL+N + DG + LAD HVLPAT + Y  G+K+K Y+NSTS P ATI+FKGT
Sbjct  428   VKRAGGAAMILVNAETDGDSTLADPHVLPATHVGYVAGVKIKAYLNSTSNPAATILFKGT  487

Query  1033  FIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIIS  854
              IG   AP + SFSSRGPS AS GILKPDI+GPGV+ILAAWPV  +       ATFN++S
Sbjct  488   VIGDGLAPKITSFSSRGPSIASTGILKPDIIGPGVSILAAWPVSVDNGTEGK-ATFNMVS  546

Query  853   GTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATG  674
             GTSM+ PHLSGIA LLKS+HPDWSPAAIKSAI+TTA+ +NL G  I+DE L PAD+FATG
Sbjct  547   GTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIMTTAEVHNLEGKPIVDETLKPADIFATG  606

Query  673   GGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNY  494
              GHVNPS+A+DPGLIYD + +DYIPYLCGLNYTD++IQ I Q++V CSQV +IPEAQLNY
Sbjct  607   AGHVNPSKANDPGLIYDTKPEDYIPYLCGLNYTDEQIQVITQQRVNCSQVEAIPEAQLNY  666

Query  493   PSFAIWLGKT----SLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQL  326
             PSF+I +G +    S  Y+RTV NVG ANS Y + +     + + V P  L FTEVNQ++
Sbjct  667   PSFSIIVGSSEDSRSQYYTRTVKNVGPANSTYNLDLFVPQNMGMSVNPQVLKFTEVNQEI  726

Query  325   TYNISF--SPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             T+   F    S+    + F QG + WVS +H V SPI++IF
Sbjct  727   TFEAEFFAQDSAGKDGVPFAQGYLRWVSDQHSVTSPISVIF  767



>gb|EYU39035.1| hypothetical protein MIMGU_mgv1a001882mg [Erythranthe guttata]
Length=745

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/709 (64%), Positives = 558/709 (79%), Gaps = 7/709 (1%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
             TYIVHV  P   ++  S++   ++ SF+   GD+G R+R+V ++RHVA+GFAAKL+ E V
Sbjct  40    TYIVHVKLPRGRVSADSDELERWYISFLP--GDKGPRTRLVRTFRHVATGFAAKLTSEEV  97

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
              EM KK+GFI+AR Q+  +L+TTHSP+FLGL+QN G W+ S+YG+GVI+G++D+GI+P H
Sbjct  98    KEMEKKEGFITARLQKKLSLHTTHSPSFLGLHQNLGLWKGSNYGEGVIIGLIDSGISPGH  157

Query  1981  PSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAST  1802
              SF+D ++PPPP KWKG+CEF    CNNKLIGARNF S+      PPVD+ GHGTHTAST
Sbjct  158   SSFDDRDVPPPPKKWKGQCEFSA-GCNNKLIGARNFASD---TWGPPVDDYGHGTHTAST  213

Query  1801  AAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvls  1622
             AAGNFV    VFG A GTAVGMAP AHL++YKVC+++GC E+DILAAMDAAI+DGV V+S
Sbjct  214   AAGNFVPGGNVFGMANGTAVGMAPRAHLAMYKVCSDEGCYEADILAAMDAAIEDGVHVMS  273

Query  1621  lslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDR  1442
             LSLGGGS  FF+D IAIGAFAA++KGIFVSC+AGN GP   +LSNEAPW+LTVGASTIDR
Sbjct  274   LSLGGGSIDFFDDVIAIGAFAAIQKGIFVSCSAGNSGPFDGSLSNEAPWILTVGASTIDR  333

Query  1441  TIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvdvkgkvV  1262
              I ATAVLGN  +  GES +Q  +FP   +PLI     +    LC PGSLD +DVKGK+V
Sbjct  334   RIVATAVLGNKDEYTGESVYQPSDFPYEDMPLIDAAGGNVTTGLCEPGSLDNIDVKGKIV  393

Query  1261  LCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDY  1082
             LC  GG    +DKGQTVKDAGGAAMIL+N++ D YT +AD HVLPATE+SY+ G+K++ Y
Sbjct  394   LCQSGGWTDPIDKGQTVKDAGGAAMILMNKERDAYTTIADPHVLPATEVSYDAGVKIRAY  453

Query  1081  INSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVg  902
             I+STS P A I+F+GT IG  +A +VASFSSRGPS+ASPGILKPDI+GPGVNILAAWP  
Sbjct  454   ISSTSTPRAAIMFRGTVIGFPSALTVASFSSRGPSSASPGILKPDIVGPGVNILAAWP-E  512

Query  901   nntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGT  722
             +  N  N NA FNIISGTSM+ PHLSG+A LLKSAHPDWSPAAIKSAI+TTA Q +  G 
Sbjct  513   SVDNYPNENAIFNIISGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIMTTASQLDSAGG  572

Query  721   KILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRK  542
              I DER +PAD+FA G GHVNPS A+DPGL+YDLQ +DYIPYLCGL YTD EI+ IV + 
Sbjct  573   PIEDERHLPADIFALGAGHVNPSSANDPGLVYDLQPEDYIPYLCGLGYTDDEIETIVHQS  632

Query  541   VECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTP  362
             V CS +TSIPEAQLNYPSF++ LG ++ TY+RTVTNVGEANS Y+V++    GVD+GV P
Sbjct  633   VSCSNITSIPEAQLNYPSFSVQLGASTKTYTRTVTNVGEANSTYSVEIIRAKGVDLGVEP  692

Query  361   DTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAI  215
              TL F++VNQ++TY ISF  SST V+  FVQGAI W S +  V+SPI++
Sbjct  693   CTLSFSKVNQKMTYEISFRKSSTSVNGTFVQGAIVWRSAKRAVRSPISV  741



>ref|XP_009781098.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=756

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/716 (62%), Positives = 544/716 (76%), Gaps = 11/716 (2%)
 Frame = -1

Query  2338  YIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERS--RIVHSYRHVASGFAAKLSPEM  2165
             YI+H   P    +   +D  S++ SF+  +  +G R   R+++SYR+V +GFAAKL P+ 
Sbjct  43    YIIHCEFPDREGDSRYQDLDSWYLSFLPATTSDGSREAPRLIYSYRNVLTGFAAKLYPDD  102

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             + EM+K+KGFISAR +R  +LYTTHS NFLGL+QN GFW +S+YGKGVI+GV+DTGI P+
Sbjct  103   LKEMQKRKGFISARPERQLDLYTTHSLNFLGLHQNMGFWNDSNYGKGVIIGVIDTGIFPD  162

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             HPSF+D+ MPPPPAKWKGKCEF  T CNNKLIGAR F S G+  P    DE GHGTHTAS
Sbjct  163   HPSFSDDGMPPPPAKWKGKCEFNVTKCNNKLIGARYFQSSGNGSPW---DENGHGTHTAS  219

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAGNFV  A +FG+A GTA G+APLAH++IYKVC+   C+ESD LAAMD AI+DGVDVL
Sbjct  220   TAAGNFVPGANIFGNANGTAAGVAPLAHVAIYKVCSGITCSESDTLAAMDMAIEDGVDVL  279

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
             SLSLG  + +F+ D+IA+GAF+AMEKGIFVSCAAGN GP  ++ +NEAPW+LTVGASTID
Sbjct  280   SLSLGRLTNNFYSDNIALGAFSAMEKGIFVSCAAGNSGPSSFSTANEAPWILTVGASTID  339

Query  1444  RTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK--DEDAALCGPGSLdkvdvkg  1271
             R IK TAVLGN  + DGESAFQ   FPPTLL L YPGS   D DA  C P SL+  +V G
Sbjct  340   RKIKTTAVLGNNEEFDGESAFQPSEFPPTLLHLAYPGSNASDSDAKYCTPASLNNTNVMG  399

Query  1270  kvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKV  1091
             K+VLC+ G    RVDKG+ VK AGGAAMIL+N +    T LA+ HVLP T +SY DGLK+
Sbjct  400   KIVLCEVGR-TTRVDKGKAVKVAGGAAMILMNTENLANTTLAEAHVLPVTHVSYADGLKI  458

Query  1090  KDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAW  911
             K+YINST  PTATIVFKGT IG   AP VA FSSRGP+ ASPGILKPDI GPGVNILAAW
Sbjct  459   KEYINSTLIPTATIVFKGTIIGDDRAPVVAGFSSRGPNFASPGILKPDITGPGVNILAAW  518

Query  910   PVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNL  731
              V    N    +   N+ISGTSM+ PHLSG+A LLKS+HPDWSPAAIKSAI+TTAD  NL
Sbjct  519   HVSLENNTNTNSNF-NMISGTSMSCPHLSGVAALLKSSHPDWSPAAIKSAIMTTADVLNL  577

Query  730   NGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIV  551
               + I DE  +PA VFATG GHVNPS+A+DPGLIYD++  DY+ YLCGLNYTD+++   +
Sbjct  578   GLSSIEDETYLPASVFATGAGHVNPSKANDPGLIYDIEPADYVAYLCGLNYTDRQVGIFL  637

Query  550   QRKVECSQVTSIPEAQLNYPSFAIWL--GKTSLTYSRTVTNVGEANSMYTVKVSPFLGVD  377
             QRKV+CS++TSI E QLNYPSF+I +    T+ TYSR  TN+G+ANS Y +++    GVD
Sbjct  638   QRKVKCSEITSILEGQLNYPSFSIQVRSNSTAQTYSRNATNIGQANSTYNIEIDSPPGVD  697

Query  376   VGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             V V P TLVF+E+NQ+L+Y ++F+P +T     F QG++ W+S++HIV+SPI + F
Sbjct  698   VKVEPTTLVFSEMNQKLSYQVTFTPLATRPSTSFNQGSLRWISKKHIVRSPIVVRF  753



>ref|XP_006440471.1| hypothetical protein CICLE_v10024346mg [Citrus clementina]
 gb|ESR53711.1| hypothetical protein CICLE_v10024346mg [Citrus clementina]
Length=742

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/718 (61%), Positives = 538/718 (75%), Gaps = 11/718 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAA--AINGVSEDYRSYFRSF--VSESGDEGERSRIVHSYRHVASGFAAKL  2177
             +TYIV+V  P    A   +  D  S++ SF  VS S     + R+++ Y++V +GFAAKL
Sbjct  31    ETYIVYVRKPDQDQATTSIKLDLDSWYHSFLPVSISSSINNQPRMLYCYKNVITGFAAKL  90

Query  2176  SPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTG  1997
             + E    M  K+GFISA  ++   L+TTH+PNFLGL+QN GFW++S+ GKGVI+GV+DTG
Sbjct  91    TAEQAKAMETKEGFISAHVEKTLQLHTTHTPNFLGLHQNSGFWKDSNLGKGVIIGVMDTG  150

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGT  1817
             ITP HPSF+DE MPPPPAKWKGKCEF+G ACNNKLIGARNF+    S   PP+D+EGHGT
Sbjct  151   ITPGHPSFSDEGMPPPPAKWKGKCEFKGAACNNKLIGARNFLQ--GSTGEPPLDDEGHGT  208

Query  1816  HTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddg  1637
             HTA+TAAGNFV  A VFG A GTAVG+APLAHL+IYKVC  DGC+ES + AAMD AIDDG
Sbjct  209   HTATTAAGNFVNGANVFGQANGTAVGIAPLAHLAIYKVCDFDGCSESRVYAAMDTAIDDG  268

Query  1636  vdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGA  1457
             VDVLSLSLG  S  FFED +AIG+F+A++K IFVSC+AGNEGP+  T SNEAPW+L+VGA
Sbjct  269   VDVLSLSLGAASVPFFEDPLAIGSFSAIQKEIFVSCSAGNEGPNPSTSSNEAPWILSVGA  328

Query  1456  STIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvd  1280
             ST DR+I A+  LGN A  DGE+ FQ ++FP    PLIYPG+  +  +A C PGSL    
Sbjct  329   STTDRSIVASVELGNQAVYDGEALFQPKDFPSKQFPLIYPGANGNVSSAQCSPGSLSSNI  388

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
                 V LC+RGGG  R  KGQ VKDAGG  MIL+N  ++GY+ LAD H+LPA  +SY  G
Sbjct  389   RGKLV-LCERGGG-ERTKKGQVVKDAGGIGMILMNDKLNGYSTLADPHLLPAVHVSYAAG  446

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
               +K YINSTS P ATIVFKGT IG K+ P VASFSSRGPS ASPGILKPDI+GPGV+IL
Sbjct  447   ESIKAYINSTSSPNATIVFKGTVIGKKSTPEVASFSSRGPSIASPGILKPDIIGPGVSIL  506

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAWP           +TFN++SGTSM+ PHLSG+A LLKSAHPDWSPAAIKSAI+TTAD 
Sbjct  507   AAWPFSVENKTNTK-STFNMVSGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIMTTADI  565

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              +L+G  I+D+RL+PAD+FA G GHVNPS A+DPGLIYD+Q DDYIPYLCGLNY+DQ +Q
Sbjct  566   VSLDGKPIVDQRLLPADMFAVGAGHVNPSSANDPGLIYDIQPDDYIPYLCGLNYSDQHVQ  625

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGV  380
              IV   V+CS+V+ I E +LNYPSF++ LG TS TY+RTVTNVG+A S YT K+    GV
Sbjct  626   DIVMINVQCSKVSGIAETELNYPSFSVILGSTSQTYNRTVTNVGQAESSYTHKIVAPEGV  685

Query  379   DVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
              V V P+ + FT+ NQ+  Y+I+F+ S     + F QG ++WVS +H V+SPIA+ FQ
Sbjct  686   TVTVEPENISFTKKNQKAIYSITFTRSQKTSAL-FAQGYLSWVSTKHTVRSPIAVRFQ  742



>gb|KDO63675.1| hypothetical protein CISIN_1g048043mg [Citrus sinensis]
Length=742

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/718 (61%), Positives = 538/718 (75%), Gaps = 11/718 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAA--AINGVSEDYRSYFRSF--VSESGDEGERSRIVHSYRHVASGFAAKL  2177
             +TYIV+V  P    A   +  D  S++ SF  VS S     + R+++ Y++V +GFAAKL
Sbjct  31    ETYIVYVRKPDQDQATTSIKLDLDSWYHSFLPVSISSSINNQPRMLYCYKNVITGFAAKL  90

Query  2176  SPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTG  1997
             + E    M  K+GFISA  ++   L+TTH+PNFLGL+QN GFW++S+ GKGVI+GV+DTG
Sbjct  91    TAEQAKAMETKEGFISAHVEKTLQLHTTHTPNFLGLHQNSGFWKDSNLGKGVIIGVMDTG  150

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGT  1817
             ITP HPSF+DE MPPPPAKWKGKCEF+G ACNNKLIGARNF+    S   PP+D+EGHGT
Sbjct  151   ITPGHPSFSDEGMPPPPAKWKGKCEFKGAACNNKLIGARNFLQ--GSTGEPPLDDEGHGT  208

Query  1816  HTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddg  1637
             HTA+TAAGNFV  A VFG A GTAVG+APLAHL+IYKVC  DGC+ES + AAMD AIDDG
Sbjct  209   HTATTAAGNFVNGANVFGQADGTAVGIAPLAHLAIYKVCDFDGCSESRVYAAMDTAIDDG  268

Query  1636  vdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGA  1457
             VDVLSLSLG  S  FFED +AIG+F+A++K IFVSC+AGNEGP+  T SNEAPW+L+VGA
Sbjct  269   VDVLSLSLGAASVPFFEDPLAIGSFSAIQKEIFVSCSAGNEGPNPSTSSNEAPWILSVGA  328

Query  1456  STIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvd  1280
             ST DR+I A+  LGN A  DGE+ FQ ++FP    PLIYPG+  +  +A C PGSL    
Sbjct  329   STTDRSIVASVELGNQAVYDGEALFQPKDFPSKQFPLIYPGANGNVSSAQCSPGSLSSNI  388

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
                 V LC+RGGG  R  KGQ VKDAGG  MIL+N  ++GY+ LAD H+LPA  +SY  G
Sbjct  389   RGKLV-LCERGGG-ERTKKGQVVKDAGGIGMILMNDKLNGYSTLADPHLLPAVHVSYAAG  446

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
               +K YINSTS P ATIVFKGT IG K+ P +ASFSSRGPS ASPGILKPDI+GPGVNIL
Sbjct  447   ESIKAYINSTSSPNATIVFKGTVIGKKSTPELASFSSRGPSIASPGILKPDIIGPGVNIL  506

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAWP           +TFN+++GTSM+ PHLSG+A LLKSAHPDWSPAAIKSAI+TTAD 
Sbjct  507   AAWPFSVENKTNTK-STFNMVAGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIMTTADI  565

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              +L+G  I+D+RL+PAD+FA G GHVNPS A+DPGLIYD+Q DDYIPYLCGLNY+DQ +Q
Sbjct  566   VSLDGKPIVDQRLLPADMFAVGAGHVNPSSANDPGLIYDIQPDDYIPYLCGLNYSDQHVQ  625

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGV  380
              IV   V+CS+V+ I E +LNYPSF++ LG TS TY+RTVTNVG+A S YT K+    GV
Sbjct  626   DIVMINVQCSKVSGIAETELNYPSFSVILGSTSQTYNRTVTNVGQAESSYTHKIVAPEGV  685

Query  379   DVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
              V V P+ + FT+ NQ+  Y+I+F+ S     + F QG ++WVS +H V+SPIA+ FQ
Sbjct  686   TVTVEPENISFTKKNQKAIYSITFTRSQKTSAL-FAQGYLSWVSTKHTVRSPIAVRFQ  742



>ref|XP_004300734.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=765

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/756 (59%), Positives = 565/756 (75%), Gaps = 16/756 (2%)
 Frame = -1

Query  2440  IIAMKGTPNMAYISVVVCLTLV--FHSVASAKYEDTYIVHVSPPAAAINGVSE--DYRSY  2273
             II + G   M Y+S+ +    V     +A  K   TYIV +  P  ++   S+  D  S+
Sbjct  11    IIYLLGFSFMFYLSLAIAAEKVAELEPLAETKSMQTYIVWLEKPVGSLLEQSDHADLESW  70

Query  2272  FRSFVSE---SGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNL  2102
             ++S++ +   S ++ E+ R+V++YR+VA+GFAAKL+ E V+EM KK+GFISA  +R   +
Sbjct  71    YQSYLPQTIASSNQLEKPRMVYAYRNVATGFAAKLTVEEVAEMEKKEGFISAHPERNLQM  130

Query  2101  YTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCE  1922
             +TTHSPNFLGL Q  G  + S+YG+G+I+GVLD+GI P+HPSFNDE +PPPPAKWKG+C+
Sbjct  131   HTTHSPNFLGLQQGMGLSKGSNYGEGMIIGVLDSGIFPDHPSFNDEGVPPPPAKWKGRCD  190

Query  1921  FEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAV  1742
             F GT CNNKLIGAR+F + G +   PPVD+EGHGTHT++TAAGNFV  A+VFG A GTA 
Sbjct  191   FNGTVCNNKLIGARSF-NGGKTTGAPPVDDEGHGTHTSTTAAGNFVKGASVFGMANGTAT  249

Query  1741  GMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAF  1562
             GMAP AH+++YKVC+EDGC+ESDI+AAMD A+DDGVDVLSLSLGGGSA F+ D IA+GAF
Sbjct  250   GMAPHAHVAMYKVCSEDGCSESDIIAAMDTAVDDGVDVLSLSLGGGSAFFYADGIAVGAF  309

Query  1561  AAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAF  1382
              AM+KGIFVSC+AGNEGPDY TLSNEAPW+LTVGASTIDR+I+ATA LGNG + DGES F
Sbjct  310   GAMQKGIFVSCSAGNEGPDYQTLSNEAPWILTVGASTIDRSIRATAKLGNGQEYDGESLF  369

Query  1381  QVENFPPTLLPLIYPGS-KDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKD  1205
             Q ++F   L+PL+Y G+  +E +A C  GSL  V  K    +C+ GGG+AR+ KG  VK 
Sbjct  370   QPKDFSSDLVPLVYAGAHSNESSAFCDEGSLTNVGGKVV--VCELGGGVARIAKGVEVKR  427

Query  1204  AGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIG  1025
             AGG AMIL+N D  GY+ LAD HVLPAT +S+  G+ +K YINSTS PTAT++FKGT IG
Sbjct  428   AGGVAMILVNPDFGGYSTLADAHVLPATHVSFAAGVSIKTYINSTSTPTATVLFKGTVIG  487

Query  1024  TKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTS  845
              + AP V  FSSRGPS ASP ILKPDI+GPGV+ILAAWP   +    +  ATFNIISGTS
Sbjct  488   DQLAPKVGFFSSRGPSLASPAILKPDIIGPGVSILAAWPFSVDNATDSK-ATFNIISGTS  546

Query  844   MATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGH  665
             M+ PHLSGIA LLKS HPDWSPAAIKSA++TTA+  NL G+ ILDE L  AD+FA G GH
Sbjct  547   MSCPHLSGIAALLKSVHPDWSPAAIKSAMMTTAEVNNLAGSAILDETLSAADLFAIGAGH  606

Query  664   VNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSF  485
             VNPS+A+DPGLIYD+Q  DYIPYLCGLNYT ++I  I Q+KV+CS+V +IPE QLNYPSF
Sbjct  607   VNPSKANDPGLIYDIQPQDYIPYLCGLNYTSKQIAAITQQKVQCSKVGAIPEGQLNYPSF  666

Query  484   AIWL--GKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNIS  311
             +I++  G     Y+RT+TNVG ANS Y +       +++ V P+ L FTEVNQ+LTY + 
Sbjct  667   SIFILPGGKPQKYTRTLTNVGPANSTYKLAPLSQHKMNITVLPEVLTFTEVNQKLTYQVV  726

Query  310   FSPSSTP--VDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             F+         I F QG ++WVS +H V +PI+++F
Sbjct  727   FAAQDGAGGDGIPFSQGYLSWVSNQHTVNTPISVVF  762



>ref|XP_009629566.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=756

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/716 (62%), Positives = 547/716 (76%), Gaps = 11/716 (2%)
 Frame = -1

Query  2338  YIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERS--RIVHSYRHVASGFAAKLSPEM  2165
             YIVH   P        +D  S++ SF+  +  +  R   R+++SYR+V +GFAAKLSP+ 
Sbjct  43    YIVHCEFPDGDRATGYQDLESWYLSFLPATTADSSREAPRLIYSYRNVLTGFAAKLSPDD  102

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             + EM KK+GFISAR ++  +LYTTHS NFLGL+QN GFW +S+YGKGVI+GV+DTGI P+
Sbjct  103   LKEMEKKEGFISARPEKQLDLYTTHSLNFLGLHQNMGFWNDSNYGKGVIIGVIDTGIFPD  162

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             HPSF+D  MPPPPAKWKGKCEF  T CNNKLIGAR F S G+  P    DE GHGTHTAS
Sbjct  163   HPSFSDGGMPPPPAKWKGKCEFNVTKCNNKLIGARYFQSSGNGSPW---DENGHGTHTAS  219

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAGNFV  A +FG+A GTA G+APLAH++IYKVC+   C+ESDILAAMD AI DGVDVL
Sbjct  220   TAAGNFVPGANIFGNANGTAAGVAPLAHVAIYKVCSPTTCSESDILAAMDMAIQDGVDVL  279

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
             SLSLGG + +F+ED +A+GAF+AME+GIFVSCAAGN GP  ++LSNEAPW+LTVGASTID
Sbjct  280   SLSLGGITYNFYEDVVAVGAFSAMERGIFVSCAAGNSGPSSFSLSNEAPWILTVGASTID  339

Query  1444  RTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDED--AALCGPGSLdkvdvkg  1271
             R IKATAVLGN  + DGESAFQ  +FP TLLPL YPG+   D  A  C P SL  ++V G
Sbjct  340   RKIKATAVLGNNEEYDGESAFQPSDFPSTLLPLAYPGNDASDSYAKFCTPDSLKNINVMG  399

Query  1270  kvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKV  1091
             K+VLC+  G I RV+KG+ VK AGG AMIL+N ++   T  A+ HVLP T +SY DGLK+
Sbjct  400   KIVLCEV-GNITRVNKGKAVKAAGGVAMILMNTELLANTTSAEAHVLPVTHVSYADGLKI  458

Query  1090  KDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAW  911
             K+YINST  PTATIVFKGT IG   AP VA FSSRGP+ ASPGILKPDI+GPGVNILAAW
Sbjct  459   KEYINSTLIPTATIVFKGTVIGDDRAPVVAGFSSRGPNYASPGILKPDIIGPGVNILAAW  518

Query  910   PVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNL  731
              + +  NN N N+ FN+ISGTSM+ PHLSG+A LLKS HPDWSPAAIKSAI+TTAD  NL
Sbjct  519   HI-SLENNINTNSYFNMISGTSMSCPHLSGVAALLKSVHPDWSPAAIKSAIMTTADILNL  577

Query  730   NGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIV  551
                 I D+   PA V ATG GHVNPS+A+DPGLIYD++  DY+PYLCGLNYTD ++  I+
Sbjct  578   GLDFIEDQTYNPASVLATGSGHVNPSKANDPGLIYDIEPADYVPYLCGLNYTDVQVGIIL  637

Query  550   QRKVECSQVTSIPEAQLNYPSFAIW--LGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVD  377
              RKV CS++TSI E +LNYPSF+I   +  T+  YSRTVTNVG+ANS+Y+V++   LG+D
Sbjct  638   NRKVRCSEITSILEGELNYPSFSIQVSVSSTAQIYSRTVTNVGQANSIYSVEIDSPLGLD  697

Query  376   VGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             V V P TLVF+EVNQ+L Y ++F+PS T     + QG++ W+S + IV+SPIA+ F
Sbjct  698   VKVEPTTLVFSEVNQKLNYQVTFTPSGTIPSTSYNQGSLKWISDKRIVRSPIAVRF  753



>ref|XP_009781099.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=932

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/716 (62%), Positives = 550/716 (77%), Gaps = 11/716 (2%)
 Frame = -1

Query  2338  YIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERS--RIVHSYRHVASGFAAKLSPEM  2165
             YIVH   P        +D  S++ SF+  +  +  R   R+++SYR+V +GFAAKLSP+ 
Sbjct  219   YIVHCEFPDREGASRYQDLDSWYLSFLPATTSDSSREAPRLIYSYRNVLTGFAAKLSPDD  278

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             + EM KK+GFISAR +R  +L+TTHS NFLGL+QN GFW +S+YGKGVI+GV+DTG+ P+
Sbjct  279   LKEMEKKEGFISARPERQLDLHTTHSLNFLGLHQNMGFWNDSNYGKGVIIGVIDTGVFPD  338

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             HPSF+D+ MPPPPAKWKGKCEF+   CNNKLIGAR F S G      P+DE+GHGTHTAS
Sbjct  339   HPSFSDDGMPPPPAKWKGKCEFDVPKCNNKLIGARYFQSSG---DGTPLDEDGHGTHTAS  395

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAGNFV  A +FG+A GTA G+APLAH++IYKVC+   C+ESD LAAMD AI+DGVDVL
Sbjct  396   TAAGNFVPGANIFGNANGTAAGVAPLAHVAIYKVCSPITCSESDTLAAMDMAIEDGVDVL  455

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
             SLSLG  +++F+ D+IA+GAF+AME+GIFVSC+AGN GP  +T+SNEAPW+LTVGASTID
Sbjct  456   SLSLGRLTSNFYSDNIAVGAFSAMERGIFVSCSAGNSGPYRFTISNEAPWILTVGASTID  515

Query  1444  RTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDED--AALCGPGSLdkvdvkg  1271
             R IKATAVLGN  + DGESAFQ  +FPPTLLPL YPG+   D  A  C P SL+ ++V G
Sbjct  516   RKIKATAVLGNNEEYDGESAFQPSDFPPTLLPLAYPGNDASDSYAKFCTPDSLNNMNVMG  575

Query  1270  kvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKV  1091
             K+VLC+  G   RV+KG+ VK AGG AMIL+N ++   T  A+ HVLP T +SY DGLK+
Sbjct  576   KIVLCEV-GNTTRVNKGKAVKAAGGVAMILMNTELQANTTSAEAHVLPVTHVSYADGLKI  634

Query  1090  KDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAW  911
             K+YINST  PTATIVFKGT IG   AP VA FSSRGP+ ASPGILKPDI+GPGVNILAAW
Sbjct  635   KEYINSTLIPTATIVFKGTIIGDDRAPVVAGFSSRGPNFASPGILKPDIIGPGVNILAAW  694

Query  910   PVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNL  731
              + +  NN N N+ FN+ISGTSM+ PHLSG+A LLKS HPDWSPAAIKSAI+TTAD  NL
Sbjct  695   HI-SLENNINTNSYFNMISGTSMSCPHLSGVAALLKSVHPDWSPAAIKSAIMTTADILNL  753

Query  730   NGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIV  551
                 I D+   PA V ATG GHVNPS+A+DPGLIYD++  DY+PYLCGLNYTD ++  I+
Sbjct  754   GLDFIEDQTYNPASVLATGSGHVNPSKANDPGLIYDIEPADYVPYLCGLNYTDAQVGIIL  813

Query  550   QRKVECSQVTSIPEAQLNYPSFAI--WLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVD  377
              RKV CS++TSI E QLNYPSF+I   +  T+ TYSRTVTNVG+ANS+Y+V++    GVD
Sbjct  814   NRKVSCSEITSILEGQLNYPSFSIKVTVSSTAQTYSRTVTNVGQANSIYSVEIDSPPGVD  873

Query  376   VGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             V V P TL F+EVNQ+L Y ++F+PS T     + QG++ W+S +HIV+SPIA+ F
Sbjct  874   VKVEPTTLAFSEVNQKLIYQVTFTPSGTIPSTSYNQGSLKWISDKHIVRSPIAVRF  929


 Score = 68.9 bits (167),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  1419  STAVALMVLSIVLAPTVRSHGASLDKV**SGPSFPAAQLTKMPFSMAAKAPMAM  1580
             STAVAL+ LS+VLAPTV+  GASLD     GP FPAAQLTK+PFS+A  AP AM
Sbjct  108   STAVALIFLSMVLAPTVKIQGASLDVENLYGPEFPAAQLTKIPFSIALNAPTAM  161



>ref|XP_006477585.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=742

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/718 (61%), Positives = 537/718 (75%), Gaps = 11/718 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPA--AAINGVSEDYRSYFRSF--VSESGDEGERSRIVHSYRHVASGFAAKL  2177
             +TYIV+V  P    A   +  D  S++ SF  VS S     + R+++ Y++V +GFAA+L
Sbjct  31    ETYIVYVRKPDHDQATTSIKLDLDSWYHSFLPVSISSSINNQPRMLYCYKNVITGFAARL  90

Query  2176  SPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTG  1997
             + E    M  K+GF+SA  ++   L+TTH+PNFLGL+Q  GFW++S+ GKGVI+GV+DTG
Sbjct  91    TAEQAKAMETKEGFLSAHVEKTLQLHTTHTPNFLGLHQKSGFWKDSNLGKGVIIGVMDTG  150

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGT  1817
             ITP HPSF+DE MPPPPAKWKGKCEF+G ACNNKLIGARNF+    S   PP+D+EGHGT
Sbjct  151   ITPGHPSFSDEGMPPPPAKWKGKCEFKGAACNNKLIGARNFLQ--GSTGEPPLDDEGHGT  208

Query  1816  HTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddg  1637
             HTA+TAAGNFV  A VFG A GTAVG+APLAHL+IYKVC  DGC+ES + AAMD AIDDG
Sbjct  209   HTATTAAGNFVNGANVFGQADGTAVGIAPLAHLAIYKVCDFDGCSESRVYAAMDTAIDDG  268

Query  1636  vdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGA  1457
             VDVLSLSLG  S  FFED +AIG+F+A++K IFVSC+AGNEGP+  T SNEAPW+L+VGA
Sbjct  269   VDVLSLSLGAASVPFFEDPLAIGSFSAIQKEIFVSCSAGNEGPNPSTSSNEAPWILSVGA  328

Query  1456  STIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvd  1280
             ST DR+I A+  LGN A  DGE+ FQ E+FP    PLIYPG+  +  +A C PGSL    
Sbjct  329   STTDRSIVASVELGNQAVYDGEALFQPEDFPSKQFPLIYPGANGNVSSAQCSPGSLSSDI  388

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
                 V LC+RGGG  R  KGQ VKDAGG  MIL+N  ++GY+ LAD H+LPA  +SY  G
Sbjct  389   RGKLV-LCERGGG-ERTKKGQVVKDAGGIGMILMNDKLNGYSTLADPHLLPAVHVSYAAG  446

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
               +K YINSTS P ATIVFKGT IG K+ P +ASFSSRGPS ASPGILKPDI+GPGVNIL
Sbjct  447   ESIKAYINSTSSPNATIVFKGTVIGKKSTPELASFSSRGPSIASPGILKPDIIGPGVNIL  506

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAWP           +TFN+++GTSM+ PHLSG+A LLKSAHPDWSPAAIKSAI+TTAD 
Sbjct  507   AAWPFSVENKTNTK-STFNMVAGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIMTTADI  565

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              +L+G  I+D+RL+PAD+FA G GHVNPS A+DPGLIYD+Q DDYIPYLCGLNY+DQ +Q
Sbjct  566   VSLDGKPIVDQRLLPADLFAVGAGHVNPSSANDPGLIYDIQPDDYIPYLCGLNYSDQHVQ  625

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGV  380
              IV   V+CS+V+ I E +LNYPSF++ LG TS TY+RTVTNVG+A S YT K+    GV
Sbjct  626   DIVMINVQCSKVSGIAETELNYPSFSVILGSTSQTYNRTVTNVGQAESSYTHKIVAPEGV  685

Query  379   DVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
              V V P+ + FT+ NQ+  Y+I+F+ S     + F QG ++WVS +H V+SPIA+ FQ
Sbjct  686   IVTVEPENISFTKKNQKAIYSITFTRSQKTSAL-FAQGYLSWVSTKHTVRSPIAVRFQ  742



>ref|XP_008238728.1| PREDICTED: subtilisin-like protease SDD1 [Prunus mume]
Length=763

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/754 (60%), Positives = 551/754 (73%), Gaps = 25/754 (3%)
 Frame = -1

Query  2404  ISVVVCLTLVFHSVASAKYED------TYIVHVSPPAAAINGVS--EDYRSYFRSFVSES  2249
             + +V  L L+F S  S   ++      TYIV V  P A  +     ED  S++++F+ ES
Sbjct  11    MQIVYLLCLLFMSSLSLAADEEQNGMQTYIVWVEKPVAQGSSAQSHEDLESWYQTFLPES  70

Query  2248  ----GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPN  2081
                  ++  + RIVH+Y +VA+GFAAKL+PE V  M KK GF+SA  + +  L+TTHSPN
Sbjct  71    TIATSNQLSKPRIVHAYHNVATGFAAKLTPEEVKAMEKKPGFVSAYPEAILPLHTTHSPN  130

Query  2080  FLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACN  1901
             FLGL Q  GFW+ S+YGKGVI+GVLDTG++P+HPSF+D  +PPPPAKWKGKCEF G  CN
Sbjct  131   FLGLNQGLGFWKGSNYGKGVIIGVLDTGVSPDHPSFSDAGVPPPPAKWKGKCEFNGRVCN  190

Query  1900  NKLIGARNF--VSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPL  1727
             NKLIGARNF  +S G     PP+D+EGHGTHT+STAAGNFV  AAVFG  KGTAVGMAP 
Sbjct  191   NKLIGARNFNGISTGQPAGDPPLDQEGHGTHTSSTAAGNFVKGAAVFGMVKGTAVGMAPY  250

Query  1726  AHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEK  1547
             AHL+IY+VC+  GCAE DILAAMDAA+DDGVDVLSLSLGG S  F+ D +A+GAF A++K
Sbjct  251   AHLAIYRVCSVAGCAEGDILAAMDAAVDDGVDVLSLSLGGFSRPFYSDGVAVGAFGAIQK  310

Query  1546  GIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENF  1367
             GIFVSC+AGN GP Y T SNEAPW+LTVGASTIDR I+ATA LGN  + +GES FQ  NF
Sbjct  311   GIFVSCSAGNSGPSYSTSSNEAPWILTVGASTIDRNIRATARLGNKKEYNGESLFQPNNF  370

Query  1366  -PPTLLPLIYPGS-KDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGA  1193
                 +LPL+  GS  ++  A C PG+L  V  K    LC+RGG   R+DKG  VK AGGA
Sbjct  371   NSKIMLPLVDAGSLGNQTTAFCDPGTLKNVKGKIV--LCERGGAGGRIDKGAEVKRAGGA  428

Query  1192  AMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTA  1013
             AMIL+NQ IDG++ LAD HVLP   +SYN GLK+K Y+ ST+ PTATI+FKGT IG K A
Sbjct  429   AMILMNQRIDGFSTLADPHVLPTAHVSYNAGLKIKSYLKSTTKPTATILFKGTVIGDKHA  488

Query  1012  PSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATP  833
             PSVASFSSRGPS ASPGILKPDI GPGV+ILA WPV  +    +  ATFNIISGTSM+ P
Sbjct  489   PSVASFSSRGPSTASPGILKPDITGPGVSILATWPVSVDNATKSK-ATFNIISGTSMSCP  547

Query  832   HLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPS  653
             HLSGIA LLK +HPDWSPAAIKSAI+TTAD +NL G  I+D+ L  AD+FA G GHVNPS
Sbjct  548   HLSGIAALLKGSHPDWSPAAIKSAIMTTADVHNLGGKSIVDQTLKAADLFAIGAGHVNPS  607

Query  652   RASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWL  473
             +A+DPGL+YD Q ++YI YLCGLNYTD++IQ I Q+ V+CS++ +IPEAQLNYPSF+I +
Sbjct  608   KANDPGLVYDTQPNNYIQYLCGLNYTDKQIQIITQQTVDCSKIGAIPEAQLNYPSFSIII  667

Query  472   GKTSLT----YSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISF-  308
             G    T    Y+RTV NVGEANS Y + +     VDV V+P+ L FT+V Q +TY + F 
Sbjct  668   GSNKKTKSQLYTRTVKNVGEANSTYKLDILAPHKVDVNVSPEVLKFTKVKQTITYRVKFV  727

Query  307   -SPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
                 +    + F +G + WVS +H V SPI +IF
Sbjct  728   AQDGAGKDGVLFGKGYLRWVSDKHNVTSPIVVIF  761



>gb|EYU39034.1| hypothetical protein MIMGU_mgv1a019276mg, partial [Erythranthe 
guttata]
Length=688

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/703 (65%), Positives = 540/703 (77%), Gaps = 20/703 (3%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
             TYIVHV+ P   +   S+  +S++ SF+  +                    +  LSPE V
Sbjct  1     TYIVHVNLPTGRVLADSDGLKSWYTSFLPTT------------TTTADDASSRLLSPEEV  48

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
              EM KK GF+ ARRQ+   L+TTH+P+FLGL+QN GFWR S+YG+GVI+G+ DTGI P H
Sbjct  49    KEMEKKDGFVFARRQKKLPLHTTHTPSFLGLHQNLGFWRGSNYGEGVIIGLFDTGIAPGH  108

Query  1981  PSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAST  1802
             PSF+D++MPPPPA+WKGKCEF  + CNNKLIGARN VS    P  PPVD+EGHGTHTAST
Sbjct  109   PSFDDKDMPPPPAEWKGKCEFNSSTCNNKLIGARNLVS---GPTRPPVDDEGHGTHTAST  165

Query  1801  AAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvls  1622
             AAGNFV  A VFG A GTAVG+AP AHL++YKVC+EDGCAE+DILAAMDAAI+DGV VLS
Sbjct  166   AAGNFVQGANVFGMANGTAVGIAPRAHLAMYKVCSEDGCAEADILAAMDAAIEDGVHVLS  225

Query  1621  lslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDR  1442
             LSLGGGSA FF D IAIGAFAA++KGIFVSC+AGN GP   +LSNEAPW+LTVGASTIDR
Sbjct  226   LSLGGGSADFFADGIAIGAFAAIQKGIFVSCSAGNSGPFNASLSNEAPWILTVGASTIDR  285

Query  1441  TIKATAVLGNGAQ--LDGESAFQVENFPP-TLLPLIYPGSK-DEDAALCGPGSLdkvdvk  1274
              I ATA+LGN      DG+S FQ  +F     LPL+  G+  +  A +CGPGSLD +DVK
Sbjct  286   RIVATAILGNRNMDGYDGQSLFQPSDFSSDKYLPLVDAGANGNGTAGICGPGSLDNIDVK  345

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             GK+VLC+RGGGIAR+ KGQTVKDAGGAAMIL+N ++D Y  +AD HVLPAT +SY+ G K
Sbjct  346   GKIVLCERGGGIARIAKGQTVKDAGGAAMILMNDELDAYITIADAHVLPATHVSYDAGEK  405

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             ++ YI+STS PTATI+F+GT IG    P VASFSSRGPS ASPGILKPDI+GPGV+ILAA
Sbjct  406   IRAYISSTSTPTATILFQGTDIGYPMDPIVASFSSRGPSLASPGILKPDIIGPGVSILAA  465

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             WPV  +       ATFN+ISGTSM+ PHLSGIA LLKSAHPDWSPAAIKSAI+TTA Q N
Sbjct  466   WPVSVDNYTNEK-ATFNMISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTTAAQVN  524

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             + G  I DER + AD+FA G GHVNP+ A+DPGL+YDLQS+DYIPYLCGL YTD EIQ I
Sbjct  525   VGGGPIDDERYLNADIFALGAGHVNPTSANDPGLVYDLQSEDYIPYLCGLGYTDTEIQAI  584

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDV  374
             VQ+ V CS +TSIPEAQLNYPSF++ LG    TY+RTVTNVGEANS Y++++    GVD+
Sbjct  585   VQKPVSCSNITSIPEAQLNYPSFSVELGPAKKTYTRTVTNVGEANSTYSLEIILAKGVDI  644

Query  373   GVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQ  245
              VTPDTL F EVNQ+++Y ISFS S TPV+  FVQ AI   S+
Sbjct  645   SVTPDTLSFGEVNQKMSYEISFSKSGTPVNAAFVQAAIVSSSK  687



>ref|XP_004300737.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=721

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/719 (61%), Positives = 541/719 (75%), Gaps = 12/719 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVS-EDYRSYFRSFVSES---GDEGERSRIVHSYRHVASGFAAKLS  2174
             TYIV V  P   +   S +D   +++SF+ ++     E    R+V++Y HVA+GFAAKL+
Sbjct  3     TYIVWVKKPVRKLFSESHQDLEGWYKSFLPKTFTNSMEVMEQRLVYAYHHVATGFAAKLT  62

Query  2173  PEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGI  1994
              E V EM  K GFISA ++R+  L+TTH+PNFLGLYQN G W+ S YG+G+I+GVLDTGI
Sbjct  63    AEEVKEMAVKDGFISAHQERILPLHTTHTPNFLGLYQNLGLWKGSYYGEGIIIGVLDTGI  122

Query  1993  TPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTH  1814
             TP HPSF+D  + PPPAKWKGKC+F GT CNNKLIGAR+F   G S   PPVD EGHGTH
Sbjct  123   TPGHPSFHDAGVNPPPAKWKGKCDFNGTFCNNKLIGARSF-QGGKSTGAPPVDIEGHGTH  181

Query  1813  TASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgv  1634
             T+STAAGNFV  A VFG A+GTA GMAP AH+++Y++C EDGC+ESDI+AAMD A+ DGV
Sbjct  182   TSSTAAGNFVKGANVFGMAEGTASGMAPYAHVAMYQICNEDGCSESDIVAAMDTAVADGV  241

Query  1633  dvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAS  1454
             DVLSLSLGGGS  F+ D IA+GAF A++KGIFVSC+AGN GPDY +LSNEAPW+LTVGAS
Sbjct  242   DVLSLSLGGGSVPFYGDGIAVGAFGAIQKGIFVSCSAGNSGPDYGSLSNEAPWILTVGAS  301

Query  1453  TIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDA-ALCGPGSLdkvdv  1277
             T+DR+IKATA LGNG + DGES FQ ++F   LLPL+Y G+   D+ ALC  G+L+ V+ 
Sbjct  302   TVDRSIKATAKLGNGKEYDGESLFQDKDFSSELLPLVYAGAYSNDSTALCDIGTLNGVEG  361

Query  1276  kgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGL  1097
             +    LC+RGGGI R+ KG+ VK AGGAAMIL+NQ+ DG++ LAD HVLPAT LSY  G+
Sbjct  362   QVV--LCERGGGIGRIAKGEEVKRAGGAAMILMNQETDGFSTLADAHVLPATHLSYAAGV  419

Query  1096  KVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILA  917
              +K+YINSTS PTATI+FKGT IG + AP+V SFSSRGPS AS GILKPDI+GPGV+ILA
Sbjct  420   SIKEYINSTSTPTATILFKGTVIGDQNAPAVTSFSSRGPSIASTGILKPDIIGPGVSILA  479

Query  916   AWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQY  737
             AWPV  +    +   TFN++SGTSM+ PHLSGIA LLKS+HPDWSPAAIKSAI+TTAD  
Sbjct  480   AWPVSVDNGTESTE-TFNMVSGTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIVTTADMV  538

Query  736   NLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQ  557
             NL G  I+DE L PAD+FATG GHVNP++A DPGLIYD    DYIPYLCGLNYT+ +IQ 
Sbjct  539   NLGGKPIVDETLTPADIFATGAGHVNPTKADDPGLIYDTTPGDYIPYLCGLNYTEDQIQI  598

Query  556   IVQRKVECSQVTSIPEAQLNYPSFAIWLG--KTSLTYSRTVTNVGEANSMYTVKVSPFLG  383
             I Q+ V+CS+V  IPE +LNYPSF+I       S +Y+RTVTNVG ANS Y +++     
Sbjct  599   ITQQTVKCSEVGVIPEQELNYPSFSIIFQDLSESQSYTRTVTNVGPANSTYNLELMVPHK  658

Query  382   VDVGVTPDTLVFTEVNQQLTYNISFSPSS-TPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             + + V P  LVFTEV Q +TY + F P      D  F QG + W + +H V SPI++IF
Sbjct  659   MGMSVNPGQLVFTEVGQTMTYRVDFIPEEGAGKDAPFSQGYLRWFNDQHSVASPISVIF  717



>ref|XP_008238739.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=751

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/760 (59%), Positives = 561/760 (74%), Gaps = 31/760 (4%)
 Frame = -1

Query  2440  IIAMKGTPNMAYISVVVCLTLVFHSVASAKYED-----TYIVHVSPPAAAI--NGVSEDY  2282
             II + G   M Y+SV         +VA+   ED     TYIV V  P   +      ED 
Sbjct  4     IIYLLGFSVMFYLSV---------AVAAETDEDKSSMQTYIVWVKRPVQNLFFAKSHEDL  54

Query  2281  RSYFRSFVSES---GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRV  2111
              S++++F+ ++    +E  + R+VH+YR+VA+GFAAKL+PE V  M +K+GF+SA  +R+
Sbjct  55    ESWYQTFLPDTIANSNELTKPRMVHTYRNVATGFAAKLTPEEVKAMEQKEGFVSAHPERI  114

Query  2110  YNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKG  1931
               L+TTHSPNFLGL Q  G W+ ++YG+GVI+GVLDTGI P+HPSF+DE +PPPPAKWKG
Sbjct  115   LPLHTTHSPNFLGLQQGLGVWKGANYGEGVIIGVLDTGIGPDHPSFSDEGVPPPPAKWKG  174

Query  1930  KCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKG  1751
             KC+F GT CNNKLIGARNF S G +   PPVD+EGHGTHT+STAAGNFV  A  FG A G
Sbjct  175   KCDFNGTVCNNKLIGARNFQS-GKTTGGPPVDDEGHGTHTSSTAAGNFVKGANAFGMANG  233

Query  1750  TAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAI  1571
             TA GMAP AHL++YK+C+EDGC E DI+AA+D A++DGVDVLSLSLGG S  F+ED IA+
Sbjct  234   TAAGMAPYAHLAMYKICSEDGCTEGDIVAALDTAVEDGVDVLSLSLGGPSFPFYEDGIAV  293

Query  1570  GAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGE  1391
             GAF A++KGIFVSC+AGN GP Y +LSNEAPW+LTVG STIDR+I+ATA+LG+  + DG 
Sbjct  294   GAFGAIQKGIFVSCSAGNSGPSYESLSNEAPWILTVGGSTIDRSIRATALLGDHGEFDGV  353

Query  1390  SAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQT  1214
             S FQ ++F   LLPL+YPG+  +  +ALC PGSL+ ++ K    +C+  GG  RV KG+ 
Sbjct  354   SLFQPKDFNSALLPLVYPGANGNPSSALCSPGSLENLEGKIV--VCE--GGRGRVAKGEE  409

Query  1213  VKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGT  1034
             VK AGGAAMIL+NQ IDGY++LAD HVLPAT +SY  GL +K +INSTS PTATI+FKGT
Sbjct  410   VKRAGGAAMILVNQAIDGYSVLADAHVLPATHVSYQAGLNIKAFINSTSTPTATILFKGT  469

Query  1033  FIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIIS  854
              IG   AP VASFSSRGPS  SPGILKPDI+GPGV+ILAAWPV  +       ATFN++S
Sbjct  470   VIGDPLAPKVASFSSRGPSIRSPGILKPDIIGPGVSILAAWPVSVDNGTEGK-ATFNMVS  528

Query  853   GTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATG  674
             GTSM+ PHLSGIA LLKS+HPDWSPAAIKSAI+TTA+  NL G+ I+D+ L PAD+FA G
Sbjct  529   GTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIMTTAEVENLAGSAIVDQTLFPADIFALG  588

Query  673   GGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNY  494
              GHVNPS+A+DPGLIYD+Q +DYIPYLCGLNYTD++IQ I Q+ V CSQV ++PEAQLNY
Sbjct  589   AGHVNPSKANDPGLIYDIQPEDYIPYLCGLNYTDEQIQVITQQTVNCSQVGAVPEAQLNY  648

Query  493   PSFAIWLGKTSLT---YSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLT  323
             P+F+I  G +      Y+RTVTNVG ANS Y + +     V + V P  L FTEVNQ++T
Sbjct  649   PTFSIKTGSSETQTQYYTRTVTNVGPANSTYELALVVPPKVGMSVNPQVLTFTEVNQKIT  708

Query  322   YNISFSP--SSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             Y++ F+    +    + F +G + WVS +H V + I   F
Sbjct  709   YHVEFNAHDDAGKDGVPFAEGYLRWVSDKHSVTTRIVATF  748



>ref|XP_011081167.1| PREDICTED: subtilisin-like protease SDD1 [Sesamum indicum]
Length=1084

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/716 (62%), Positives = 551/716 (77%), Gaps = 11/716 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSF--VSESGDEGERSRIVHSYRHVASGFAAKLSP  2171
             +TYIVHV  P   +    +D +SY +SF  V  +    +R  +++SYR+V SGF+A+L+ 
Sbjct  371   ETYIVHVKKPEGRLEVQLDDMKSYHQSFLPVRTAVSSADRQPLLYSYRNVISGFSARLTA  430

Query  2170  EMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGIT  1991
             E V  M++K GFISAR +R+Y   TTHSPNFLGL+Q  GFW+ S+YGKGVIVGVLDTGI 
Sbjct  431   EEVEAMKEKDGFISARLERMYRPLTTHSPNFLGLHQEMGFWKKSNYGKGVIVGVLDTGIF  490

Query  1990  PNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNF---VSEGssppppPVDEEGHG  1820
             P+HPSF+ E+MPPPPAKWKGKCEF+ T CNNKLIGAR+F    +  S     P+D++GHG
Sbjct  491   PSHPSFSGEDMPPPPAKWKGKCEFKATECNNKLIGARSFNLAANASSLEAETPLDDDGHG  550

Query  1819  THTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaidd  1640
             THTASTAAG FV NA+  G+A GTAVG+AP AHL+IYKVC    C ESDILA +DAA++D
Sbjct  551   THTASTAAGGFVQNASALGNAYGTAVGIAPQAHLAIYKVCFGPDCPESDILAGLDAAVED  610

Query  1639  gvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVG  1460
             GVDVLS+SLG  S  F+ D++A+G+FAA +KGIFVSCA GN GP   T+SNEAPW+LTVG
Sbjct  611   GVDVLSISLGEESTPFYNDNLAVGSFAAAQKGIFVSCAGGNSGPSQQTISNEAPWILTVG  670

Query  1459  ASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkv  1283
             ASTIDR+I+ATA LG+G + DGES FQ ++FPPTLLPL+Y GS   +D+A C  GSL  V
Sbjct  671   ASTIDRSIRATAKLGDGQEFDGESVFQPKDFPPTLLPLVYAGSNGKQDSAFCANGSLSGV  730

Query  1282  dvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYND  1103
             DVKGKVVLCDRGGGIAR+DKG+ VK+AGGAAMIL NQ  DG++  AD HVLPAT ++Y+ 
Sbjct  731   DVKGKVVLCDRGGGIARLDKGREVKNAGGAAMILANQQSDGFSTSADAHVLPATHVAYSS  790

Query  1102  GLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNI  923
             GLK+K YINST+ PTATI+FKGT IG   AP VASFSSRGPS A+PGILKPDI+GPGVNI
Sbjct  791   GLKIKAYINSTTSPTATILFKGTVIGDPLAPIVASFSSRGPSLATPGILKPDIIGPGVNI  850

Query  922   LAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTAD  743
             +AAWP   + +  +   TFN+ SGTSM+ PHLSG+A LLKSAHP WSPAAIKSAI+TTAD
Sbjct  851   IAAWPFPLDGSTNSKL-TFNVESGTSMSCPHLSGVAALLKSAHPYWSPAAIKSAIMTTAD  909

Query  742   QYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEI  563
               N+ GT I+DERL PAD+FATG GHVNPS+A+DPGL+YD+ +DDYIPYLCGL YTD+++
Sbjct  910   LVNIKGTSIVDERLTPADIFATGAGHVNPSKANDPGLVYDIAADDYIPYLCGLGYTDEQV  969

Query  562   QQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLG  383
               I  + V C+  + IPE QLNYPSF+  LG +S T++RTVTNVGEA S YTVK+    G
Sbjct  970   GIIAHKSVHCT--SKIPEGQLNYPSFSATLG-SSQTFTRTVTNVGEAVSYYTVKIVEPQG  1026

Query  382   VDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAI  215
             V + V P  L FT V ++ TY+++FS SS  +   F QG + WVS +H V+S I++
Sbjct  1027  VSISVQPAKLSFTRVGEKATYSVTFSRSSN-ISNTFSQGYLLWVSTKHTVRSVISV  1081


 Score =   249 bits (637),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 142/180 (79%), Gaps = 2/180 (1%)
 Frame = -1

Query  787  WSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDD  608
            WSPAAIKSAI+TTA Q+NL+G  ILDER +PAD+FA G GHVNP  A+DPGLIYDLQ +D
Sbjct  165  WSPAAIKSAIMTTATQWNLHGGAILDERYLPADIFALGAGHVNPPSANDPGLIYDLQPED  224

Query  607  YIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVG  428
            YIPYLCGL Y++ EI+ IVQ  V CS VTSIPEAQLNYPSF++ LG    TY+RTVTNVG
Sbjct  225  YIPYLCGLGYSNNEIEIIVQHPVTCSNVTSIPEAQLNYPSFSVELGADKKTYTRTVTNVG  284

Query  427  EANSMYTVKVS--PFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAW  254
            EANS Y V++      GVDV VTP TL F+EVNQ+LTY ISFS S+TP +  FV+GA+ W
Sbjct  285  EANSTYMVEIELDSAQGVDVAVTPATLSFSEVNQKLTYEISFSKSATPANATFVEGAVVW  344


 Score =   106 bits (264),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 76/139 (55%), Gaps = 44/139 (32%)
 Frame = -1

Query  1960  MPPPPAKWKGKCEF-EGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFV  1784
             MPPPPAKWKGKCEF  GT CNNKLIGARNFVS+    P PPVD+EGHGTHTASTAAGNFV
Sbjct  1     MPPPPAKWKGKCEFVTGTMCNNKLIGARNFVSD---LPGPPVDDEGHGTHTASTAAGNFV  57

Query  1783  GNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslggg  1604
               A VFG              + +  +    G  E                         
Sbjct  58    QGANVFGDG------------VDVLSLSLGGGSIE-------------------------  80

Query  1603  SASFFEDSIAIGAFAAMEK  1547
                FF+D IAIGAFAA++K
Sbjct  81    ---FFQDGIAIGAFAAIQK  96


 Score = 96.7 bits (239),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  1237  ARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPT  1058
             AR+ KGQTVKDAGGA MIL+N + DGY+ +AD HVLPAT +SY  G  ++ YINSTS PT
Sbjct  97    ARIAKGQTVKDAGGAGMILMNAEPDGYSTIADPHVLPATHVSYAAGESIRAYINSTSTPT  156

Query  1057  ATIVFKGTF  1031
             ATI+F+GT+
Sbjct  157   ATIIFRGTW  165



>ref|XP_002275471.2| PREDICTED: uncharacterized protein LOC100242816 [Vitis vinifera]
Length=1485

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/693 (65%), Positives = 543/693 (78%), Gaps = 5/693 (1%)
 Frame = -1

Query  2368  SVASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFVS-ESGDEGERSRIVHSYRHVASG  2192
             ++  + +  TYIVHV      +   S+   S++ SF+   +     + RIV+SYR+V +G
Sbjct  51    AIEESDHLQTYIVHVKRTHRRVFTKSDGLESWYESFLPVATASSNRKQRIVYSYRNVLNG  110

Query  2191  FAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVG  2012
             FAAKL+ + V  M +K GF+SAR QR+  L+TTHSP+FLGL+Q  GFW+ S+YGKGVI+G
Sbjct  111   FAAKLTAQEVKAMEEKDGFVSARPQRILPLHTTHSPSFLGLHQELGFWKGSNYGKGVIIG  170

Query  2011  VLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDE  1832
             VLDTG+ P+HPSF+DE +PPPPAKWKGKC+F  T+CNNK+IGARNF  +  +   PP+DE
Sbjct  171   VLDTGLFPDHPSFSDEGLPPPPAKWKGKCDFNWTSCNNKIIGARNF--DSGAEAVPPIDE  228

Query  1831  EGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamda  1652
             EGHGTHTASTAAGNFV NA   G+A GTAVGMAP AHL+IYKVC+E GCA++DILAA+D 
Sbjct  229   EGHGTHTASTAAGNFVPNADALGNANGTAVGMAPFAHLAIYKVCSEFGCADTDILAALDT  288

Query  1651  aiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWL  1472
             AI+DGVDVLSLSLGGGSA FF DSIA+GAF+A++KGIFVSC+AGN GP   +LSNEAPW+
Sbjct  289   AIEDGVDVLSLSLGGGSAPFFADSIALGAFSAIQKGIFVSCSAGNSGPLNGSLSNEAPWI  348

Query  1471  LTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGS  1295
             LTVGASTIDR I ATA LGNG + DGES FQ  +FP TLLPL+Y G+  +  +ALC P S
Sbjct  349   LTVGASTIDRKIMATATLGNGEEFDGESLFQPSDFPSTLLPLVYAGANGNASSALCAPES  408

Query  1294  LdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATEL  1115
             L  VDV GKVV+CDRGGGI R+ KGQ VKDAGGAAMIL N +++G++ L D HVLPAT +
Sbjct  409   LKDVDVAGKVVVCDRGGGIGRIAKGQEVKDAGGAAMILTNDELNGFSTLVDAHVLPATHV  468

Query  1114  SYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGP  935
             SY  GLK+K YI S S PTATIVFKGT IG  TAP V SFSSRGPS  SPGILKPDI+GP
Sbjct  469   SYAAGLKIKSYIKSDSAPTATIVFKGTIIGVPTAPEVTSFSSRGPSLESPGILKPDIIGP  528

Query  934   GVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAII  755
             GV+ILAAWP     +  +   TFN+ISGTSM+ PHLSGIA L+KSAHPDWSPAAIKSAII
Sbjct  529   GVSILAAWPFPLENDTTSK-PTFNVISGTSMSCPHLSGIAALIKSAHPDWSPAAIKSAII  587

Query  754   TTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYT  575
             TTAD +NL    I+DE   PAD+FATG GHVNPS A+DPGLIYDL+ DDYIPYLCGL YT
Sbjct  588   TTADLHNLENKPIIDETFQPADLFATGAGHVNPSAANDPGLIYDLEPDDYIPYLCGLGYT  647

Query  574   DQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVS  395
             D+E+  IV R ++CS+ +SIPEAQLNYPSF+I LG +S TYSRTVTNVG ANS Y+V++ 
Sbjct  648   DEEVGLIVNRTLKCSEESSIPEAQLNYPSFSIALGPSSGTYSRTVTNVGAANSSYSVQIL  707

Query  394   PFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSS  296
                GV+V V PD L FTEVNQ++TY +SFS +S
Sbjct  708   APSGVEVSVNPDKLEFTEVNQKITYMVSFSRTS  740


 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/719 (61%), Positives = 551/719 (77%), Gaps = 9/719 (1%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVS-ESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYIVHV     +     E+  S+ RSF+   +     + R+V+SY++V SGFAA+L+ E 
Sbjct  769   TYIVHVKQLERSTTAQQENLESWHRSFLPVATATSDNQERLVYSYKNVISGFAARLTEEE  828

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             V  M    GFISA  +++  L TTHSP+FLGL+Q  GFW+ S++GKGVI+GVLD+G+ P+
Sbjct  829   VRAMENMDGFISASPEKMLPLLTTHSPDFLGLHQEMGFWKESNFGKGVIIGVLDSGVLPS  888

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNF----VSEGssppppPVDEEGHGT  1817
             HPSF+ E +PPPPAKWKG CEF  + CNNKLIGAR+F     +       PP+D++GHGT
Sbjct  889   HPSFSGEGIPPPPAKWKGSCEFMASECNNKLIGARSFNVGAKATKGVTAEPPLDDDGHGT  948

Query  1816  HTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddg  1637
             HTASTAAG FV NA V G+AKGTAVGMAP AHL+IYKVC    C ESD++A +DAA++DG
Sbjct  949   HTASTAAGAFVKNADVLGNAKGTAVGMAPYAHLAIYKVCFGPDCPESDVIAGLDAAVEDG  1008

Query  1636  vdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGA  1457
             VDV+S+SLG  +  FF+D+IA+G+FAAM+KGIFVSC+AGN GP   TLSNEAPW+LTVGA
Sbjct  1009  VDVISISLGDPAVPFFQDNIAVGSFAAMQKGIFVSCSAGNSGPFNTTLSNEAPWILTVGA  1068

Query  1456  STIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDE-DAALCGPGSLdkvd  1280
             S+IDRTIKA A LGNG Q DGE+ FQ  +FP T LPL+Y G   + ++A+CG GSL  +D
Sbjct  1069  SSIDRTIKAAAKLGNGEQFDGETLFQPSDFPATQLPLVYAGMNGKPESAVCGEGSLKNID  1128

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
             VKGKVVLCDRGGGIAR+DKG  VK+AGGAAMIL+NQ+ DG++ LAD HVLPAT +SY  G
Sbjct  1129  VKGKVVLCDRGGGIARIDKGTEVKNAGGAAMILVNQESDGFSTLADAHVLPATHVSYAAG  1188

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
             LK+K YINST+ PTA I+FKGT IG   +P++ SFSSRGPS ASPGILKPDI+GPGV+IL
Sbjct  1189  LKIKAYINSTATPTAAILFKGTVIGNPLSPAITSFSSRGPSFASPGILKPDIIGPGVSIL  1248

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAWP   + N  +  +TFNIISGTSM+ PHLSGIA LLKS+HPDWSPAAIKSAI+TTAD 
Sbjct  1249  AAWPFPLDNNINSK-STFNIISGTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIMTTADL  1307

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              N+ G  I+DERL+PAD+FATG GHVNPSRA+DPGL+YD++ DDYIPYLCGL YTD E+ 
Sbjct  1308  LNVGGKPIVDERLLPADIFATGAGHVNPSRANDPGLVYDIEPDDYIPYLCGLGYTDTEVG  1367

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGV  380
              +  R ++CS+ +SIPE +LNYPSF++ LG    T++RTVTNVGEA S YTV      GV
Sbjct  1368  ILAHRSIKCSEESSIPEGELNYPSFSVALGPPQ-TFTRTVTNVGEAYSSYTVTAIVPQGV  1426

Query  379   DVGVTPDTLVFTEVNQQLTYNISF-SPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
             DV V PD L F++VNQ+LTY+++F   SS+     F QG + WVS +H V SPI+I+F+
Sbjct  1427  DVSVNPDKLYFSKVNQKLTYSVTFSHNSSSGKSSKFAQGYLKWVSGKHSVGSPISIMFK  1485



>ref|XP_010053378.1| PREDICTED: subtilisin-like protease SDD1 [Eucalyptus grandis]
Length=752

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/715 (62%), Positives = 546/715 (76%), Gaps = 9/715 (1%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSE-SGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYIVHV   A  +   SED +S+++SF+ + + +  + +R+VHSY++  +GFAAK++ + 
Sbjct  44    TYIVHVRKRAGEVFARSEDLQSWYQSFLPQMTPNSDQTNRMVHSYKNSITGFAAKMTEDE  103

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             V E+ K    +S +++++++L+TTHSP+FL L    G W++S+ GKGVI+GVLDTGITP+
Sbjct  104   VKELLKLDAVVSVKQEKIFSLHTTHSPSFLNLNPGVGLWKDSTLGKGVIIGVLDTGITPD  163

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             HPSF+DE M  PPAKWKGKC F  T+CNNKLIGARNFV+       PP DE+GHGTHT+S
Sbjct  164   HPSFDDEGMSSPPAKWKGKCNFNATSCNNKLIGARNFVNS----TLPPTDEDGHGTHTSS  219

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAGNFV NA V G A GTA+GMAP AHL++Y+VC++ GC ES ILA MDAAI+DGVDVL
Sbjct  220   TAAGNFVKNANVLGQALGTAIGMAPHAHLAMYQVCSDVGCPESSILAGMDAAIEDGVDVL  279

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
             SLSLGGGSA F+ DS A+GAF+A+ KGIFVSC+AGN GP   +LSN+APW+LTVGASTID
Sbjct  280   SLSLGGGSAPFYADSTAVGAFSAIRKGIFVSCSAGNSGPINTSLSNDAPWILTVGASTID  339

Query  1444  RTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvkgk  1268
             RTIKATA LGNGA+ DGES FQ ++F      L+Y G+  ++ +A+C  GSL  +DVKGK
Sbjct  340   RTIKATAKLGNGAEYDGESLFQPKDFG-LAYSLVYAGANGNQTSAICAEGSLRNLDVKGK  398

Query  1267  vVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVK  1088
             VVLC+RGGGIAR+ KGQ VKDAGGAAMIL+N +++GY+ LAD HVLPAT + Y DGLK+K
Sbjct  399   VVLCERGGGIARIAKGQEVKDAGGAAMILMNDELNGYSTLADAHVLPATHIPYADGLKIK  458

Query  1087  DYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWP  908
              YINSTS PTATI+FKGT I    AP+V SFSSRGPS  SPGILKPDI+GPGV+ILAAWP
Sbjct  459   AYINSTSDPTATILFKGTIIRNSDAPAVTSFSSRGPSLESPGILKPDIIGPGVSILAAWP  518

Query  907   VgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLN  728
                + ++     TFNIISGTSM+ PHLSGIA LLKS+HPDWSPAAIKSAI+TTA Q NL 
Sbjct  519   FSLDNSSTTE-VTFNIISGTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIMTTAYQMNLG  577

Query  727   GTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQ  548
                I+DE L+PAD+FATG GHVNP +A DPGLIYD++ DDYIPYLCGL Y D EI+ I Q
Sbjct  578   SKPIIDETLLPADIFATGAGHVNPPKADDPGLIYDIKPDDYIPYLCGLGYKDSEIETITQ  637

Query  547   RKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGV  368
              K +CSQ+ SIPEAQLNYPSF+I LG ++  YSRTVTNV   +S YT KV    GVDV V
Sbjct  638   EKAKCSQIKSIPEAQLNYPSFSIILGSSAQNYSRTVTNVEPTHSSYTYKVDAPEGVDVTV  697

Query  367   TPDTLVFTEVNQQLTYNISFSPSS-TPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
              P  + F+   Q  TY + F  SS   V   F QG++ WVS  H V+SPIA++FQ
Sbjct  698   YPSEIKFSVAVQIATYTVGFRRSSGGSVTKPFAQGSLTWVSSDHSVRSPIAVVFQ  752



>ref|XP_007208831.1| hypothetical protein PRUPE_ppa025337mg [Prunus persica]
 gb|EMJ10030.1| hypothetical protein PRUPE_ppa025337mg [Prunus persica]
Length=753

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/728 (61%), Positives = 539/728 (74%), Gaps = 19/728 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVS--EDYRSYFRSFVSES----GDEGERSRIVHSYRHVASGFAA  2183
              TYIV V  P A  +     ED  S++++F+ ES     ++  + RIVH+Y +VA+GFAA
Sbjct  27    QTYIVWVEKPVAQGSSAQSHEDLESWYQTFLPESTIATSNQLSKPRIVHAYHNVATGFAA  86

Query  2182  KLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLD  2003
             KL+PE V  M KK GF+SA  + +  L+TTHSPNFLGL Q  GFW+ S+YGKGVI+GVLD
Sbjct  87    KLTPEEVKAMEKKPGFVSAHPEAILPLHTTHSPNFLGLNQGLGFWKGSNYGKGVIIGVLD  146

Query  2002  TGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNF--VSEGssppppPVDEE  1829
             TG++P+HPSF+D  +PPPPAKWKGKCEF G  CNNKLIGARNF  +S G     PP D+E
Sbjct  147   TGVSPDHPSFSDAGVPPPPAKWKGKCEFNGRVCNNKLIGARNFNGISTGQPAGDPPFDQE  206

Query  1828  GHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaa  1649
             GHGTHT+STAAGNFV  AAVFG  KGTAVGMAP AHL+IY+VC+  GCAE DILAAMDAA
Sbjct  207   GHGTHTSSTAAGNFVKGAAVFGMVKGTAVGMAPYAHLAIYRVCSVAGCAEGDILAAMDAA  266

Query  1648  iddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLL  1469
             +DDGVDVLSLSLGG S  F+ D +A+GAF A++KGIFVSC+AGN GP Y T SNEAPW+L
Sbjct  267   VDDGVDVLSLSLGGFSRPFYSDGVAVGAFGAIQKGIFVSCSAGNSGPSYSTSSNEAPWIL  326

Query  1468  TVGASTIDRTIKATAVLGNGAQLDGESAFQVENF-PPTLLPLIYPGS-KDEDAALCGPGS  1295
             TVGASTIDR I+ATA LGN  + +GES FQ  NF    +LPL+  GS  ++ +A C PG+
Sbjct  327   TVGASTIDRNIRATARLGNKKEYNGESLFQPNNFNSKIMLPLVDAGSLGNQTSAFCDPGT  386

Query  1294  LdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATEL  1115
             L  V  K    LC+RGG   R+DKG  VK AGGAAMIL+NQ IDG++ LAD HVLP   +
Sbjct  387   LKNVKGKIV--LCERGGAGGRIDKGAEVKRAGGAAMILMNQRIDGFSTLADPHVLPTAHV  444

Query  1114  SYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGP  935
             SY+ GLK+K Y+ ST+ PTATI+FKGT IG K APSVASFSSRGPS ASPGILKPDI GP
Sbjct  445   SYDAGLKIKSYLKSTTKPTATILFKGTVIGDKHAPSVASFSSRGPSTASPGILKPDITGP  504

Query  934   GVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAII  755
             GV+ILA WPV  +    +  ATFNIISGTSMA PHLSGIA LLK +HPDWSPAAIKSAI+
Sbjct  505   GVSILATWPVSVDNATKSK-ATFNIISGTSMACPHLSGIAALLKGSHPDWSPAAIKSAIM  563

Query  754   TTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYT  575
             TTAD +NL G  I+D+ L  AD+FA G GHVNPS+A+DPGL+YD Q ++YI YLCGLNYT
Sbjct  564   TTADVHNLGGKSIVDQALKAADLFAIGAGHVNPSKANDPGLVYDTQPNNYIQYLCGLNYT  623

Query  574   DQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLT----YSRTVTNVGEANSMYT  407
             D++IQ I Q+ V+CS++ +IPEAQLNYPSF+I +G    T    Y+RTV NVGEANS Y 
Sbjct  624   DKQIQIITQQTVDCSKIGAIPEAQLNYPSFSIIIGSNKKTRSQLYTRTVKNVGEANSTYK  683

Query  406   VKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISF--SPSSTPVDIDFVQGAIAWVSQRHIV  233
             + +     VDV V+P+ L FT+V Q +TY + F     +    + F +G + WVS  H V
Sbjct  684   LDILAPHKVDVNVSPEVLKFTKVKQTITYRVKFVAQEGAGKDGVLFGKGYLRWVSDNHNV  743

Query  232   KSPIAIIF  209
              SPI +IF
Sbjct  744   ASPIVVIF  751



>ref|XP_011071279.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=741

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/743 (59%), Positives = 553/743 (74%), Gaps = 16/743 (2%)
 Frame = -1

Query  2407  YISVVVCLTLVFHSVASAKYE--DTYIVHVS-PPAAAINGVSEDYRSYFRSFV--SESGD  2243
             +   +VC+ L FH++  A+    ++YIVHV  P    ++ +++D   +++SF+  + S  
Sbjct  6     FFLTLVCV-LNFHTIVRAQESKLESYIVHVEMPRGPTVSALTDDLEGWYQSFLPTTLSSS  64

Query  2242  EGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQ  2063
               +   I++SY +V  GFAA+LSPE V EM KK GF+SAR Q+   L+TTHSPNFLGL Q
Sbjct  65    SVDGPHIIYSYHNVFKGFAARLSPEHVKEMEKKPGFVSARPQKTLPLHTTHSPNFLGLNQ  124

Query  2062  NFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGA  1883
             N GFWR+S+YG+GVI+GVLD+GI P+HPSFNDE MPPPPAKWKG+C+F  T CNNKLIGA
Sbjct  125   NMGFWRDSNYGRGVIIGVLDSGINPDHPSFNDEGMPPPPAKWKGQCQFNSTMCNNKLIGA  184

Query  1882  RNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKV  1703
             R F          P+DE GHGTHTASTAAGNFV  A VFG+A GTA G+APLAH+++YKV
Sbjct  185   RYFT----IGNGTPLDENGHGTHTASTAAGNFVRGANVFGNANGTAAGIAPLAHIAMYKV  240

Query  1702  CTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAA  1523
             C    C+ESDILA MDAAIDDGVD++SLSLG  + +F++D++A+GAF+A+E+GIFVS AA
Sbjct  241   CITR-CSESDILAGMDAAIDDGVDIISLSLGSPATNFYDDNVAVGAFSAVERGIFVSSAA  299

Query  1522  GNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLI  1343
             GN GP   ++ N APWLLTVGAS++DR I+ATAVLGN  + DGES FQ  +F  TLLPL+
Sbjct  300   GNRGPSLGSIENGAPWLLTVGASSVDRKIRATAVLGNNEEFDGESTFQPADFSSTLLPLV  359

Query  1342  YP--GSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQD  1169
             YP   S + +A  C P  L  +DV+GK+VLC+ GGGI R+ KG  V++AGGAAMIL+NQ 
Sbjct  360   YPRLNSSNPNAQFCLPALLRNIDVQGKIVLCELGGGIGRIAKGSAVRNAGGAAMILINQQ  419

Query  1168  IDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSS  989
               GYT L+++HVLPAT LSY DGLK+K Y+NSTS PTATI FKGT IG   AP+VA FS+
Sbjct  420   PQGYTTLSESHVLPATHLSYADGLKIKAYLNSTSSPTATISFKGTIIGDDRAPAVAYFSA  479

Query  988   RGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATL  809
             RGP+ AS GILKPDI+GPG NILAAW +    N     + FNIISGTSM+ PHLSG+A L
Sbjct  480   RGPNIASLGILKPDIIGPGNNILAAWHISVEKNTNTK-SNFNIISGTSMSCPHLSGVAAL  538

Query  808   LKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLI  629
             LK+AHPDWSPAAIKSAI+TTADQ NL G  I DE L PA VFA G GHVN  +A+DPGL+
Sbjct  539   LKNAHPDWSPAAIKSAIMTTADQVNLAGNFIEDETLRPAFVFAVGSGHVNILKATDPGLV  598

Query  628   YDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWL--GKTSLT  455
             Y++Q  DY+PYLCGLNYTDQ+++ I  R V CS+++SI EA+LNYPSF   L  G TS T
Sbjct  599   YEIQPQDYVPYLCGLNYTDQQVEIIANRPVRCSEISSISEAELNYPSFTALLGTGNTSET  658

Query  454   YSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDF  275
             Y+RTVTNVGEANS+YTV+     GVD+ V P TL F+ VNQ+LTY ++FS  +       
Sbjct  659   YNRTVTNVGEANSVYTVETGGLPGVDMRVEPSTLQFSGVNQRLTYQVTFSRLANARSDIV  718

Query  274   VQGAIAWVSQRHIVKSPIAIIFQ  206
             V+G + W S RH V+SP+ +IF+
Sbjct  719   VRGFLTWTSARHSVRSPLVVIFE  741



>ref|XP_011034012.1| PREDICTED: uncharacterized protein LOC105132300 [Populus euphratica]
Length=1500

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/719 (64%), Positives = 555/719 (77%), Gaps = 13/719 (2%)
 Frame = -1

Query  2353  KYEDTYIVHVSPPAAAINGVSEDYRSYFRSFVSES-GDEGERSRIVHSYRHVASGFAAKL  2177
             K+E TYIV V  P   ++  ++D   +++SF+  +      + R+V+SYRHVA+GFAAKL
Sbjct  787   KFE-TYIVFVQKPEGGVS--ADDLDGWYKSFLPVTIPSSNHQERMVYSYRHVATGFAAKL  843

Query  2176  SPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTG  1997
             + E    M  K GF+SA+ Q++ +L TTHSPNFLGL +N GFWRNS+YGKGVI+GVLDTG
Sbjct  844   TAEEAKAMEDKDGFLSAKPQKILSLQTTHSPNFLGLQKNLGFWRNSTYGKGVIIGVLDTG  903

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGT  1817
             I+P+HPSF+DE +PPPP KWKGKC F GT CNNKLIGAR+F S       PP DE GHGT
Sbjct  904   ISPDHPSFSDEGVPPPPTKWKGKCNFNGTVCNNKLIGARDFTSS---KAAPPFDEVGHGT  960

Query  1816  HTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddg  1637
             HTASTAAGNFV +A+VFG+A GTAVGMAPLAHL+IYKVC++ GC ESDILAAMDAA++DG
Sbjct  961   HTASTAAGNFVNDASVFGNANGTAVGMAPLAHLAIYKVCSDFGCTESDILAAMDAAVEDG  1020

Query  1636  vdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGA  1457
             VDVLSLSLGGGSA FFEDSIA+GAF A +KGIFVSC+AGNEGP   +LSNEAPW+LTVGA
Sbjct  1021  VDVLSLSLGGGSAPFFEDSIAVGAFGATQKGIFVSCSAGNEGPYSGSLSNEAPWILTVGA  1080

Query  1456  STIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvd  1280
             ST+DR+I+A  +LGN     GES FQ  N PP  + L+Y G+   + AA C P SL  +D
Sbjct  1081  STVDRSIRAHVLLGNSNHFFGESLFQ-SNSPP-YMSLVYAGAHGSQSAAFCAPESLTDID  1138

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
             VKGK+VLC+RGGGIAR+DKGQ VKDAGGAAMIL+N    GY+ LAD HVLPA+ +SY+ G
Sbjct  1139  VKGKIVLCERGGGIARIDKGQAVKDAGGAAMILMNDKDSGYSTLADAHVLPASHVSYSAG  1198

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
             L +K YINST  PTATI+F GT IG KTAP+VASFSSRGPS ASPGILKPDI+GPGV+IL
Sbjct  1199  LSIKAYINSTQVPTATIMFLGTKIGDKTAPTVASFSSRGPSMASPGILKPDIIGPGVSIL  1258

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAWPV          +TFNIISGTSM+ PHLSGIA LLKSAHPDWSPAAIKSAI+TTAD 
Sbjct  1259  AAWPVSVENRTDKK-STFNIISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTTADL  1317

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              NL    ILDERL+PAD+ ATG GHVNPS+ASDPGL+YD+Q DDY+PYLCGL Y D++I 
Sbjct  1318  VNLGNQPILDERLLPADILATGAGHVNPSKASDPGLVYDIQPDDYVPYLCGLGYPDRDIS  1377

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLGKT--SLTYSRTVTNVGEANSMYTVKVSPFL  386
              IVQR+V+CS+ +SI EAQLNYPSF+I  G    + TY+RTVTNVG  NS YT  V P  
Sbjct  1378  YIVQRQVKCSEKSSILEAQLNYPSFSIVYGPNPATQTYTRTVTNVGPPNSFYTAFVDPPP  1437

Query  385   GVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             GV+V VTP+ ++FT   Q  TY+++F+ +S   +    QG I WVS +H ++S I + F
Sbjct  1438  GVNVTVTPNNIIFTNTEQTATYSVTFTATSESNNDPIGQGYIRWVSDKHSIRSQILVSF  1496


 Score =   219 bits (559),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 135/194 (70%), Gaps = 1/194 (1%)
 Frame = -1

Query  799  AHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDL  620
            +HPDWSPAAIKSAI+TTA+  NL G  I D+  VP DVF  G GHVNP++A DPGL+YD+
Sbjct  178  SHPDWSPAAIKSAIMTTANLTNLGGMPITDQFFVPVDVFGIGSGHVNPTKADDPGLVYDI  237

Query  619  QSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTV  440
            Q DDYIPYLCGL Y D  +  IVQR V CS  +SIPEAQLNYPSF+I LG     Y+RTV
Sbjct  238  QPDDYIPYLCGLGYNDTAVGIIVQRPVTCSNSSSIPEAQLNYPSFSIKLGSGPQAYTRTV  297

Query  439  TNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAI  260
            TNVG   S Y  ++    GVDV VTP  + F   + + TY+++F+ ++  V + F QG +
Sbjct  298  TNVGPLKSSYIAEIISPQGVDVKVTPSAIEFGGGSSKATYSVTFTRAAN-VKVPFAQGYL  356

Query  259  AWVSQRHIVKSPIA  218
             WVS  H+V+SPIA
Sbjct  357  NWVSADHVVRSPIA  370


 Score =   100 bits (249),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 77/136 (57%), Gaps = 38/136 (28%)
 Frame = -1

Query  1942  KWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFG  1763
             KWKGKCEF GT CNNKLIGARNF S+G     PP+D  GHGTHTASTAAGN V  A+ F 
Sbjct  7     KWKGKCEFNGTLCNNKLIGARNFYSDG----KPPIDGNGHGTHTASTAAGNPVPGASFFD  62

Query  1762  SAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFED  1583
                GTA G+  L+ LS+                                 GG S  F+ED
Sbjct  63    QYNGTADGVDVLS-LSL---------------------------------GGPSVPFYED  88

Query  1582  SIAIGAFAAMEKGIFV  1535
             SIAIGAF A++KGIFV
Sbjct  89    SIAIGAFGAIQKGIFV  104


 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -1

Query  1252  RGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINS  1073
             +G  +  ++KG+ VKDAGGAAMI++N +I G    A  HVLPA+ ++Y DGL +K YINS
Sbjct  100   KGIFVRLINKGREVKDAGGAAMIVMNDEIYGNVTTASLHVLPASHVTYADGLSIKAYINS  159

Query  1072  TSWPTATIVFKGTFIGTKTAP  1010
             TS P ATI+FKGT  G  + P
Sbjct  160   TSSPMATILFKGTVFGVPSHP  180



>ref|XP_010053374.1| PREDICTED: subtilisin-like protease SDD1 [Eucalyptus grandis]
Length=752

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/715 (61%), Positives = 549/715 (77%), Gaps = 9/715 (1%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSE-SGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYIVHV   A  +   SED +S+++SF+ + + +  + +R+VHSY++  +GFAAK++ + 
Sbjct  44    TYIVHVRKRAGEVFARSEDLQSWYQSFLPQMTPNSDQTNRMVHSYKNSITGFAAKMTADE  103

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
               E+ K    +S +++++++L+TTHSP+FL L    G W++S+ GKGVI+GVLDTGITP 
Sbjct  104   AKELLKLDAVVSVKQEKIFSLHTTHSPSFLNLNPGVGLWKDSTLGKGVIIGVLDTGITPG  163

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             HPSF+DE M  PPAKWKGKC F  T+CNNKLIGARNFV+       PP DE+GHGTHT+S
Sbjct  164   HPSFDDEGMSFPPAKWKGKCTFNATSCNNKLIGARNFVTS----TLPPTDEDGHGTHTSS  219

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAGNFV NA V G A GTA+G+AP AHL++Y+VC++ GC ES ILAAMDAAI+DGVDVL
Sbjct  220   TAAGNFVKNANVLGQALGTAIGVAPHAHLAMYQVCSDVGCPESSILAAMDAAIEDGVDVL  279

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
             SLSLGGGS  F+ DSIA+GAF+A++KGIFVSC+AGN GP   +LSNEAPW+LTVGASTID
Sbjct  280   SLSLGGGSTPFYADSIAVGAFSAIQKGIFVSCSAGNSGPINTSLSNEAPWILTVGASTID  339

Query  1444  RTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvkgk  1268
             RT+KATA LGNGA+ +GES FQ ++F  +  PL+Y G+  ++ +ALC  GSL  +DVKGK
Sbjct  340   RTVKATAKLGNGAEHNGESLFQPKDF-GSAYPLVYAGANGNQTSALCAEGSLRNLDVKGK  398

Query  1267  vVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVK  1088
             VVLC+RGGGIAR+ KGQ VKDAGGAAMI++N +++GY+ LAD HVLPAT + Y DGLK+K
Sbjct  399   VVLCERGGGIARIAKGQEVKDAGGAAMIMMNDELNGYSTLADAHVLPATHIPYADGLKIK  458

Query  1087  DYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWP  908
              YINSTS P ATI+FKGT IG   AP+V SFSSRGPS  SPGILKPDI+GPGV+ILAAWP
Sbjct  459   SYINSTSNPMATILFKGTIIGNSEAPAVTSFSSRGPSFESPGILKPDIIGPGVSILAAWP  518

Query  907   VgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLN  728
               +  N+   + TFNIISGTSM+ PHLSGIA LLKS+HPDWSPAAIKSAI+TTA Q NL 
Sbjct  519   F-SLDNSSTTDVTFNIISGTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIMTTAYQINLG  577

Query  727   GTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQ  548
                I+DE L+PAD+FATG GHVNP +A DPGLIYD++ D+YIPYLCGL Y D EI+ I Q
Sbjct  578   SKPIVDETLLPADIFATGAGHVNPPKADDPGLIYDIKPDNYIPYLCGLGYKDSEIETITQ  637

Query  547   RKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGV  368
              K +C Q+ SIP+AQLNYPSF+I LG ++  YSRTVTNVG A+S YT KV    GVDV V
Sbjct  638   EKAKCLQIKSIPQAQLNYPSFSIILGSSAQNYSRTVTNVGPADSSYTYKVDAPEGVDVTV  697

Query  367   TPDTLVFTEVNQQLTYNISFSPSS-TPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
              P  + F+   Q  TY + F  SS       F QG++ WVS  H V+SPIA++F+
Sbjct  698   YPSEIKFSVAVQMATYTVGFHRSSGGSFTKPFAQGSLTWVSSDHSVRSPIAVVFK  752



>gb|KDP25551.1| hypothetical protein JCGZ_20707 [Jatropha curcas]
Length=757

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/731 (59%), Positives = 550/731 (75%), Gaps = 13/731 (2%)
 Frame = -1

Query  2365  VASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFV--SESGDEGERSRIVHSYRHVASG  2192
             +   K    YIVHVSPP        E+  ++ +SF+  S +  E ++ R+++SY ++ SG
Sbjct  29    ITENKNLQAYIVHVSPPEGRTFSQRENLENWHKSFLPFSTASSEKQQKRMLYSYHNIISG  88

Query  2191  FAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVG  2012
             F+A+L+ E V  M +  GF+ AR +R  +L TTH+P+FLGL++  GFW+ S++GKGVI+G
Sbjct  89    FSARLTHEEVKAMEEINGFVLARPERKLHLQTTHTPSFLGLHRQMGFWKESNFGKGVIIG  148

Query  2011  VLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNF----VSEGsspppp  1844
             VLD G+ P+HPSFND+ MPPPPAKWKG+CEF  + CNNKLIGAR+F     +        
Sbjct  149   VLDGGVFPSHPSFNDKGMPPPPAKWKGRCEFNASKCNNKLIGARSFNLAAKAMKGIAAET  208

Query  1843  PVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVC---TEDGCAESd  1673
             P+D +GHGTHTASTAAG+FV NA V G+AKGTAVGMAP AHL+IYKVC     D C ESD
Sbjct  209   PIDVDGHGTHTASTAAGSFVYNANVLGNAKGTAVGMAPYAHLAIYKVCFGDPNDDCPESD  268

Query  1672  ilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTL  1493
             ILA +DAAI DGVDVLSLS+G  S  FF+D+IAIG+FAA++KGIFVSCAAGN GP   TL
Sbjct  269   ILAGLDAAIQDGVDVLSLSIGDISMPFFQDNIAIGSFAAIQKGIFVSCAAGNSGPFNGTL  328

Query  1492  SNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDE-DA  1316
             SNEAPW+LTVGASTIDR I ATA LGNG +LDGES  Q  NFP TLLPL+YPG   + ++
Sbjct  329   SNEAPWILTVGASTIDRKIAATAKLGNGEELDGESVLQPSNFPTTLLPLVYPGMNGKTES  388

Query  1315  ALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTH  1136
             A C   ++  +DVK KVVLC+RGGGI RV KG+ VK+AGGAAMIL+N +I G++ +AD H
Sbjct  389   AFCSERAVQGMDVKDKVVLCERGGGIGRVAKGEEVKNAGGAAMILINDEISGFSTIADAH  448

Query  1135  VLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGIL  956
             VLPAT +S+  GL++K YINST  P ATI+FKGT IG   +P+V SFSSRGP+ ASPGIL
Sbjct  449   VLPATHVSFAAGLQIKAYINSTKTPMATILFKGTVIGDPLSPAVTSFSSRGPNLASPGIL  508

Query  955   KPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPA  776
             KPDI+GPGV+ILAAWP   +       +TFN++SGTSMA PHLSGIA LLKS+HP WSPA
Sbjct  509   KPDIIGPGVSILAAWPFPLDNTTNTK-STFNLVSGTSMACPHLSGIAALLKSSHPYWSPA  567

Query  775   AIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPY  596
             AIKSAI+TTAD +N+ G+ I+DE+  PAD+F  G GHVNPSRA+DPGLIYD+Q DDYIPY
Sbjct  568   AIKSAIMTTADIFNMEGSPIVDEKHQPADLFTIGAGHVNPSRANDPGLIYDIQPDDYIPY  627

Query  595   LCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANS  416
             LCGL Y ++++  I  R+++CS+  SIPE QLNYPSF++ LG  S T++RTVTNVGEANS
Sbjct  628   LCGLGYKEEQVSIIAHRRIKCSEKLSIPEGQLNYPSFSVTLG-ASQTFTRTVTNVGEANS  686

Query  415   MYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPS-STPVDIDFVQGAIAWVSQRH  239
             +Y   + P  GV V V P  L F++VNQ++TY+++FSP+ S+    +F QG I W S +H
Sbjct  687   VYAATIVPPPGVAVTVEPYRLYFSQVNQKVTYSVTFSPTGSSGKTSEFAQGYILWSSAKH  746

Query  238   IVKSPIAIIFQ  206
             +V+SPI++ F+
Sbjct  747   LVRSPISVRFK  757



>ref|XP_007208859.1| hypothetical protein PRUPE_ppa025839mg, partial [Prunus persica]
 gb|EMJ10058.1| hypothetical protein PRUPE_ppa025839mg, partial [Prunus persica]
Length=729

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/721 (60%), Positives = 545/721 (76%), Gaps = 19/721 (3%)
 Frame = -1

Query  2440  IIAMKGTPNMAYISVVVCLTLVFHSVASAKYEDTYIVHVSPPAAAINGVS--EDYRSYFR  2267
             II + G   M Y+SV V       +        TYIV V  P   +  V   ED  S++ 
Sbjct  11    IIYLLGFSVMFYLSVAVAA----ETGEGKSSMQTYIVWVKRPVQNLFFVKSHEDLESWYH  66

Query  2266  SFVSES---GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYT  2096
             +F+ ++    +E  +SR+VH+YR+VA+GFAAKL+PE V  M +K+GF+SA  +R+  L+T
Sbjct  67    TFLPDTIANSNEPTKSRMVHTYRNVATGFAAKLTPEEVKAMEQKEGFVSAHPERILPLHT  126

Query  2095  THSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE  1916
             THSPNFLGL Q  G W+ ++YG+GVI+GVLDTGI P+HPSF+DE +PPPPAKWKGKC+F+
Sbjct  127   THSPNFLGLQQGLGVWKGANYGEGVIIGVLDTGIGPDHPSFSDEGVPPPPAKWKGKCDFD  186

Query  1915  GTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGM  1736
             GT CNNKLIGARNF S G +   PPVD+EGHGTHT+STAAGNFV  A  FG A GTA GM
Sbjct  187   GTLCNNKLIGARNFQS-GKTTGGPPVDDEGHGTHTSSTAAGNFVKGANAFGMANGTAAGM  245

Query  1735  APLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAA  1556
             AP AHL++YK+C+EDGC E DI+AA+D A++DGVDVLSLSLGG S  F+ED IA+GAF A
Sbjct  246   APYAHLAMYKICSEDGCTEGDIVAALDTAVEDGVDVLSLSLGGPSFPFYEDGIAVGAFGA  305

Query  1555  MEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQV  1376
             ++KGIFVSC+AGN GP Y +LSNEAPW+LTVGASTIDR+I+ATA+LG+  + DG S FQ 
Sbjct  306   IQKGIFVSCSAGNSGPSYESLSNEAPWILTVGASTIDRSIRATALLGDHGEFDGVSLFQP  365

Query  1375  ENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAG  1199
             ++F  TLLPL+YPG+  +  +ALC PGSL+ ++ K    +C+  GG  RV KG+ VK AG
Sbjct  366   KDFNSTLLPLVYPGANGNPSSALCSPGSLENLEGKIV--VCE--GGRGRVAKGEEVKRAG  421

Query  1198  GAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTK  1019
             GAAMIL+NQ IDGY++LAD HVLPAT +SY  GL +K +INSTS PTATI+FKGT IG  
Sbjct  422   GAAMILVNQAIDGYSVLADAHVLPATHVSYKAGLDIKAFINSTSTPTATILFKGTVIGDP  481

Query  1018  TAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMA  839
              AP VASFSSRGPS  SPGILKPDI+GPGV+ILAAWPV  +       ATFN++SGTSM+
Sbjct  482   LAPKVASFSSRGPSTTSPGILKPDIIGPGVSILAAWPVSVDNGTEGK-ATFNMVSGTSMS  540

Query  838   TPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVN  659
              PHLSGIA LLKS+HPDWSPAAIKSAI+TTA+  NL G+ I+D+ L PAD+FA G GHVN
Sbjct  541   CPHLSGIAALLKSSHPDWSPAAIKSAIMTTAEVENLAGSAIVDQTLFPADIFALGAGHVN  600

Query  658   PSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAI  479
             PS+A+DPGLIYD+Q +DYIPYLCGLNYTD++IQ I Q+ V CSQV ++PEAQLNYP+F+I
Sbjct  601   PSKANDPGLIYDIQPEDYIPYLCGLNYTDEQIQVITQQTVNCSQVGAVPEAQLNYPTFSI  660

Query  478   WLGKTSLT---YSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISF  308
               G +      Y+RTVTNVG ANS Y + +     V + V P  L FTE NQ++TY++ F
Sbjct  661   KTGSSETRTQYYTRTVTNVGPANSTYNLALVVPPKVGMSVNPQVLTFTEFNQKITYHVEF  720

Query  307   S  305
             +
Sbjct  721   N  721



>gb|KDO47505.1| hypothetical protein CISIN_1g042259mg [Citrus sinensis]
Length=745

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/718 (60%), Positives = 536/718 (75%), Gaps = 12/718 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAIN-GVSEDYRSYFRSF----VSESGDEGERSRIVHSYRHVASGFAAKL  2177
             TYIVHV  P    N  +  D  +++R+F    +S+S D   RSR+V+ YR+V SGFAA+L
Sbjct  34    TYIVHVRKPKQEGNFSIKLDLDNWYRTFLPDNISKSIDAHHRSRMVYGYRNVISGFAARL  93

Query  2176  SPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTG  1997
             + E V  M  K GFISAR + +    TTHSPNFLGL+QN GFW++S+ GKGVI+GVLD G
Sbjct  94    TAEEVKAMETKSGFISARVENILEPQTTHSPNFLGLHQNSGFWKDSNLGKGVIIGVLDMG  153

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGT  1817
             ITP HPSF+DE MPPPPAKWKGKCE EG  CNNK+IGARNF+++      PP+D +GHGT
Sbjct  154   ITPGHPSFSDEGMPPPPAKWKGKCELEGANCNNKIIGARNFLNK----SEPPIDNDGHGT  209

Query  1816  HTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTED-GCAESdilaamdaaidd  1640
             HTASTAAGNFV  A +FG A GTA GMAPLAHL+IYKVC  D GC ES + AA+DAA+++
Sbjct  210   HTASTAAGNFVNGANLFGQANGTAAGMAPLAHLAIYKVCETDLGCPESIVNAAIDAAVEE  269

Query  1639  gvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVG  1460
             GVDVLS+SLG  S  FF D++A  AF A +KGI VSC+AGN GP+  TL+NEAPW+LTVG
Sbjct  270   GVDVLSISLGSPSLPFFADAMATAAFTASQKGILVSCSAGNSGPNSSTLANEAPWMLTVG  329

Query  1459  ASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvd  1280
             ASTIDR+I A   LGN    DGE+ FQ ++FP   LPL+YPG K+  AA C P +L  +D
Sbjct  330   ASTIDRSIVALTQLGNQETYDGETIFQPKDFPSKQLPLVYPGVKNSSAAFCLPETLKSID  389

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
             VKGKVVLC RGGG  R+ KG+ VKDAGGAAMIL+N ++  Y  +AD HVLPA  +SY  G
Sbjct  390   VKGKVVLCQRGGGTQRIRKGKDVKDAGGAAMILMNDELFDYGTVADNHVLPAVYVSYAAG  449

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
              ++K YINSTS PTA+IVFKGT IG K+AP VA FSSRGP+ ASPGILKPDI+GPGV+IL
Sbjct  450   ERIKAYINSTSSPTASIVFKGTVIGKKSAPEVAVFSSRGPNTASPGILKPDIIGPGVSIL  509

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAWP  +  N  N  +TF +ISGTSM+ PHLSGIA LLKSAHPDWSPAAIKSAI+TTAD 
Sbjct  510   AAWPF-SEENITNTKSTFTMISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTTADI  568

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              NL G  I++  L+PAD+FA G GHVNPS+A+DPGL+Y++  DDY+ YLCG NYTDQ+I+
Sbjct  569   VNLEGKPIMNHHLLPADLFAVGAGHVNPSKANDPGLVYEISHDDYVRYLCGKNYTDQQIE  628

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGV  380
              IV   V+CS+V+SI EA+LNYPSF++ LG +  TY+RTVTNVG+ NS YT  +    GV
Sbjct  629   GIVDHDVQCSKVSSIAEAELNYPSFSVKLGSSPQTYNRTVTNVGQDNSFYTHHIIVPEGV  688

Query  379   DVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
              + V PD + FTE NQ+ T++++F       +   VQG ++WVS  H V+SPIAI F+
Sbjct  689   KIIVQPDKISFTEKNQKATFSVTFIRDQNS-NASSVQGYLSWVSATHTVRSPIAIGFE  745



>ref|XP_006358907.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=645

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/651 (67%), Positives = 531/651 (82%), Gaps = 7/651 (1%)
 Frame = -1

Query  2155  MRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPS  1976
             M KK GF+SAR +++  L+TTH+PNFLGLY+N GFW+ S+YGKGVI+GVLDTGITP+HPS
Sbjct  1     MEKKDGFVSARVEKILALHTTHTPNFLGLYRNVGFWQESNYGKGVIIGVLDTGITPSHPS  60

Query  1975  FNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVSEGssppppPVDEEGHGTHTASTA  1799
             F+DENMP PPAKWKGKCEF G   CN K+IGARN VS       PP DEEGHGTHT+STA
Sbjct  61    FSDENMPSPPAKWKGKCEFTGNVTCNKKIIGARNLVS---GSSDPPFDEEGHGTHTSSTA  117

Query  1798  AGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlsl  1619
             AGNFV +A++FG+A GTA GMAPLAH+++YKVCTE GC++ DILAA+DAAIDDGVDVLSL
Sbjct  118   AGNFVDDASLFGNANGTAAGMAPLAHIAMYKVCTE-GCSDVDILAALDAAIDDGVDVLSL  176

Query  1618  slgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRT  1439
             S+GG S  F+EDSIA GAFAAM+KGIFVS +AGNEGP   TLSNEAPW+LTVGAST DR 
Sbjct  177   SIGGFSDPFYEDSIATGAFAAMQKGIFVSASAGNEGPLNSTLSNEAPWILTVGASTHDRK  236

Query  1438  IKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvdvkgkvVL  1259
             I ATAVLGNG + DGES+FQ  +FP TLLPL+YPG  D++AALC  GSL+  DVKGKVV+
Sbjct  237   IVATAVLGNGQEYDGESSFQPTSFPHTLLPLVYPGLSDQEAALCSSGSLNNTDVKGKVVV  296

Query  1258  CDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYI  1079
             CDRGGG+AR++K QTVKDAGGAAMIL N +IDG    AD HVLPAT + Y  G  +K YI
Sbjct  297   CDRGGGVARLEKSQTVKDAGGAAMILANLEIDGDGTFADAHVLPATHVGYTAGESIKAYI  356

Query  1078  NSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgn  899
             NSTS P+A I+FKGT IG K++PSV+SFSSRGP+ ASPGI+KPDI+GPGVN+LAAWPV  
Sbjct  357   NSTSTPSAGILFKGTSIGFKSSPSVSSFSSRGPNLASPGIVKPDIIGPGVNVLAAWPVSV  416

Query  898   ntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTK  719
                 G    TFNIISGTSM+ PHLSGIA LLKSAHPDWSPAAIKSAI+TTADQ+NL G  
Sbjct  417   ENKTGTDL-TFNIISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTTADQFNLEGQP  475

Query  718   ILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKV  539
             ILD+R +PAD+FATG GHVNPS+ASDPGLIYD++ ++YI YLCGL Y D++I+ +VQ+ +
Sbjct  476   ILDQRGLPADIFATGAGHVNPSKASDPGLIYDIKVENYIQYLCGLGYKDKDIELLVQQTI  535

Query  538   ECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPD  359
             +CS  +SI EA+LNYPSF+I LG  +  Y+RTVTNVG+A+S YTV ++   GVDV V P 
Sbjct  536   KCSLQSSISEAELNYPSFSIILGPQTQNYTRTVTNVGDASSTYTVNITQIQGVDVVVEPA  595

Query  358   TLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
             TLVFT+VNQQ TY++SF+ +    D  FVQGA++W+S +++V+ PI++  +
Sbjct  596   TLVFTQVNQQATYSVSFTQTGLITD-RFVQGALSWISNKYVVRIPISVKLE  645



>ref|XP_011071267.1| PREDICTED: subtilisin-like protease SDD1 [Sesamum indicum]
Length=741

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/743 (59%), Positives = 552/743 (74%), Gaps = 16/743 (2%)
 Frame = -1

Query  2407  YISVVVCLTLVFHSVASAKYE--DTYIVHVS-PPAAAINGVSEDYRSYFRSFV--SESGD  2243
             +   +VC+ L FH++  A+    ++YIVHV  P    ++  ++D   +++SF+  + S  
Sbjct  6     FFLTLVCV-LNFHTIVRAEESKLESYIVHVEMPRGPTVSAHTDDLEGWYQSFLPTTLSSS  64

Query  2242  EGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQ  2063
               +   I++SY +V  GFAA+LSPE V EM KK GF+SAR Q+   L+TTHSPNFLGL Q
Sbjct  65    SADGPHIIYSYHNVFKGFAARLSPEQVKEMEKKPGFVSARPQKTLPLHTTHSPNFLGLNQ  124

Query  2062  NFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGA  1883
             N GFWR+S+YG+GVI+GVLD+GI P+HPSFNDE MPPPPAKWKG+C+F  T CNNKLIGA
Sbjct  125   NMGFWRDSNYGRGVIIGVLDSGINPDHPSFNDEGMPPPPAKWKGQCQFNSTVCNNKLIGA  184

Query  1882  RNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKV  1703
             R F          P+DE GHGTHTASTAAGNFV  A VFG+A GTA G+APLAH+++YKV
Sbjct  185   RYFT----IGNGTPLDENGHGTHTASTAAGNFVRGANVFGNANGTAAGIAPLAHIAMYKV  240

Query  1702  CTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAA  1523
             C   GC+ESDILAAMDAAIDDGVD++SLSLGG + +F++D++A+GAF+A+E+GIFVS +A
Sbjct  241   CNT-GCSESDILAAMDAAIDDGVDIISLSLGGPARNFYDDNVAVGAFSAVERGIFVSASA  299

Query  1522  GNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLI  1343
             GN GP   ++ N APWLLTVGAS++DR I+ATAVLGN  +L+GES FQ  +F  T L L+
Sbjct  300   GNSGPFLGSIENGAPWLLTVGASSVDRKIRATAVLGNNEELEGESTFQPADFSSTPLHLV  359

Query  1342  YP--GSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQD  1169
             YP   S D +A  C P  L  V+V+GK+VLC++GGGI R+ KG+ V +AGGAAMIL+NQ 
Sbjct  360   YPRLNSSDPNAQFCLPALLRNVNVQGKIVLCEQGGGIGRIAKGRAVGNAGGAAMILINQQ  419

Query  1168  IDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSS  989
               GYT  +D+HVLPAT LSY DGLK+K Y+NSTS PTATI FKGT IG   AP+VA FS 
Sbjct  420   PQGYTTYSDSHVLPATHLSYADGLKIKAYLNSTSSPTATISFKGTIIGDDRAPTVAYFSG  479

Query  988   RGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATL  809
             RGP+ AS GILKPDI+GPG NILAAW +    N     + FNIISGTSM+ PHLSG+A L
Sbjct  480   RGPNLASLGILKPDIIGPGHNILAAWHISVENNTNTK-SNFNIISGTSMSCPHLSGVAAL  538

Query  808   LKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLI  629
             LK+AHPDWSPAAIKSAI+TTADQ NL G  I DE L PA +FA G GHVN  +A+DPGL+
Sbjct  539   LKNAHPDWSPAAIKSAIMTTADQVNLAGNFIEDETLRPAILFAVGSGHVNILKATDPGLV  598

Query  628   YDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWL--GKTSLT  455
             YD+Q  DY+PYLCGLNYTDQ+++ I  R V CS+++SI EA+LNYPSF   L  G TS T
Sbjct  599   YDIQPQDYVPYLCGLNYTDQQVEIIANRPVRCSEISSISEAELNYPSFTALLGTGNTSET  658

Query  454   YSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDF  275
             Y+RTVTNVGEANS+YTV+     GVD+ V P TL F+ VNQ+LTY ++F+  +       
Sbjct  659   YNRTVTNVGEANSVYTVETVGLPGVDMRVEPSTLQFSGVNQRLTYQVTFNRLANASSNTV  718

Query  274   VQGAIAWVSQRHIVKSPIAIIFQ  206
              QG + W S RH V+SP+ +IF+
Sbjct  719   AQGFLTWTSARHSVRSPLVVIFE  741



>gb|KCW77772.1| hypothetical protein EUGRSUZ_D02072 [Eucalyptus grandis]
Length=807

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/715 (60%), Positives = 538/715 (75%), Gaps = 9/715 (1%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERS-RIVHSYRHVASGFAAKLSPEM  2165
             TYIVHV  PA  +   SED +S+++SF+ ++    +++ R+VHSY+H  +GFAAK++ + 
Sbjct  99    TYIVHVRKPAGEVFARSEDLQSWYQSFLPQTAANWDQTKRMVHSYKHAITGFAAKMTADE  158

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
               E+ K    +S +R+++++L+TTHSP+FL L    G W+ S+ GKGVI+GVLDTGITP 
Sbjct  159   AKELLKLDAVVSVKREKIFSLHTTHSPSFLNLNPGMGLWKASTLGKGVIIGVLDTGITPG  218

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             HPSF+D+ M  PPAKWKGKC F  T+CNNKLIGARNFV+    P     DE+GHGTHT+S
Sbjct  219   HPSFDDQGMSTPPAKWKGKCTFNATSCNNKLIGARNFVTSNLPP----TDEDGHGTHTSS  274

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAGNFV  A   G A G AVG+AP AHL++Y+VC+   C ES +LA MDAAI+DGVDVL
Sbjct  275   TAAGNFVKKANFLGQAPGIAVGIAPRAHLAMYRVCSNGRCLESHVLAGMDAAIEDGVDVL  334

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
             S+S+G   A F+ DS+A+GAF+A++KGIFVSC+AGN GP   +LSNEAPW+LTVGASTID
Sbjct  335   SISIGFRQAPFYADSMAVGAFSAIQKGIFVSCSAGNRGPINTSLSNEAPWILTVGASTID  394

Query  1444  RTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvkgk  1268
             RT+KATA LGNGA+ DGES FQ ++F  +  PL+Y G+  ++ +A+C  GSL  +DVKGK
Sbjct  395   RTVKATAKLGNGAEYDGESLFQPKDF-ASAYPLVYAGANGNQTSAICAEGSLRNLDVKGK  453

Query  1267  vVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVK  1088
             VVLC+   GIAR+ +GQ VKDAGG AMIL+N +++GY+  AD HVLPAT + Y DGLK+K
Sbjct  454   VVLCETDRGIARIAQGQEVKDAGGVAMILMNNELNGYSTRADVHVLPATHIPYADGLKIK  513

Query  1087  DYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWP  908
              YINSTS PTATI+FKGT IG   AP+V SFSSRGPS  SPGILKPDI+GPGV+ILAAWP
Sbjct  514   AYINSTSDPTATILFKGTIIGNSDAPAVTSFSSRGPSFESPGILKPDIIGPGVSILAAWP  573

Query  907   VgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLN  728
               +  N+   +ATFNIISGTSM+ PHLSGIA LLKS+HPDWSPAAIKSAI+TTA Q NL 
Sbjct  574   F-SLDNSSTTDATFNIISGTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIMTTAYQMNLG  632

Query  727   GTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQ  548
                I+DE L+PAD+FA G GHVNP +A DPGLIYD++ +DYIPYLCGL Y D EI+ I Q
Sbjct  633   SKPIIDETLLPADIFAIGAGHVNPPKADDPGLIYDIKPNDYIPYLCGLGYKDSEIETITQ  692

Query  547   RKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGV  368
              K +CSQ+ SIPEAQLNYPSF+I LG ++  YSRTVTNVG A+S YT KV    GVDV V
Sbjct  693   EKAKCSQIKSIPEAQLNYPSFSIILGSSAQNYSRTVTNVGSADSSYTYKVDAPEGVDVTV  752

Query  367   TPDTLVFTEVNQQLTYNISFSPSSTPVDID-FVQGAIAWVSQRHIVKSPIAIIFQ  206
              P  + F+   Q  TY + F  SS    I  F QG++ WVS  H VKSPIA++F+
Sbjct  753   YPSEIKFSMAVQMATYTVGFHRSSGGTVIKPFAQGSLTWVSSDHSVKSPIAVVFK  807



>ref|XP_009776158.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=744

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/744 (59%), Positives = 546/744 (73%), Gaps = 18/744 (2%)
 Frame = -1

Query  2404  ISVVVCLTLVFHSVASAKYEDTYIVHVSPPAAAINGVS---EDYRSYFRSF------VSE  2252
             I ++ C+   F         DTYIV V    + I+  S   +D  S++RSF      ++ 
Sbjct  6     IFLLFCMVSYFPWPTIQSPLDTYIVQVESQESQISTQSLSDQDLESWYRSFLPNTIAITR  65

Query  2251  SGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLG  2072
             S DE E  R+V+SYR+V  GFAA+LS E V EM KK GF+SA  +R+ +L+TTH+P+FLG
Sbjct  66    SNDE-EGPRLVYSYRNVMKGFAARLSAEHVKEMEKKPGFVSAWPERIMSLHTTHTPSFLG  124

Query  2071  LYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNK  1895
             L Q+ G W++S+YG GVI+GVLDTGI+P+HPSF+DE M PPPAKWKGKCE    T CNNK
Sbjct  125   LQQHMGLWKDSNYGNGVIIGVLDTGISPDHPSFSDEGMLPPPAKWKGKCESNFTTKCNNK  184

Query  1894  LIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLS  1715
             LIGAR+++ E       P+D++GHGTHTASTAAG FV  A V+G+AKGTAVG+APLAHL+
Sbjct  185   LIGARSYIQE----DRSPIDDDGHGTHTASTAAGGFVQGANVYGNAKGTAVGVAPLAHLA  240

Query  1714  IYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFV  1535
             IYKVC   GCA+S+ILAAMDAAIDDGVD+LSLSLGG S+    D IA+GA++A E+GI V
Sbjct  241   IYKVCDSSGCADSEILAAMDAAIDDGVDILSLSLGGFSSPLHSDPIALGAYSATERGILV  300

Query  1534  SCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTL  1355
             SC+AGNEGP   + SNEAPW+LTVGAST+DR IKAT  LGN  + +GES F  ++F  T 
Sbjct  301   SCSAGNEGPYNSSTSNEAPWILTVGASTLDRKIKATVKLGNKKEFEGESTFHPKSFNVTF  360

Query  1354  LPLIYPG--SKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMIL  1181
              PL  P   + D D+  CG G+L    ++GK+VLC  GGG  R+ KGQ VKDAGG  MI+
Sbjct  361   FPLFDPAKNASDFDSPYCGTGTLTDPAIRGKIVLCMAGGGYTRIGKGQAVKDAGGVGMII  420

Query  1180  LNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVA  1001
              N    G T LAD HVLPA +++Y DG+K+ DY+NST  P A I F+GT IG + AP VA
Sbjct  421   YNGLEYGVTTLADAHVLPALDVTYADGMKILDYMNSTEKPVARITFQGTIIGDRNAPMVA  480

Query  1000  SFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSG  821
             SFSSRGPS ASPGILKPDI+GPGVNILAAWP     N  +  +TFNIISGTSM+ PHLSG
Sbjct  481   SFSSRGPSMASPGILKPDIIGPGVNILAAWPASVENNTNSK-STFNIISGTSMSCPHLSG  539

Query  820   IATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASD  641
             +A LLKSAHP WSPAAIKSAI+TTAD  NL    ILDERL+PA++FA G GHVNPSRA+D
Sbjct  540   VAALLKSAHPTWSPAAIKSAIMTTADTVNLANNPILDERLLPANIFAVGSGHVNPSRAND  599

Query  640   PGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTS  461
             PGLIYD   DDY+PYLCGLNYT++++  ++QRK+ CS+V SIPEAQLNYPSF+I LG  +
Sbjct  600   PGLIYDTPFDDYLPYLCGLNYTNRQVGNLLQRKINCSEVKSIPEAQLNYPSFSITLGTNT  659

Query  460   LTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDI  281
              TY+RTVTNVG+A S Y V++    GV V V P TL F+E+NQ+LTY ++FS ++   + 
Sbjct  660   HTYTRTVTNVGDAKSSYNVEIVSPRGVSVMVKPSTLTFSELNQKLTYQVTFSRTANSSNS  719

Query  280   DFVQGAIAWVSQRHIVKSPIAIIF  209
             D V+G + W S RH V+SPIA++ 
Sbjct  720   DVVEGFLKWTSNRHSVRSPIAVVL  743



>ref|XP_010108074.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXC17806.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=798

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/743 (60%), Positives = 548/743 (74%), Gaps = 35/743 (5%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGV----SEDYRSYFRSFVSESG------DEGERSRIVHSYRHVASG  2192
             TYIVHV  P   I+GV     +D ++++++F+  +             R+VH+Y++V SG
Sbjct  57    TYIVHVKKPQ--ISGVLSVSDQDLKAWYQTFLPSTTPTIATTRSSHYPRLVHAYKNVVSG  114

Query  2191  FAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVG  2012
             FAA+L+ + V  M KK GF+SAR +++Y+L+TTH+P FLGL+Q  G W +S  G+GVIVG
Sbjct  115   FAARLTADEVKAMEKKDGFVSAREEKIYSLHTTHTPKFLGLFQGLGLWNDSRLGEGVIVG  174

Query  2011  VLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppP---  1841
             +LDTGI P+HPSF+DE +PPPPAKW+GKC+F GT CNNKLIGAR+FV+   S        
Sbjct  175   LLDTGIWPDHPSFSDEGLPPPPAKWRGKCDFTGTECNNKLIGARDFVTSTKSTGTKSPSG  234

Query  1840  ---VDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYK------------  1706
                 D EGHGTHT+STAAGNFV  A  FG A GTA G+AP AHL++Y+            
Sbjct  235   QPPFDLEGHGTHTSSTAAGNFVSGANAFGMANGTAAGIAPRAHLAMYRQENEEYLQYLCP  294

Query  1705  VCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCA  1526
             VC E GC+E+DILAA+DAAI+DGVDVLSLSLGGGSA F+ DSIAIGAFAA++KGI VSC+
Sbjct  295   VCAE-GCSEADILAALDAAIEDGVDVLSLSLGGGSAPFYFDSIAIGAFAAIQKGIIVSCS  353

Query  1525  AGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTL-LP  1349
             AGNEGPDY+TLSNEAPW+LTVGAST+DR IKA A+LGNG  L+GES  Q+  F  +   P
Sbjct  354   AGNEGPDYFTLSNEAPWILTVGASTVDRKIKADAILGNGEVLEGESLNQLAPFDSSKPYP  413

Query  1348  LIYPG-SKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQ  1172
             LIYPG S +E    C PGSL  +DVKGK+V CDRGGGIAR+DKG  VK AGG AMIL+N+
Sbjct  414   LIYPGASGNESVKYCAPGSLQSLDVKGKIVACDRGGGIARIDKGTEVKSAGGIAMILMNE  473

Query  1171  DIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFS  992
              IDG++ LAD HVLPAT +S+   LK+K YI S+S P ATI+FKGT IG   AP V SFS
Sbjct  474   KIDGFSTLADAHVLPATHVSFAASLKIKAYIKSSSSPLATILFKGTVIGDSHAPVVTSFS  533

Query  991   SRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIAT  812
             SRGPS AS GILKPDI+GPGV+ILAAWPV  + +  +G ATFN+ISGTSM+ PHLSG+A 
Sbjct  534   SRGPSEASIGILKPDIIGPGVSILAAWPVSVDNSTTSGKATFNMISGTSMSCPHLSGVAA  593

Query  811   LLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGL  632
             LLKS+HP+WSPA IKSAI+TTAD  NL G  ILDE+  PADVFATG GHVNPS+A++PGL
Sbjct  594   LLKSSHPEWSPATIKSAILTTADVSNLGGGAILDEKASPADVFATGAGHVNPSKANNPGL  653

Query  631   IYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTY  452
             IYD++ +DYIPYLCGLNYTD ++  I Q  V+CS+V SIPE+QLNYP+F + LG   L+Y
Sbjct  654   IYDIEPEDYIPYLCGLNYTDDQVSTITQTTVKCSEVQSIPESQLNYPTFTVLLGNERLSY  713

Query  451   SRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTP--VDID  278
             +RTVTNVGEANS YT+ V P +G  + VTP+ L FTEVNQ+  Y I     S P      
Sbjct  714   TRTVTNVGEANSEYTLDVYPPVGTGINVTPNKLTFTEVNQKAEYKIEIIQVSGPGRSTNP  773

Query  277   FVQGAIAWVSQRHIVKSPIAIIF  209
             F QG + W S ++ V+S I  IF
Sbjct  774   FEQGYLVWKSDKYSVRSQITAIF  796



>ref|XP_003525747.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=749

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/717 (60%), Positives = 538/717 (75%), Gaps = 8/717 (1%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSES-GDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYI+HV+ P       SED  S++RSF+  +     E+ R+++SYR+V SGFAA+L+ E 
Sbjct  34    TYIIHVTGPQGKTLAQSEDLESWYRSFMPPTIMSSEEQPRMIYSYRNVMSGFAARLTEEE  93

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             +  ++KK GFISA  +R+ +  TTH+P FLGL Q+ GFW+ S++GKGVIVGV+D+GI P+
Sbjct  94    LRSVQKKNGFISAHPERMLHRQTTHTPQFLGLQQDMGFWKESNFGKGVIVGVVDSGIEPD  153

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNF--VSEGssppppPVDEEGHGTHT  1811
             HPSF+D  MPPPP KWKG+CE   T CNNKLIGAR+F   +        P+DE+GHGTHT
Sbjct  154   HPSFSDAGMPPPPLKWKGRCELNATFCNNKLIGARSFNLAATAMKGADSPIDEDGHGTHT  213

Query  1810  ASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvd  1631
             +STAAG FV +A V G+AKGTA G+AP AHL++Y+VC  + CAESDILAA+DAA++DGVD
Sbjct  214   SSTAAGAFVDHAEVLGNAKGTAAGIAPYAHLAMYRVCFGEDCAESDILAALDAAVEDGVD  273

Query  1630  vlslslgggSAS-FFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAS  1454
             V+S+SLG      FF DSIAIGAFAAM+KGIFVSCAAGN GP + +L N APW+LTVGAS
Sbjct  274   VISISLGLSEPPPFFNDSIAIGAFAAMQKGIFVSCAAGNSGPFHGSLVNGAPWVLTVGAS  333

Query  1453  TIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdv  1277
              IDR+I ATA LGNG + DGES FQ  +F PTLLPL Y G    ++AA C  GSL+  D 
Sbjct  334   NIDRSIAATAKLGNGQEFDGESVFQPSDFSPTLLPLAYAGKNGKQEAAFCANGSLNDCDF  393

Query  1276  kgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGL  1097
             +GKVVLC+RGGGI R+ KG+ VK  GGAAMIL+N + +G+++LAD HVLPAT LSY+ GL
Sbjct  394   RGKVVLCERGGGIGRIAKGEEVKRVGGAAMILMNDESNGFSVLADVHVLPATHLSYDSGL  453

Query  1096  KVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILA  917
             K+K YINST+ PTATI+FKGT IG   AP+V SFSSRGP+  SPGILKPDI+GPGVNILA
Sbjct  454   KIKAYINSTAIPTATILFKGTIIGNSLAPAVTSFSSRGPNLPSPGILKPDIIGPGVNILA  513

Query  916   AWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQY  737
             AWP   N +  +  +TFNI+SGTSM+ PHLSG+A LLKS+HP WSPAAIKSAI+T+AD  
Sbjct  514   AWPFPLNNDTDSK-STFNIMSGTSMSCPHLSGVAALLKSSHPHWSPAAIKSAIMTSADII  572

Query  736   NLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQ  557
             N     I+DE L PADVFATG GHVNPSRA+DPGL+YD+Q DDYIPYLCGL Y D E+  
Sbjct  573   NFEHKLIVDETLYPADVFATGSGHVNPSRANDPGLVYDIQPDDYIPYLCGLGYGDTEVGI  632

Query  556   IVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVD  377
             I  + + CS+ +SIPE +LNYPSF++ LG    T++RTVTNVGEANS Y V V    GV+
Sbjct  633   IAHKTITCSETSSIPEGELNYPSFSVVLGSPQ-TFTRTVTNVGEANSSYVVMVMAPEGVE  691

Query  376   VGVTPDTLVFTEVNQQLTYNISFSP-SSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             V V P+ L F+E NQ+ TY++SFS   S     ++ QG + WVS +H V+SPI + F
Sbjct  692   VKVRPNNLTFSEANQKETYSVSFSRIESGNETAEYAQGFLQWVSAKHTVRSPILVDF  748



>emb|CDP09846.1| unnamed protein product [Coffea canephora]
Length=729

 Score =   801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/744 (59%), Positives = 548/744 (74%), Gaps = 41/744 (6%)
 Frame = -1

Query  2398  VVVCLTLVFHSVASAKYE-------DTYIVHVSPPA------AAINGVSEDYRSYFRSFV  2258
             +++   L FHS+A A  +       +TYIVHV  P       ++ +G +ED  S++RSF+
Sbjct  7     LILISVLSFHSLAVAANDFLGKSNLETYIVHVELPEYSDIQLSSSSGPNEDLDSWYRSFL  66

Query  2257  SES-GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPN  2081
               +     E  +IVHSY +V  GFAAKLS E V  M KK GFISA+ Q + +L+TTHSPN
Sbjct  67    PTTVASSNEAPQIVHSYHNVFKGFAAKLSAEDVKTMEKKPGFISAQPQMLLSLHTTHSPN  126

Query  2080  FLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACN  1901
             FLGL+QN GFW  S+YGKGVI+GVLD+GI P+HPSF+DE MPPPPAKWKGKC+F  +ACN
Sbjct  127   FLGLHQNVGFWNESNYGKGVIIGVLDSGIAPDHPSFSDEGMPPPPAKWKGKCQFNTSACN  186

Query  1900  NKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAH  1721
             NKLIGAR F S+G+  P   +DE+GHGTHTA TAAGN+V  A VFG+A GTAVG+APLAH
Sbjct  187   NKLIGAR-FFSDGNGSP---MDEDGHGTHTAGTAAGNYVKGANVFGNANGTAVGVAPLAH  242

Query  1720  LSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGI  1541
             L+IYKVC+  GC+ESDILAAMDAAI DGVD+LSLSL GGS  F+ D+IA+GA++AMEKGI
Sbjct  243   LAIYKVCSP-GCSESDILAAMDAAIHDGVDILSLSLQGGSGPFYADNIAMGAYSAMEKGI  301

Query  1540  FVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPP  1361
             FVSC+AGN GP   +LSNEAPW+LTVGASTIDR I+  A LGN  + DG+          
Sbjct  302   FVSCSAGNSGPFNRSLSNEAPWILTVGASTIDRKIRTIAKLGNNEEFDGD----------  351

Query  1360  TLLPLIYPGSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMIL  1181
                        D ++  CG G L+   V GK+V+CD GGG++R+ KGQ +K AGG  MIL
Sbjct  352   -----------DFNSGYCGSGLLNDTGVLGKIVVCDNGGGVSRIAKGQNIKSAGGVGMIL  400

Query  1180  LNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVA  1001
             +NQ   GY   AD HVLPAT LSY DG+KV  YINST  P ++I FKGT IG   AP VA
Sbjct  401   INQLSQGYATSADAHVLPATHLSYTDGVKVLAYINSTKSPMSSIAFKGTIIGDHQAPLVA  460

Query  1000  SFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSG  821
             +FSSRGPS  SPGILKPD++GPGVNILAAW   +  NN N  ATFN+ISGTSM+ PHLSG
Sbjct  461   AFSSRGPSRTSPGILKPDVIGPGVNILAAWH-RSVENNSNTKATFNVISGTSMSCPHLSG  519

Query  820   IATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASD  641
             +A LLKS HPDWSPAAIKSAI+TTAD  NL    I D+ L+PA+VFATG GHVNP++A++
Sbjct  520   VAALLKSVHPDWSPAAIKSAIMTTADIVNLAKNPIEDQTLLPANVFATGSGHVNPAKANN  579

Query  640   PGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTS  461
             PGLIYD++  DYIPYLCGLNYT++E+  +VQRKV C+  +SIPEAQLNYPSF+I  G + 
Sbjct  580   PGLIYDIEPKDYIPYLCGLNYTNREVSHLVQRKVNCTAESSIPEAQLNYPSFSIVFGSSI  639

Query  460   LTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDI  281
               Y+RTVTNVGEA S+YTVKV+P  GV+V V P+TL F+EVNQ+LTY ++FS  ++  + 
Sbjct  640   QKYTRTVTNVGEAKSVYTVKVAPPAGVNVTVKPNTLSFSEVNQKLTYEVTFSLLASSANN  699

Query  280   DFVQGAIAWVSQRHIVKSPIAIIF  209
                QG++AW S ++ V+SPI  +F
Sbjct  700   TVSQGSLAWTSAKYSVRSPIVALF  723



>ref|XP_009629568.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=761

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/721 (62%), Positives = 542/721 (75%), Gaps = 16/721 (2%)
 Frame = -1

Query  2338  YIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERS--RIVHSYRHVASGFAAKLSPEM  2165
             YIVH   P        +D  S++ SF+  +  +  R   R+++SYR+V +GFAAKLSP+ 
Sbjct  43    YIVHCEFPDGDKTTRYQDLDSWYLSFLPATTSDSSREAPRLIYSYRNVLTGFAAKLSPDD  102

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             + EM KK+GFISAR ++  +LYTTHS NFLGL+QN GFW +S+YGKGVI+GV+DTGI P+
Sbjct  103   LKEMEKKEGFISARPEKQLDLYTTHSLNFLGLHQNMGFWNDSNYGKGVIIGVIDTGIFPD  162

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             HPSF+D  MPPPPAKWKGKCEF  T CNNKLIGAR F S G+  P    DE GHGTHTAS
Sbjct  163   HPSFSDGGMPPPPAKWKGKCEFNVTKCNNKLIGARYFQSSGNGSPW---DENGHGTHTAS  219

Query  1804  TAAGNFVGNAAVFGSAKGTAVG-----MAPLAHLSIYKVCTEDGCAESdilaamdaaidd  1640
             TAAGNFV  A +FG+A G         +APLAH++IYKVC+   C+ESDILAAMD AI+D
Sbjct  220   TAAGNFVPGANIFGNANGXNANGTAAGVAPLAHVAIYKVCSYIYCSESDILAAMDMAIED  279

Query  1639  gvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVG  1460
             GVDVLSLSLGG + +F+ED IA+GAF+AMEKGIFVSCAAGN GP  ++ SNEAPW+LTVG
Sbjct  280   GVDVLSLSLGGVAYNFYEDVIAVGAFSAMEKGIFVSCAAGNSGPFSFSTSNEAPWILTVG  339

Query  1459  ASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDED--AALCGPGSLdk  1286
             ASTIDR IKATAVLGN  + DGESAFQ  +FPPTLLPL+YPGS D D  A  C P SL+ 
Sbjct  340   ASTIDRKIKATAVLGNNEEYDGESAFQPSDFPPTLLPLVYPGSNDSDIWAKYCYPTSLNN  399

Query  1285  vdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYN  1106
              +V GK+VLC+ G   +RV KG+ VK AGGAAMI++N +    T LA+ HVLPAT +SY 
Sbjct  400   TNVTGKIVLCEVGI-TSRVSKGEAVKAAGGAAMIIMNTESLANTTLAEAHVLPATHVSYA  458

Query  1105  DGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVN  926
             DGLK+K+YINST  PTATIVF GT IG   AP VA FSSRGPS ASPGILKPDI+GPGVN
Sbjct  459   DGLKIKEYINSTLVPTATIVFNGTIIGDDRAPVVAGFSSRGPSYASPGILKPDIIGPGVN  518

Query  925   ILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTA  746
             ILAAW V    N     + FN+ISGTSM+ PHLSG+A LLKS HPDWSPAAIKSAI+TTA
Sbjct  519   ILAAWRVSLENNTNTN-SMFNMISGTSMSCPHLSGVAALLKSVHPDWSPAAIKSAIMTTA  577

Query  745   DQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQE  566
             D  NL    I DE  +PA VFATG GHVNPS+A+DPGLIYD++  DY+ YLCGLNYT+++
Sbjct  578   DVLNLGLNFIEDETYLPAGVFATGAGHVNPSKANDPGLIYDIEPADYVSYLCGLNYTNRQ  637

Query  565   IQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSL--TYSRTVTNVGEANSMYTVKVSP  392
             +   +QRKV CS++TSI E QLNYPSF+I L   S   TYSR VTNVG+ANS Y+V++  
Sbjct  638   VGIFLQRKVNCSEITSILEGQLNYPSFSIKLSADSAAQTYSRNVTNVGQANSTYSVEIDS  697

Query  391   FLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAII  212
               GVDV V P TL F+EVNQ+L+Y ++F+P  +     + QG++ W+S +HIV+SPI++ 
Sbjct  698   PPGVDVKVEPITLAFSEVNQKLSYQVTFTPLPSNPSFGYYQGSLKWISDKHIVRSPISVR  757

Query  211   F  209
             F
Sbjct  758   F  758



>ref|XP_009362845.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=754

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/757 (58%), Positives = 557/757 (74%), Gaps = 21/757 (3%)
 Frame = -1

Query  2431  MKGTPNMAYISVVVCLTLVFH---SVASAKYEDTYIVHVSPPAAA--INGVSEDYRSYFR  2267
             M+       + +V  L L+F    SVA+A    TY+V V  P      +   +D  S+++
Sbjct  1     MENRKCQVLLQIVCLLGLIFLFCLSVAAAADTQTYVVWVKKPVQGELFSKSHQDLESWYQ  60

Query  2266  SFVSES---GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYT  2096
             +F+ E+    +E  + R+VH+YR+VA+GFAAKL+ E V  M  K+GF+SAR +R+  L+T
Sbjct  61    TFLPETVADSNEVTKPRMVHTYRNVATGFAAKLTAEEVRAMENKEGFVSARPERILPLHT  120

Query  2095  THSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE  1916
             THSPNFLGL Q  G W+ ++YG GVI+GVLDTGI P+HPSF+DE +PPPPAKWKGKC+F 
Sbjct  121   THSPNFLGLQQGLGAWKGANYGAGVIIGVLDTGIGPDHPSFSDEGVPPPPAKWKGKCDFN  180

Query  1915  GTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGM  1736
             G  CNNKLIGARNF S G S   PPVD+EGHGTHT+STAAGNFV  A  FG A GTAVGM
Sbjct  181   GPVCNNKLIGARNFQS-GQSTGGPPVDDEGHGTHTSSTAAGNFVKGANAFGMANGTAVGM  239

Query  1735  APLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAA  1556
             AP AH+++YKVC E GC+++DILAAMD A++DGVDVLSLSLGG S  F++D+IAIGAF A
Sbjct  240   APYAHVAMYKVCGEAGCSDADILAAMDTAVEDGVDVLSLSLGGASFPFYDDAIAIGAFTA  299

Query  1555  MEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQV  1376
             ++KGIFVSCAAGN GPDY +LSNEAPW+LTVGASTIDR+I+ATA+LGN  + DG S  Q 
Sbjct  300   IQKGIFVSCAAGNSGPDYESLSNEAPWILTVGASTIDRSIRATALLGNHGEFDGVSLNQP  359

Query  1375  ENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAG  1199
             ++F  TLLPL+YPG+  D+  +LC PGSL  V+ K  +   +RG    RV KG+ VK AG
Sbjct  360   KDFNSTLLPLVYPGANGDQSLSLCAPGSLGNVEGKIVLCEGERG----RVAKGEEVKRAG  415

Query  1198  GAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTK  1019
             GAAMIL N +  GYT+LAD HVLPAT +SY  GL +K YINST+ P ATI+FKGT IG  
Sbjct  416   GAAMILANLEDGGYTVLADAHVLPATHVSYAAGLMIKAYINSTTTPQATILFKGTVIGDP  475

Query  1018  TAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngng-NATFNIISGTSM  842
              AP VA FSSRGPS ASPGILKPDI+GPGV+ILAAWPV  +        ATFN++SGTSM
Sbjct  476   LAPQVAFFSSRGPSIASPGILKPDIIGPGVSILAAWPVSVDNATLPNPKATFNMVSGTSM  535

Query  841   ATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHV  662
             + PHLSGIA LLKS+HPDWSPAAIKSAI+TTA+  NL G  I+DE L PAD+FATG GHV
Sbjct  536   SCPHLSGIAALLKSSHPDWSPAAIKSAIMTTAEVNNLGGQPIVDETLKPADIFATGAGHV  595

Query  661   NPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFA  482
             NPS A DPGLIYD+   +YIPY+CGLNYT+++IQ + Q+ V CS+V +IPEAQLNYPSF+
Sbjct  596   NPSNAIDPGLIYDINPAEYIPYMCGLNYTNEQIQVVTQQTVNCSEVGTIPEAQLNYPSFS  655

Query  481   IWLGKT----SLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNI  314
             I +G +    S  Y+RTV NVG A+S Y + ++    + + V P+ L FTEVNQ++T+++
Sbjct  656   IIIGSSDESKSQDYTRTVKNVGPASSTYKLDLNVPHKMGMSVNPEVLTFTEVNQEITFSV  715

Query  313   SF--SPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              F     +    + F +G + W+S +H V SPI++IF
Sbjct  716   EFIAEDGAGKDGVLFDRGYLRWISDKHSVTSPISVIF  752



>ref|XP_011071248.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=741

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/740 (60%), Positives = 554/740 (75%), Gaps = 12/740 (2%)
 Frame = -1

Query  2416  NMAYISVVVCLTLVFHSV-ASAKYEDTYIVHVSPPAA-AINGVSEDYRSYFRSFVSES-G  2246
              M  +S++  L L    V A+    +TYIVHV  P +  ++  S+D  S++ SF+  +  
Sbjct  3     QMPILSLICALILQLSLVIANDVSLETYIVHVDLPGSPMLSDQSQDLESWYESFLPTTIA  62

Query  2245  DEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLY  2066
                E  R+V+SYR+V  GFAAKL+ E V  M KKKGFISAR Q+V  L+TTH+PNFLGL+
Sbjct  63    SSIETPRMVYSYRNVFPGFAAKLTSEEVKVMEKKKGFISARPQQVLPLHTTHTPNFLGLH  122

Query  2065  QNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLI  1889
             QN GFWR+S+YGKG+I+GVLDTGI P+HPSF+DE MP PPAKWKG CEF  T ACNNKLI
Sbjct  123   QNMGFWRDSNYGKGIIIGVLDTGILPDHPSFSDEGMPSPPAKWKGTCEFGFTGACNNKLI  182

Query  1888  GARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIY  1709
             GAR+F +        P+D +GHGTHTA+TAAGNFV  A +FG A GTAVG+APLAHL++Y
Sbjct  183   GARHFRN----GDGTPLDFDGHGTHTAATAAGNFVRGANLFGMANGTAVGVAPLAHLAMY  238

Query  1708  KVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSC  1529
             KVC+   C+ESDILAAMD AI+DGVDVLS+SLGG S  F +D+IA+GAF+AME+GIFVSC
Sbjct  239   KVCSPS-CSESDILAAMDTAIEDGVDVLSISLGGPSRPFHDDNIALGAFSAMERGIFVSC  297

Query  1528  AAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLP  1349
             +AGN GP Y +LSNEAPW+LTVGASTIDR + ATAVLGN  +L+GESAFQ ++FP   LP
Sbjct  298   SAGNFGPSYTSLSNEAPWILTVGASTIDRKLVATAVLGNKQELNGESAFQPQDFPAEQLP  357

Query  1348  LIYPG--SKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLN  1175
             L+YPG  + D +A  C   SL+   VKGK+VLC+ GG    V +GQ VKDAGGAAMIL++
Sbjct  358   LVYPGLNASDFNAQHCSISSLNDTGVKGKIVLCNIGGWTTSVQQGQAVKDAGGAAMILID  417

Query  1174  QDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASF  995
             ++  G++  AD HVLPAT ++Y DGLK+  YINS+S PTATIVFKGT IG K +P VASF
Sbjct  418   EERQGFSTSADAHVLPATNVNYEDGLKILAYINSSSSPTATIVFKGTVIGDKNSPMVASF  477

Query  994   SSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIA  815
             SSRGPS +SPGILKPDILGPGVNILAAWP     N    N   N+ISGTSM+ PHLSG+A
Sbjct  478   SSRGPSISSPGILKPDILGPGVNILAAWPTSVENNTNTKNNF-NVISGTSMSCPHLSGVA  536

Query  814   TLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPG  635
              L+KSAHPDWSPAAIKSA++TTAD  NL    ILDER +PADV ATG GHVNP+RA+DPG
Sbjct  537   ALIKSAHPDWSPAAIKSAMMTTADTMNLGNRPILDERHLPADVLATGAGHVNPTRANDPG  596

Query  634   LIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLT  455
             LIYD+++ DY  YLCGLNYT +EI  ++QR + CS  + + E QLNYPSF+I  G +  T
Sbjct  597   LIYDIETQDYESYLCGLNYTSREIFIVLQRHLNCSSNSRVHEGQLNYPSFSIRSGSSDQT  656

Query  454   YSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDF  275
             ++RTVTNVG+A+S YTV+V    G++V V+P TL F+E+NQ+LTY I+F  S        
Sbjct  657   FTRTVTNVGDASSSYTVEVVSPRGINVAVSPQTLNFSELNQKLTYEITFRRSENAGTSTV  716

Query  274   VQGAIAWVSQRHIVKSPIAI  215
              QG I W S +H V+SPIA+
Sbjct  717   SQGYIVWQSAKHSVRSPIAV  736



>ref|XP_009599111.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=742

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/740 (58%), Positives = 541/740 (73%), Gaps = 13/740 (2%)
 Frame = -1

Query  2404  ISVVVCLTLVFHSVASAKYEDTYIVHVSPPAAAINGVSE--DYRSYFRSFVSE---SGDE  2240
             I ++ C+   F         +TYIVHV    + I   S   D  S++ SF+ +   S   
Sbjct  6     IFLLFCIVSCFAWPTIQSPLETYIVHVESQESQILTQSSLMDLESWYNSFLPKTITSSSS  65

Query  2239  GERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQN  2060
              E  R+++SYR+V  GFAA+LS E V EM KK GFISA+ QR+ +L+TTH+P+FLGL QN
Sbjct  66    NEEPRLIYSYRNVMKGFAARLSAEHVKEMEKKPGFISAQPQRILSLHTTHTPSFLGLQQN  125

Query  2059  FGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGA  1883
              G W++S+YGKGVI+GVLDTGI P+HPSF+DE MPPPPAKWKGKCE    T CNNK+IGA
Sbjct  126   MGLWKDSNYGKGVIIGVLDTGIFPDHPSFSDEGMPPPPAKWKGKCESNFTTKCNNKIIGA  185

Query  1882  RNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKV  1703
             R+++ +       P+D++GHGTHTASTAAG+FV  A V+G+AKGTAVG+APLAHL+IYKV
Sbjct  186   RSYIQD----DRSPIDDDGHGTHTASTAAGSFVQGANVYGNAKGTAVGVAPLAHLAIYKV  241

Query  1702  CTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAA  1523
             C   GCA+S+ILAAMDAAIDDGVD+LSLSLGG S+    D IA+GA++A E+GI VSC+A
Sbjct  242   CDSSGCADSEILAAMDAAIDDGVDILSLSLGGFSSPLHSDPIALGAYSATERGILVSCSA  301

Query  1522  GNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLI  1343
             GNEGP   + SNEAPW+LTVGAST+DR IKAT  LGN  + +GES F  +    T+ PL 
Sbjct  302   GNEGPYNSSTSNEAPWILTVGASTLDRKIKATVKLGNKKEFEGESTFHPKASSVTVFPLF  361

Query  1342  YPG--SKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQD  1169
              P   + D D+  CG G+L    ++GK+VLC  GGG  R+ KGQ VKDAGG  MI+ N  
Sbjct  362   DPAKNASDFDSPYCGRGTLTDPAIRGKIVLCMAGGGYTRIGKGQAVKDAGGVGMIIYNGL  421

Query  1168  IDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSS  989
               G T LAD HVLPA +++Y DG+K+ DY+NST  P A I F+GT IG + AP VASFSS
Sbjct  422   EYGVTTLADAHVLPALDVTYADGMKILDYMNSTEKPVARITFEGTIIGDRNAPVVASFSS  481

Query  988   RGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATL  809
             RGPS ASPGILKPDI+ PGVN+LAAWP           +TFNIISGTSM+ PHLSG+A L
Sbjct  482   RGPSTASPGILKPDIISPGVNVLAAWPTSVENKTNTK-STFNIISGTSMSCPHLSGVAAL  540

Query  808   LKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLI  629
             LKSAH  WSPAAIKSAI+TTAD  NL    ILDERL+ A++FA G GHVNPSRA+DPGLI
Sbjct  541   LKSAHLTWSPAAIKSAIMTTADTVNLANNPILDERLLTANIFAIGAGHVNPSRANDPGLI  600

Query  628   YDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYS  449
             YD   DDY+PYLCGLNYT++++ +++QRKV CS+V SIPEAQLNYPSF+I LG  S TY+
Sbjct  601   YDTPFDDYLPYLCGLNYTNRQVGKLLQRKVNCSEVKSIPEAQLNYPSFSITLGTNSQTYT  660

Query  448   RTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQ  269
             RTVTNVG+A S Y+V++    GV V V P TL F+E+NQ+LTY ++FS ++   + D V+
Sbjct  661   RTVTNVGDAKSSYSVEIVSPQGVSVMVKPSTLKFSELNQKLTYQVTFSKTANSSNSDVVE  720

Query  268   GAIAWVSQRHIVKSPIAIIF  209
             G + W S RH V+SPIA++ 
Sbjct  721   GFLKWTSNRHSVRSPIAVVL  740



>ref|XP_004300738.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=745

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/748 (58%), Positives = 556/748 (74%), Gaps = 18/748 (2%)
 Frame = -1

Query  2404  ISVVVCLTLVF-----HSVASAKYE----DTYIVHVSPPAAAINGVSEDYRSYFRSFV-S  2255
             ++V+  LTL+F     H +A  K E     TYIVHV  P   +   +ED  S+ +SF+ S
Sbjct  1     MAVIPFLTLIFMLSFSHGIAQ-KTEISPLQTYIVHVMQPEGRVFAATEDLESWHKSFLPS  59

Query  2254  ESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFL  2075
              +    +++R+++SY+ V SGF+A+L+ E V  M    GF++A  +RV+   TTH+PNFL
Sbjct  60    MTASSDDQTRLLYSYKTVISGFSARLTQEEVKVMELMDGFVAAHPERVFRRKTTHTPNFL  119

Query  2074  GLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNK  1895
             GL +  G W++S++GKGVI+GVLD G+ P+HPSF+   +PPPPAKWKG+C+F  + CNNK
Sbjct  120   GLNRQAGIWKDSNFGKGVIIGVLDGGVFPSHPSFSGAGIPPPPAKWKGRCDFNVSECNNK  179

Query  1894  LIGARNF----VSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPL  1727
             LIGA++F    ++   +   PP+DE+GHGTHTASTA G FV NA V G+AKGTAVGMAP 
Sbjct  180   LIGAQSFNLAAMALKGAKAEPPIDEDGHGTHTASTAGGAFVQNADVLGNAKGTAVGMAPY  239

Query  1726  AHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEK  1547
             AHL+IYKVC  + C ESDILAA++AA+ DGVDV+S+SLG  S  FF+DS AIG+FAA++K
Sbjct  240   AHLAIYKVCFGEPCPESDILAALEAAVHDGVDVISISLGEDSVPFFQDSTAIGSFAAIQK  299

Query  1546  GIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENF  1367
             GIFVSCAAGN GP   T+SNEAPW+LTVGAST+DR I A+A LGNG   DGES FQ ++F
Sbjct  300   GIFVSCAAGNSGPFNGTISNEAPWILTVGASTLDRRIVASAALGNGLVFDGESLFQPKDF  359

Query  1366  PPTLLPLIYPGSKDE-DAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAA  1190
             P TLLPL+Y G   + ++A C  GSL  + VKGKVV+C+RGGGI R+DKG  VK+AGGAA
Sbjct  360   PSTLLPLVYAGVIGKVESAFCAEGSLKNISVKGKVVVCERGGGIGRIDKGVEVKNAGGAA  419

Query  1189  MILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAP  1010
             MILLN + DG++  AD HVLPA  +++  GL +K YINST+ PTATI+FKGT IG  T+P
Sbjct  420   MILLNAETDGFSTSADAHVLPAAHVTHAAGLNIKAYINSTATPTATILFKGTVIGDSTSP  479

Query  1009  SVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPH  830
             +VASFSSRGP+ ASPGILKPDI+GPGVN+LAAWP   + N     +TFNIISGTSM+ PH
Sbjct  480   AVASFSSRGPNLASPGILKPDIIGPGVNVLAAWPFPLDNNTKAA-STFNIISGTSMSCPH  538

Query  829   LSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSR  650
             LSGIA LLKS+HP WSPAAIKSAI+T+AD  NL G  I DE L PADV ATG GHVNPS+
Sbjct  539   LSGIAALLKSSHPYWSPAAIKSAIMTSADLINLQGKLIFDETLQPADVLATGAGHVNPSK  598

Query  649   ASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLG  470
             A+DPGL+YD+Q DDYIPYLCGL Y D E+  +  R + CS+V+SIPE +LNYPSF++ LG
Sbjct  599   ATDPGLVYDIQPDDYIPYLCGLGYKDSEVSILAHRPITCSKVSSIPEGELNYPSFSVKLG  658

Query  469   KTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTP  290
               S T++RTVTNVG   S Y+VKV+   GV V V P TL FT++NQ+++Y+++FS  S  
Sbjct  659   P-SQTFTRTVTNVGAPYSTYSVKVNAPQGVYVTVKPSTLYFTKMNQKMSYSVTFSHGSGG  717

Query  289   VDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
                 F QG I W S +HIV+SP++++ Q
Sbjct  718   KAGSFTQGFITWASAKHIVRSPVSVLLQ  745



>ref|XP_008381953.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=852

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/728 (60%), Positives = 540/728 (74%), Gaps = 16/728 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAI--NGVSEDYRSYFRSFVS---ESGDEGERSRIVHSYRHVASGFAAKL  2177
             TYIV V+ P      +   +D  S++ +F+     S ++    R+VH YR+VA+GFAAKL
Sbjct  127   TYIVWVNQPVQKFLFSKSHQDLESWYHTFLPTTISSSNKMVNPRMVHVYRNVATGFAAKL  186

Query  2176  SPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTG  1997
             +PE V  M KK+GF+SA  +R+  L+TTHSPNFLGL Q  G W+ ++YGKGVI+GVLDTG
Sbjct  187   TPEEVKAMEKKEGFVSAHPERILPLHTTHSPNFLGLNQGLGVWKGANYGKGVIIGVLDTG  246

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGT  1817
             ITP+HPSF+DE MPPPPAKWKGKC+F GT CNNKLIGARNF   G S   PPVD+EGHGT
Sbjct  247   ITPDHPSFSDEGMPPPPAKWKGKCDFNGTVCNNKLIGARNF-QGGKSTGAPPVDDEGHGT  305

Query  1816  HTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddg  1637
             HT+STA GNFV   +VFG A GTA GMAP AH+++YKVC E+GC+ES+ILAAMD A++DG
Sbjct  306   HTSSTAGGNFVKGVSVFGQAYGTASGMAPYAHVAMYKVCGEEGCSESNILAAMDTAVEDG  365

Query  1636  vdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGA  1457
             VDVLSLSLGG S  F+ D IAIGAF A++KGIFVSC+AGN GP Y +LSNEAPW+LTVGA
Sbjct  366   VDVLSLSLGGPSFPFYADGIAIGAFGAIQKGIFVSCSAGNSGPFYGSLSNEAPWILTVGA  425

Query  1456  STIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvd  1280
             STIDR+I+A A LGNG + DGES FQ ++F   LLP++Y G+   E +  C  GSL+ V+
Sbjct  426   STIDRSIRAVAKLGNGGEYDGESLFQPKDFGSELLPMVYAGANGKESSRFCSSGSLENVE  485

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
                   +C+RGGGI R+DKG  VK AGGAAMIL+N   DG + LAD HVLPAT + Y  G
Sbjct  486   GAIV--VCERGGGIGRIDKGAEVKRAGGAAMILVNAVTDGDSTLADPHVLPATHVGYAAG  543

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
             +++K Y+NSTS P ATI+FKGT IG K AP + SFSSRGP+  SPGILKPDI+GPGV+IL
Sbjct  544   VRIKXYLNSTSSPAATILFKGTIIGDKLAPKITSFSSRGPNMESPGILKPDIVGPGVSIL  603

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAWPV  +    +  ATFN+ISGTSM+ PHLSGIA LLKS+HPDWSPAAIKSAI+TTA  
Sbjct  604   AAWPVSVDNATDSN-ATFNMISGTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIMTTAGV  662

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              NL G  I+DE L PAD+FATG GHVNP +A+DPGLIYD +  DYIPYLCGLNYT+++IQ
Sbjct  663   NNLGGKPIVDETLKPADIFATGAGHVNPYKANDPGLIYDTKPADYIPYLCGLNYTNEQIQ  722

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLGKT----SLTYSRTVTNVGEANSMYTVKVSP  392
              I Q+ V CS+V +IPEAQLNYPSF+I +G +    S  Y+RTV NVG ANS Y + ++ 
Sbjct  723   VITQQTVNCSEVENIPEAQLNYPSFSIIVGSSDESKSQYYTRTVKNVGLANSTYKLDLNV  782

Query  391   FLGVDVGVTPDTLVFTEVNQQLTYNISF--SPSSTPVDIDFVQGAIAWVSQRHIVKSPIA  218
                + + V P+ L FT VNQ++T+ + F     +    + F QG + WVS +H V SPI+
Sbjct  783   PXQMGMSVNPEVLTFTXVNQEITFYVEFLAEDGAGKDGVPFAQGYLRWVSDKHSVSSPIS  842

Query  217   IIFQ*GLN  194
             +IF  G N
Sbjct  843   VIFDTGSN  850



>ref|XP_011033844.1| PREDICTED: subtilisin-like protease SDD1 [Populus euphratica]
Length=766

 Score =   798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/722 (61%), Positives = 550/722 (76%), Gaps = 13/722 (2%)
 Frame = -1

Query  2338  YIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERS-RIVHSYRHVASGFAAKLSPEMV  2162
             YIVHV+ P        ED  S+++SF+  S    E+  R++++Y++V SGFAA+L+ E V
Sbjct  47    YIVHVAKPEGRTLAEFEDLESWYQSFLPVSTASSEKQQRMLYAYQNVMSGFAARLTQEEV  106

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
               M +K GF+SAR +R+ +L TTH+P FLGL+Q  GFW+ S++GKGVIVGVLD GI P+H
Sbjct  107   KSMEEKDGFLSARPERILHLQTTHTPRFLGLHQELGFWKESNFGKGVIVGVLDGGIFPSH  166

Query  1981  PSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNF-----VSEGssppppPVDEEGHGT  1817
             PSFNDE MPPPPAKWKG+C+F  + CNNKLIGAR+F       +GS+   PP+D +GHGT
Sbjct  167   PSFNDEGMPPPPAKWKGRCDFNASDCNNKLIGARSFNIAAKAKKGSAATEPPIDVDGHGT  226

Query  1816  HTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVC---TEDGCAESdilaamdaai  1646
             HTASTAAG FV +A V G+A+GTAVG+AP AHL+IYKVC     D C ESDILA +DAA+
Sbjct  227   HTASTAAGAFVKDAEVLGNARGTAVGIAPHAHLAIYKVCFGDPGDDCPESDILAGLDAAV  286

Query  1645  ddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLT  1466
              DGVDVLSLSLGG S  FF D+IAIG+FAA++KGIFVSC+AGN GP   TLSNEAPW+LT
Sbjct  287   QDGVDVLSLSLGGDSVPFFNDTIAIGSFAAIQKGIFVSCSAGNSGPFTGTLSNEAPWILT  346

Query  1465  VGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG-SKDEDAALCGPGSLd  1289
             VGAST+DR I A A LGNG Q+DGES  Q  NFP TLLPL+Y G S   +++LCG G+L+
Sbjct  347   VGASTVDRRIAAIARLGNGEQIDGESLSQHSNFPSTLLPLVYAGMSGKPNSSLCGEGALE  406

Query  1288  kvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSY  1109
              +DV+GK+VLC+RGGGI R+ KG  VK+AGGAAMIL+N++ DG++  AD HVLPAT +S+
Sbjct  407   GMDVRGKIVLCERGGGIGRIAKGGEVKNAGGAAMILMNEEADGFSTNADVHVLPATHVSF  466

Query  1108  NDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGV  929
               GLK+K YINST  P ATI+FKGT IG  ++P VASFSSRGPS ASPGILKPDI+GPGV
Sbjct  467   AKGLKIKAYINSTQAPMATILFKGTAIGDPSSPFVASFSSRGPSLASPGILKPDIIGPGV  526

Query  928   NILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITT  749
             +ILAAWP   + N  +  +TFNIISGTSM+ PHLSGIA LLKS+HP WSPAAIKSAI+TT
Sbjct  527   SILAAWPFPLDNNTNSK-STFNIISGTSMSCPHLSGIAALLKSSHPYWSPAAIKSAIMTT  585

Query  748   ADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQ  569
             AD  N+ G  I+D+ L PAD+FATG GHVNPSRA++PGL+YD+Q D+YIPYLCGL Y D 
Sbjct  586   ADTLNMEGKLIVDQTLQPADIFATGAGHVNPSRANNPGLVYDIQPDNYIPYLCGLGYADN  645

Query  568   EIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPF  389
             E+  IV  +V+CS+  SIPE +LNYPSFA+ LG  S T++RTVTNVG+ NS Y V +   
Sbjct  646   EVSIIVHEQVKCSEKPSIPEGELNYPSFAVTLGP-SQTFTRTVTNVGDVNSAYEVAIFSP  704

Query  388   LGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDI-DFVQGAIAWVSQRHIVKSPIAII  212
              GVDV V P  L F++VN++ TY+++FS +       +  QG I W S ++IV+SPIA+ 
Sbjct  705   PGVDVTVKPSKLYFSKVNRKATYSVAFSRTEYGGKTSEIAQGHIVWASSKYIVRSPIAVS  764

Query  211   FQ  206
             F+
Sbjct  765   FK  766



>ref|XP_008381935.1| PREDICTED: subtilisin-like protease SDD1 [Malus domestica]
Length=752

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/753 (58%), Positives = 550/753 (73%), Gaps = 21/753 (3%)
 Frame = -1

Query  2413  MAYISVVVCLTLVFHSVASAKYE-----------DTYIVHVSPPAAAINGVSEDYRSYFR  2267
             M +++++  L+  +  V + K E            TYIVHV  P   +   +ED +S+  
Sbjct  4     MPFLTLIFILSFCY--VTAQKKELSPATTKTSNLQTYIVHVRQPEGRVFAQTEDLKSWHE  61

Query  2266  SFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTH  2090
             SF+   +    E  R+++SY+ V SGFAA+L+ + V  M++   F++A  QRV+   TTH
Sbjct  62    SFLPXTTASADEPPRLLYSYQXVISGFAARLTQDEVKAMQEMDXFVAAYPQRVFRRKTTH  121

Query  2089  SPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGT  1910
             +P FLGL+Q  G W++S++GKGVI+GVLD GI PNHPSF+   +PPPPAKWKG+C+F  +
Sbjct  122   TPYFLGLHQQTGIWKDSNFGKGVIIGVLDGGIEPNHPSFSGAGIPPPPAKWKGRCDFNXS  181

Query  1909  ACNNKLIGARNFVSEGsspp----ppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAV  1742
              CNNKLIGAR F     +        P+D +GHGTHTASTAAG FV NA V G+AKGTAV
Sbjct  182   DCNNKLIGARAFNLAAKALKGEKPEAPIDIDGHGTHTASTAAGAFVQNADVLGNAKGTAV  241

Query  1741  GMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAF  1562
             G+AP AHL+IYKVC  D C ++DILAA++AA+ DGVDV+S+SLG  S  FF+D+ AIG+F
Sbjct  242   GIAPHAHLAIYKVCFGDPCPDADILAALEAAVQDGVDVISISLGEASVPFFQDTTAIGSF  301

Query  1561  AAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAF  1382
             AA++KGIFVSCAAGN GP   TLSNEAPW+LTVGASTIDR + ATA LGNG   DGES F
Sbjct  302   AAIQKGIFVSCAAGNSGPFNGTLSNEAPWMLTVGASTIDRXVVATAKLGNGQVFDGESLF  361

Query  1381  QVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDA  1202
             Q  +FP TL+PLIY G    D+ALC  GSL  + VKGKVV+C+RGGGI R+ KG+ VK+A
Sbjct  362   QPSDFPSTLMPLIYAGVNGNDSALCAEGSLKGLPVKGKVVVCERGGGIGRIAKGEEVKNA  421

Query  1201  GGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGT  1022
             GGAAMILLN++ DG +  AD HVLPAT +SY  GLK+K YINST  PTATI+FKGT IG 
Sbjct  422   GGAAMILLNEETDGVSXSADVHVLPATHVSYAAGLKIKAYINSTXTPTATILFKGTVIGD  481

Query  1021  KTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSM  842
              + P VASFSSRGPS ASPGILKPDI+GPGV+ILAAWP   +    +    FNI+SGTSM
Sbjct  482   SSTPVVASFSSRGPSLASPGILKPDIIGPGVSILAAWPFPVDNTTKSKI-NFNIMSGTSM  540

Query  841   ATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHV  662
             + PHLSGIA LLKS+HP WSPAAIKSAI+T+AD  NL G  ILDE+L PADV ATG G V
Sbjct  541   SCPHLSGIAALLKSSHPYWSPAAIKSAIMTSADLLNLEGKPILDEQLQPADVLATGAGQV  600

Query  661   NPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFA  482
             NPS+A+DPGLIYD+Q DDYIPYLCGL Y D EI  IV R+++CS V+SIPE +LNYPSF+
Sbjct  601   NPSKANDPGLIYDIQPDDYIPYLCGLGYKDDEISIIVHRQIKCSMVSSIPEGELNYPSFS  660

Query  481   IWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSP  302
             + LG  S T++RT+TNVGEA S Y VKV+   GV V V P TL FT+VNQ+++Y+++FS 
Sbjct  661   VTLGP-SZTFTRTLTNVGEAYSSYAVKVNAPEGVHVSVKPKTLNFTKVNQKMSYSVTFSH  719

Query  301   SSTPVDI-DFVQGAIAWVSQRHIVKSPIAIIFQ  206
               +  +  +F  G + WVS +++V+SP+++  Q
Sbjct  720   IGSKGEAGEFTXGFLTWVSAKYVVRSPVSVKLQ  752



>gb|KCW77656.1| hypothetical protein EUGRSUZ_D01954 [Eucalyptus grandis]
Length=679

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/679 (63%), Positives = 524/679 (77%), Gaps = 8/679 (1%)
 Frame = -1

Query  2236  ERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNF  2057
             + +R+VHSY++  +GFAAK++ + V E+ K    +S +++++++L+TTHSP+FL L    
Sbjct  7     QTNRMVHSYKNSITGFAAKMTEDEVKELLKLDAVVSVKQEKIFSLHTTHSPSFLNLNPGV  66

Query  2056  GFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARN  1877
             G W++S+ GKGVI+GVLDTGITP+HPSF+DE M  PPAKWKGKC F  T+CNNKLIGARN
Sbjct  67    GLWKDSTLGKGVIIGVLDTGITPDHPSFDDEGMSSPPAKWKGKCNFNATSCNNKLIGARN  126

Query  1876  FVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCT  1697
             FV+       PP DE+GHGTHT+STAAGNFV NA V G A GTA+GMAP AHL++Y+VC+
Sbjct  127   FVNS----TLPPTDEDGHGTHTSSTAAGNFVKNANVLGQALGTAIGMAPHAHLAMYQVCS  182

Query  1696  EDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGN  1517
             + GC ES ILA MDAAI+DGVDVLSLSLGGGSA F+ DS A+GAF+A+ KGIFVSC+AGN
Sbjct  183   DVGCPESSILAGMDAAIEDGVDVLSLSLGGGSAPFYADSTAVGAFSAIRKGIFVSCSAGN  242

Query  1516  EGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYP  1337
              GP   +LSN+APW+LTVGASTIDRTIKATA LGNGA+ DGES FQ ++F      L+Y 
Sbjct  243   SGPINTSLSNDAPWILTVGASTIDRTIKATAKLGNGAEYDGESLFQPKDFG-LAYSLVYA  301

Query  1336  GSK-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDG  1160
             G+  ++ +A+C  GSL  +DVKGKVVLC+RGGGIAR+ KGQ VKDAGGAAMIL+N +++G
Sbjct  302   GANGNQTSAICAEGSLRNLDVKGKVVLCERGGGIARIAKGQEVKDAGGAAMILMNDELNG  361

Query  1159  YTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGP  980
             Y+ LAD HVLPAT + Y DGLK+K YINSTS PTATI+FKGT I    AP+V SFSSRGP
Sbjct  362   YSTLADAHVLPATHIPYADGLKIKAYINSTSDPTATILFKGTIIRNSDAPAVTSFSSRGP  421

Query  979   SNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKS  800
             S  SPGILKPDI+GPGV+ILAAWP   + ++     TFNIISGTSM+ PHLSGIA LLKS
Sbjct  422   SLESPGILKPDIIGPGVSILAAWPFSLDNSSTTE-VTFNIISGTSMSCPHLSGIAALLKS  480

Query  799   AHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDL  620
             +HPDWSPAAIKSAI+TTA Q NL    I+DE L+PAD+FATG GHVNP +A DPGLIYD+
Sbjct  481   SHPDWSPAAIKSAIMTTAYQMNLGSKPIIDETLLPADIFATGAGHVNPPKADDPGLIYDI  540

Query  619   QSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTV  440
             + DDYIPYLCGL Y D EI+ I Q K +CSQ+ SIPEAQLNYPSF+I LG ++  YSRTV
Sbjct  541   KPDDYIPYLCGLGYKDSEIETITQEKAKCSQIKSIPEAQLNYPSFSIILGSSAQNYSRTV  600

Query  439   TNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSS-TPVDIDFVQGA  263
             TNV   +S YT KV    GVDV V P  + F+   Q  TY + F  SS   V   F QG+
Sbjct  601   TNVEPTHSSYTYKVDAPEGVDVTVYPSEIKFSVAVQIATYTVGFRRSSGGSVTKPFAQGS  660

Query  262   IAWVSQRHIVKSPIAIIFQ  206
             + WVS  H V+SPIA++FQ
Sbjct  661   LTWVSSDHSVRSPIAVVFQ  679



>ref|XP_009767058.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=744

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/747 (58%), Positives = 542/747 (73%), Gaps = 16/747 (2%)
 Frame = -1

Query  2416  NMAYISVVVCLTLVFHSVASAKYEDTYIVHVSPPAAAINGVS---EDYRSYFRSFV----  2258
             N   I  + C+   F         +TYIV V  P + I+  S   +D  S++RSF+    
Sbjct  2     NFLKIFFLFCMVSCFPWPTIQSPFETYIVQVESPESQISTQSLSDQDLESWYRSFLPNTI  61

Query  2257  -SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPN  2081
              S   D+ E  R+V+SYR+V  GFAA+L+ E V EM KK GF+SA  +++ +L+TTH+P+
Sbjct  62    ASTRSDDEEGPRLVYSYRNVMKGFAARLTAEQVKEMEKKPGFMSAWPEKILSLHTTHTPS  121

Query  2080  FLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTAC  1904
             FLGL QN G W++S+YGKGVI+GVLDTGI+P+HPSF+DE MPPPPAKWKGKCE    T C
Sbjct  122   FLGLQQNMGLWKDSNYGKGVIIGVLDTGISPDHPSFSDEGMPPPPAKWKGKCESNFTTKC  181

Query  1903  NNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLA  1724
             NNKLIGAR+++ E       P+D++GHGTHTASTAAG FV  A V+G+AKGTAVG+APLA
Sbjct  182   NNKLIGARSYIQE----DRSPIDDDGHGTHTASTAAGGFVQGANVYGNAKGTAVGVAPLA  237

Query  1723  HLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKG  1544
             HL+IYKVC   GCA+ +ILAAMDAAIDDGVD+LSLSLGG  +    D IA+GA++A E+G
Sbjct  238   HLAIYKVCDSSGCADGEILAAMDAAIDDGVDILSLSLGGSGSPLHSDPIALGAYSATERG  297

Query  1543  IFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFP  1364
             I VSC+AGNEGP   + SNEAPW+LTVGAST+DR IKAT  LGN  + +GES F  ++F 
Sbjct  298   ILVSCSAGNEGPYNSSTSNEAPWILTVGASTLDRKIKATVKLGNKKEFEGESTFHPKSFN  357

Query  1363  PTLLPLIYPG--SKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAA  1190
              T  PL  P   + D D+  CG G+L    ++GK+VLC  GGG  R+ KGQ VKDAGG  
Sbjct  358   VTFFPLFDPAKNASDFDSPYCGTGTLTDPAIRGKIVLCMAGGGYTRIGKGQAVKDAGGVG  417

Query  1189  MILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAP  1010
             MI+ N    G+T LAD HVLPA +++  DG+K+ DY+NST  P A I F+GT IG + AP
Sbjct  418   MIIYNGPEYGFTTLADAHVLPALDVTDADGMKILDYMNSTEKPVARITFQGTIIGDRNAP  477

Query  1009  SVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPH  830
              VASFSSRGPS ASPGILKPDI+GPGVNILAAWP     N     +TFNIISGTSM+ PH
Sbjct  478   MVASFSSRGPSMASPGILKPDIIGPGVNILAAWPASVENNTNLK-STFNIISGTSMSCPH  536

Query  829   LSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSR  650
             LSG+A LLKSAHP WSPAAIKSAI+TTAD  NL    ILDERL+ A++FA G GHVNPSR
Sbjct  537   LSGVAALLKSAHPTWSPAAIKSAIMTTADTLNLANNPILDERLLTANIFAVGSGHVNPSR  596

Query  649   ASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLG  470
             A+DPGLIYD   DDY+PYLCGLNYT++++  ++QRKV CS+V SI EAQLNYPSF+I LG
Sbjct  597   ANDPGLIYDTPFDDYLPYLCGLNYTNRQVGNLLQRKVNCSEVKSILEAQLNYPSFSITLG  656

Query  469   KTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTP  290
               + TY+RTVTNVG+A S Y+V++    GV V V P TL F+++NQ+LTY + FS  +  
Sbjct  657   TNTQTYTRTVTNVGDAKSSYSVEIISPRGVSVMVKPSTLKFSKLNQKLTYQVIFSKITNN  716

Query  289   VDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              + D V+G + W S RH V+SPIA++ 
Sbjct  717   SNSDVVEGFLKWTSNRHSVRSPIAVVL  743



>emb|CDP11959.1| unnamed protein product [Coffea canephora]
Length=747

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/746 (58%), Positives = 553/746 (74%), Gaps = 18/746 (2%)
 Frame = -1

Query  2413  MAYISVVVCL------TLVFHSVASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFVSE  2252
             +  IS + CL        +   V      +TYIV + P    +   SED  S+ RSF+  
Sbjct  3     LMVISTLFCLFSCCVLATIAREVPQKSNLETYIVRLEPRDGPVTE-SEDLESWHRSFLPA  61

Query  2251  SGDEGE-RSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFL  2075
             + +     SR+V+SYR+V  GFAAKLSPE V EM+KKKGFISAR     +L+TTHSP+FL
Sbjct  62    TIESTNYDSRMVYSYRNVMQGFAAKLSPEEVKEMQKKKGFISARPPERLSLHTTHSPSFL  121

Query  2074  GLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNN  1898
             GL QN GFW++S+YGKGVI+G+LD+GITP+HPSF+D+ + PPPAKWKGKCE    + CNN
Sbjct  122   GLQQNVGFWKDSNYGKGVIIGILDSGITPDHPSFSDDGILPPPAKWKGKCELRPASLCNN  181

Query  1897  KLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHL  1718
             K+IGA++F+ +         DE GHGTHTASTAAGNFV  A V+G+A GTA G+APLAHL
Sbjct  182   KIIGAQHFIQD--DQNGTSADETGHGTHTASTAAGNFVKGANVYGNANGTAAGVAPLAHL  239

Query  1717  SIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIF  1538
             +IYKVC+   C+ESD+LA +D AI+DGVDV+S+SLGG S  F+++ + +GA++AMEKGIF
Sbjct  240   AIYKVCSTV-CSESDVLAGIDTAIEDGVDVISISLGGTSKPFYDNYVPLGAYSAMEKGIF  298

Query  1537  VSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPT  1358
             VSC+AGNEGPDY+++ N+APW+LTVGAST+DR I+A+A+LGN  +L+GESAFQ +++  T
Sbjct  299   VSCSAGNEGPDYFSVGNDAPWILTVGASTMDRKIRASAMLGNNKKLEGESAFQPKDYAST  358

Query  1357  LLPLIYPGSKDED--AALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMI  1184
             + PL+YPGS   D  AA C P SL+   VKGK VLC+RG  +  V  G+ VK AGGAAMI
Sbjct  359   MFPLVYPGSNKSDPFAAYCFPDSLNNTGVKGKTVLCERG--LPGVTMGELVKAAGGAAMI  416

Query  1183  LLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSV  1004
             ++N +  GYT  AD HVLPA  LSY DG+K+K Y+NST  P A I F GT IG   AP+V
Sbjct  417   IINPEDRGYTTEADAHVLPAAHLSYVDGVKIKAYMNSTKLPKAAIFFNGTAIGDDQAPAV  476

Query  1003  ASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLS  824
             ASFSSRGPS ASPGILKPDI+GPGV+ILAAWPV    N     +TFN +SGTSM+ PHLS
Sbjct  477   ASFSSRGPSEASPGILKPDIVGPGVSILAAWPVSVENNTNTK-STFNFLSGTSMSCPHLS  535

Query  823   GIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDE-RLVPADVFATGGGHVNPSRA  647
             G+A LLKSAHPDWSPAAIKSAI+TTAD  NL    I D+  L+PADVFATG GHVNPSRA
Sbjct  536   GVAALLKSAHPDWSPAAIKSAIMTTADSVNLEKKPIADQLNLLPADVFATGAGHVNPSRA  595

Query  646   SDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGK  467
             ++PGL+YD++  +YIPYLCGLNYT++E+  ++QR V CS  + IP++QLNYPSF+I LG 
Sbjct  596   NNPGLVYDIEPKEYIPYLCGLNYTNREVGMLLQRHVNCSVESRIPDSQLNYPSFSIVLGA  655

Query  466   TSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPV  287
             T+ TY+RTVTNVGEA+S+YTV +    GV V V PDTL F++++++LTY + F   +   
Sbjct  656   TAQTYTRTVTNVGEADSVYTVNIVQPRGVSVNVEPDTLKFSKLHEKLTYEVRFIRLANAP  715

Query  286   DIDFVQGAIAWVSQRHIVKSPIAIIF  209
             ++   QG++ W S ++ V+SPIA+ F
Sbjct  716   NVSASQGSLTWTSDKYSVRSPIAVTF  741



>ref|XP_006358904.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=757

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/739 (58%), Positives = 543/739 (73%), Gaps = 13/739 (2%)
 Frame = -1

Query  2404  ISVVVCLTLVFHSVASAKYE-DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERS  2228
             I V++C+   F + A+ +     YIVH   P   ++   +D  S++ SF+  +  +  R 
Sbjct  11    IIVLICVLFSFTTNATKQNNSQIYIVHCQFPDGEMSTRYQDLESWYLSFLPATTSDSSRE  70

Query  2227  --RIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFG  2054
               R+++SYR+V +GFAAKLSPE + EM K +GF+SAR   + NL+TTHS NF+GL QN G
Sbjct  71    APRLIYSYRNVLTGFAAKLSPEDIKEMEKMEGFVSARPDEILNLHTTHSVNFMGLQQNMG  130

Query  2053  FWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNF  1874
             FW +S+YGKGVI+GV+D GI P+HPSF+D+ MPPPPAKWKGKCEF  T CNNKLIGAR F
Sbjct  131   FWNDSNYGKGVIIGVIDGGIFPDHPSFSDDGMPPPPAKWKGKCEFNVTKCNNKLIGARVF  190

Query  1873  VSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTE  1694
              + G  P     DE+GHGTHTASTAAG FV  A +FG+A GTA G+APL+H+++YK C+ 
Sbjct  191   PNSGIDPW----DEDGHGTHTASTAAGCFVPGANIFGNANGTAAGVAPLSHVAVYKACSA  246

Query  1693  DGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNE  1514
               C+ SDILAAMD AI+DGVD+LS+SLG  S +F+ +S+A+GAF+A +KGIFVSC+ GN 
Sbjct  247   GFCSGSDILAAMDMAIEDGVDILSISLGSLSNAFYRNSVALGAFSATKKGIFVSCSGGNS  306

Query  1513  GPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG  1334
             GP  +++SNEAPW+LTVGASTIDR IKAT VLGN  + DGESA Q  +FPPTLLPL YPG
Sbjct  307   GPYSFSMSNEAPWILTVGASTIDRKIKATVVLGNNQEFDGESALQPHDFPPTLLPLAYPG  366

Query  1333  SK--DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDG  1160
             S   D DA  C P SL+  +V GK+V C+  G I R DKG  VK AGGAAMI +N++   
Sbjct  367   SNASDSDAKYCTPASLNNTNVMGKIVFCE-SGKITRADKGIAVKAAGGAAMIFMNREAMA  425

Query  1159  YTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGP  980
              T LA+ +VLP T + Y DGLK+K+YI+ST  PTATIVFKGT IG   AP VA+FSSRGP
Sbjct  426   NTTLAEAYVLPTTYVGYADGLKIKEYIDSTPTPTATIVFKGTIIGDDRAPVVAAFSSRGP  485

Query  979   SNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKS  800
             S ASPGILKPDI+GPGVNILAAW +  + N     + FN+ISGTSM+ PHLSG+A LLKS
Sbjct  486   SYASPGILKPDIIGPGVNILAAWHISLDNNTNTN-SRFNMISGTSMSCPHLSGVAALLKS  544

Query  799   AHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDL  620
              HPDWSPAAIKSAI+TTAD  NL    I DE  +PA+VFATG GHVNPS+A+DPGLIYD+
Sbjct  545   VHPDWSPAAIKSAIMTTADVLNLRSNLIEDETYLPANVFATGAGHVNPSKANDPGLIYDI  604

Query  619   QSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIW--LGKTSLTYSR  446
                 Y+PYLCGLNYTD ++      KV CS+VTSI + QLNYPSF+I   +  ++  YSR
Sbjct  605   DPAVYLPYLCGLNYTDTQVGFFFPGKVNCSEVTSISDGQLNYPSFSIQVRVNSSAQVYSR  664

Query  445   TVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQG  266
             TV NVG+ANS Y V++    G+DV V P TLVF+EV Q L+Y ++F+P  T  +  F QG
Sbjct  665   TVMNVGQANSTYRVEIDSPPGLDVKVEPTTLVFSEVKQALSYQVTFTPLDTIPNTTFNQG  724

Query  265   AIAWVSQRHIVKSPIAIIF  209
             ++ W+S++HIV+SPIA+I+
Sbjct  725   SLRWISEKHIVRSPIALIY  743



>gb|EYU39033.1| hypothetical protein MIMGU_mgv1a001909mg [Erythranthe guttata]
Length=741

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/728 (60%), Positives = 538/728 (74%), Gaps = 19/728 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFV---SESGDEGERSRIVHSYRHVASGFAAKLS  2174
             + YIVHV  P       SED  S++ SF+   + S +E E SRIV+SYR V  GFAA LS
Sbjct  18    EIYIVHVEGPTEQFTTQSEDLESWYGSFLPTTTTSSNERE-SRIVYSYRTVFKGFAANLS  76

Query  2173  PEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGI  1994
             PE V EM KK GFISAR +    L+TTHSP FLGL +  G+W++S+YG+GVI+G+LDTGI
Sbjct  77    PEEVKEMEKKVGFISARPEIKLPLHTTHSPGFLGLNRETGYWKDSNYGRGVIIGILDTGI  136

Query  1993  TPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppP-----VDEE  1829
              P HPSF+DE MPPPPAKWKG+CEF  TACNNK+IGAR+F S              +D++
Sbjct  137   FPEHPSFSDEGMPPPPAKWKGRCEFNHTACNNKIIGARSFGSTAGGGGGGGGQITPLDDD  196

Query  1828  GHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaa  1649
             GHGTHTASTAAGNFV  A +FG+A GTA G+APLAHL++Y+VC    C+ES+ILA MDAA
Sbjct  197   GHGTHTASTAAGNFVNGANIFGNANGTAAGVAPLAHLAVYRVCVP-FCSESNILAGMDAA  255

Query  1648  iddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLL  1469
             I+DGVDVLS+SLGG + +FF++ IA+GAF+AMEKGIFVSC+AGN GP  +++SNEAPW+L
Sbjct  256   IEDGVDVLSISLGGLTNNFFKNFIALGAFSAMEKGIFVSCSAGNNGPFNFSISNEAPWIL  315

Query  1468  TVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG---SKDEDAALCGPG  1298
             TVGASTIDR ++AT VLGN     GESAFQ +NFPPTLLPL+Y G   + D  A  CG  
Sbjct  316   TVGASTIDRKLRATTVLGNKQLFHGESAFQPDNFPPTLLPLVYAGMLNTSDPFAPFCG-D  374

Query  1297  SLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGG-AAMILLNQDIDGYTILADTHVLPAT  1121
             SL+  DV+GK+V+C+ GGG+ R++KG+ VK AGG AAMIL+N +    T  AD H LPA 
Sbjct  375   SLNASDVRGKIVVCELGGGLTRIEKGEAVKSAGGTAAMILVNNERYANTTSADAHALPAA  434

Query  1120  ELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDIL  941
             ++ Y DGLK+K YINSTS P A+I+F+GT IG   AP VA+FSSRGP+ AS GILKPDIL
Sbjct  435   DVGYADGLKIKAYINSTSSPKASILFEGTAIGDSNAPVVAAFSSRGPNFASRGILKPDIL  494

Query  940   GPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSA  761
             GPGVNILAAWP           ATFN++SGTSM+ PHLSG+A LLKS+HPDWSPAAIKSA
Sbjct  495   GPGVNILAAWPTSVENRTDTK-ATFNMVSGTSMSCPHLSGVAALLKSSHPDWSPAAIKSA  553

Query  760   IITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLN  581
             I+TTAD  NL    I DER V A +FATG GHVNPSRA+DPGL+YD+Q +DYIPYLCGLN
Sbjct  554   IMTTADVVNLAHNPIEDERFVQAGIFATGSGHVNPSRANDPGLVYDIQPEDYIPYLCGLN  613

Query  580   YTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTS---LTYSRTVTNVGEANSMY  410
             YTD+E+   +QR+V CS  +SIPEAQLNYPSFA+    T      Y+RTVTNVGE  S Y
Sbjct  614   YTDREVGFFLQRRVNCSVESSIPEAQLNYPSFALTFTSTKSNIQVYTRTVTNVGEPKSSY  673

Query  409   TVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVK  230
              V++ P  G+DV V P TL F+EVN+++ Y ++F   S+  +   VQG + W S +H V+
Sbjct  674   NVEIVPPPGIDVRVAPTTLDFSEVNRKMQYEVTFERLSSAENNTIVQGFLKWTSLKHSVR  733

Query  229   SPIAIIFQ  206
             SPIA+I  
Sbjct  734   SPIAVILN  741



>ref|XP_004147596.1| PREDICTED: subtilisin-like protease SDD1-like [Cucumis sativus]
 ref|XP_004164315.1| PREDICTED: subtilisin-like protease SDD1-like [Cucumis sativus]
 gb|KGN50165.1| hypothetical protein Csa_5G157240 [Cucumis sativus]
Length=745

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/725 (59%), Positives = 536/725 (74%), Gaps = 26/725 (4%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERS-RIVHSYRHVASGFAAKLSPEM  2165
             TYIVHV  P      V +D  S+ RSF+  S +  E    +++SYR+V SGF+A+L+ E 
Sbjct  32    TYIVHVKKPE-----VVDDLESWHRSFLPTSLENSEEQPTLLYSYRNVMSGFSARLTEEH  86

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             V  M +K GF+SARR+ + +L+TTHSPNFLGL + FGFW++S++GKGVI+GVLD GITP+
Sbjct  87    VKAMEEKDGFVSARRETIVHLHTTHSPNFLGLNRQFGFWKDSNFGKGVIIGVLDGGITPS  146

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGAR--NFVSEGssppppP-----VDEEG  1826
             HPSF D  MP PPAKWKG+CEF  +ACNNKLIGAR  N  S+             +DE+G
Sbjct  147   HPSFVDAGMPQPPAKWKGRCEFNFSACNNKLIGARSLNLASQALKGKITTLDDSPIDEDG  206

Query  1825  HGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaai  1646
             HGTHTASTAAG FV  A   G+A GTAVGMAPLAHL+IYKVC  + C+  DILA +DAA+
Sbjct  207   HGTHTASTAAGTFVDGAEALGNAFGTAVGMAPLAHLAIYKVCFGESCSNVDILAGLDAAV  266

Query  1645  ddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLT  1466
             +DGVDVLS+SLGG    FF D  AIGAFAA++KGIFVSC+A N GP   TLSNEAPW+LT
Sbjct  267   EDGVDVLSISLGGPPVPFFADITAIGAFAAIQKGIFVSCSAANSGPFNATLSNEAPWILT  326

Query  1465  VGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdk  1286
             V ASTIDR I ATA LGNG + DGES FQ  +FP T LPL++PG K+E  ALC  GSL  
Sbjct  327   VAASTIDRKITATAKLGNGEEFDGESLFQPNDFPQTFLPLVFPGEKNETVALCAEGSLKN  386

Query  1285  vdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYN  1106
             +DVKGKVV+CDRGGGIAR+ KG  VK+AGGAAMILLN + DG+T  AD HVLPA+ +S+ 
Sbjct  387   IDVKGKVVVCDRGGGIARIAKGVEVKNAGGAAMILLNAESDGFTTEADAHVLPASHVSHT  446

Query  1105  DGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVN  926
               LK+K YINST++PTATIVFKGT IG   +P++A+FSSRGPS ASPGILKPDI GPGV+
Sbjct  447   AALKIKAYINSTTYPTATIVFKGTTIGDDFSPAIAAFSSRGPSLASPGILKPDITGPGVS  506

Query  925   ILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTA  746
             ILAAWP     NN N  +TFNI+SGTSM+ PHLSGIA L+KSAHPDWSPAAIKS+I+TTA
Sbjct  507   ILAAWPF-PLDNNTNTKSTFNIVSGTSMSCPHLSGIAALIKSAHPDWSPAAIKSSIMTTA  565

Query  745   DQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQE  566
             +  NL G  I+D+ L PAD+FA G GHVNPS+A DPGL+YD+Q DDYIPYLCGL YT+ +
Sbjct  566   NITNLEGNPIVDQTLQPADLFAIGAGHVNPSKAVDPGLVYDIQPDDYIPYLCGLGYTNNQ  625

Query  565   IQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFL  386
             +  I  + ++C   TSIPE +LNYPSF + LG+   T+SRTVT VG    +Y V +    
Sbjct  626   VSLIAHKPIDCLTTTSIPEGELNYPSFMVKLGQVQ-TFSRTVTYVGSGREVYNVVIEAPE  684

Query  385   GVDVGVTPDTLVFTEVNQQLTYNISF------SPSSTPVDIDFVQGAIAWVSQRHIVKSP  224
             GV V V P  ++F+ +NQ+ TY+++F      SPS+     +F +G + WVS +H+V+SP
Sbjct  685   GVSVTVRPRKVIFSALNQKATYSVTFKRIGSISPST-----EFAEGYLKWVSAKHLVRSP  739

Query  223   IAIIF  209
             I++ F
Sbjct  740   ISVKF  744



>ref|XP_004244591.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=743

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/723 (60%), Positives = 533/723 (74%), Gaps = 17/723 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAING--VSEDYRSYFRSFV-----SESGDEGERSRIVHSYRHVASGFA  2186
             +TYIVHV  P   I+   +SED  S+++SF+     S + +E E  R+V+SYR+V  GFA
Sbjct  26    ETYIVHVESPENKISTQLLSEDLDSWYQSFLPNTVASTNSNEEEGPRLVYSYRNVMKGFA  85

Query  2185  AKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVL  2006
             A+LS E V EM KK GFISA+ QR+ +L+TTH+P+FLGL QN G W +S+YGKGVI+GVL
Sbjct  86    ARLSEEQVKEMEKKPGFISAQPQRILSLHTTHTPSFLGLQQNSGLWSDSNYGKGVIIGVL  145

Query  2005  DTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARNFVSEGssppppPVDEE  1829
             DTGI+P+HPSF+DE MPPPPAKWKGKCE    T CNNKLIG R F  E  SP    +D++
Sbjct  146   DTGISPDHPSFSDEGMPPPPAKWKGKCESNFTTMCNNKLIGVRTFPKENGSP----IDDD  201

Query  1828  GHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaa  1649
             GHGTHTASTAAG+FV  A V+G+A GTAVG+APLAHL+IYK C   GCA S+ILAAMDAA
Sbjct  202   GHGTHTASTAAGSFVRGANVYGNANGTAVGVAPLAHLAIYKACESIGCASSNILAAMDAA  261

Query  1648  iddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLL  1469
             IDDGVD+LSLSLGG +  F+ D +A+GA+ A E+GI VSC+AGN GP   +LSNEAPW+L
Sbjct  262   IDDGVDILSLSLGGFTRPFYNDPVALGAYTATERGILVSCSAGNSGPAKSSLSNEAPWIL  321

Query  1468  TVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDA---ALCGPG  1298
             TVGAST+DR IKAT  LGN  +++GESAF  +    T  PL  PG  + ++   + C  G
Sbjct  322   TVGASTLDRKIKATLQLGNKHEIEGESAFHPKVLNSTFFPLNEPGKNERESTERSYCQDG  381

Query  1297  SLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATE  1118
              L      GK+VLC  GGGI+RV KGQ VK++GG  MI++N+  DG T     HVLPA +
Sbjct  382   -LVYNSNGGKIVLCQVGGGISRVGKGQVVKNSGGVGMIIINEKGDGITTSVSAHVLPALD  440

Query  1117  LSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILG  938
             ++Y +G+KV  Y+NST  P A I F+GT IG K AP VA+FSSRGP+ AS GILKPDI+G
Sbjct  441   ITYANGMKVLAYMNSTKKPVARITFQGTIIGDKNAPVVAAFSSRGPNLASRGILKPDIIG  500

Query  937   PGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAI  758
             PGVNILAAWP     N     +TFNIISGTSM+ PHLSG+A LLKSAHP WSPAAIKSAI
Sbjct  501   PGVNILAAWPTSMENNTNTK-STFNIISGTSMSCPHLSGVAALLKSAHPTWSPAAIKSAI  559

Query  757   ITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNY  578
             +TTAD  NL    ILDERL+PA++FA G GHVNPSRA+DPGLIYD     Y+PYLCGLNY
Sbjct  560   MTTADTVNLANKPILDERLLPANIFAVGAGHVNPSRANDPGLIYDTSFKSYLPYLCGLNY  619

Query  577   TDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKV  398
             T+QEIQ+++QRKV CS+V SIPEAQLNYPSF+I L   S TY+RTVTNVGEA S Y+V++
Sbjct  620   TNQEIQRLLQRKVNCSEVKSIPEAQLNYPSFSITLRANSQTYTRTVTNVGEAKSSYSVEI  679

Query  397   SPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIA  218
                 GV V V P TL F+++NQ+LTY ++FS +        VQG + W S RH V+SPIA
Sbjct  680   VSPPGVSVIVKPSTLKFSKLNQKLTYRVTFSRTENSSTSGTVQGFLKWTSNRHSVRSPIA  739

Query  217   IIF  209
             ++ 
Sbjct  740   VVL  742



>gb|KCW77653.1| hypothetical protein EUGRSUZ_D01951 [Eucalyptus grandis]
Length=679

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/679 (63%), Positives = 527/679 (78%), Gaps = 8/679 (1%)
 Frame = -1

Query  2236  ERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNF  2057
             + +R+VHSY++  +GFAAK++ +   E+ K    +S +++++++L+TTHSP+FL L    
Sbjct  7     QTNRMVHSYKNSITGFAAKMTADEAKELLKLDAVVSVKQEKIFSLHTTHSPSFLNLNPGV  66

Query  2056  GFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARN  1877
             G W++S+ GKGVI+GVLDTGITP HPSF+DE M  PPAKWKGKC F  T+CNNKLIGARN
Sbjct  67    GLWKDSTLGKGVIIGVLDTGITPGHPSFDDEGMSFPPAKWKGKCTFNATSCNNKLIGARN  126

Query  1876  FVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCT  1697
             FV+       PP DE+GHGTHT+STAAGNFV NA V G A GTA+G+AP AHL++Y+VC+
Sbjct  127   FVTS----TLPPTDEDGHGTHTSSTAAGNFVKNANVLGQALGTAIGVAPHAHLAMYQVCS  182

Query  1696  EDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGN  1517
             + GC ES ILAAMDAAI+DGVDVLSLSLGGGS  F+ DSIA+GAF+A++KGIFVSC+AGN
Sbjct  183   DVGCPESSILAAMDAAIEDGVDVLSLSLGGGSTPFYADSIAVGAFSAIQKGIFVSCSAGN  242

Query  1516  EGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYP  1337
              GP   +LSNEAPW+LTVGASTIDRT+KATA LGNGA+ +GES FQ ++F  +  PL+Y 
Sbjct  243   SGPINTSLSNEAPWILTVGASTIDRTVKATAKLGNGAEHNGESLFQPKDF-GSAYPLVYA  301

Query  1336  GSK-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDG  1160
             G+  ++ +ALC  GSL  +DVKGKVVLC+RGGGIAR+ KGQ VKDAGGAAMI++N +++G
Sbjct  302   GANGNQTSALCAEGSLRNLDVKGKVVLCERGGGIARIAKGQEVKDAGGAAMIMMNDELNG  361

Query  1159  YTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGP  980
             Y+ LAD HVLPAT + Y DGLK+K YINSTS P ATI+FKGT IG   AP+V SFSSRGP
Sbjct  362   YSTLADAHVLPATHIPYADGLKIKSYINSTSNPMATILFKGTIIGNSEAPAVTSFSSRGP  421

Query  979   SNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKS  800
             S  SPGILKPDI+GPGV+ILAAWP  +  N+   + TFNIISGTSM+ PHLSGIA LLKS
Sbjct  422   SFESPGILKPDIIGPGVSILAAWPF-SLDNSSTTDVTFNIISGTSMSCPHLSGIAALLKS  480

Query  799   AHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDL  620
             +HPDWSPAAIKSAI+TTA Q NL    I+DE L+PAD+FATG GHVNP +A DPGLIYD+
Sbjct  481   SHPDWSPAAIKSAIMTTAYQINLGSKPIVDETLLPADIFATGAGHVNPPKADDPGLIYDI  540

Query  619   QSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTV  440
             + D+YIPYLCGL Y D EI+ I Q K +C Q+ SIP+AQLNYPSF+I LG ++  YSRTV
Sbjct  541   KPDNYIPYLCGLGYKDSEIETITQEKAKCLQIKSIPQAQLNYPSFSIILGSSAQNYSRTV  600

Query  439   TNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSS-TPVDIDFVQGA  263
             TNVG A+S YT KV    GVDV V P  + F+   Q  TY + F  SS       F QG+
Sbjct  601   TNVGPADSSYTYKVDAPEGVDVTVYPSEIKFSVAVQMATYTVGFHRSSGGSFTKPFAQGS  660

Query  262   IAWVSQRHIVKSPIAIIFQ  206
             + WVS  H V+SPIA++F+
Sbjct  661   LTWVSSDHSVRSPIAVVFK  679



>ref|XP_008437181.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=745

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/720 (60%), Positives = 536/720 (74%), Gaps = 16/720 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGD-EGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYIVHV  P      V +D   + RSF+  S D E E+  +++SYR+V SGF+A+L+ E 
Sbjct  32    TYIVHVKKPE-----VVDDLEIWHRSFLPTSLDNEEEQPTLLYSYRNVMSGFSARLTEEH  86

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             V  M +K GF+SARR+ + +L+TTH+P+FLGL + FGFW++S++GKGVI+GVLD GITPN
Sbjct  87    VKAMEEKDGFVSARRETIVHLHTTHTPDFLGLNRQFGFWKDSNFGKGVIIGVLDGGITPN  146

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGAR--NFVSEGssppppP-----VDEEG  1826
             HPSF+D  M  PPAKWKG+CEF  +ACNNKLIGAR  N  S+             +DE+G
Sbjct  147   HPSFDDAGMAQPPAKWKGRCEFNFSACNNKLIGARSMNLASQALKGKITTLDDSPIDEDG  206

Query  1825  HGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaai  1646
             HGTHTASTAAG FV  A   G+A GTAVGMAPLAHL+IYKVC  + C++ DILA +DAA+
Sbjct  207   HGTHTASTAAGTFVDGAEALGNAFGTAVGMAPLAHLAIYKVCFGEDCSDVDILAGLDAAV  266

Query  1645  ddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLT  1466
             +DGVDVLS+SLGG S  FF D  AIG+FAA++KGIFVSC+A N GP   TLSNEAPW+LT
Sbjct  267   EDGVDVLSISLGGPSVPFFADITAIGSFAAIQKGIFVSCSAANSGPFNATLSNEAPWILT  326

Query  1465  VGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdk  1286
             V ASTIDR I ATA LGNG + DGES FQ  +FP TLLPL++PG K+E  ALC  GSL  
Sbjct  327   VAASTIDRKITATAKLGNGEEFDGESLFQPNDFPQTLLPLVFPGEKNETVALCAEGSLKN  386

Query  1285  vdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYN  1106
             +DVKGKVV+C+RGGGIAR+ KG  VK+ GGAAMILLN + DG+T   D HVLPA+ +S+ 
Sbjct  387   IDVKGKVVVCERGGGIARIAKGVEVKNGGGAAMILLNAESDGFTTEVDAHVLPASHVSHT  446

Query  1105  DGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVN  926
               LK+K YINST++PTATI+FKGT IG   +P++ASFSSRGPS ASPGILKPDI GPGV+
Sbjct  447   AALKIKAYINSTTYPTATILFKGTTIGDDFSPAIASFSSRGPSLASPGILKPDITGPGVS  506

Query  925   ILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTA  746
             ILAAWP     NN N  +TFNIISGTSM+ PHLSGIA L+KSAHPDWSPAAIKS+I+TTA
Sbjct  507   ILAAWPF-PLDNNTNTKSTFNIISGTSMSCPHLSGIAALIKSAHPDWSPAAIKSSIMTTA  565

Query  745   DQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQE  566
             +  NL G  ILDE L PAD+FA G GHVNPS+A DPGL+YD+Q DDYIPYLCGL YT+ +
Sbjct  566   NITNLEGNPILDETLQPADLFAIGAGHVNPSKAIDPGLVYDIQPDDYIPYLCGLGYTNNQ  625

Query  565   IQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFL  386
             +  I  + ++C   +SIPE +LNYPSF + LG    T+SRTVT+VG    +Y V +    
Sbjct  626   VSLIAHKPIDCLTTSSIPEGELNYPSFMVKLGPVQ-TFSRTVTSVGSGRVVYNVVIEAPE  684

Query  385   GVDVGVTPDTLVFTEVNQQLTYNISFSPS-STPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             GV V V P  L F+ +NQ+ TY+++F  S S    I+F +G + WVS +H+V+SPI++ F
Sbjct  685   GVSVTVRPRKLSFSALNQKATYSVTFKRSGSISPSIEFAEGYLKWVSAKHVVRSPISVKF  744



>ref|XP_006428960.1| hypothetical protein CICLE_v10011144mg [Citrus clementina]
 gb|ESR42200.1| hypothetical protein CICLE_v10011144mg [Citrus clementina]
Length=745

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/718 (61%), Positives = 536/718 (75%), Gaps = 12/718 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAIN-GVSEDYRSYFRSF----VSESGDEGERSRIVHSYRHVASGFAAKL  2177
             TYIVHV  P    N  +  D  +++R+F    +S+S D   RSR+V+ YR+V SGFAA+L
Sbjct  34    TYIVHVRKPKQEGNFSIKLDLDNWYRTFLPDNISKSIDAHHRSRMVYGYRNVISGFAARL  93

Query  2176  SPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTG  1997
             + E V  M  K GFISAR + +    TTHSPNFLGL+QN GFW++S+ GKGVI+GVLD G
Sbjct  94    TAEEVKAMETKSGFISARVENILEPQTTHSPNFLGLHQNSGFWKDSNLGKGVIIGVLDMG  153

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGT  1817
             ITP HPSF+DE MPPPPAKWKGKCE EG  CNNK+IGARNF+++      PP+D +GHGT
Sbjct  154   ITPGHPSFSDEGMPPPPAKWKGKCELEGANCNNKIIGARNFLNK----SEPPIDNDGHGT  209

Query  1816  HTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTED-GCAESdilaamdaaidd  1640
             HTASTAAGNFV  A +FG A GTA GMAPLAHL+IYKVC  D GC ES + AA+DAA+++
Sbjct  210   HTASTAAGNFVNGANLFGQANGTAAGMAPLAHLAIYKVCETDLGCPESIVNAAIDAAVEE  269

Query  1639  gvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVG  1460
             GVDVLS+SLG  S  FF D++A  AF A +KGI VSC+AGN GP+  TL+NEAPW+LTVG
Sbjct  270   GVDVLSISLGSPSLPFFADAMATAAFTATQKGILVSCSAGNSGPNSSTLANEAPWMLTVG  329

Query  1459  ASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvd  1280
             ASTIDR+I A   LGN    DGE+ FQ ++FP   LPL+YPG K+  AA C P +L  +D
Sbjct  330   ASTIDRSIVALTQLGNQETYDGETIFQPKDFPSKQLPLVYPGVKNSSAAFCLPETLKSID  389

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
             VKGKVVLC RGGG  R+ KG+ VKDAGGAAMIL+N ++  Y  +AD HVLPA  +SY  G
Sbjct  390   VKGKVVLCQRGGGTQRIRKGKDVKDAGGAAMILMNDELFDYGTVADNHVLPAVYVSYAAG  449

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
              ++K YINSTS PTA+IVFKGT IG K+AP VA FSSRGP+ ASPGILKPDI+GPGV+IL
Sbjct  450   ERIKAYINSTSSPTASIVFKGTVIGKKSAPEVAVFSSRGPNKASPGILKPDIIGPGVSIL  509

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAWP  +  N  N  +TF +ISGTSM+ PHLSGIA LLKSAHPDWSPAAIKSAI+TTAD 
Sbjct  510   AAWPF-SEENITNTKSTFTMISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTTADI  568

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              NL G  I++  L+PAD+FA G GHVNPS+A+DPGL+YD+  DDY+ YLCG NYTDQ+I+
Sbjct  569   VNLEGKPIMNHHLLPADLFAVGAGHVNPSKANDPGLVYDISHDDYVRYLCGKNYTDQQIE  628

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGV  380
              IV   V+CS+V+SI EA+LNYPSF++ LG +  TY+RTVTNVG+ NS YT  +    GV
Sbjct  629   GIVDHDVQCSKVSSIAEAELNYPSFSVKLGSSPQTYNRTVTNVGQDNSFYTHHIIVPEGV  688

Query  379   DVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
              + V PD + FTE NQ+ TY+++F       +   VQG ++WVS  H V+SPIAI F+
Sbjct  689   KIIVQPDKISFTEKNQKATYSVTFIRDQIS-NASSVQGYLSWVSATHTVRSPIAIGFE  745



>ref|XP_006480601.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=745

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/718 (61%), Positives = 536/718 (75%), Gaps = 12/718 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAIN-GVSEDYRSYFRSF----VSESGDEGERSRIVHSYRHVASGFAAKL  2177
             TYIVHV  P    N  +  D  +++R+F    +S+S D   RSR+V+ YR+V SGFAA+L
Sbjct  34    TYIVHVRKPKQEGNFSIKLDLDNWYRTFLPDNISKSIDAHHRSRMVYGYRNVISGFAARL  93

Query  2176  SPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTG  1997
             + E V  M  K GFISAR + +    TTHSPNFLGL+QN GFW++S+ GKGVI+GVLD G
Sbjct  94    TAEEVKAMETKSGFISARVENILEPQTTHSPNFLGLHQNSGFWKDSNLGKGVIIGVLDMG  153

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGT  1817
             ITP HPSF+DE MPPPPAKWKGKCE EG  CNNK+IGARNF+++      PP+D +GHGT
Sbjct  154   ITPGHPSFSDEGMPPPPAKWKGKCELEGANCNNKIIGARNFLNK----SEPPIDNDGHGT  209

Query  1816  HTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTED-GCAESdilaamdaaidd  1640
             HTASTAAGNFV  A +FG A GTA GMAPLAHL+IYKVC  D GC ES + AA+DAA+++
Sbjct  210   HTASTAAGNFVNGANLFGQANGTAAGMAPLAHLAIYKVCETDLGCPESIVNAAIDAAVEE  269

Query  1639  gvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVG  1460
             GVDVLS+SLG  S  FF D++A  AF A +KGI VSC+AGN GP+  TL+NEAPW+LTVG
Sbjct  270   GVDVLSISLGSPSLPFFADAMATAAFTATQKGILVSCSAGNSGPNSSTLANEAPWMLTVG  329

Query  1459  ASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvd  1280
             ASTIDR+I A   LGN    DGE+ FQ ++FP   LPL+YPG K+  AA C P +L  +D
Sbjct  330   ASTIDRSIVALTQLGNQETYDGETIFQPKDFPSKQLPLVYPGVKNSSAAFCLPETLKSID  389

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
             VKGKVVLC RGGG  R+ KG+ VKDAGGAAMIL+N ++  Y  +AD HVLPA  +SY  G
Sbjct  390   VKGKVVLCQRGGGTQRIRKGKDVKDAGGAAMILMNDELFDYGTVADNHVLPAVYVSYAAG  449

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
              ++K YINSTS PTA+IVFKGT IG K+AP VA FSSRGP+ ASPGILKPDI+GPGV+IL
Sbjct  450   ERIKAYINSTSSPTASIVFKGTVIGKKSAPEVAVFSSRGPNKASPGILKPDIIGPGVSIL  509

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAWP  +  N  N  +TF +ISGTSM+ PHLSGIA LLKSAHPDWSPAAIKSAI+TTAD 
Sbjct  510   AAWPF-SEENITNTKSTFTMISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTTADI  568

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              NL G  I++  L+PAD+FA G GHVNPS+A+DPGL+YD+  DDY+ YLCG NYTDQ+I+
Sbjct  569   VNLEGKPIMNHHLLPADLFAVGAGHVNPSKANDPGLVYDISHDDYVRYLCGKNYTDQQIE  628

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGV  380
              IV   V+CS+V+SI EA+LNYPSF++ LG +  TY+RTVTNVG+ NS YT  +    GV
Sbjct  629   GIVDHDVQCSKVSSIAEAELNYPSFSVKLGSSPQTYNRTVTNVGQDNSFYTHHIIVPEGV  688

Query  379   DVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
              + V PD + FTE NQ+ TY+++F       +   VQG ++WVS  H V+SPIAI F+
Sbjct  689   KIIVQPDKISFTEKNQKATYSVTFIRDQIS-NASCVQGYLSWVSATHTVRSPIAIGFE  745



>dbj|BAF95754.1| subtilase [Lotus japonicus]
Length=750

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/715 (60%), Positives = 538/715 (75%), Gaps = 13/715 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
             TYIVHV  P       S+D  +++ S + ES  +    RIV +YR+V +GFA KL+PE  
Sbjct  44    TYIVHVRKPQVI---QSDDLHTFYYSLLPES-TKTTNQRIVFTYRNVVNGFAVKLTPEEA  99

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
               +++ +  +SAR +++ +L+TTH+P+FLGL Q  G W+ S+ GKGVI+G+LDTGI+P H
Sbjct  100   KALQQNEEVVSARPEKILSLHTTHTPSFLGLQQGLGLWKGSNSGKGVIIGILDTGISPFH  159

Query  1981  PSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             PSF+DE MP PPAKW G CEF G   CNNK+IGARNFV   +     P D+ GHGTHTAS
Sbjct  160   PSFSDEGMPSPPAKWNGICEFTGKRTCNNKIIGARNFVK--TKNLTLPFDDVGHGTHTAS  217

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAG  V  A V+G+A GTAVGMAP AH+++YKVC   GC+ES ILA MD A+DDGVDVL
Sbjct  218   TAAGRPVQGANVYGNANGTAVGMAPDAHIAMYKVCGLVGCSESAILAGMDTAVDDGVDVL  277

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
             SLSLGG S  FFED IA+GAF A++KGIFVSC+A N GP Y +LSNEAPW+LTVGAS+ID
Sbjct  278   SLSLGGPSGPFFEDPIALGAFGAIQKGIFVSCSAANSGPAYSSLSNEAPWILTVGASSID  337

Query  1444  RTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDED--AALCGPGSLdkvdvkg  1271
             RTI ATA LGNG +  G+S FQ ++F P+LLPL+Y G+   +  +  C P SL++ DV+G
Sbjct  338   RTIMATAKLGNGKEYVGQSVFQPKDFAPSLLPLVYAGANGNNNFSVFCAPESLNRSDVEG  397

Query  1270  kvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKV  1091
             KVVLC+ GG + RV KG+ VKDAGGAAMIL+N  ++ +  +AD HVLPA  +SY  GL +
Sbjct  398   KVVLCEDGGFVPRVFKGKAVKDAGGAAMILMNSVLEDFNPIADVHVLPAVHISYEAGLAL  457

Query  1090  KDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAW  911
             K+YINSTS PTATI+F+GT IG   AP V SFSSRGPS ASPGILKPDI+GPG+NILAAW
Sbjct  458   KEYINSTSTPTATILFEGTVIGNLLAPQVTSFSSRGPSKASPGILKPDIIGPGLNILAAW  517

Query  910   PVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNL  731
             PV  + +       FNIISGTSM+ PHLSGIA LLK++HPDWSPAAIKSAI+TTA Q NL
Sbjct  518   PVSLDNSTT---PPFNIISGTSMSCPHLSGIAALLKNSHPDWSPAAIKSAIMTTASQVNL  574

Query  730   NGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIV  551
              GT ILD+RLVPADVFATG GHVNP +A+DPGL+YD++ +DYIPYLCGLNYTD+E+  I+
Sbjct  575   GGTPILDQRLVPADVFATGAGHVNPVKANDPGLVYDIEPNDYIPYLCGLNYTDREVGVIL  634

Query  550   QRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVG  371
             Q++V CS+V  I EA+LNYPSF+I LG T+  Y+RTV NVG ANS YT ++   +GV + 
Sbjct  635   QQRVRCSEVNHIAEAELNYPSFSILLGNTTQLYTRTVANVGPANSTYTAEIGVPVGVGMS  694

Query  370   VTPDTLVFTEVNQQLTYNISFSPSSTPVDID-FVQGAIAWVSQRHIVKSPIAIIF  209
             ++P  L FTEV Q+LTY++SF P S   D   F QG++ WVS ++ V+SPI+ IF
Sbjct  695   LSPAQLTFTEVGQKLTYSVSFIPFSEDRDNHTFAQGSLKWVSGKYSVRSPISFIF  749



>ref|XP_002303551.2| hypothetical protein POPTR_0003s11870g [Populus trichocarpa]
 gb|EEE78530.2| hypothetical protein POPTR_0003s11870g [Populus trichocarpa]
Length=764

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/718 (61%), Positives = 544/718 (76%), Gaps = 13/718 (2%)
 Frame = -1

Query  2338  YIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERS-RIVHSYRHVASGFAAKLSPEMV  2162
             YIVHV+ P        ED  S+++SF+  S    E+  R++++Y++V SGFAA+L+ E V
Sbjct  38    YIVHVAKPEGRTMAEFEDLESWYQSFLPVSTASSEKQQRMLYAYQNVMSGFAARLTQEEV  97

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
               M +K GF+SAR +R+ +L TTH+P FLGL+Q  GFW+ S++GKGVI+GVLD GI P+H
Sbjct  98    KSMEEKDGFLSARPERILHLQTTHTPRFLGLHQELGFWKESNFGKGVIIGVLDGGIFPSH  157

Query  1981  PSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNF-----VSEGssppppPVDEEGHGT  1817
             PSF+DE MPPPPAKWKG+C+F  + CNNKLIGAR+F       +GS+   PP+D +GHGT
Sbjct  158   PSFSDEGMPPPPAKWKGRCDFNASDCNNKLIGARSFNIAAKAKKGSAATEPPIDVDGHGT  217

Query  1816  HTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVC---TEDGCAESdilaamdaai  1646
             HTASTAAG FV +A V G+A+GTAVG+AP AHL+IYKVC     D C ESDILA +DAA+
Sbjct  218   HTASTAAGAFVKDAEVLGNARGTAVGIAPHAHLAIYKVCFGDPGDDCPESDILAGLDAAV  277

Query  1645  ddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLT  1466
              DGVDVLSLSLG  S   F D+IAIG+FAA++KGIFVSC+AGN GP   TLSNEAPW+LT
Sbjct  278   QDGVDVLSLSLGEDSVPLFNDTIAIGSFAAIQKGIFVSCSAGNSGPFNGTLSNEAPWILT  337

Query  1465  VGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG-SKDEDAALCGPGSLd  1289
             VGAST+DR   ATA LGNG Q+DGES  Q  NFP TLLPL+Y G S   +++LCG G+L+
Sbjct  338   VGASTVDRRFSATARLGNGEQIDGESLSQHSNFPSTLLPLVYAGMSGKPNSSLCGEGALE  397

Query  1288  kvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSY  1109
              +DVKGK+VLC+RGGGI R+ KG  VK+AGGAAMIL+N++ DG++  AD HVLPAT +S+
Sbjct  398   GMDVKGKIVLCERGGGIGRIAKGGEVKNAGGAAMILMNEEADGFSTNADVHVLPATHVSF  457

Query  1108  NDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGV  929
               GLK+K YINST  P ATI+FKGT IG  ++P VASFSSRGPS ASPGILKPDI+GPGV
Sbjct  458   AAGLKIKAYINSTQAPMATILFKGTVIGDSSSPFVASFSSRGPSLASPGILKPDIIGPGV  517

Query  928   NILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITT  749
             +ILAAWP   + N  +  +TFNIISGTSM+ PHLSGIA LLKS+HP WSPAAIKSAI+TT
Sbjct  518   SILAAWPFPLDNNTNSK-STFNIISGTSMSCPHLSGIAALLKSSHPYWSPAAIKSAIMTT  576

Query  748   ADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQ  569
             AD  N+ G  I+D+ L PAD+FATG GHVNPSRA++PGL+YD+Q DDYIPYLCGL Y D 
Sbjct  577   ADTLNMEGKLIVDQTLQPADIFATGAGHVNPSRANNPGLVYDIQPDDYIPYLCGLGYADN  636

Query  568   EIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPF  389
             E+  IV  +V+CS+  SIPE +LNYPSFA+ LG  S T++RTVTNVG+ NS Y V +   
Sbjct  637   EVSIIVHEQVKCSEKPSIPEGELNYPSFAVTLGP-SQTFTRTVTNVGDVNSAYEVAIVSP  695

Query  388   LGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDI-DFVQGAIAWVSQRHIVKSPIA  218
              GVDV V P  L F++VNQ+ TY+++FS +       +  QG I W S ++ V+SPIA
Sbjct  696   PGVDVTVKPSKLYFSKVNQKATYSVAFSRTEYGGKTSETAQGYIVWASAKYTVRSPIA  753



>ref|XP_011081071.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=694

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/695 (63%), Positives = 541/695 (78%), Gaps = 7/695 (1%)
 Frame = -1

Query  2281  RSYFRSFVSE-SGDEGERS-RIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVY  2108
              S++ SF+ + + +  + S R++HSYR+V +GFAA+LSP  VS+M KK GF+SAR Q+ Y
Sbjct  2     ESWYNSFLPKPTANSADYSLRMIHSYRNVITGFAARLSPLEVSQMEKKDGFVSARPQKTY  61

Query  2107  NLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGK  1928
              L+TTH+P+FLGL++N G W+ S+YGKGVIVGV+DTGI+P H SF+DE MPPPPAKWKGK
Sbjct  62    TLHTTHAPSFLGLHENVGAWQISNYGKGVIVGVIDTGISPGHLSFSDEGMPPPPAKWKGK  121

Query  1927  CEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGT  1748
             CE  GT CNNKLIGARNFVS       PP+D+EGHGT TASTAAGNFV  A V G+A GT
Sbjct  122   CELNGTMCNNKLIGARNFVSH--LSGLPPIDQEGHGTLTASTAAGNFVSGANVLGNANGT  179

Query  1747  AVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIG  1568
             A GMAPLAHL++YK C+ D C ESDILAAMDAA++DGVDV+S SLG G  +F EDS+AI 
Sbjct  180   AAGMAPLAHLAVYKACSLDVCGESDILAAMDAAVEDGVDVISASLGRGPINFSEDSVAIA  239

Query  1567  AFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGES  1388
             AF A+++GIFVSC+A N GP+  TL+NE PW+LTVGASTIDR+I+A AVLGNG + DGES
Sbjct  240   AFGAIQRGIFVSCSADNGGPNSSTLANEFPWVLTVGASTIDRSIRAIAVLGNGDEFDGES  299

Query  1387  AFQVENFPPTLLPLIYPGS-KDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTV  1211
              FQ ++F PTLLPL+ P +  +E  A C PGSL+  DVKGKVVLC  GGG++R+ KGQTV
Sbjct  300   LFQPKDFQPTLLPLVDPSAGGNETVAYCMPGSLNDTDVKGKVVLCVGGGGVSRIVKGQTV  359

Query  1210  KDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTF  1031
             KDAGGAAMI+ N  +  Y I  D HVLPA  +SY  G  +K YINSTS PTATI+FKGT 
Sbjct  360   KDAGGAAMIVSNDAVTAYDIKPDAHVLPAAHVSYAAGQNIKAYINSTSTPTATIIFKGTV  419

Query  1030  IGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA-WPVgnntnngngNATFNIIS  854
             IGTK+AP VASFSSRGPS +SPGILKPDI+GPGV+ILAA +   +NT N + NA F+++S
Sbjct  420   IGTKSAPMVASFSSRGPSLSSPGILKPDIIGPGVSILAARYMSMDNTTNDSTNANFSMVS  479

Query  853   GTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATG  674
             GTS++ PHLSGIA L+KSAHPDWSPAAIKSA++T+A Q NLNG+ I DERL+PADVF  G
Sbjct  480   GTSISCPHLSGIAALVKSAHPDWSPAAIKSALMTSATQANLNGSLIADERLLPADVFTVG  539

Query  673   GGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNY  494
              GHVNP +A DPGL+YD+  +DYI YLCGL YT++EI  I +R + C +   IPEAQLNY
Sbjct  540   AGHVNPPKAIDPGLVYDISPEDYISYLCGLGYTEKEITIITKRIISC-RGRGIPEAQLNY  598

Query  493   PSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNI  314
             PSF+I LG+   TY+RT TNVG A S Y +K+    GVD+ V P  L FTEVNQ++TY I
Sbjct  599   PSFSIQLGRNGSTYTRTATNVGAAESTYYLKIESIPGVDIVVKPRVLSFTEVNQKMTYQI  658

Query  313   SFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              FS S+ PV+  +VQG+IAW+S +HIV+S I++ F
Sbjct  659   FFSRSAAPVNATYVQGSIAWISPKHIVRSSISVKF  693



>ref|XP_004246134.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=746

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/742 (59%), Positives = 544/742 (73%), Gaps = 18/742 (2%)
 Frame = -1

Query  2404  ISVVVCLTLVFHSVASAKYEDT---YIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGE  2234
             +S++  + ++F    +A  +D    YIVH   P    +  ++D  SY+ SF+  +  +  
Sbjct  9     LSIIGLICVLFPFTTNATEQDNSQIYIVHCEFPDGKRSTNNQDLESYYLSFLPATTSDSS  68

Query  2233  RS--RIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQN  2060
             R   R+++SYR+V +GFAAKLS E + EM K +GF+SAR + + +L+TTHS NF+GL QN
Sbjct  69    REAPRLIYSYRNVITGFAAKLSLEDLKEMEKMEGFVSARPEGLLDLHTTHSVNFMGLNQN  128

Query  2059  FGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGAR  1880
              GFW +S+YGKGVI+GV+DTGI P+HPSF+D+ MPPPPAKWKG C+F  T CNNKLIGAR
Sbjct  129   MGFWNDSNYGKGVIIGVIDTGIFPDHPSFSDDGMPPPPAKWKGICQFNTTKCNNKLIGAR  188

Query  1879  NFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVC  1700
              F   G+ P     DE GHGTHTASTA+G FV  A + G+A GTA+G+APLAH++IYK C
Sbjct  189   YFSYTGNDPW----DENGHGTHTASTASGRFVPGANILGNANGTAMGVAPLAHVAIYKTC  244

Query  1699  TEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAG  1520
             +  GC  SDILAAMD AI+DGVD+LS+SLG  S  F+ED IA+GAF+AME+GIFVSC+AG
Sbjct  245   SAIGCFGSDILAAMDMAIEDGVDILSISLGSRSRQFYEDVIALGAFSAMERGIFVSCSAG  304

Query  1519  NEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIY  1340
             N GP  +++SN+APW+LTVGASTIDR IKATAVLGN  + DGESAFQ  +FP TLLPLIY
Sbjct  305   NSGPYTFSVSNDAPWILTVGASTIDRKIKATAVLGNNQEFDGESAFQPSDFPSTLLPLIY  364

Query  1339  PGSKDED--AALCGPGSLdkvdvkgkvVLCDRGGGIAR-VDKGQTVKDAGGAAMILLNQD  1169
             PGS D D  A  C P SL+  +V GK+VLC+   GI R VDKG  VK AGGAAMI++N  
Sbjct  365   PGSNDSDILAQYCYPSSLNNTNVMGKIVLCE--AGITRAVDKGIAVKAAGGAAMIIMNPK  422

Query  1168  IDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSS  989
                 T  A+ HVLP T ++Y DGLK++ YINST+ PTATI FKGT IG   AP VA FSS
Sbjct  423   SWANTTFAEAHVLPVTHVTYADGLKIQAYINSTTTPTATIAFKGTTIGDNRAPVVAGFSS  482

Query  988   RGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATL  809
             RGPS  SP ILKPDI+GPGVNILAAWPV    N    +   N+ISGTSM+ PHLSG+A L
Sbjct  483   RGPSYVSPRILKPDIIGPGVNILAAWPVSLENNTNTNSTF-NMISGTSMSCPHLSGVAAL  541

Query  808   LKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLI  629
             LKS HPDWSPAAIKSAI+TTAD  NL    I DE  +PADVFATG GHVNPS+A+ PGLI
Sbjct  542   LKSVHPDWSPAAIKSAIMTTADVLNLGSNLIEDETYLPADVFATGAGHVNPSKANAPGLI  601

Query  628   YDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTS--LT  455
             YD++  DY+PYLCGLNYT+++I  I+QRKV CS+VTSI E QLNYPSFAI +   S    
Sbjct  602   YDIKPSDYLPYLCGLNYTNRQIAVILQRKVNCSEVTSILEGQLNYPSFAIQVKSNSGVQV  661

Query  454   YSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDF  275
             YSRTVTNVG+ANS Y V +    G+DV V P TLVF++V Q+L+Y ++F+P + P    +
Sbjct  662   YSRTVTNVGQANSTYRVDIDSPQGLDVKVEPTTLVFSDVKQKLSYQVTFTPFAAP-STTY  720

Query  274   VQGAIAWVSQRHIVKSPIAIIF  209
              QG++ W+S+ HIV+S IA  F
Sbjct  721   TQGSLRWISENHIVRSQIAAWF  742



>ref|XP_002275410.2| PREDICTED: subtilisin-like protease SDD1 [Vitis vinifera]
Length=755

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/730 (58%), Positives = 544/730 (75%), Gaps = 7/730 (1%)
 Frame = -1

Query  2383  TLVFHSVASAK-YEDTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGD-EGERSRIVHSY  2210
             ++ F  +A+ K    TYIVHV+ P    +  SE   S+++SF+  S + E ++ R+++SY
Sbjct  29    SVAFQQIAAEKSMLKTYIVHVNDPVGKFSAQSEALESWYQSFLPASTESENQQQRLLYSY  88

Query  2209  RHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYG  2030
             RHV SGFAA+L+ E V  M KK GF+SA  +++Y+L+TT +P FLGL+   GFW+ S++G
Sbjct  89    RHVISGFAARLTEEEVKAMEKKDGFVSATPEKIYHLHTTRTPGFLGLHNRSGFWKGSNFG  148

Query  2029  KGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGsspp  1850
             +GVI+G+LDTG+ P HPSF+DE MP PPAKW G CEF GTACNNKLIGARNF  +  +P 
Sbjct  149   EGVIIGILDTGVYPQHPSFSDEGMPLPPAKWTGTCEFNGTACNNKLIGARNF--DSLTPK  206

Query  1849  ppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdi  1670
               P+DEEGHGTHTASTAAGN+V +A ++G+AKGTA G+AP AH+++YKVC   GC  SDI
Sbjct  207   QLPIDEEGHGTHTASTAAGNYVKHANMYGNAKGTAAGIAPRAHVAVYKVCGLLGCGGSDI  266

Query  1669  laamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLS  1490
             LAA DAAI+DGVDVLSLSLGG S+ F++D +A+GAFAA+ KGIFVSC+AGN GP ++TLS
Sbjct  267   LAAYDAAIEDGVDVLSLSLGGESSPFYDDPVALGAFAAIRKGIFVSCSAGNSGPAHFTLS  326

Query  1489  NEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAA  1313
             NEAPW+LTV AST+DR+I ATA LGN  + DGES +Q  NF   LLPL+Y G+  ++ +A
Sbjct  327   NEAPWILTVAASTLDRSITATAKLGNTEEFDGESLYQPRNFSSKLLPLVYAGANGNQTSA  386

Query  1312  LCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHV  1133
              C PGSL  +DVKGKVV+CDRGG I R +KG  VK+AGGAAMIL N   D ++  AD HV
Sbjct  387   YCAPGSLKNLDVKGKVVVCDRGGDIGRTEKGVEVKNAGGAAMILANSINDSFSTFADPHV  446

Query  1132  LPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILK  953
             LPAT +SY  GLK+K Y  STS P+ATI+FKGT +G  +AP + SFSSRGPS ASPGILK
Sbjct  447   LPATHVSYAAGLKIKAYTKSTSNPSATILFKGTNVGVTSAPQITSFSSRGPSIASPGILK  506

Query  952   PDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAA  773
             PDI GPGV+ILAAWP       G+  +TFN+ISGTSM+ PHLSG+A LLKSAHP+WSPAA
Sbjct  507   PDITGPGVSILAAWPAPLLNVTGSK-STFNMISGTSMSCPHLSGVAALLKSAHPNWSPAA  565

Query  772   IKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYL  593
             IKSAI+TTAD  NL    ILD++ +PAD+FA G GHVNPS+A+DPGLIYD++  DYIPYL
Sbjct  566   IKSAILTTADTLNLKDEPILDDKHMPADLFAIGAGHVNPSKANDPGLIYDIEPYDYIPYL  625

Query  592   CGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSM  413
             CGL YT+ +++ IV RKV CS+ +SIPEA+LNYPSF+I LG   L + R VTNVG+ +S 
Sbjct  626   CGLGYTNAQVEAIVLRKVNCSKESSIPEAELNYPSFSIALGSKDLKFKRVVTNVGKPHSS  685

Query  412   YTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISF-SPSSTPVDIDFVQGAIAWVSQRHI  236
             Y V ++   GVDV V P  + F +V Q+ +Y + F S         + QG + WVS  H 
Sbjct  686   YAVSINAPEGVDVVVKPTKIHFNKVYQKKSYTVIFRSIGGVDSRNRYAQGFLKWVSATHS  745

Query  235   VKSPIAIIFQ  206
              KSPI++ F+
Sbjct  746   AKSPISVTFE  755



>ref|XP_007211044.1| hypothetical protein PRUPE_ppa019040mg [Prunus persica]
 gb|EMJ12243.1| hypothetical protein PRUPE_ppa019040mg [Prunus persica]
Length=752

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/729 (59%), Positives = 544/729 (75%), Gaps = 20/729 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAA--INGVSEDYRSYFRSFVSES---GDEGERSRIVHSYRHVASGFAAK  2180
              TYIV V  P +    +   E   S+++SF+ E+    +E + SRIVH+YR+V +GFAAK
Sbjct  26    QTYIVWVEKPVSRNIFSQSHEGLESWYQSFLPETTVNSNEQKSSRIVHAYRNVGTGFAAK  85

Query  2179  LSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDT  2000
             L+PE V  M KK+GF+SAR +R+  L TTH+P+FLGL+Q +G W+ ++YG+GVI+GVLDT
Sbjct  86    LTPEEVKAMEKKQGFVSARPERILPLQTTHTPDFLGLHQGYGLWKQTNYGEGVIIGVLDT  145

Query  1999  GITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVS--EGssppppPVDEEG  1826
             GI   HPSF+DE +PPPPA+WKGKCEF  T CNNKLIGA+NFV   +G++   PPVD  G
Sbjct  146   GIGAGHPSFSDEGVPPPPARWKGKCEFNATLCNNKLIGAKNFVGSGKGNTTDSPPVDNHG  205

Query  1825  HGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaai  1646
             HGTHT+STAAGNFV  A+VFG A GTAVGMAP AHL++YKVC   GCA+ DILAA+DAA+
Sbjct  206   HGTHTSSTAAGNFVAGASVFGEANGTAVGMAPYAHLAMYKVCAGGGCADGDILAALDAAV  265

Query  1645  ddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLT  1466
             +DGVDVLSLSLGG S  F+ED IAIGAFAA++KGIF SCAAGN GP Y +LSNEAPW+LT
Sbjct  266   EDGVDVLSLSLGGESLPFYEDVIAIGAFAAIQKGIFFSCAAGNSGPSYNSLSNEAPWILT  325

Query  1465  VGASTIDRTIKATAVLGNGA--QLDGESAFQVENFPPTL-LPLIYPGS-KDEDAALCGPG  1298
             VGAST DR +K+ A +G+      DG+S  Q E+F  T+ LPL+Y GS  ++ +A C  G
Sbjct  326   VGASTTDRILKSKAQIGDDKNNHFDGKSLSQPEDFDSTVSLPLVYAGSVGNQPSASCKAG  385

Query  1297  SLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATE  1118
             SL+ V+ K    LC+ GGG+  + KG+ VK AGGAAMIL+NQ+ DG++ LA++HVLP+T 
Sbjct  386   SLENVEGKIV--LCETGGGVTNIAKGEEVKRAGGAAMILMNQETDGFSTLAESHVLPSTH  443

Query  1117  LSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILG  938
             +SY  GL++K YI+STS PTA I+F GT IG   AP VASFSSRGPS+ASPGILKPDI+G
Sbjct  444   VSYAAGLQIKSYISSTSSPTAKILFNGTVIGDALAPKVASFSSRGPSSASPGILKPDIIG  503

Query  937   PGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAI  758
             PGV+ILAAWPV  +       ATFNIISGTSM+TPHLSGIA LLKS+HPDWSPAAIKSAI
Sbjct  504   PGVSILAAWPVAVDQTQSK--ATFNIISGTSMSTPHLSGIAALLKSSHPDWSPAAIKSAI  561

Query  757   ITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNY  578
             +TTA+  NL G  I+D+ L PAD+FATG GHVNPS+A+DPGL+YD Q  DYIPYLCGLNY
Sbjct  562   MTTANVLNLEGKPIVDQTLEPADIFATGAGHVNPSKANDPGLVYDTQPKDYIPYLCGLNY  621

Query  577   TDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKT---SLTYSRTVTNVGEANSMYT  407
             TDQ+IQ I ++ V CSQV +IPEAQLNYPSF+I +      S  Y+RTV NVG A+S Y 
Sbjct  622   TDQQIQLITKQAVICSQVEAIPEAQLNYPSFSIKIRSNETQSQYYTRTVRNVGPASSTYN  681

Query  406   VKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISF--SPSSTPVDIDFVQGAIAWVSQRHIV  233
             + +     + + V P  L FTEVNQ+LT+++ F     +    +   QG + W S ++ V
Sbjct  682   LDLLVPHKMGMSVNPQVLTFTEVNQELTFHVEFIAEDGAGKDGVPISQGYLRWFSDKYNV  741

Query  232   KSPIAIIFQ  206
              SPIA++F+
Sbjct  742   TSPIAVVFE  750



>ref|XP_003550884.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=741

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/736 (58%), Positives = 542/736 (74%), Gaps = 9/736 (1%)
 Frame = -1

Query  2395  VVCLTLVFHSVASAKYE-DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESG-DEGERSRI  2222
             ++   L FH ++SA     TYI+HV  P       +ED  S++ SF+  +     E+ R+
Sbjct  7     ILTFLLSFHKLSSAASSSKTYIIHVEGPQDKTLDQTEDLESWYHSFMPPTTMSSEEQPRM  66

Query  2221  VHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRN  2042
             ++SYR+V SGFAA+L+ E +  M KK GFISAR +R+ +  TT++P FLGL +  G W+ 
Sbjct  67    IYSYRNVMSGFAARLTEEELRTMEKKNGFISARPERMLHCLTTNTPQFLGLQKQTGLWKE  126

Query  2041  SSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGAR--NFVS  1868
             S++GKG+I+GVLD+GITP HPSF+D  MPPPP KWKG+CE   TACNNKLIG R  N   
Sbjct  127   SNFGKGIIIGVLDSGITPGHPSFSDAGMPPPPPKWKGRCEINVTACNNKLIGVRAFNLAE  186

Query  1867  EGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDG  1688
             + +      +DE+GHGTHTASTAAG FV +A + G+AKGTA G+AP AHL+IY+VC    
Sbjct  187   KLAKGAEAAIDEDGHGTHTASTAAGAFVDHAELLGNAKGTAAGIAPYAHLAIYRVCFGKD  246

Query  1687  CAESdilaamdaaiddgvdvlslslgggS-ASFFEDSIAIGAFAAMEKGIFVSCAAGNEG  1511
             C ESDILAAMDAA++DGVDV+S+SLG  +  S F+DS AIGAFAAM+KGIFVSCAAGN G
Sbjct  247   CHESDILAAMDAAVEDGVDVISISLGSHTPKSIFDDSTAIGAFAAMQKGIFVSCAAGNSG  306

Query  1510  PDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS  1331
             P + +L N APW+LTVGAS IDR+I ATA LGNG + DGES FQ  +F PTLLPL Y G 
Sbjct  307   PFHGSLINGAPWVLTVGASNIDRSIAATAKLGNGQEFDGESVFQPSDFSPTLLPLAYAGK  366

Query  1330  K-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYT  1154
                ++AA C  GSL+  D +GKVVLC+RGGGI R+ KG+ VK  GGAAMIL N + +G++
Sbjct  367   NGKQEAAFCANGSLNDSDFRGKVVLCERGGGIGRIPKGEEVKRVGGAAMILANDESNGFS  426

Query  1153  ILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSN  974
             + AD HVLPAT +SY+ GLK+K YINST+ P ATI+FKGT IG   AP+V SFSSRGP+ 
Sbjct  427   LSADVHVLPATHVSYDAGLKIKAYINSTAIPIATILFKGTIIGNSLAPAVTSFSSRGPNL  486

Query  973   ASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAH  794
              SPGILKPDI+GPGVNILAAWP   N +  +  +TFN +SGTSM+ PHLSGIA LLKS+H
Sbjct  487   PSPGILKPDIIGPGVNILAAWPFPLNNDTDSK-STFNFMSGTSMSCPHLSGIAALLKSSH  545

Query  793   PDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQS  614
             P WSPAAIKSAI+T+AD  N     I+DE L PADVFATG GHVNPSRA+DPGL+YD+Q 
Sbjct  546   PHWSPAAIKSAIMTSADIINFERKLIVDETLHPADVFATGSGHVNPSRANDPGLVYDIQP  605

Query  613   DDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTN  434
             DDYIPYLCGL Y+D ++  I  + ++CS+ +SIPE +LNYPSF++ LG    T++RTVTN
Sbjct  606   DDYIPYLCGLGYSDTQVGIIAHKTIKCSETSSIPEGELNYPSFSVVLGSPQ-TFTRTVTN  664

Query  433   VGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSP-SSTPVDIDFVQGAIA  257
             VGEANS Y V V    GV+V V P+ L F+E NQ+ TY+++FS   S    + +VQG + 
Sbjct  665   VGEANSSYVVMVMAPEGVEVRVQPNKLYFSEANQKDTYSVTFSRIKSGNETVKYVQGFLQ  724

Query  256   WVSQRHIVKSPIAIIF  209
             WVS +HIV+SPI++ F
Sbjct  725   WVSAKHIVRSPISVNF  740



>ref|XP_006358147.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=730

 Score =   787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/679 (63%), Positives = 519/679 (76%), Gaps = 14/679 (2%)
 Frame = -1

Query  2230  SRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGF  2051
             SR+++SYR+V +GFAA+LSP+ V  +  K GFIS R QRV  + TTHSP+FLGL+QN GF
Sbjct  60    SRVIYSYRNVFNGFAARLSPDEVKGLETKDGFISIRPQRVLRVQTTHSPSFLGLHQNLGF  119

Query  2050  WRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFV  1871
             W  S+YG+GVI+G+LDTGI P HPSF+DE MPPPPAKWKGKCEF  TACNNKLIGAR+F+
Sbjct  120   WNTSNYGEGVIIGLLDTGIYPEHPSFDDEGMPPPPAKWKGKCEFNFTACNNKLIGARDFL  179

Query  1870  SEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTED  1691
             S        P+DE GHGTHT+STAAGNFV  A VFG+A GTA G+AP AHL++YKVC   
Sbjct  180   S---VEDGTPLDENGHGTHTSSTAAGNFVDGANVFGNANGTAAGIAPRAHLAMYKVCNPS  236

Query  1690  G-CAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNE  1514
             G C+ESD+LAAMDAAI+DGVDV+S+S+GG S  F++D+IA+GAF++M KGIFVSC+AGN 
Sbjct  237   GLCSESDMLAAMDAAIEDGVDVISISIGGISTPFWDDNIALGAFSSMAKGIFVSCSAGNG  296

Query  1513  GPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG  1334
             GPD  TLSNEAPW+LTVGASTIDR IKAT  LGNG + DGES  Q  +FPPTLLP++YP 
Sbjct  297   GPDNATLSNEAPWILTVGASTIDRQIKATVALGNGVEYDGESTSQPNDFPPTLLPIVYPA  356

Query  1333  --SKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDG  1160
               S    A +C P SL   +V+GK+VLC  GG  A + KGQ VKDAG A MIL+N DI+G
Sbjct  357   LNSTYFGAFVCSPESL--TNVEGKLVLCGVGGATA-IAKGQPVKDAGAAGMILMNGDIEG  413

Query  1159  YTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGP  980
             YTI A  +VLPAT +SY D   +  YINSTS P A+I+FKGT IG K APSVA FSSRGP
Sbjct  414   YTIPAHDYVLPATRISYADAQDLIAYINSTSTPMASILFKGTVIGNKHAPSVAFFSSRGP  473

Query  979   SNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKS  800
             S  SPGILKPDI+GPG NILAAWP     N      TFN+ISGTSMA PHL+G+A LLKS
Sbjct  474   SRTSPGILKPDIIGPGFNILAAWPTSIENNTHTNL-TFNMISGTSMACPHLAGVAALLKS  532

Query  799   AHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDL  620
             AHPDWSPAAIKSAI+TTA   NL    I DER +PA++FA G GHVNP  A+DPGLIYD+
Sbjct  533   AHPDWSPAAIKSAIMTTAGLVNLGNNPIEDERHLPANIFAIGAGHVNPLSANDPGLIYDI  592

Query  619   QSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTV  440
             Q  DY+PYLCGLNYTDQ++  I+Q+KV C+    IPEA+LNYPSF+I LG  +  Y+R V
Sbjct  593   QPHDYVPYLCGLNYTDQQVSAILQKKVNCT--IRIPEAELNYPSFSIKLGSETQEYTRAV  650

Query  439   TNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSS--TPVDIDFVQG  266
             TNVGEANS YTV++SP  GV++ V+P +L F+EV +++TY ++F  S+  T  +  FVQG
Sbjct  651   TNVGEANSTYTVEISPPEGVEITVSPSSLHFSEVKERITYQVTFKRSAPGTVSNAKFVQG  710

Query  265   AIAWVSQRHIVKSPIAIIF  209
              + W S +H V+SPIA+I 
Sbjct  711   YLKWSSDKHSVRSPIAVIL  729



>ref|XP_006358961.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=745

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/745 (59%), Positives = 551/745 (74%), Gaps = 21/745 (3%)
 Frame = -1

Query  2404  ISVVVCLTLVFHSVAS--AKYEDTYIVHVSPPAAAING---VSEDYRSYFRSFVSES-GD  2243
             I +   L + F+S+ S  A   +TYIV V  P + I+     + D  S++ SF+  +  +
Sbjct  5     IRIPFLLFIFFNSLFSTMATNLETYIVQVESPNSQISTHRTSTMDLDSWYHSFLPTTIAN  64

Query  2242  EGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQ  2063
               E +R+V++Y +V  GFA KLS E + EM KK+GFISAR QRV +L+TTH+P+FLGL Q
Sbjct  65    SIEDTRMVYAYHNVIKGFAVKLSDEELKEMEKKEGFISARPQRVLSLHTTHTPSFLGLQQ  124

Query  2062  NFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGA  1883
             N GFWR+S+YGKGVI+GVLDTGI  +HPSFNDE MPPPPAKWKGKCEF  + CNNKLIGA
Sbjct  125   NMGFWRDSNYGKGVIIGVLDTGIAHDHPSFNDEGMPPPPAKWKGKCEFNSSICNNKLIGA  184

Query  1882  RNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKV  1703
             R+F    S       D++GHGTHTASTAAG++V NA V+G+A GTAVG+APLAHL+IY+V
Sbjct  185   RSF----SFGKGTTWDDDGHGTHTASTAAGSYVKNANVYGNANGTAVGVAPLAHLAIYRV  240

Query  1702  CTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAA  1523
             CT  GC+ESDILAAMD AI+DGVD+LSLSLGG + SF +D+IA+GA++AME+GIFVSC+A
Sbjct  241   CTSVGCSESDILAAMDVAIEDGVDILSLSLGGSTKSFHDDAIALGAYSAMEQGIFVSCSA  300

Query  1522  GNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLI  1343
             GN GP   +++NEAPW+LTVGAST+DR IKATAVLGN     GESAFQ +NF   L PL+
Sbjct  301   GNRGPTPESVTNEAPWILTVGASTLDRNIKATAVLGNKEMFQGESAFQPKNFSSHLYPLV  360

Query  1342  YPG---SKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQ  1172
             Y G     D +   C   SL++ D  GK+VLC+ GGG+ RVDKGQ VK AGG AMIL+N+
Sbjct  361   YAGGSNQSDINDPYCSTTSLNQTDFTGKIVLCEVGGGVTRVDKGQAVKAAGGIAMILMNR  420

Query  1171  DIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFS  992
               DG+T  AD HVLPAT+++Y DG K+  YINSTS P ATI F+GT IG K  P +ASFS
Sbjct  421   MQDGFTTSADAHVLPATDVTYVDGQKILAYINSTSNPLATITFQGTIIGDKNTPVIASFS  480

Query  991   SRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIAT  812
             SRGPS A+PGILKPDI+GPGVNILAAWP     N      TFNIISGTSM+ PHLSG+A 
Sbjct  481   SRGPSRATPGILKPDIIGPGVNILAAWPTSVENNTEPK-PTFNIISGTSMSCPHLSGVAA  539

Query  811   LLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGL  632
             LLKS+HP+WSP+ IKSAI+TTAD  NL    I DE   PA++FA G GHVNPS+A+DPGL
Sbjct  540   LLKSSHPNWSPSMIKSAIMTTADTVNLGEKTIQDENHEPANLFAIGSGHVNPSKANDPGL  599

Query  631   IYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTY  452
             +YD++ +DY+PYLCGLNYT++E+  IVQRK+ CS+V SI + QLNYPSF+I LG T  TY
Sbjct  600   VYDIKPNDYVPYLCGLNYTNREVGVIVQRKINCSEVGSIQQGQLNYPSFSIILGSTPQTY  659

Query  451   SRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSP----SSTPVD  284
             +RTVTNVGEA S YTV V    GVDV V P  L F E+ Q+++Y ++F+     SS  VD
Sbjct  660   TRTVTNVGEAKSSYTVDVVSPPGVDVKVEPSVLKFAELKQKMSYQVTFTQIVYRSSGTVD  719

Query  283   IDFVQGAIAWVSQRHIVKSPIAIIF  209
                V+G + W S ++ V+SPIA + 
Sbjct  720   ---VEGFLKWKSTKYSVRSPIAALL  741



>ref|XP_002299578.1| hypothetical protein POPTR_0001s08340g [Populus trichocarpa]
 gb|EEE84383.1| hypothetical protein POPTR_0001s08340g [Populus trichocarpa]
Length=698

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/698 (61%), Positives = 527/698 (76%), Gaps = 9/698 (1%)
 Frame = -1

Query  2290  EDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQR  2114
             E+  S+++SF+ + +     + R+VHSY +V +GFAAKL+ +    M  K+GF+SA  Q+
Sbjct  7     EELDSWYQSFLPAVTTSSSNQQRLVHSYHNVVTGFAAKLTEKEAKAMEMKEGFVSAHPQK  66

Query  2113  VYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWK  1934
             V+++ TTH+PNFLGL QN GFW +S+YGKGVI+GVLDTGITP+HPSF+DE MPPPPAKWK
Sbjct  67    VFHVKTTHTPNFLGLQQNLGFWNHSNYGKGVIIGVLDTGITPSHPSFSDEGMPPPPAKWK  126

Query  1933  GKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAK  1754
             GKCEF GT CNNKLIGARNF S G  P    VD+ GHGTHTASTAAG+ V  A+ +    
Sbjct  127   GKCEFNGTLCNNKLIGARNFDSAGKPP----VDDNGHGTHTASTAAGSRVQGASFYDQLN  182

Query  1753  GTAVGMAPLAHLSIYKVCTEDG-CAESdilaamdaaiddgvdvlslslgggSASFFEDSI  1577
             GTAVG+A  AHL+IY+VC+  G C ES+ILA MD A++DG DVLSLSLG GS  F+EDSI
Sbjct  183   GTAVGIASSAHLAIYQVCSGFGSCEESNILAGMDTAVEDGADVLSLSLGAGSLPFYEDSI  242

Query  1576  AIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLD  1397
             AIGAF A++KGIFVSCAAGNEGP   +LSNEAPW+LTVGAST+DR+I+AT +LGN A  D
Sbjct  243   AIGAFGAIQKGIFVSCAAGNEGPFKGSLSNEAPWILTVGASTVDRSIRATVLLGNKASYD  302

Query  1396  GESAFQVENFPPTLLPLIYPGSKDED-AALCGPGSLdkvdvkgkvVLCDRGGGIARVDKG  1220
             G+S +Q  NF  TLLPLIY G+   D AA C PGSL  VDVKGKVVLC+ GG    VDKG
Sbjct  303   GQSFYQPTNFSSTLLPLIYAGANGSDTAAFCDPGSLKDVDVKGKVVLCESGGFSESVDKG  362

Query  1219  QTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFK  1040
             Q VKDAGGAAMI++N ++ G    AD HVLPA++++Y DGL +K YINSTS P ATI+FK
Sbjct  363   QEVKDAGGAAMIIMNDELSGNITTADFHVLPASDVTYADGLSIKAYINSTSSPMATILFK  422

Query  1039  GTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNI  860
             GT  G   AP +A FSSRGPS  SPGILKPDI+GPGV+ILAAWP   + N     +TFN+
Sbjct  423   GTVFGVPYAPQLADFSSRGPSLESPGILKPDIIGPGVDILAAWPYAVDNNRNTK-STFNM  481

Query  859   ISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFA  680
             ISGTSMATPHLSGIA LLKS+HPDWSPAAIKSAI+TTA+  NL GT I D+   P DVFA
Sbjct  482   ISGTSMATPHLSGIAALLKSSHPDWSPAAIKSAIMTTANLTNLGGTPITDDSFGPVDVFA  541

Query  679   TGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQL  500
              G GHVNP++A DPGL+YD+Q DDYIPYLCGL Y + E+  IVQR V CS  +SIPEAQL
Sbjct  542   IGSGHVNPTKADDPGLVYDIQPDDYIPYLCGLGYNNTEVGIIVQRPVTCSNSSSIPEAQL  601

Query  499   NYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTY  320
             NYPSF+I LG +  TY+RTVTNVG   S Y  ++    GVDV VTP+ + F   + +  Y
Sbjct  602   NYPSFSIKLGSSPQTYTRTVTNVGPFKSSYIAEIIAPQGVDVKVTPNAIPFGGGDPKAAY  661

Query  319   NISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
             +++F+ ++  V++ F QG + WVS  H+V++PIA+ F+
Sbjct  662   SVTFTRTAN-VNLPFSQGYLNWVSADHVVRNPIAVTFE  698



>ref|XP_009776224.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=742

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/737 (59%), Positives = 528/737 (72%), Gaps = 28/737 (4%)
 Frame = -1

Query  2395  VVCLTLVFHSVASAKYE-------DTYIVHVSPPAAAINGVSEDYRSYFRSFV-SESGDE  2240
             +VC+ L+ HS A+           +TYIVH+  P       S+D   + +SF+ + S + 
Sbjct  22    LVCI-LILHSSATLAGHFTNQNDLETYIVHLEFPDDIFFSDSDDLYLWHQSFLPTTSTNS  80

Query  2239  GERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQN  2060
                SRI++SYRHV +GFAA LS E V  M KK GF+SAR QRV  ++TTHSP+FLGL QN
Sbjct  81    DHLSRIIYSYRHVFNGFAALLSSEEVKTMEKKPGFVSARPQRVLQMHTTHSPDFLGLNQN  140

Query  2059  FGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGAR  1880
              G W  S+ G+GVI+G+LD+GI P HPSFND  MPPPP+KWKGKCEF  TACNNKLIGAR
Sbjct  141   VGLWNTSNSGEGVIIGLLDSGIAPRHPSFNDNGMPPPPSKWKGKCEFNLTACNNKLIGAR  200

Query  1879  NFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVC  1700
             NF          P+DEEGHGTHT+STAAGNFV  A + GSA GTA G+AP AH+++YKVC
Sbjct  201   NFARS---INLSPLDEEGHGTHTSSTAAGNFVEGANLLGSANGTASGIAPRAHVAMYKVC  257

Query  1699  TEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAG  1520
             T +GC ESDI+A +DAAI DGVDVLS+SLG     F+ED+IAIGA++A+EKGIFVSC+AG
Sbjct  258   TSEGCQESDIVAGIDAAIGDGVDVLSISLGASPVPFYEDNIAIGAYSAIEKGIFVSCSAG  317

Query  1519  NEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIY  1340
             N GP   T+SN APWLLTVGAST DR I A AVLGNG Q +GES FQ  NF   LLPLI 
Sbjct  318   NSGPFNATVSNSAPWLLTVGASTTDRKISAVAVLGNGQQYEGESVFQPRNFSRKLLPLID  377

Query  1339  PGSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGI-ARVDKGQTVKDAGGAAMILLNQDID  1163
              GS +  A +   G +         VLCD  G +  RV KG+ VK AGGAAMIL+N    
Sbjct  378   GGSCELLAPIDVKGKI---------VLCDTSGVMYTRVQKGEQVKKAGGAAMILMNIKAR  428

Query  1162  GYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRG  983
             GYT  AD HVLPAT +SYNDG K+ +Y  STS P ATI FKGT IG K AP+VA FSSRG
Sbjct  429   GYTTFADVHVLPATLISYNDGQKILNYTKSTSAPVATISFKGTRIGDKNAPTVAFFSSRG  488

Query  982   PSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLK  803
             PS  S GILKPDI+GPG+NILAAWP  +     +  +TFNIISGTSM+ PHL+G+A LLK
Sbjct  489   PSLVSQGILKPDIIGPGLNILAAWPT-SVGQKTSSKSTFNIISGTSMSCPHLAGVAALLK  547

Query  802   SAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYD  623
             SAHPDWSPAAIKSAI+TTAD  NL    I DE L PAD+F+ G GHVNPS+A+DPGL+YD
Sbjct  548   SAHPDWSPAAIKSAIMTTADFVNLANNPIPDETLNPADLFSIGSGHVNPSKANDPGLVYD  607

Query  622   LQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRT  443
             +Q + Y+PYLCGLNYTD ++  IV+R V C+  +SI EA+LNYPSFAI LG T+ TY+RT
Sbjct  608   IQPEAYVPYLCGLNYTDDQVSAIVRRNVRCT--SSIAEAELNYPSFAINLGSTAQTYTRT  665

Query  442   VTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGA  263
             VTNVGEANS YTV+V    GV + + P TL F+ +NQ+L+YNI+F  S   V +D  QG 
Sbjct  666   VTNVGEANSTYTVQVFGVKGVKLSIKPTTLTFSALNQKLSYNITFKRS---VSVDSSQGY  722

Query  262   IAWVSQRHIVKSPIAII  212
             I W S ++ V+SPIA+ 
Sbjct  723   ITWSSTKYSVRSPIAVF  739



>ref|XP_008238737.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=762

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/751 (58%), Positives = 549/751 (73%), Gaps = 25/751 (3%)
 Frame = -1

Query  2395  VVCLTLVFH-SVASAKYED----TYIVHVSPPAAA--INGVSEDYRSYFRSFVSES---G  2246
             ++ LT +F+ S+  A+ E     TYIV V  P +    +   E   S+++SF+ E+    
Sbjct  14    LLGLTFMFYQSLGLAQEEQNSLQTYIVWVEKPVSRNIFSQSHEGLESWYQSFLPETTVNS  73

Query  2245  DEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLY  2066
             +E + SRIVH+Y +V +GFAAKL+PE V  M KK+GF+SAR +R+  L TTH+P+FLGL+
Sbjct  74    NEQKSSRIVHAYCNVGTGFAAKLTPEEVKAMEKKQGFVSARPERILPLQTTHTPDFLGLH  133

Query  2065  QNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIG  1886
             Q +G W+ ++YG+GVI+GVLDTGI   HPSF+DE +PPPPA+WKGKCEF  T CNNKLIG
Sbjct  134   QGYGLWKQTNYGEGVIIGVLDTGIGAGHPSFSDEGVPPPPARWKGKCEFNATLCNNKLIG  193

Query  1885  ARNFVSEGssppppP--VDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSI  1712
             A+NFV  G         VD  GHGTHT+STAAGNFV  A+VFG A GTAVGMAP AHL++
Sbjct  194   AKNFVGSGKGNTTDSPPVDNHGHGTHTSSTAAGNFVAGASVFGEANGTAVGMAPYAHLAM  253

Query  1711  YKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVS  1532
             YKVC   GCA+ DILAA+DAA++DGVDVLSLSLGG S  F+ED IAIGAFAA++KGIF S
Sbjct  254   YKVCAGGGCADGDILAALDAAVEDGVDVLSLSLGGESLPFYEDVIAIGAFAAIQKGIFFS  313

Query  1531  CAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGA--QLDGESAFQVENFPPT  1358
             CAAGN GP Y +LSNEAPW+LTVGAST DR +K+ A +G+      DG+S  Q E+F   
Sbjct  314   CAAGNSGPSYNSLSNEAPWILTVGASTTDRILKSEAQIGDDKNNHFDGKSLSQPEDFNSA  373

Query  1357  L-LPLIYPGS-KDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMI  1184
             + LPL+Y GS  ++ +A C  GSL+ V  K    LC+ GGG+  + KG+ VK AGGAAMI
Sbjct  374   VSLPLVYAGSVGNQLSASCKAGSLENVKGKIV--LCETGGGVTNIAKGEEVKRAGGAAMI  431

Query  1183  LLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSV  1004
             L+NQ+ DG++ LA++HVLP+T +SY  GL++K YI+STS PTA I+F GT IG   AP V
Sbjct  432   LMNQETDGFSTLAESHVLPSTHVSYAAGLQIKSYISSTSSPTAKILFNGTVIGDALAPKV  491

Query  1003  ASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLS  824
             ASFSSRGPS+ASPGILKPDI+GPGV+ILAAWPV  +       ATFNIISGTSM+TPHLS
Sbjct  492   ASFSSRGPSSASPGILKPDIIGPGVSILAAWPVAVDQTQSK--ATFNIISGTSMSTPHLS  549

Query  823   GIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRAS  644
             GIA LLKS+HPDWSPAAIKSAI+TTA+  NL G  I+D+RL PAD+FATG GHVNPS+A+
Sbjct  550   GIAALLKSSHPDWSPAAIKSAIMTTANVLNLAGKPIVDQRLEPADIFATGAGHVNPSKAN  609

Query  643   DPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKT  464
             DPGL+YD Q  DYIPYLCGLNYTDQ+IQ I ++ V CSQV +IPEAQLNYPSF+I +   
Sbjct  610   DPGLVYDTQPKDYIPYLCGLNYTDQQIQLITKQAVICSQVEAIPEAQLNYPSFSIKIRSN  669

Query  463   ---SLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISF--SPS  299
                S  Y+RTV NVG A+S Y + +     + + V P  L FTEVNQ+LT+++ F     
Sbjct  670   ETQSQYYTRTVRNVGPASSTYNLDLLVPHKMGMSVNPQMLTFTEVNQELTFHVEFIAEDG  729

Query  298   STPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
             +    +   QG + W S ++ V SPIA++F+
Sbjct  730   AGKDGVPISQGYLRWFSDKYNVTSPIAVVFE  760



>ref|XP_010108071.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXC17803.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=839

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/719 (60%), Positives = 538/719 (75%), Gaps = 11/719 (2%)
 Frame = -1

Query  2338  YIVHVSPPAAAINGVSEDYRSYFRSFV--SESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             YI+HV PP   +   SED  S++RSF+  + +     + R++++YR+V  GFAA+L+ + 
Sbjct  124   YIIHVKPPKGRVLSQSEDLESWYRSFLPATTAASSDNQPRMLYAYRNVLRGFAARLTQDQ  183

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             V  M  K GFISAR +R+    TTH+PNFLGL+Q  GFWR+S++GKGVI+GVLD GI P+
Sbjct  184   VRAMEGKDGFISARPERILKKLTTHTPNFLGLHQQKGFWRDSNFGKGVIIGVLDGGIFPS  243

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNF----VSEGssppppPVDEEGHGT  1817
             HPSF+DE MPPPPAKWKG+C+F  + CNNKLIGAR+F     +       PP+DE+GHGT
Sbjct  244   HPSFSDEGMPPPPAKWKGRCDFNVSDCNNKLIGARSFNLAAKATKGDKAEPPIDEDGHGT  303

Query  1816  HTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddg  1637
             HTASTAAG FV  A V G+AKGTAVGMAP AHL+IYKVC  + C ++DILAA+DAA++DG
Sbjct  304   HTASTAAGGFVNYADVLGNAKGTAVGMAPYAHLAIYKVCFGEDCPDADILAALDAAVEDG  363

Query  1636  vdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGA  1457
             VDVLSLSLG  S  FF DS+AIGAFAA EKGI VSC+AGN GP   TLSNEAPW+LTVGA
Sbjct  364   VDVLSLSLGDVSRPFFNDSLAIGAFAATEKGILVSCSAGNSGPVNSTLSNEAPWILTVGA  423

Query  1456  STIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG-SKDEDAALCGPGSLdkvd  1280
             STIDR I ATA LGN  + DGES  +  +FP T  PL+Y G +   D+A C  GSL  +D
Sbjct  424   STIDRKIIATAKLGNDEEFDGESIHR-GDFPQTSWPLVYAGINGKADSAFCAEGSLKDID  482

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
             VK KVVLC+RGGG+ R+ KG+ VK+AGGAAMIL+NQ+ DG++  AD H LPA  +S+ DG
Sbjct  483   VKNKVVLCERGGGVGRIAKGEEVKNAGGAAMILVNQESDGFSTEADPHALPAAHVSFADG  542

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
             LK+K YINST+ PTAT+ FKGT IG   AP +ASFSSRGP+ ASPGILKPDI+GPGV+IL
Sbjct  543   LKIKAYINSTATPTATLFFKGTVIGDSLAPFIASFSSRGPNLASPGILKPDIIGPGVSIL  602

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAWP   + N     + FNI+SGTSM+ PHLSGIA LLKS+HP WSPAAIKSAI+TTAD 
Sbjct  603   AAWPFPLDNNTNPK-SPFNIMSGTSMSCPHLSGIAVLLKSSHPYWSPAAIKSAIMTTADI  661

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              NL G  ILD+ L PADVFATG GHVNP +A+DPGLIYDLQ DDYIPYLCGL Y D+E+ 
Sbjct  662   VNLEGKAILDQALTPADVFATGAGHVNPIKANDPGLIYDLQPDDYIPYLCGLGYNDKEVG  721

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGV  380
              + +R ++CS+  SIPE +LNYPSF++ LG  S T++RTVTNVGEA S YT  +    GV
Sbjct  722   IVARRPIKCSEKPSIPEGELNYPSFSVTLGP-SQTFTRTVTNVGEAYSTYTANIMAPDGV  780

Query  379   DVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDID-FVQGAIAWVSQRHIVKSPIAIIFQ  206
              V V P  L F++VNQ+ TY+++FS  ++  +   + QG + WVS RH V+SPI++ FQ
Sbjct  781   YVSVKPSKLYFSKVNQKATYSVNFSRITSSGETGPYGQGFLTWVSARHCVRSPISVKFQ  839



>gb|KHN34449.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=689

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/681 (61%), Positives = 518/681 (76%), Gaps = 7/681 (1%)
 Frame = -1

Query  2236  ERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNF  2057
             E+ R+++SYR+V SGFAA+L+ E +  ++KK GFISA  +R+ +  TTH+P FLGL Q+ 
Sbjct  10    EQPRMIYSYRNVMSGFAARLTEEELRSVQKKNGFISAHPERMLHRQTTHTPQFLGLQQDM  69

Query  2056  GFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARN  1877
             GFW+ S++GKGVIVGV+D+GI P+HPSF+D  MPPPP KWKG+CE   T CNNKLIGAR+
Sbjct  70    GFWKESNFGKGVIVGVVDSGIEPDHPSFSDAGMPPPPLKWKGRCELNATFCNNKLIGARS  129

Query  1876  F--VSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKV  1703
             F   +        P+DE+GHGTHT+STAAG FV +A V G+AKGTA G+AP AHL++Y+V
Sbjct  130   FNLAATAMKGADSPIDEDGHGTHTSSTAAGAFVDHAEVLGNAKGTAAGIAPYAHLAMYRV  189

Query  1702  CTEDGCAESdilaamdaaiddgvdvlslslgggSAS-FFEDSIAIGAFAAMEKGIFVSCA  1526
             C  + CAESDILAA+DAA++DGVDV+S+SLG      FF DSIAIGAFAAM+KGIFVSCA
Sbjct  190   CFGEDCAESDILAALDAAVEDGVDVISISLGLSEPPPFFNDSIAIGAFAAMQKGIFVSCA  249

Query  1525  AGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPL  1346
             AGN GP + +L N APW+LTVGAS IDR+I ATA LGNG + DGES FQ  +F PTLLPL
Sbjct  250   AGNSGPFHGSLVNGAPWVLTVGASNIDRSIAATAKLGNGQEFDGESVFQPSDFSPTLLPL  309

Query  1345  IYPGSK-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQD  1169
              Y G    ++AA C  GSL+  D +GKVVLC+RGGGI R+ KG+ VK  GGAAMIL+N +
Sbjct  310   AYAGKNGKQEAAFCANGSLNDSDFRGKVVLCERGGGIGRIAKGEEVKRVGGAAMILMNDE  369

Query  1168  IDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSS  989
              +G+++LAD HVLPAT LSY+ GLK+K YINST+ PTATI+FKGT IG   AP+V SFSS
Sbjct  370   SNGFSVLADVHVLPATHLSYDSGLKIKAYINSTAIPTATILFKGTIIGNSLAPAVTSFSS  429

Query  988   RGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATL  809
             RGP+  SPGILKPDI+GPGVNILAAWP   N +  +  +TFN +SGTSM+ PHLSGIA L
Sbjct  430   RGPNLPSPGILKPDIIGPGVNILAAWPFPLNNDTDSK-STFNFMSGTSMSCPHLSGIAAL  488

Query  808   LKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLI  629
             LKS+HP WSPAAIKSAI+T+AD  N     I+DE L PADVFATG GHVNPSRA+DPGL+
Sbjct  489   LKSSHPHWSPAAIKSAIMTSADIINFEHKLIVDETLYPADVFATGSGHVNPSRANDPGLV  548

Query  628   YDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYS  449
             YD+Q DDYIPYLCGL Y D E+  I  + + CS+ +SIPE +LNYPSF++ LG    T++
Sbjct  549   YDIQPDDYIPYLCGLGYGDTEVGIIAHKTITCSETSSIPEGELNYPSFSVVLGSPQ-TFT  607

Query  448   RTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSP-SSTPVDIDFV  272
             RTVTNVGEANS Y V V    GV+V V P+ L F+E NQ+ TY++SFS   S     ++ 
Sbjct  608   RTVTNVGEANSSYVVMVMAPEGVEVKVRPNNLTFSEANQKETYSVSFSRIESGNETAEYA  667

Query  271   QGAIAWVSQRHIVKSPIAIIF  209
             QG + WVS +H V+SPI + F
Sbjct  668   QGFLQWVSAKHTVRSPILVDF  688



>ref|XP_002509669.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF51056.1| Cucumisin precursor, putative [Ricinus communis]
Length=767

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/728 (59%), Positives = 541/728 (74%), Gaps = 14/728 (2%)
 Frame = -1

Query  2353  KYEDTYIVHVSPPAAAINGVSEDYRSYFRSFVS---ESGDEGERSRIVHSYRHVASGFAA  2183
             K   TYIVHV+ P        ED +++ +SF+S    S +E ++ R+++SY+++ SGF+A
Sbjct  42    KNLQTYIVHVNQPEGRTFSQPEDLKNWHKSFLSFSTASSEEEQQQRMLYSYQNIISGFSA  101

Query  2182  KLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLD  2003
             +L+ E V  M +  GF+SA  +R   L TTH+P+FLGL+Q  G W++S +GKGVI+G+LD
Sbjct  102   RLTQEEVKAMEEITGFVSACLERKLRLQTTHTPSFLGLHQQMGLWKDSDFGKGVIIGILD  161

Query  2002  TGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNF----VSEGssppppPVD  1835
              G+ P+HPSF+DE MP PPAKWKG+CEF  + CNNKLIGAR F     +   +P  PP+D
Sbjct  162   GGVYPSHPSFSDEGMPLPPAKWKGRCEFNASECNNKLIGARTFNLAAKTMKGAPTEPPID  221

Query  1834  EEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVC---TEDGCAESdila  1664
              +GHGTHTASTAAG FV N+ V G+AKGTAVGMAP AHL+IYKVC     D C ESD+LA
Sbjct  222   VDGHGTHTASTAAGGFVYNSDVLGNAKGTAVGMAPFAHLAIYKVCFGDPNDDCPESDVLA  281

Query  1663  amdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNE  1484
              +DAA+DDGVDVLSLSLG  S  FF+D+IAIG+FAA++KGIFVSC+AGN GP   TLSNE
Sbjct  282   GLDAAVDDGVDVLSLSLGDVSMPFFQDNIAIGSFAAIQKGIFVSCSAGNSGPSKSTLSNE  341

Query  1483  APWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDE-DAALC  1307
             APW+LTVGASTIDR I A A LGNG +LDGES  Q  NFP TLLP++Y G   + D+A C
Sbjct  342   APWILTVGASTIDRRIVAIAKLGNGEELDGESVSQPSNFPTTLLPIVYAGMNSKPDSAFC  401

Query  1306  GPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLP  1127
             G G+L+ ++VK KVV+C+RGGGI R+ KG  VK+AGGAAMIL+N + +G++ +AD HVLP
Sbjct  402   GEGALEGMNVKDKVVMCERGGGIGRIAKGDEVKNAGGAAMILVNDETNGFSTIADAHVLP  461

Query  1126  ATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPD  947
             AT +S+  GLK+K YINST  P ATI+FKGT IG  ++P+V SFSSRGPS ASPGILKPD
Sbjct  462   ATHVSFAAGLKIKAYINSTKTPMATILFKGTVIGDSSSPAVTSFSSRGPSLASPGILKPD  521

Query  946   ILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIK  767
             I+GPGV+ILAAWP   + N      TFNI+SGTSM+ PHLSGIA LLKS+HP WSPAAIK
Sbjct  522   IIGPGVSILAAWPFPLDNNTNTKL-TFNIMSGTSMSCPHLSGIAALLKSSHPYWSPAAIK  580

Query  766   SAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCG  587
             SAI+TTAD  N+ G  I+DE   PAD FATG GHVNPSRA+DPGL+YD+Q DDYIPYLCG
Sbjct  581   SAIVTTADILNMEGKPIVDETHQPADFFATGAGHVNPSRANDPGLVYDIQPDDYIPYLCG  640

Query  586   LNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYT  407
             LNYTD+++  I  R + CS + +I E QLNYPSF++ LG    T+ RTVTNVG ANS++ 
Sbjct  641   LNYTDEQVSIIAHRPISCSTIQTIAEGQLNYPSFSVTLGPPQ-TFIRTVTNVGYANSVFA  699

Query  406   VKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDI-DFVQGAIAWVSQRHIVK  230
               ++   GV V V P  L F+++NQ+ TY+I+FS +       +F QG I WVS ++ V 
Sbjct  700   ATITSPPGVAVSVKPSRLYFSKLNQKATYSITFSHTGYGAKTSEFGQGYITWVSDKYFVG  759

Query  229   SPIAIIFQ  206
             SPI++ F+
Sbjct  760   SPISVRFK  767



>ref|XP_009760563.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=727

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/721 (61%), Positives = 535/721 (74%), Gaps = 34/721 (5%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSY-FRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPE  2168
             + YIVHV  P        E+   Y   S VS        SRI++SYR+V SGFAA+LSPE
Sbjct  33    EIYIVHVESP--------ENLHEYSLLSVVS--------SRIIYSYRNVFSGFAARLSPE  76

Query  2167  MVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITP  1988
              V  +  K GFIS R QRV  + TTH+P+FLGL+QN GFW  S+YG+GVI+G+LDTGI P
Sbjct  77    EVKLLETKDGFISIRPQRVLRVQTTHTPSFLGLHQNLGFWNTSNYGEGVIIGLLDTGIYP  136

Query  1987  NHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNF-VSEGssppppPVDEEGHGTHT  1811
              HPSF+DE MPPPPAKWKGKCEF  TACNNK+IGAR+F V EG      P+DE GHGTHT
Sbjct  137   EHPSFDDEGMPPPPAKWKGKCEFNFTACNNKIIGARDFSVFEG----GTPLDENGHGTHT  192

Query  1810  ASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDG-CAESdilaamdaaiddgv  1634
             +STAAGNFV  A VFGSA GTAVG+AP AHL++YKVC   G C+ESD+LAAMDAAIDDGV
Sbjct  193   SSTAAGNFVDGANVFGSANGTAVGIAPRAHLAMYKVCNPSGLCSESDMLAAMDAAIDDGV  252

Query  1633  dvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAS  1454
             DV+S+S+GG S  F++D+IA+GAF++M KGI VSC+AGNEGP   TLSNEAPW+LTVGAS
Sbjct  253   DVISISIGGISGPFWDDNIALGAFSSMAKGILVSCSAGNEGPYNGTLSNEAPWILTVGAS  312

Query  1453  TIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG--SKDEDAALCGPGSLdkvd  1280
             TIDR +KAT  LGNG + DGES +Q  +FPPTL+P++YP   S    A  C P SL   +
Sbjct  313   TIDRQMKATVALGNGVEFDGESTYQPNDFPPTLVPIVYPALNSSYFGAFACSPESL--TN  370

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
             V+GK+VLC  GG  A + KG+ VKDAG A MIL+N+DI+GYTI A  +VLPAT +SY D 
Sbjct  371   VEGKLVLCGTGGATA-IAKGKPVKDAGAAGMILMNEDIEGYTIPAHDYVLPATRISYADA  429

Query  1099  LKVKDYINSTSWPTATIVFKGTFI-GTKTAPSVASFSSRGPSNASPGILKPDILGPGVNI  923
               +  YINSTS P A+I+FKGT I G K AP+VA FSSRGP+ ASPGILKPDI+GPG NI
Sbjct  430   QNLIAYINSTSTPMASILFKGTVINGDKHAPTVAFFSSRGPNRASPGILKPDIIGPGFNI  489

Query  922   LAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTAD  743
             LAAWP     N      TFNIISGTSMA PHL+GIA LLKSAHPDWSPAAIKSAI+TTAD
Sbjct  490   LAAWPTSIENNTHTNL-TFNIISGTSMACPHLAGIAALLKSAHPDWSPAAIKSAIMTTAD  548

Query  742   QYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEI  563
               NL    I DE  +PA+VF  G GHVNPS+A+DPGLIYD+Q  DY+PYLCGLNYT+Q++
Sbjct  549   LVNLGNNPIEDELHLPANVFEIGAGHVNPSKANDPGLIYDIQPQDYVPYLCGLNYTEQQV  608

Query  562   QQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLG  383
               I Q KV C++  SIPEA+LNYPSF+I LG  +  Y+R VTNVGEA+S Y V++ P  G
Sbjct  609   SAIFQNKVNCTK--SIPEAELNYPSFSIKLGSETQEYTRAVTNVGEADSTYNVEILPPEG  666

Query  382   VDVGVTPDTLVFTEVNQQLTYNISF--SPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             V+V V+P +L F+   +++TY ++F  S S T  + +FVQG + W S +H+V+SPIA+I 
Sbjct  667   VEVTVSPSSLNFSAAKERMTYQVTFTRSASGTGRNTNFVQGYLKWSSDKHVVRSPIAVIL  726

Query  208   Q  206
             +
Sbjct  727   E  727



>ref|XP_003538718.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=758

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/720 (60%), Positives = 531/720 (74%), Gaps = 15/720 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSE--DYRSYFRSFVSESGD-EGERSRIVHSYRHVASGFAAKLSP  2171
             TYIV V  P +  +   +  D  S++ S +  S   +  + RI  SYR+V  GFA KL+P
Sbjct  44    TYIVRVKKPQSQGDDSLQYKDLHSWYHSLLPASTKTDQNQQRITFSYRNVVDGFAVKLNP  103

Query  2170  EMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGIT  1991
             E    +++K+  +SAR +R ++L+TTH+P+FLGL Q  G W NS++GKG+I+G+LDTGIT
Sbjct  104   EEAKALQEKEEVVSARPERTFSLHTTHTPSFLGLQQGLGLWTNSNFGKGIIIGILDTGIT  163

Query  1990  PNHPSFNDENMPPPPAKWKGKCEFEG-TACNNKLIGARNFVSEGssppppPVDEEGHGTH  1814
             P+H SFNDE MP PPAKW G CEF G   CNNKLIGARNFV         P+D+ GHGTH
Sbjct  164   PDHLSFNDEGMPLPPAKWSGHCEFTGEKTCNNKLIGARNFVKN--PNSTLPLDDVGHGTH  221

Query  1813  TASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgv  1634
             TASTAAG FV  A+VFG+AKGTAVGMAP AHL+IYKVC   GC+ES ILA MD AI DGV
Sbjct  222   TASTAAGRFVQGASVFGNAKGTAVGMAPDAHLAIYKVCDLFGCSESAILAGMDTAIQDGV  281

Query  1633  dvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAS  1454
             D+LSLSLGG  A FF+D IA+GAF+A++KGIFVSC+A N GP Y +LSNEAPW+LTVGAS
Sbjct  282   DILSLSLGGPPAPFFDDPIALGAFSAIQKGIFVSCSAANAGPFYSSLSNEAPWILTVGAS  341

Query  1453  TIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAA-LCGPGSLdkvdv  1277
             TIDR I A A LGNG   +GES FQ  NF  TLLPL+Y G+   D++  C PGSL  +DV
Sbjct  342   TIDRRIVAAAKLGNGEAFNGESVFQPNNFTSTLLPLVYAGANGNDSSTFCAPGSLQSMDV  401

Query  1276  kgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGL  1097
             KGKVVLC+ GG + RVDKGQ VK AGGAAMIL+N  I+ +   AD HVLPAT +SY  GL
Sbjct  402   KGKVVLCEIGGFVRRVDKGQEVKSAGGAAMILMNSPIEDFNPFADVHVLPATHVSYKAGL  461

Query  1096  KVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILA  917
              +K+YINSTS PTATI+F+GT IG   AP+V SFSSRGPS  SPGILKPDI+GPG NILA
Sbjct  462   AIKNYINSTSTPTATILFQGTVIGNPHAPAVTSFSSRGPSLESPGILKPDIIGPGQNILA  521

Query  916   AWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQY  737
             AWP+  + N       FNIISGTSM+ PHLSGIA LLK++HPDWSPAAIKSAI+T+A+  
Sbjct  522   AWPLSLDNNL----PPFNIISGTSMSCPHLSGIAALLKNSHPDWSPAAIKSAIMTSANTV  577

Query  736   NLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQ  557
             NL G  IL++RL+PADVFATG GHVNP +A+DPGL+YDLQ  DYIPYLCGLNYTD+E+  
Sbjct  578   NLGGKPILEQRLLPADVFATGAGHVNPLKANDPGLVYDLQPTDYIPYLCGLNYTDKEVGF  637

Query  556   IVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVD  377
             I+ +KV+C +V SI EAQLNYPSF+I LG +S  Y+RT+TNVG AN  Y+V+V     V 
Sbjct  638   ILNQKVKCLEVKSIAEAQLNYPSFSIRLGSSSQFYTRTLTNVGPANITYSVEVDAPSAVS  697

Query  376   VGVTPDTLVFTEVNQQLTYNISFSP--SSTPVDIDFVQGAIAWVSQ--RHIVKSPIAIIF  209
             + ++P  + FTEV Q+++Y++ F P   +      F QG+I WVS   ++ V  PIA+IF
Sbjct  698   ISISPAEIAFTEVKQKVSYSVGFYPEGKNNRRKHPFAQGSIKWVSSNGKYSVSIPIAVIF  757



>gb|ADY38794.1| serine protease [Coffea arabica]
Length=763

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/761 (58%), Positives = 544/761 (71%), Gaps = 30/761 (4%)
 Frame = -1

Query  2413  MAYISVVVCLTLV-FHSVASAKYED------TYIVHVSPP------AAAINGVSEDYRSY  2273
             M ++ +++ L ++ F S+A+    D      TYIVHV  P      +A+ +  ++D  ++
Sbjct  1     MGFMQILILLFVISFLSIAAKGLHDQESTVQTYIVHVELPTDTPLSSASASPNNDDLENW  60

Query  2272  FRSFV---SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNL  2102
             ++SF+   + S    E  R+++SY +V  GFAAKLS E V EM KK GF+SA  Q + +L
Sbjct  61    YKSFLPTTTISSSSNEAPRMLYSYHNVFKGFAAKLSAEDVKEMEKKPGFLSASPQEMLSL  120

Query  2101  YTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCE  1922
             +TTH+P+FLGL+ + GFW++S+YG GVI+GV+DTGI P+HPSF+DE MPPPPAKWKGKCE
Sbjct  121   HTTHTPSFLGLHPDMGFWKDSNYGNGVIIGVMDTGIRPDHPSFSDEGMPPPPAKWKGKCE  180

Query  1921  FEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAV  1742
             F  +ACNNKLIGARNF  E        +DE GHGTHTASTAAGNFV  A V  +A GTA 
Sbjct  181   FNSSACNNKLIGARNFNQE---FSDSVLDEVGHGTHTASTAAGNFVQGANVLRNANGTAA  237

Query  1741  GMAPLAHLSIYKVC--------TEDGCAESdilaamdaaiddgvdvlslslgggSASFFE  1586
             G+APLAHL++YKVC          D C ES ILAAMDAAIDDGVD+LSLS+GG S  F+ 
Sbjct  238   GIAPLAHLAMYKVCIIVCQGVICIDICPESAILAAMDAAIDDGVDILSLSIGGSSKPFYT  297

Query  1585  DSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGA  1406
             DS+A+GA+ AMEKGI VSC+AGN GP   +L NEAPW+LTVGASTIDR I ATA+LGN  
Sbjct  298   DSVALGAYTAMEKGILVSCSAGNGGPSNQSLENEAPWILTVGASTIDRKIVATALLGNKE  357

Query  1405  QLDGESAFQVENFPPTLLPLIYPGSKDED--AALCGPGSLdkvdvkgkvVLCDRGGGIAR  1232
             + DGES +  ++F  T  PL Y G    D  +A C   +L+   V+GK+V+CD GGGI+ 
Sbjct  358   EFDGESLYNPKHFLSTPFPLYYAGWNASDILSAYCFSSALNSSKVQGKIVVCDHGGGISG  417

Query  1231  VDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTAT  1052
               KG+ VK AGG  MI++N   +GYT  AD HVLPAT LSY DG+KV  YINST  P A 
Sbjct  418   AQKGEHVKAAGGVGMIIINGQNEGYTTFADAHVLPATHLSYADGVKVLSYINSTELPMAA  477

Query  1051  IVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNA  872
             I FKGT IG   AP VASFSSRGPS ASPGILKPDI+GPGVNILAAWP  +  NN N  +
Sbjct  478   ISFKGTIIGDDHAPVVASFSSRGPSMASPGILKPDIIGPGVNILAAWP-QSVENNTNTKS  536

Query  871   TFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPA  692
             TFNI+SGTSM+ PHLSG+A LLKSAHPDWSPAAIKSAI+TTAD  NL    I DERL+PA
Sbjct  537   TFNILSGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIMTTADLVNLAKNPIEDERLLPA  596

Query  691   DVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIP  512
             ++FA G GHVNPSRA++PGLIYD+   DY+PYLCGLNYT + +  I+QR+V C++ +SIP
Sbjct  597   NIFAIGSGHVNPSRANNPGLIYDIVPKDYVPYLCGLNYTRRGLLYILQRRVNCAEESSIP  656

Query  511   EAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQ  332
             EAQLNYPSF+I  G     Y+RTVTNVGEA S+YTVKV P  GV+V V P TL F+EV Q
Sbjct  657   EAQLNYPSFSIQFGSPIQRYTRTVTNVGEAKSVYTVKVVPPEGVEVIVKPKTLRFSEVKQ  716

Query  331   QLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             ++TY + FS   T  +    QG+I W S +  V+SPIA I 
Sbjct  717   KVTYEVVFSQLPTAANNTASQGSITWTSAKVSVRSPIATII  757



>gb|KCW72062.1| hypothetical protein EUGRSUZ_E00506, partial [Eucalyptus grandis]
Length=730

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/727 (58%), Positives = 530/727 (73%), Gaps = 20/727 (3%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYI+ V  P        ED  + +RSF+ + +    +  R+VHSYR+V SGFAAKL+ E 
Sbjct  9     TYIIQVQKPKDKDLTTLEDLDTLYRSFLPTAAASSNQEQRMVHSYRNVLSGFAAKLTAEE  68

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                +R+K   +  R ++  +L+TTH+PNFLGL+Q  G W +S+YGKG+I+GVLDTGI P+
Sbjct  69    AKAIREKDRVLHVRPEKALSLHTTHTPNFLGLHQGVGLWNDSNYGKGMIIGVLDTGIFPD  128

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppP--VDEEGHGTHT  1811
             HPSF+DE MPPPPAKWKG+C+F GT+CNNKLIGAR+F S  ++        D EGHGTHT
Sbjct  129   HPSFSDEGMPPPPAKWKGRCDFNGTSCNNKLIGARSFTSSSTTHAQAVPPYDGEGHGTHT  188

Query  1810  ASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvd  1631
             +STAAG FV +A+  G AKGTA GMAPLAHL++YKVC  +GC ESDILA +D AI+DGVD
Sbjct  189   SSTAAGAFVRDASALGHAKGTATGMAPLAHLAMYKVCDANGCLESDILAGLDTAIEDGVD  248

Query  1630  vlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAST  1451
             VLSLSLGG S  FF+DSIAIGAFAA +KGIFVSC+AGN GP   TLSNEAPW+LTVGAS+
Sbjct  249   VLSLSLGGISQPFFDDSIAIGAFAATQKGIFVSCSAGNSGPSDGTLSNEAPWILTVGASS  308

Query  1450  IDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG-SKDEDAALCGPGSLdkvdvk  1274
             IDRTIKATA LGNG + DGE+ +Q  +FPPTLLPLIY G + D  +ALC PGSL      
Sbjct  309   IDRTIKATAHLGNGQEFDGETLYQPHDFPPTLLPLIYAGVNGDPSSALCLPGSLGGRSDL  368

Query  1273  g-kvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGL  1097
               KVV+CD G G  RV KGQ VK+AGGAAMIL+N  I+GYT L D HVLPA  +SY  G+
Sbjct  369   QGKVVVCDIGDGRGRVAKGQEVKNAGGAAMILVNGPIEGYTTLVDAHVLPAVHVSYVAGM  428

Query  1096  KVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILA  917
              +KDY+++   P  TI+FKGT IG   AP+V+ FSSRGP+  SPGILKPDI+GPGVNI+A
Sbjct  429   AIKDYLSTAQAPAGTILFKGTLIGRSVAPAVSFFSSRGPNFQSPGILKPDIIGPGVNIIA  488

Query  916   AWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQY  737
              WP   + +    +A FN+ISGTSM+ PHLSG+A LLKSAHPDWSPAAIKSAI+TTA   
Sbjct  489   GWPFPLDNSTNLKHA-FNVISGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAILTTATTS  547

Query  736   NLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQ  557
             NL    I+D+ L PAD+FATG GHVNPS+A DPGLIYD+   DYI YLCGL YTD EI+ 
Sbjct  548   NLERRPIVDQTLHPADIFATGAGHVNPSKAVDPGLIYDVGPQDYIAYLCGLGYTDSEIET  607

Query  556   IVQRKVECSQVTSIPEAQLNYPSFAIWLGKT--SLTYSRTVTNVGEANSMYTVK-VSPFL  386
             IVQ  V CS + SIP+ QLNYPS ++    +  +++ +RTV NVG A S Y +  + P +
Sbjct  608   IVQETVTCSSIPSIPDYQLNYPSISVRFEGSVNTVSVTRTVRNVGPAKSRYILSLIDPIM  667

Query  385   GVD-VGVTPDTLVFTEVNQQLTYNISFSPS------STPVDIDFVQGAIAWVSQRHIVKS  227
             G+D +GV+P  L FTEVNQ ++Y + F+ S      +TP    F QGAI WVS +H V++
Sbjct  668   GLDSIGVSPGDLEFTEVNQTVSYTVDFTRSVDWNTTATP----FAQGAITWVSGQHSVRT  723

Query  226   PIAIIFQ  206
             P+A++F+
Sbjct  724   PVAVLFE  730



>ref|XP_006440474.1| hypothetical protein CICLE_v10023558mg [Citrus clementina]
 gb|ESR53714.1| hypothetical protein CICLE_v10023558mg [Citrus clementina]
Length=750

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/748 (58%), Positives = 549/748 (73%), Gaps = 21/748 (3%)
 Frame = -1

Query  2398  VVVCLTLVFH-----------SVASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFVSE  2252
             + + L  +FH           SV       TYIV V  P  +    SE   ++ RSF+  
Sbjct  7     IFLTLLFIFHFKKAHGTDQVSSVTERSNLQTYIVSVQQPEGSDLAESEYVENWHRSFLPY  66

Query  2251  SGDEGE-RSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFL  2075
             S +  + + R  +SY++V SGFAAKL+ E V +M+KK GF+SAR +R   L TTHSP+FL
Sbjct  67    SLESSDVQQRPFYSYKNVISGFAAKLTEEEVQDMKKKNGFVSARPERKVRLQTTHSPSFL  126

Query  2074  GLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNK  1895
             GL+Q  G W+ S++GKGVI+G+LD GI P+HPSF+DE MPPPPAKWKG+C+F  + CNNK
Sbjct  127   GLHQGMGVWKESNFGKGVIIGILDGGINPDHPSFSDEGMPPPPAKWKGRCDF--STCNNK  184

Query  1894  LIGARNFVSEGssppppP-VDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHL  1718
             LIGAR F  EG+     P +D +GHGTH A TAAG FV NA   G+AKGTAVGMAP AHL
Sbjct  185   LIGARTFNIEGNVKGTEPPIDVDGHGTHVAGTAAGAFVKNAESLGNAKGTAVGMAPYAHL  244

Query  1717  SIYKVC--TEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKG  1544
             +IYKVC   +  C ESD+LA +DAAI+DGVDVLS+S+GGGS  FF DSIA+G+FAA++KG
Sbjct  245   AIYKVCFGGDVDCTESDLLAGLDAAIEDGVDVLSISIGGGSVPFFNDSIAVGSFAAIQKG  304

Query  1543  IFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFP  1364
             IFVSCAAGN GP   T+SNEAPW+LTVGAST+DR+I ATA LGN  + DGES FQ ++FP
Sbjct  305   IFVSCAAGNSGPFNSTISNEAPWILTVGASTLDRSIVATAKLGNREEFDGESVFQPKDFP  364

Query  1363  PTLLPLIYPGSKDE-DAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAM  1187
              T LPL+Y G   + ++A CG GSL  +DVKGKVVLC+RGGGIAR+ KG+ VK+AGGAAM
Sbjct  365   QTPLPLVYAGMNGKPESAFCGNGSLSGIDVKGKVVLCERGGGIARIFKGEQVKNAGGAAM  424

Query  1186  ILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPS  1007
             IL+N + + ++++AD HVLPAT +S + GLK+K YINST+ P ATI+FKGT IG   AP+
Sbjct  425   ILMNDEPNAFSVIADPHVLPATHVSNDAGLKIKSYINSTATPMATIIFKGTVIGNSLAPT  484

Query  1006  VASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHL  827
             V SFSSRGP+ ASPGILKPDI+GPG++ILAAW       N N  + FNI+SGTSMA PHL
Sbjct  485   VVSFSSRGPNLASPGILKPDIIGPGLSILAAW-FEPLDFNTNPKSIFNIMSGTSMACPHL  543

Query  826   SGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRA  647
             SGIA LLKS+HP WSPAAIKSA++TTAD  N+NG +I+DE L PAD+FA G GHVNPSRA
Sbjct  544   SGIAALLKSSHPYWSPAAIKSALMTTADLLNMNGERIVDETLRPADIFAIGAGHVNPSRA  603

Query  646   SDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGK  467
             +DPGL+YD+Q DDYIPYLCGL Y+D+E+  +V R V CS +  IPEAQLNYPSF++ LG 
Sbjct  604   NDPGLVYDIQPDDYIPYLCGLGYSDKEVGILVHRPVVCSGIGKIPEAQLNYPSFSVTLGP  663

Query  466   TSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPS-STP  290
                T++RTVTNVG+  S Y V V    GV V V P  L F++VNQ+ TY+++F+ S S  
Sbjct  664   AQ-TFTRTVTNVGQVYSSYAVNVVAPQGVVVSVKPSKLYFSKVNQKATYSVTFTRSGSGY  722

Query  289   VDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
                 F QG I WVS ++ V+SPI++  Q
Sbjct  723   TSGQFAQGYITWVSAKYSVRSPISVRLQ  750



>gb|KDP25559.1| hypothetical protein JCGZ_20715 [Jatropha curcas]
Length=745

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/742 (59%), Positives = 542/742 (73%), Gaps = 12/742 (2%)
 Frame = -1

Query  2419  PNMAYISVVVCLTLVFHSVASAKYE--DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESG  2246
             P M  I ++  +++   S+A+ +    +TYIV V  P +A +  ++D   +++SF+  S 
Sbjct  10    PKMVVICLLSLVSIASSSLATTEERNIETYIVLVEKPESAASMQAKDLDIWYQSFLPVSN  69

Query  2245  DEGERS-RIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGL  2069
              +  ++ RIV+SY +V SGFAAK++ E    +  K+GF+ AR ++V +L+TTHSP FLGL
Sbjct  70    SKSNQTARIVYSYHNVVSGFAAKMTAEEAKSIEGKEGFLLARPEKVLHLHTTHSPRFLGL  129

Query  2068  YQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLI  1889
              QN GFW  SSYGKGVI+GVLDTGI P+HPSF+DE MPPPPAKWKGKCEF    CNNKLI
Sbjct  130   QQNVGFWNYSSYGKGVIIGVLDTGIFPDHPSFSDEGMPPPPAKWKGKCEFNEIVCNNKLI  189

Query  1888  GARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIY  1709
             GARNF+S G  P        GHGTHTASTAAG+ V +A +FG A GTAVG+APLAHL++Y
Sbjct  190   GARNFISAGKPPIGF-----GHGTHTASTAAGSPVQSANLFGQANGTAVGIAPLAHLAMY  244

Query  1708  KVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSC  1529
             KVC   GC E+ +LAAMD AIDDGVDVLSLSLGG S  FF D IAIGA+ A+ KGIFVSC
Sbjct  245   KVCAGFGCPETAVLAAMDTAIDDGVDVLSLSLGGASLPFFHDVIAIGAYGAIRKGIFVSC  304

Query  1528  AAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLP  1349
             +AGN GP   +LSNEAPW+LTVGASTIDRTI+AT +LGN +   GES FQ ++  P  LP
Sbjct  305   SAGNSGPGNSSLSNEAPWILTVGASTIDRTIRATILLGNMSTFYGESLFQPKDLLPKFLP  364

Query  1348  LIYPGSK-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQ  1172
             L+Y G+  +  +A C PGSL KVDVKGK+VLC+ GG I R+DKGQ VKD GGAAMIL+N 
Sbjct  365   LVYAGANGNASSAFCAPGSLRKVDVKGKIVLCESGGEIERIDKGQEVKDNGGAAMILMND  424

Query  1171  DIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFS  992
             +++GY   AD HVLPA+ ++Y DG+ +K Y NSTS P ATI+F+GT  G   AP VA FS
Sbjct  425   ELNGYITEADFHVLPASHVNYVDGIAIKSYFNSTSSPVATILFQGTVTGLPKAPQVAEFS  484

Query  991   SRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIAT  812
             SRGPS ASPGILKPDI GPGV+ILAAWP+  +    +  +TFN +SGTSM+ PHLSG+A 
Sbjct  485   SRGPSVASPGILKPDITGPGVSILAAWPISVDNRIKSK-STFNFLSGTSMSCPHLSGVAA  543

Query  811   LLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGL  632
             LLKSAHPDWSPAAIKSAI+TTA   NL G  I DE+ VPA+VF  G GHVNPS A++PGL
Sbjct  544   LLKSAHPDWSPAAIKSAIMTTARISNLLGEPISDEQFVPANVFDLGSGHVNPSEANNPGL  603

Query  631   IYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTY  452
             +YD+Q DDYIPYLCGL Y+D+E+  IVQR V+CS  + IPEAQLNYPSF+I LG T  TY
Sbjct  604   VYDIQPDDYIPYLCGLAYSDKEVGLIVQRPVKCSNYSRIPEAQLNYPSFSIKLGSTPQTY  663

Query  451   SRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEV-NQQLTYNISFSPSSTPVDIDF  275
              RTVTNVG   S +  ++    GVDV V P+ LVF+   NQ+ TY+++F  +    +  F
Sbjct  664   LRTVTNVGLPGSAFLPEIIAPPGVDVEVKPNALVFSNSENQKATYSVTFRRNGN-ANGAF  722

Query  274   VQGAIAWVSQRHIVKSPIAIIF  209
              QG I W S+ + V SPIA+IF
Sbjct  723   AQGYITWTSELYSVTSPIAVIF  744



>ref|XP_006477586.1| PREDICTED: subtilisin-like protease SDD1-like [Citrus sinensis]
Length=750

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/748 (58%), Positives = 549/748 (73%), Gaps = 21/748 (3%)
 Frame = -1

Query  2398  VVVCLTLVFH-----------SVASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFVSE  2252
             + + L  +FH           SV       TYIV V  P  +    SE   ++ RSF+  
Sbjct  7     IFLTLLFIFHFKKAHGTDQVSSVTERSNLQTYIVSVQQPEGSDLAESEYVENWHRSFLPY  66

Query  2251  SGDEGE-RSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFL  2075
             S +  + + R  +SY++V SGFAAKL+ E V +M+KK GF+SAR +R   L TTHSP+FL
Sbjct  67    SLESSDVQQRPFYSYKNVISGFAAKLTEEEVQDMKKKNGFVSARPERKVRLQTTHSPSFL  126

Query  2074  GLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNK  1895
             GL+Q  G W+ S++GKGVI+G+LD GI P+HPSF+DE MPPPPAKWKG+C+F  + CNNK
Sbjct  127   GLHQGMGVWKESNFGKGVIIGILDGGINPDHPSFSDEGMPPPPAKWKGRCDF--STCNNK  184

Query  1894  LIGARNFVSEGssppppP-VDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHL  1718
             LIGAR F  EG+     P +D +GHGTH A TAAG FV NA   G+AKGTA GMAP AHL
Sbjct  185   LIGARTFNIEGNVKGTEPPIDVDGHGTHVAGTAAGAFVKNAESLGNAKGTAAGMAPYAHL  244

Query  1717  SIYKVC--TEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKG  1544
             +IYKVC   +  C ESD+LA +DAAI+DGVDVLS+S+GGGS  FF DSIA+G+FAA++KG
Sbjct  245   AIYKVCFGGDVDCTESDLLAGLDAAIEDGVDVLSISIGGGSVPFFNDSIAVGSFAAIQKG  304

Query  1543  IFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFP  1364
             IFVSCAAGN GP   T+SNEAPW+LTVGAST+DR+I ATA LGN  + DGES FQ ++FP
Sbjct  305   IFVSCAAGNSGPFNSTISNEAPWILTVGASTLDRSIVATAKLGNREEFDGESVFQPKDFP  364

Query  1363  PTLLPLIYPGSKDE-DAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAM  1187
              T LPL+Y G   + ++A CG GSL  +DVKGKVVLC+RGGGIAR+ KG+ VK+AGGAAM
Sbjct  365   QTPLPLVYAGMNGKPESAFCGNGSLSGIDVKGKVVLCERGGGIARIFKGEQVKNAGGAAM  424

Query  1186  ILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPS  1007
             IL+N + + ++++AD HVLPAT +S + GLK+K YINST+ P ATI+FKGT IG   AP+
Sbjct  425   ILMNDEPNAFSVIADPHVLPATHVSNDAGLKIKSYINSTATPMATIIFKGTVIGNSLAPT  484

Query  1006  VASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHL  827
             V SFSSRGP+ ASPGILKPDI+GPG++ILAAW       N N  + FNI+SGTSMA PHL
Sbjct  485   VVSFSSRGPNLASPGILKPDIIGPGLSILAAW-FEPLDFNTNPKSIFNIMSGTSMACPHL  543

Query  826   SGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRA  647
             SGIA LLKS+HP WSPAAIKSA++TTAD  N+NG +I+DE L PAD+FA G GHVNPSRA
Sbjct  544   SGIAALLKSSHPYWSPAAIKSALMTTADLLNMNGERIVDETLRPADIFAIGAGHVNPSRA  603

Query  646   SDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGK  467
             +DPGL+YD+Q DDYIPYLCGL Y+D+E+  +V R V CS++  IPEAQLNYPSF++ LG 
Sbjct  604   NDPGLVYDIQPDDYIPYLCGLGYSDKEVGILVHRPVVCSRIGKIPEAQLNYPSFSVTLGP  663

Query  466   TSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPS-STP  290
                T++RTVTNVG+  S Y V V    GV V V P  L F++VNQ+ TY+++F+ S S  
Sbjct  664   AQ-TFTRTVTNVGQVYSSYAVNVVAPQGVVVSVKPSKLYFSKVNQKATYSVTFTRSGSGY  722

Query  289   VDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
                 F QG I WVS ++ V+SPI++  Q
Sbjct  723   TSGQFAQGYITWVSAKYSVRSPISVRLQ  750



>ref|XP_007155580.1| hypothetical protein PHAVU_003G214100g [Phaseolus vulgaris]
 gb|ESW27574.1| hypothetical protein PHAVU_003G214100g [Phaseolus vulgaris]
Length=749

 Score =   782 bits (2019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/748 (57%), Positives = 539/748 (72%), Gaps = 16/748 (2%)
 Frame = -1

Query  2410  AYISVVVCLTLVFH--------SVASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFVS  2255
             ++  + +   L FH          ++A    TYI+HV  P       SED  S+  SF+ 
Sbjct  3     SFFFIALTFVLSFHIHFAQANEQPSTASSSKTYIIHVKWPQGKTLAQSEDLESWHNSFMP  62

Query  2254  ESGDEGE-RSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNF  2078
              +    E + R+++SYR+V SGFAA+LS E +  + KK GFISA  +R+ +  TTH+P F
Sbjct  63    PTTMSSEDQPRMIYSYRNVISGFAARLSEEELRAVEKKNGFISAHPERMLHRQTTHTPRF  122

Query  2077  LGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNN  1898
             LGL Q  G W+ S++GKGVIVGVLD+GITP+HPSF+D  MPPPP KWKG+CE  GTACNN
Sbjct  123   LGLQQQMGLWKESNFGKGVIVGVLDSGITPHHPSFSDAGMPPPPPKWKGRCELNGTACNN  182

Query  1897  KLIGARNF--VSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLA  1724
             KLIGAR+F   +E +     P+DE+GHGTHTASTAAG FV  A V G+AKGTA G+AP A
Sbjct  183   KLIGARSFNLAAEPTKEAGTPIDEDGHGTHTASTAAGAFVDYAEVLGNAKGTAAGIAPHA  242

Query  1723  HLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSAS-FFEDSIAIGAFAAMEK  1547
             HL+IYKVC  + C ES+ILAA+DAA++DGVDV+S+SLG      FF DS AIG FAAM+K
Sbjct  243   HLAIYKVCFGEDCPESNILAALDAAVEDGVDVISISLGPSEPPPFFNDSTAIGTFAAMQK  302

Query  1546  GIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENF  1367
             GIFVSCAAGN GP + +L N APW+LTVGAS IDR+  ATA LGNG + DGE+ FQ  +F
Sbjct  303   GIFVSCAAGNSGPVHGSLVNGAPWILTVGASNIDRSFVATAKLGNGQEFDGETVFQPSDF  362

Query  1366  PPTLLPLIYPGSK-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAA  1190
              PT L L Y G    ++AA C  GSL+  D +GKVVLC+RGGGI R+ KG+ VK AGG A
Sbjct  363   SPTPLFLRYAGKNGKQEAAFCANGSLNDFDFRGKVVLCERGGGIGRIAKGEEVKRAGGTA  422

Query  1189  MILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAP  1010
             MIL+N + +G+++ AD HVLPAT +SY+ GL++K YINST+ P ATI+FKGT IG   +P
Sbjct  423   MILMNDESNGFSLSADVHVLPATHVSYDAGLQIKAYINSTATPIATILFKGTIIGNSLSP  482

Query  1009  SVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPH  830
             +V+SFSSRGP+  SPGILKPDI+GPGV+ILAAWP   N N  +  +TFNI+SGTSM+ PH
Sbjct  483   AVSSFSSRGPNLPSPGILKPDIVGPGVDILAAWPFPLNNNTHSK-STFNIMSGTSMSCPH  541

Query  829   LSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSR  650
             LSG+A LLKS+HP WSPAAIKSAI+T+A+  N     I+DE L  ADVFATG GHVNPSR
Sbjct  542   LSGVAALLKSSHPHWSPAAIKSAIMTSAEILNFEHKLIVDETLHTADVFATGSGHVNPSR  601

Query  649   ASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLG  470
             A+DPGL+YD+ +DDYIPYLCGL Y+D E+  I  R V+CSQ  SIPE QLNYPSF++ LG
Sbjct  602   ANDPGLVYDITADDYIPYLCGLGYSDTEVGIIAHRTVKCSQTPSIPEGQLNYPSFSVSLG  661

Query  469   KTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTP  290
                + ++RTVTNVGEANS Y V V P  GVDV V P+ L F+E NQ+ TY++SFS     
Sbjct  662   SPKI-FTRTVTNVGEANSSYEVTVKPPEGVDVKVKPNKLYFSEANQKETYSVSFSRIDAG  720

Query  289   VD-IDFVQGAIAWVSQRHIVKSPIAIIF  209
              + +++ QG + WVS  H V SPI + F
Sbjct  721   NETVEYAQGFLKWVSSEHTVSSPILVYF  748



>gb|EYU28956.1| hypothetical protein MIMGU_mgv1a023117mg [Erythranthe guttata]
Length=729

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/717 (61%), Positives = 531/717 (74%), Gaps = 12/717 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAI--NGVSEDYRSYFRSFVSES-GDEGERSRIVHSYRHVASGFAAKLSP  2171
             TYIV V  P   +  +  +E    ++RSF+  +   E E  RI++SYR+V SGFA KL+ 
Sbjct  18    TYIVRVDSPVTQLLSDQSNEHLERWYRSFLPTTLATETETPRIIYSYRNVFSGFAVKLTA  77

Query  2170  EMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGIT  1991
             +   EM+KK GFISAR Q+  +L+TTH+PNFLGL+QN G W  S+YGKG+I+GVLDTGI 
Sbjct  78    DEAQEMQKKTGFISARPQQQLSLHTTHTPNFLGLHQNSGLWNESNYGKGIIIGVLDTGIV  137

Query  1990  PNHPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppPVDEEGHGTH  1814
             P+HPSF+DE MPPPPAKWKG CEF  T ACNNKLIGAR+F +EG   P   +D  GHGTH
Sbjct  138   PDHPSFSDEGMPPPPAKWKGACEFNFTGACNNKLIGARHF-AEGDGTP---LDFNGHGTH  193

Query  1813  TASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTE-DGCAESdilaamdaaiddg  1637
             TA TAAGNFV  A VFG A GTA G+APLAHL++YKVC+   GC+ESD LAAMD AI+DG
Sbjct  194   TAGTAAGNFVRGANVFGIANGTAAGIAPLAHLAVYKVCSRGSGCSESDTLAAMDIAIEDG  253

Query  1636  vdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGA  1457
             VD+LSLSLG  S  F+ D IA+G+F+AME+GIFVS +A N GP  ++L+NEAPW+LTVGA
Sbjct  254   VDILSLSLGAPSRPFYNDYIALGSFSAMERGIFVSASADNNGPFNFSLANEAPWMLTVGA  313

Query  1456  STIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDED--AALCGPGSLdkv  1283
             STIDR + A A+LGN  +L+GESA+   +FP T LPL+YPGS   +  AA C   SL+  
Sbjct  314   STIDRRLVANAILGNNEELEGESAYHPMDFPLTQLPLVYPGSNTSNSGAAFCTQRSLNNT  373

Query  1282  dvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYND  1103
             DV+GK+VLC  GGGIA V KGQ VKDAGG AMIL+  +  G+T  A+ HVLPAT ++Y D
Sbjct  374   DVRGKIVLCRIGGGIAGVAKGQAVKDAGGVAMILVGIEQRGFTTTAEAHVLPATNINYRD  433

Query  1102  GLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNI  923
             G KV  YINSTS PTA IVFKGT IG K +P+VA+FSSRGPS ASPGILKPDI+GPGVNI
Sbjct  434   GQKVMAYINSTSAPTAGIVFKGTVIGDKNSPAVAAFSSRGPSRASPGILKPDIIGPGVNI  493

Query  922   LAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTAD  743
             LAA  +    NN N N TF  +SGTSM+ PHLSG+A LLKS HPDWSPAAIKSAI+TTAD
Sbjct  494   LAAH-LTYVENNTNTNITFRFVSGTSMSCPHLSGVAALLKSVHPDWSPAAIKSAIMTTAD  552

Query  742   QYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEI  563
               NL   +I DER +PAD+FATG GHVNP RAS+PGL+YD++  DY+PYLCGLNYT++E+
Sbjct  553   NVNLENRQIQDERHLPADIFATGAGHVNPVRASNPGLVYDIEPRDYVPYLCGLNYTNREM  612

Query  562   QQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLG  383
               I QRKV CS  + I E QLNYPSFAI  G ++ T++RTVTNVGEA+S Y V+V    G
Sbjct  613   NIITQRKVNCSAESRIVEGQLNYPSFAIRFGSSNQTFTRTVTNVGEASSSYAVEVVAPPG  672

Query  382   VDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAII  212
             +DV V P  L F+++NQ+ TY ++FS S    +    QG I W S  H V+SPIA+ 
Sbjct  673   IDVIVEPRRLDFSQLNQKSTYEVTFSRSEITSNTSVSQGYIVWKSANHSVRSPIAVF  729



>gb|EYU28961.1| hypothetical protein MIMGU_mgv1a020058mg [Erythranthe guttata]
Length=740

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/742 (58%), Positives = 545/742 (73%), Gaps = 24/742 (3%)
 Frame = -1

Query  2395  VVCLTLVFHSVASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFVSES--------GDE  2240
             ++C+ L  + + +A+  D YIVHV P        SE+  + + SF+  +         D 
Sbjct  9     IICI-LNLNQILNAENLDVYIVHVDPSQ------SENLETSYDSFLPTTTNPAAASANDN  61

Query  2239  GERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQN  2060
               R RI+H YR+V SGFAAKLS   V  MR+  GF+SAR ++V+ L+TTH+PNFLGL QN
Sbjct  62    NNRPRILHRYRNVFSGFAAKLSIADVEAMRQMNGFVSARPEKVFPLHTTHTPNFLGLIQN  121

Query  2059  FGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEF-EGTACNNKLIGA  1883
              GFW++S+YGKGVIVG+LD+GI+P+HPSF+DE MPPPP KW+G+C+F    ACNNKLIGA
Sbjct  122   SGFWKDSNYGKGVIVGLLDSGISPDHPSFSDEGMPPPPPKWRGECQFGSKNACNNKLIGA  181

Query  1882  RNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKV  1703
             + F +        P DEEGHGTHTA+TAAG+FVG A ++G+A GTA GMAPLAH+++Y+V
Sbjct  182   KYFTN---GNATTPFDEEGHGTHTAATAAGSFVGGANIYGNAAGTAAGMAPLAHVAMYRV  238

Query  1702  CTEDGCAESdilaamdaaiddgvdvlslslgggSASFFE-DSIAIGAFAAMEKGIFVSCA  1526
             C+  GC+ESDI+A MDAAI+DGVDV+S+SLGGGS + F+ D+IAIGAF AMEKGI VSC+
Sbjct  239   CSPSGCSESDIMAGMDAAIEDGVDVISISLGGGSPTAFDKDNIAIGAFRAMEKGIVVSCS  298

Query  1525  AGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTL-LP  1349
             AGN GP   +LSNEAPW+LTVGASTIDR IKATAVLGN  + DGE+AFQ  +FP T  L 
Sbjct  299   AGNNGPALVSLSNEAPWILTVGASTIDRKIKATAVLGNNEEYDGETAFQPNDFPSTTKLG  358

Query  1348  LIYPGSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQD  1169
             L++PG     +  CG G+LD+  V+GK+VLC+ GG   RVDKG+ VK+AGGAAMIL+NQ 
Sbjct  359   LVFPGQISNMSLYCGEGALDENIVRGKIVLCEIGGTGTRVDKGKAVKNAGGAAMILMNQQ  418

Query  1168  IDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSS  989
               G T  A+ HVLPA  ++Y D LK+K Y++S   P ATIVFKGT IG   AP VA+FSS
Sbjct  419   AQGDTTRAEAHVLPAIHVNYVDALKIKAYVSSNPNPIATIVFKGTVIGDNRAPVVAAFSS  478

Query  988   RGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATL  809
             RGPS  SPGILKPDI+GPGVNILAAWPV          +TFN++SGTSM+ PHLSG+A L
Sbjct  479   RGPSLLSPGILKPDIIGPGVNILAAWPVSVENKTDTK-STFNMVSGTSMSCPHLSGVAAL  537

Query  808   LKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLI  629
             LKSAHPDW PA IKSAI+TTADQ NL G  I  E L PADVFA G GHVNPSRA+DPGL+
Sbjct  538   LKSAHPDWLPAVIKSAIMTTADQVNLGGNPIETELLKPADVFAIGAGHVNPSRANDPGLV  597

Query  628   YDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYS  449
             YD+Q  +Y+ YLCG+N+T+ ++  IVQRKV+CS+ T I E+QLNYPSF+I LG T  TYS
Sbjct  598   YDIQPHEYVSYLCGMNFTESQVGVIVQRKVDCSKETRIAESQLNYPSFSIVLGSTPQTYS  657

Query  448   RTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSS--TPVDIDF  275
             RTVTNVGE  S Y V++    GV V V P  L FT++ Q L+YN++F+ S   T    D+
Sbjct  658   RTVTNVGECESSYDVEIGSPEGVTVVVEPVKLDFTKLGQTLSYNVTFTRSDGGTLTTDDY  717

Query  274   VQGAIAWVSQRHIVKSPIAIIF  209
             VQG + W S ++ V+SPIA++ 
Sbjct  718   VQGFVTWHSGKYSVRSPIAVVI  739



>ref|XP_007158428.1| hypothetical protein PHAVU_002G152400g [Phaseolus vulgaris]
 gb|ESW30422.1| hypothetical protein PHAVU_002G152400g [Phaseolus vulgaris]
Length=746

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/755 (57%), Positives = 550/755 (73%), Gaps = 22/755 (3%)
 Frame = -1

Query  2431  MKGTPNMAYISVVVCLTLVFHSVASAKYED------TYIVHVSPPAAAINGVSEDYRSYF  2270
             M+ +  +  ++ ++ L  +  ++A++  +D      TYIVHV  P +     SE+   ++
Sbjct  1     MEKSKYVLELAFLLGLVFMLSTMATSFAKDHGSNLQTYIVHVKRPESRATIESEELHKWY  60

Query  2269  RSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTH  2090
              SF+ ++ +   + R+V SYR+VASGFA KL+PE    + +K   +SAR +R+ +L+TTH
Sbjct  61    HSFLPQASN---KDRMVFSYRNVASGFAVKLTPEEAKALLEKDEIVSARPERILSLHTTH  117

Query  2089  SPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGT  1910
             +P+FLGL Q  G W +S+ G+GVI+GV+DTGI P HPSFNDE MPPPP KWKG CEF G 
Sbjct  118   TPSFLGLRQGLGLWNSSNLGQGVIIGVIDTGIYPFHPSFNDEGMPPPPPKWKGHCEFTGQ  177

Query  1909  -ACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMA  1733
               CNNKLIGARN +   +  PP   +   HGTHTA+ AAG FV NA+VFG+A+GTA GMA
Sbjct  178   RTCNNKLIGARNLLKSANEEPP--FENFFHGTHTAAEAAGRFVENASVFGNAQGTAAGMA  235

Query  1732  PLAHLSIYKVCTED-GCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAA  1556
             P AHL++YKVC +  GC ES ILAAMD AIDDGVDVLSLSLG GS  F ED IAIGAFAA
Sbjct  236   PNAHLAMYKVCNDKVGCTESAILAAMDIAIDDGVDVLSLSLGLGSLPFVEDPIAIGAFAA  295

Query  1555  MEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQV  1376
             ++ G+FVSC+A N GP Y TLSNEAPW+LTVGASTIDR I A+AVLGNGA+ +GES FQ 
Sbjct  296   IQNGVFVSCSAANSGPGYSTLSNEAPWILTVGASTIDRKIAASAVLGNGAEYEGESLFQP  355

Query  1375  ENFPPTLLPLIYPGSKD-EDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAG  1199
             E+F PTLLPL+Y G+    +++ C PG L+ VDVKGKVV+CD GGG + V KGQ V DAG
Sbjct  356   EDFSPTLLPLVYAGANGILNSSFCVPGFLNNVDVKGKVVVCDIGGGFSSVVKGQVVLDAG  415

Query  1198  GAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTK  1019
             G AMIL N    G++  A  HVLPA E+SY  GL +K YINST+ PTATI FKGT IG  
Sbjct  416   GVAMILANSQSLGFSTFAVAHVLPAVEVSYVAGLAIKSYINSTTSPTATISFKGTVIGDA  475

Query  1018  TAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMA  839
              AP+V SFSSRGPS ASPGILKPDI+GPGVNILAAW V  +         +NI+SGTSM+
Sbjct  476   LAPAVVSFSSRGPSQASPGILKPDIIGPGVNILAAWAVSVDNKI----PPYNIVSGTSMS  531

Query  838   TPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVN  659
              PHLSG+A LLKSAHPDWSPAAIKSAI+TTA+  NL G  ILD+RL+PAD+FATG GHVN
Sbjct  532   CPHLSGVAALLKSAHPDWSPAAIKSAIMTTANTVNLGGQPILDQRLLPADIFATGAGHVN  591

Query  658   PSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAI  479
             P++A+DPGL+YD+QSDDYIPYLCGL Y D+EI  +VQR+V CS V +IPEAQLNYPSF+I
Sbjct  592   PNKANDPGLVYDIQSDDYIPYLCGLGYEDREIGILVQRRVRCSGVKAIPEAQLNYPSFSI  651

Query  478   WLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPS  299
              +G  +  Y+RT+TNVG A + Y V +   L + + V P  + FTEVNQ++T+++ F P 
Sbjct  652   VMGSDTQYYTRTLTNVGPAEATYIVDLVVPLAMGMSVNPSQITFTEVNQKVTFSVEFIPQ  711

Query  298   --STPVDIDFVQGAIAW--VSQRHIVKSPIAIIFQ  206
                   +  F QG+++W  VS +H V+ P+++IF+
Sbjct  712   IKENRGNHTFAQGSLSWIRVSDKHTVRIPLSVIFK  746



>ref|XP_004245672.2| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SDD1 
[Solanum lycopersicum]
Length=1453

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/721 (60%), Positives = 538/721 (75%), Gaps = 11/721 (2%)
 Frame = -1

Query  2353  KYEDTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERS--RIVHSYRHVASGFAAK  2180
             +  + YIVH   P         D  S++ SF+  +  +  R   R+++SYR+V +GFA K
Sbjct  737   RNSEVYIVHCEFPEGERGTRYLDLDSWYLSFLPATTSDSSREAPRLIYSYRNVLTGFAVK  796

Query  2179  LSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDT  2000
             LSP+ + EM K +GFISAR +R+ +LYTTHS +FLGL+QN G W +S+YGKGVI+GV+DT
Sbjct  797   LSPDDLKEMEKMEGFISARPERLLDLYTTHSVDFLGLHQNTGLWNDSNYGKGVIIGVIDT  856

Query  1999  GITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHG  1820
             GI P+HPSFND+ MPPPPAKWKGKCEF  T CNNKLIGAR F S G+       DE GHG
Sbjct  857   GIFPDHPSFNDDGMPPPPAKWKGKCEFNVTKCNNKLIGARYFQSSGNETSW---DEIGHG  913

Query  1819  THTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaidd  1640
             THTASTAAG FV  A +FG+A GTAVG+APLAH+++YKVC+   C+ES +LAAMD AIDD
Sbjct  914   THTASTAAGRFVPGANIFGNANGTAVGVAPLAHIAMYKVCSGLTCSESHVLAAMDMAIDD  973

Query  1639  gvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVG  1460
             GVDVLSLSLG  + +F+ED++A+GAF+AM+KGIFVSCAAGN GP  ++ SNEAPW+LTVG
Sbjct  974   GVDVLSLSLGTLTNNFYEDNVALGAFSAMQKGIFVSCAAGNSGPSSFSTSNEAPWILTVG  1033

Query  1459  ASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK--DEDAALCGPGSLdk  1286
             ASTIDR IKATAVLGN  + DGESAFQ  +FPPT+LPLIYPGS   + +A  C P SL+ 
Sbjct  1034  ASTIDRKIKATAVLGNNQEFDGESAFQPSDFPPTVLPLIYPGSNVSNFNAKYCTPDSLNN  1093

Query  1285  vdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYN  1106
              +V GK+VLC+ G    R +KG  V+ AGGA MIL+N +    T LA+ HVLP T +SY 
Sbjct  1094  TNVVGKIVLCEVGI-TTRANKGIAVEAAGGAGMILMNPEDMANTTLAEVHVLPVTHVSYA  1152

Query  1105  DGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVN  926
              G+K+K+YINST  PTATIVFKGT IG   AP VA FSSRGP+ ASPGILKPDI+GPGVN
Sbjct  1153  AGVKIKEYINSTLIPTATIVFKGTIIGDDRAPVVAGFSSRGPNFASPGILKPDIIGPGVN  1212

Query  925   ILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTA  746
             ILAAW +          + FN+ISGTSM+ PHLSG+A LLKS HPDWSPAAIKSAI+TTA
Sbjct  1213  ILAAWHISLENKTNTN-SRFNMISGTSMSCPHLSGVAALLKSVHPDWSPAAIKSAIMTTA  1271

Query  745   DQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQE  566
             D  NL    I DE  +PADVFATG GHVNPS+A+DPGLIYD++  DY+ YLCGLNYTD++
Sbjct  1272  DDVNLRSNLIEDETYLPADVFATGAGHVNPSKANDPGLIYDIEPSDYLSYLCGLNYTDRQ  1331

Query  565   IQQIVQRKVECSQVTSIPEAQLNYPSFAIW--LGKTSLTYSRTVTNVGEANSMYTVKVSP  392
             +   +QRK  CS++TSI E QLNYPSF+I   +  T+  YSRTVTNVG+A S Y V++  
Sbjct  1332  VGIFLQRKANCSEITSILEVQLNYPSFSILVRVNSTAQVYSRTVTNVGQAYSTYRVEIGS  1391

Query  391   FLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAII  212
               G+DV + P TLVF+EV Q+L+Y ++F+P +T  +  F QG+  W+S++HIV+S IA+ 
Sbjct  1392  PPGIDVKIEPTTLVFSEVKQKLSYQVTFTPLATLPNTTFSQGSFRWISEKHIVRSQIAVR  1451

Query  211   F  209
             F
Sbjct  1452  F  1452


 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/717 (60%), Positives = 528/717 (74%), Gaps = 14/717 (2%)
 Frame = -1

Query  2395  VVCLTLVFHSVASAK-YEDTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERS--R  2225
             ++C+   F + A+ +     YIVH   P       ++D  SY+ SF+  +  +  R   R
Sbjct  13    LICVLFPFTTNATEQDNSQIYIVHCQFPDGERTTRNQDLESYYLSFLPATTSDSSREAPR  72

Query  2224  IVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWR  2045
             +++SYR+V +GFAAKLS E + EM K +GF+SAR + + +L+TTHS NF+GL QN GFW 
Sbjct  73    LIYSYRNVITGFAAKLSLEDLKEMEKMEGFVSARPEGLLDLHTTHSVNFMGLNQNIGFWN  132

Query  2044  NSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSE  1865
             +S+YGKGVI+GV+DTGI P+HPSF+D+ MPPPPAKWKGKC+F  T CNNKLIGAR F   
Sbjct  133   DSNYGKGVIIGVIDTGIFPDHPSFSDDGMPPPPAKWKGKCQFNTTKCNNKLIGARYFSYT  192

Query  1864  GssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGC  1685
             G+ P     DE GHGTHTASTAAG FV  A + G+A GTA+G+APLAH++IYK C+  GC
Sbjct  193   GNDPW----DENGHGTHTASTAAGRFVPGANILGNANGTAMGVAPLAHVAIYKTCSAIGC  248

Query  1684  AESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPD  1505
               SDILAAMD AI+DGVDVLS+SLG  S  F+ED IA+GAF+A+E+GIFVSC+AGN GP 
Sbjct  249   FGSDILAAMDMAIEDGVDVLSISLGNRSRQFYEDVIALGAFSAIERGIFVSCSAGNSGPY  308

Query  1504  YYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKD  1325
              +++SN+APW+LTVGASTIDR IKATAVLGN  + DGESAFQ  +FP TLLPLIYPG   
Sbjct  309   TFSVSNDAPWILTVGASTIDRRIKATAVLGNNQKFDGESAFQPSHFPSTLLPLIYPGMNT  368

Query  1324  ED--AALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTI  1151
              D  A  C P SL+  +V GK+VLC   G  A VDKG  VK AGGAAMI++N +    T 
Sbjct  369   SDTLAQYCYPSSLNNTNVMGKIVLC-VAGITAGVDKGIAVKAAGGAAMIIMNPESWANTT  427

Query  1150  LADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNA  971
             LA+ HVLP T ++Y DGLK+++YINST+ PTATI FKGT IG   AP VA FSS GPS A
Sbjct  428   LAEAHVLPVTHVTYGDGLKIQEYINSTTTPTATIAFKGTXIGDNRAPVVAGFSSXGPSYA  487

Query  970   SPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHP  791
             SP ILKPDI+GPGVNILAAWP+    N    +   N+I+GTSM+ PHLSG+A LLKS HP
Sbjct  488   SPRILKPDIIGPGVNILAAWPISLENNTNTNSTF-NMIAGTSMSCPHLSGVAALLKSVHP  546

Query  790   DWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSD  611
             DWSPAAIKSAI+TTAD +NL    I DE  +PADVFATG GHVNPS+A+DPGL+YD++  
Sbjct  547   DWSPAAIKSAIMTTADVFNLGSKLIEDETYLPADVFATGAGHVNPSKANDPGLVYDIEPS  606

Query  610   DYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTS--LTYSRTVT  437
             DYIPYLCGLNYT++++  IVQRKV CS++TSI E QLNYPSFAI +   S    YSRTVT
Sbjct  607   DYIPYLCGLNYTNRQVTVIVQRKVNCSEITSILEGQLNYPSFAIQVRNNSEAQVYSRTVT  666

Query  436   NVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQG  266
             NVG ANS Y V +    G+DV V P TLVF++V Q+L+Y ++F+P S P  I + QG
Sbjct  667   NVGTANSTYRVDIDSPRGLDVKVEPTTLVFSKVKQKLSYQVTFTPFSRPSTI-YTQG  722



>gb|EYU29563.1| hypothetical protein MIMGU_mgv1a022413mg [Erythranthe guttata]
Length=737

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/735 (58%), Positives = 544/735 (74%), Gaps = 13/735 (2%)
 Frame = -1

Query  2395  VVCLTLVFHSVASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGD-EGERSRIV  2219
             ++C+ L F     A+  D YIVHV P  A  + +   Y S+  +  + + +    + RI+
Sbjct  9     IICI-LNFIQFLKAENLDVYIVHVDP--AQSDNLETSYDSFMPTTTNLAANSNNNQPRIL  65

Query  2218  HSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNS  2039
             H YR+V SGFAAKLS   V  MR+ +GF+SAR ++V+ L+TTH+PNFLGL QN GFW++S
Sbjct  66    HRYRNVFSGFAAKLSIADVEAMRQMEGFVSARPEKVFPLHTTHTPNFLGLIQNSGFWKDS  125

Query  2038  SYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEF-EGTACNNKLIGARNFVSEG  1862
             +YGKGVIVG+LD+GI+P+HPSF+DE MPPPP KW+G+C+F    ACNNKLIGA+ F +  
Sbjct  126   NYGKGVIVGLLDSGISPDHPSFSDEGMPPPPPKWRGECQFGSKNACNNKLIGAKYFTN--  183

Query  1861  ssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCA  1682
                   P DEEGHGTHTA+TAAG+FVG A ++G+A GTA GMAPLAH+++Y+VC+  GC+
Sbjct  184   -GNATTPFDEEGHGTHTAATAAGSFVGGANIYGNAAGTAAGMAPLAHVAMYRVCSPSGCS  242

Query  1681  ESdilaamdaaiddgvdvlslslgggSASFFE-DSIAIGAFAAMEKGIFVSCAAGNEGPD  1505
             ESDI+A MDAAI+DGVDV+S+SLGGG+ + F+ D+IAIGAF AMEKGI VSC+AGN GP 
Sbjct  243   ESDIMAGMDAAIEDGVDVISISLGGGTPTAFDKDNIAIGAFRAMEKGILVSCSAGNNGPA  302

Query  1504  YYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFP-PTLLPLIYPGSK  1328
               +LSNEAPW+LTVGASTIDR IKATAVLGN  + DGE+AFQ  +FP  T L L++PG  
Sbjct  303   LVSLSNEAPWILTVGASTIDRKIKATAVLGNNEEYDGETAFQPNDFPSATKLGLVFPGQI  362

Query  1327  DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTIL  1148
                +  CG G+LD+  V+GK+VLC+ GG   RVDKG+ VK+AGGAAMIL+NQ+  G T  
Sbjct  363   SNMSLYCGEGALDENVVRGKIVLCEIGGTGTRVDKGKAVKNAGGAAMILMNQEAQGDTTR  422

Query  1147  ADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNAS  968
             A+ HVLPA  ++Y D LK+K Y++S   P ATIVFKGT IG   AP VA+FSSRGPS  S
Sbjct  423   AEAHVLPAIHVNYGDALKIKAYVSSNPNPIATIVFKGTVIGDDRAPVVAAFSSRGPSLLS  482

Query  967   PGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPD  788
             PGILKPDI+GPGVNILAAWPV          +TFN++SGTSM+ PHLSG+A LLKSAHPD
Sbjct  483   PGILKPDIIGPGVNILAAWPVSVENKTDTK-STFNMVSGTSMSCPHLSGVAALLKSAHPD  541

Query  787   WSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDD  608
             WSPA IKSAI+TTADQ NL G  I  E L PADVFA G GHVNPSRA+DPGL+YD+Q  +
Sbjct  542   WSPAVIKSAIMTTADQVNLGGNPIETEALKPADVFAIGAGHVNPSRANDPGLVYDIQPHE  601

Query  607   YIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVG  428
             Y+ YLCG+N+T+ ++  I QRKV+CS+ + I E+QLNYPSF+I LG T  TY+RTVTNVG
Sbjct  602   YVSYLCGMNFTESQVGVIAQRKVDCSKESRIAESQLNYPSFSIVLGSTPQTYTRTVTNVG  661

Query  427   EANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSS--TPVDIDFVQGAIAW  254
             E  S Y V++    GV V V P  L FT++ Q L+Y ++F+ S   T    D+VQG + W
Sbjct  662   ECESSYNVEIGSPEGVTVVVEPVKLDFTKLGQALSYKVTFTRSDGGTLTTDDYVQGFVTW  721

Query  253   VSQRHIVKSPIAIIF  209
              S ++ V+SPIA++ 
Sbjct  722   HSGKYSVRSPIAVVI  736



>ref|XP_009629567.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=651

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/653 (64%), Positives = 507/653 (78%), Gaps = 9/653 (1%)
 Frame = -1

Query  2155  MRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPS  1976
             M K++GF+SAR +R  +LYTTHS NFLGL+QN GFW +S+YGKGVI+GV+DTGI P+HPS
Sbjct  1     MEKREGFVSARPERQLDLYTTHSLNFLGLHQNMGFWNDSNYGKGVIIGVIDTGIFPDHPS  60

Query  1975  FNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAA  1796
             F+D+ MPPPPAKWKGKCEF  T CN KLIGAR F+S G+  P    DE GHGTHTASTAA
Sbjct  61    FSDDGMPPPPAKWKGKCEFNVTKCNKKLIGARYFLSSGNGSPW---DENGHGTHTASTAA  117

Query  1795  GNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlsls  1616
             GNFV  A +FG+A GTA G+APLAH++IYKVC+   C+ESD LAAMD AI+DGVDVLSLS
Sbjct  118   GNFVPGANIFGNANGTAAGVAPLAHVAIYKVCSGITCSESDTLAAMDMAIEDGVDVLSLS  177

Query  1615  lgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTI  1436
             LG  + +F+ D+IA+GAF+AMEKGIFVSCAAGN GP  ++ +NEAPW+LTVGASTIDR I
Sbjct  178   LGRLTNNFYSDNIALGAFSAMEKGIFVSCAAGNSGPSSFSTANEAPWILTVGASTIDRKI  237

Query  1435  KATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK--DEDAALCGPGSLdkvdvkgkvV  1262
             KATAVLGN  + DGESAFQ  +FPPTLLPL YPGS   D DA  C P SL+  +V GK+V
Sbjct  238   KATAVLGNSEEFDGESAFQPSDFPPTLLPLAYPGSNASDSDAKYCTPTSLNNTNVMGKIV  297

Query  1261  LCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDY  1082
             LC+ G    RVDKG+ VK AGGAAMIL+N +    T LA+ HVLP T ++Y DG+K+ +Y
Sbjct  298   LCEVGK-TTRVDKGKVVKAAGGAAMILMNTETLANTTLAEAHVLPVTHVTYADGIKIIEY  356

Query  1081  INSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVg  902
             INST  PTATIVFKGT IG   AP VA FSSRGP+ ASPGILKPDI+GPGVNILAAW V 
Sbjct  357   INSTLIPTATIVFKGTIIGDDRAPVVAGFSSRGPNYASPGILKPDIIGPGVNILAAWHVS  416

Query  901   nntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGT  722
                N    +   N+ISGTSM+ PHLSG+A LLKS+H DWSPAAIKSAI+TTAD  NL  +
Sbjct  417   LENNTNTNSNF-NMISGTSMSCPHLSGVAALLKSSHLDWSPAAIKSAIMTTADVLNLGLS  475

Query  721   KILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRK  542
              I D+  +PA VFATG GHVNPS+A+DPGLIYD++  DYI YLCGLNYTD+++   +QRK
Sbjct  476   SIEDQTYLPASVFATGAGHVNPSKANDPGLIYDIEQADYIAYLCGLNYTDRQVGIFLQRK  535

Query  541   VECSQVTSIPEAQLNYPSFAIWL--GKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGV  368
             V+CS +TSI E QLNYPSF+I +    T+ TYSR VTNVG+ANS Y+V++    GVDV V
Sbjct  536   VKCSAITSILEGQLNYPSFSIQVRSNSTAQTYSRNVTNVGQANSTYSVEIDSPPGVDVKV  595

Query  367   TPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              P TL F+EVNQ+L+Y ++F+P +T       QG++ W+S++HIV+SPIA+ F
Sbjct  596   EPTTLAFSEVNQKLSYQVTFTPLATRPSTSSNQGSLRWISEKHIVRSPIAVRF  648



>dbj|BAF95755.1| subtilase [Lotus japonicus]
Length=750

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/748 (58%), Positives = 547/748 (73%), Gaps = 26/748 (3%)
 Frame = -1

Query  2404  ISVVVCLTLVFHSVASAKYED-----TYIVHVSPPAAAING---VSEDYRSYFRSFVSES  2249
             + ++  L+ +  S+A+ + ++     TYIVHV      I G    +E+  ++  SF+ E+
Sbjct  14    LGLISMLSFIPASIAAEEGQEHDNLTTYIVHVK--KLEIEGPLQSTEELHTWHHSFLPET  71

Query  2248  GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGL  2069
              +   + R+V SYR+VASGFA +L+PE  + +++K+  +S R +R  +L+TTH+P+FLGL
Sbjct  72    SN---KDRMVFSYRNVASGFAVRLTPEEANALQEKEEVMSIRPERTLSLHTTHTPSFLGL  128

Query  2068  YQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEG-TACNNKL  1892
              Q  G W +S+ GKGVI+GV+DTGI P H SFNDE MPPPPAKWKG CEF G + CNNKL
Sbjct  129   RQGQGLWNDSNLGKGVIIGVIDTGIYPFHLSFNDEGMPPPPAKWKGHCEFTGGSVCNNKL  188

Query  1891  IGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSI  1712
             IGARN V      PP   ++  HGTHTA+ AAG FV  A+VFG+A+GTA GMAP AHL+I
Sbjct  189   IGARNLVKSAIQEPP--YEDFFHGTHTAAEAAGRFVEGASVFGNARGTAAGMAPDAHLAI  246

Query  1711  YKVCT---EDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGI  1541
             YKVC+   +D C ES ILAAMD AI+DGVDVLSLSLG GS  FFED IAIGAFAA +KGI
Sbjct  247   YKVCSSKVKDECPESAILAAMDIAIEDGVDVLSLSLGLGSLPFFEDPIAIGAFAATQKGI  306

Query  1540  FVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPP  1361
             FVSC+A N GP Y +LSNEAPW+LTVGASTIDR I A+A LGNGA+ +GE+ FQ ++F  
Sbjct  307   FVSCSAANSGPHYSSLSNEAPWILTVGASTIDRKISASAKLGNGAEYEGETLFQPKDFSS  366

Query  1360  TLLPLIYPGS-KDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMI  1184
              LLPL+Y  + K+  +ALC PGSL  ++VKGKVV+CD GGGI  + KGQ V DAGG+AMI
Sbjct  367   QLLPLVYAAAEKNNSSALCAPGSLRNINVKGKVVVCDLGGGIPFIAKGQEVLDAGGSAMI  426

Query  1183  LLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSV  1004
             L N +  G+T LA+ HVLPA  +SY   L +K YINST  PTAT++F+GT IG   APSV
Sbjct  427   LANIENFGFTTLANAHVLPAVHVSYAASLAIKAYINSTYTPTATVLFQGTIIGDSLAPSV  486

Query  1003  ASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLS  824
             A+FSSRGPS  SPGILKPDI+GPGVNILAAW V  +         F+IISGTSM+ PHLS
Sbjct  487   AAFSSRGPSQQSPGILKPDIIGPGVNILAAWAVSVDNKI----PAFDIISGTSMSCPHLS  542

Query  823   GIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRAS  644
             GIA LLKSAHPDWSPAAIKSAI+TTA+  NL G  ILD+RL PAD+FATG GHVNP RA+
Sbjct  543   GIAALLKSAHPDWSPAAIKSAIMTTANTLNLRGLPILDQRLQPADIFATGAGHVNPVRAN  602

Query  643   DPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKT  464
             DPGL+YD+Q +DY+PYLCGL Y+D+E+  IVQR V C  V SI +A+LNYPSF+I LG  
Sbjct  603   DPGLVYDIQPEDYVPYLCGLGYSDREVTIIVQRSVRCFNVKSIAQAELNYPSFSILLGSD  662

Query  463   SLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPS--STP  290
             S  Y+RT+TNVG ANS YTVK+   L + + V+P  + FT+VNQ++ Y + F P      
Sbjct  663   SQFYTRTLTNVGPANSTYTVKIDVPLAMGISVSPSQITFTQVNQKVAYFVDFIPQIKENR  722

Query  289   VDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
              +  F QGAI WVS +H+V++PI++IF+
Sbjct  723   GNHTFAQGAITWVSDKHVVRTPISVIFK  750



>gb|KEH31683.1| subtilisin-like serine protease [Medicago truncatula]
Length=755

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/718 (59%), Positives = 537/718 (75%), Gaps = 11/718 (2%)
 Frame = -1

Query  2338  YIVHVSPPAAAINGVSE-DYRSYFRSFVSES-GDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             YI+HV+ P   +   SE D  S+  SF+  +     E+ R+++SYR+V SGFAA+L+ E 
Sbjct  40    YIIHVNKPEGKLFTQSEEDLESWHHSFMPTTVMSSDEQPRMIYSYRNVLSGFAARLTQEE  99

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             +  +++K GF+SA  +R     TTH+P+FLGL QN G W+ S++GKG+I+GVLD+GITP+
Sbjct  100   LRAVQQKNGFVSAHPERTLRRQTTHTPDFLGLQQNIGSWKESNFGKGIIIGVLDSGITPD  159

Query  1984  -HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppP--VDEEGHGTH  1814
              HPSF+D  +PPPP+KWKG+C+  GT CNNKLIGAR+F +           +DE+GHGTH
Sbjct  160   DHPSFSDAGIPPPPSKWKGRCKLNGTVCNNKLIGARSFNNAAVKGEKAEAPIDEDGHGTH  219

Query  1813  TASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgv  1634
             TASTAAG FV NA V G+AKGTA GMAP AHL+IYKVC  + CAES+ILAA+DAA++DGV
Sbjct  220   TASTAAGAFVENAEVLGNAKGTAAGMAPHAHLAIYKVCFGEDCAESNILAALDAAVEDGV  279

Query  1633  dvlslslgggSAS-FFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGA  1457
             DV+S+SLG      FF DS AIGAFAA++KGIFVS AAGN GP   +L N APW+LTVGA
Sbjct  280   DVISISLGLSEPPPFFNDSTAIGAFAAIQKGIFVSIAAGNFGPSDASLVNGAPWMLTVGA  339

Query  1456  STIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDE-DAALCGPGSLdkvd  1280
             STIDRTI ATAVLGNG + +GES FQ  +F PTLLPL Y G   + +++ C  GSL  +D
Sbjct  340   STIDRTIVATAVLGNGEEFEGESVFQPSDFSPTLLPLAYAGINGKVESSFCANGSLSDID  399

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
              +GKVVLC+RGGGI R+ KGQ V+ AGGAAMIL+N +++G+++ AD HVLPAT +SY  G
Sbjct  400   FRGKVVLCERGGGIGRIAKGQEVQRAGGAAMILMNDELNGFSLSADVHVLPATHVSYAAG  459

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
             LK+K YINSTS PTATI FKGT IG   APSVASFSSRGP+  SPGILKPDI+GPGVNIL
Sbjct  460   LKIKAYINSTS-PTATISFKGTIIGNSLAPSVASFSSRGPNLPSPGILKPDIIGPGVNIL  518

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAWP   + N  +    FNI+SGTSM+ PHLSGIA LLKS+HPDWSPAAIKSAI+T+AD 
Sbjct  519   AAWPFPLDNNTNSKL-NFNIMSGTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIMTSADT  577

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              NL    I+DE L PA++FATG GHVNP RA DPGL+YD+Q DDYIPYLCGL Y+D+E+ 
Sbjct  578   LNLENKLIVDETLQPANLFATGSGHVNPPRADDPGLVYDIQPDDYIPYLCGLGYSDREVG  637

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGV  380
              I  RK+ C++ +SIPE +LNYPSF++ LG +S T++RTVTNVGEA S Y   V+   GV
Sbjct  638   IIAHRKINCTETSSIPEGELNYPSFSVVLG-SSQTFTRTVTNVGEAQSSYFAIVAAPKGV  696

Query  379   DVGVTPDTLVFTEVNQQLTYNISFSP-SSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             DV V P+ L F+E NQ+ TY+++F+   S    ++  QG + WVS +H V+SPI + F
Sbjct  697   DVSVHPNKLYFSEANQKQTYSVTFNRIGSGHKTVEHGQGFLKWVSAKHTVRSPILVNF  754



>ref|XP_003611191.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES94149.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/749 (57%), Positives = 543/749 (72%), Gaps = 34/749 (5%)
 Frame = -1

Query  2386  LTLVFHSVASAKYED---------------TYIVHVSPPAAAINGVSEDYRSYFRSFVSE  2252
             L L  ++ ++ KY++               TYIVHV  P+       E    ++ S + E
Sbjct  18    LVLSIYTTSAHKYQEFTTTNEGLEDESSLLTYIVHVKKPSLQ---SKESLHGWYHSLLPE  74

Query  2251  SGDEGE-RSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFL  2075
             +  + + + RI+ SYR++  GFA KL+PE    + + +  +S R +++Y+L+TTH+ +FL
Sbjct  75    TATKTQNQQRIIFSYRNIVDGFAVKLTPEEAKALEENEEVLSTRLEKMYSLHTTHTSSFL  134

Query  2074  GLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTA-CNN  1898
             GL QN   W NS+ GKG+I+G++DTGIT +HPSF+DE MP PPAKW G CEF G   CN 
Sbjct  135   GLQQNQDLWGNSNQGKGIIIGIVDTGITLSHPSFSDEGMPSPPAKWNGHCEFTGERICNK  194

Query  1897  KLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHL  1718
             K+IGAR FV+        P D+ GHGTHTASTAAG  V  A VFG+A GTA+GMAP AHL
Sbjct  195   KIIGARTFVNS-----SLPYDDVGHGTHTASTAAGRPVQGANVFGNANGTAIGMAPYAHL  249

Query  1717  SIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIF  1538
             +IYKVC   GC ES ILA MDAA+DD VDVLSLSLGG S+ FFED IA+GAF+A++KGIF
Sbjct  250   AIYKVCNIYGCTESSILAGMDAAVDDDVDVLSLSLGGPSSPFFEDGIALGAFSAIQKGIF  309

Query  1537  VSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPT  1358
             VSC+A N GP Y TLSNEAPW+LTVGASTIDR I+A A LG+G +  GES FQ ++F  T
Sbjct  310   VSCSAANSGPFYGTLSNEAPWILTVGASTIDRKIEAVAKLGDGTEYLGESVFQPKDFAST  369

Query  1357  LLPLIYPGS---KDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAM  1187
             LLPL+Y GS    D+  A CGP ++ KVDVKGK+V+C++GG + RV KGQ VKDAGGAAM
Sbjct  370   LLPLVYAGSINTSDDSIAFCGPIAMKKVDVKGKIVVCEQGGFVGRVAKGQAVKDAGGAAM  429

Query  1186  ILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPS  1007
             ILLN + + +  +AD HVLPA  +SY+ GL ++DYINSTS P ATI+FKGT IG   AP 
Sbjct  430   ILLNSEGEDFNPIADVHVLPAVHVSYSAGLNIQDYINSTSTPMATILFKGTVIGNPNAPQ  489

Query  1006  VASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHL  827
             VASFSSRGPS ASPGILKPDILGPG+NILA WP+  + +     ++FNIISGTSM+ PHL
Sbjct  490   VASFSSRGPSKASPGILKPDILGPGLNILAGWPISLDNST----SSFNIISGTSMSCPHL  545

Query  826   SGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRA  647
             SGIA LLK++HPDWSPAAIKSAI+TTA+Q NL G  ILD+R++PADVFATG GHVNPS+A
Sbjct  546   SGIAALLKNSHPDWSPAAIKSAIMTTANQVNLQGKPILDQRILPADVFATGAGHVNPSKA  605

Query  646   SDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGK  467
             +DPGL+YD++++DY+PYLCGLNYTD+++  I+Q+KV+CS V SIP+AQLNYPS +I LG 
Sbjct  606   NDPGLVYDIETNDYVPYLCGLNYTDRQVGVILQQKVKCSDVKSIPQAQLNYPSISIRLGN  665

Query  466   TSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPV  287
             TS  YSRT+TNVG  N+ Y V +   L V + V P  + FTE+ Q++TY + F P     
Sbjct  666   TSQFYSRTLTNVGPVNTTYNVVIDVPLAVGMSVRPSQITFTEMKQKVTYWVDFIPEDKEN  725

Query  286   DID--FVQGAIAWVSQRHIVKSPIAIIFQ  206
               D    QG+I WVS ++ V  PIA++F+
Sbjct  726   RGDNFIAQGSIKWVSAKYSVSIPIAVVFE  754



>gb|ADZ55305.1| serine protease [Coffea arabica]
Length=763

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/761 (58%), Positives = 542/761 (71%), Gaps = 30/761 (4%)
 Frame = -1

Query  2413  MAYISVVVCLTLV-FHSVASAKYED------TYIVHVSPP------AAAINGVSEDYRSY  2273
             M ++ +++ L ++ F S+A+    +      TYIVHV  P      +A+ +  ++D  ++
Sbjct  1     MGFMQILILLFVISFLSIAAKGLHEQESTVQTYIVHVELPTDTQLSSASASPNNDDLENW  60

Query  2272  FRSFV---SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNL  2102
             ++SF+   + S    E  R+++SY +V  GFAAKLS E V EM KK GF+SA  Q + +L
Sbjct  61    YKSFLPTTTISSSSNEAPRMLYSYHNVFRGFAAKLSAEDVKEMEKKPGFLSASPQEMLSL  120

Query  2101  YTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCE  1922
             +TTH+P+FLGL+   GFW++S+YG GVI+GV+DTGI P+HPSF+DE MPPPPAKWKGKCE
Sbjct  121   HTTHTPSFLGLHPGMGFWKDSNYGNGVIIGVMDTGIRPDHPSFSDEGMPPPPAKWKGKCE  180

Query  1921  FEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAV  1742
             F  +ACNNKLIGARNF  E        +DE GHGTHTASTAAGNFV  A V  +A GTA 
Sbjct  181   FNSSACNNKLIGARNFNQE---FSDSALDEVGHGTHTASTAAGNFVQGANVLRNANGTAA  237

Query  1741  GMAPLAHLSIYKVC--------TEDGCAESdilaamdaaiddgvdvlslslgggSASFFE  1586
             G+APLAHL++YKVC          D C ES ILAAMDAAI DGVD+LSLSLGG S  F+ 
Sbjct  238   GIAPLAHLAMYKVCIIVCQGVVCVDICPESAILAAMDAAIHDGVDILSLSLGGSSKPFYT  297

Query  1585  DSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGA  1406
             DS+A+GA+ AMEKGI VSC+AGN GP   +L NEAPW+LTVGASTIDR I ATA+LGN  
Sbjct  298   DSVALGAYTAMEKGILVSCSAGNGGPFNQSLENEAPWILTVGASTIDRKIVATALLGNKE  357

Query  1405  QLDGESAFQVENFPPTLLPLIYPGSKDED--AALCGPGSLdkvdvkgkvVLCDRGGGIAR  1232
             + DGES +  ++F  T  PL Y G    D  +A C   +L+   V+GK+V+CD G GI+ 
Sbjct  358   EFDGESLYNPKHFLSTPFPLYYAGWNASDILSAYCFSSALNSSKVRGKIVVCDYGVGISD  417

Query  1231  VDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTAT  1052
             V KG+ VK AGG  MI++N    GYT  AD HVLPAT LSY DG+KV  YINST  P A 
Sbjct  418   VQKGENVKAAGGVGMIIINGQNQGYTTFADAHVLPATHLSYADGVKVLSYINSTESPVAA  477

Query  1051  IVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNA  872
             I FKGT IG   AP VASFSSRGPS ASPGILKPDI+GPGVNILAAWP  +  NN N  +
Sbjct  478   ISFKGTIIGDDHAPVVASFSSRGPSMASPGILKPDIIGPGVNILAAWP-QSVENNTNTKS  536

Query  871   TFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPA  692
             TFN++SGTSM+ PHLSG+A LLKSAHPDWSPAAIKSAI+TTAD  NL    I DERL+PA
Sbjct  537   TFNMLSGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIMTTADLVNLAKNPIEDERLLPA  596

Query  691   DVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIP  512
             ++FA G GHVNPSRA++PGLIYD++  DY+PYLCGLNYT + +  I+QR+V C++ +SIP
Sbjct  597   NIFAIGSGHVNPSRANNPGLIYDIEPKDYVPYLCGLNYTRRGLLYILQRRVNCTEESSIP  656

Query  511   EAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQ  332
             EAQLNYPSF+I  G     Y+RTVTNVGEA S+YTVKV P  GV+V V P TL F+EV Q
Sbjct  657   EAQLNYPSFSIQFGSPIQRYTRTVTNVGEAKSVYTVKVVPPEGVEVIVKPKTLRFSEVKQ  716

Query  331   QLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             +LTY + FS   T  +    QG+I W S +  V+SPIA I 
Sbjct  717   KLTYQVIFSQLPTAANNTASQGSITWASTKVSVRSPIAAII  757



>dbj|BAF95753.1| subtilase [Lotus japonicus]
Length=755

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/718 (59%), Positives = 532/718 (74%), Gaps = 12/718 (2%)
 Frame = -1

Query  2338  YIVHVSPPAAAINGVSEDYRSYFRSFVSES-GDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
             YI+HV+ P   +   SED  S++ SF+  +     E+ R+++SY++V  GFAA L+ E +
Sbjct  41    YIIHVTGPEGKMLTESEDLESWYHSFLPPTLMSSEEQPRVIYSYKNVLRGFAASLTQEEL  100

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
             S + KK GFISA  QRV +  TTH+P FLGL Q+ G W+ S++GKGVI+GVLD+GITP H
Sbjct  101   SAVEKKNGFISAHPQRVLHRQTTHTPKFLGLQQDTGVWKESNFGKGVIIGVLDSGITPGH  160

Query  1981  PSFNDENMPPPPAKWKGKCEFEGTACNNKLIGAR--NFVSEGs--sppppPVDEEGHGTH  1814
             PSF+D  +PPPP KWKG+C+   TACNNKLIGAR  N  +E         P+DE+GHGTH
Sbjct  161   PSFSDVGIPPPPPKWKGRCDLNVTACNNKLIGARAFNLAAEAMNGKKAEAPIDEDGHGTH  220

Query  1813  TASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgv  1634
             TASTAAG FV  A V G+AKGTA GMAP AHL+IYKVC  + C ESDILAA+DAA++DGV
Sbjct  221   TASTAAGAFVNYAEVLGNAKGTAAGMAPHAHLAIYKVCFGEDCPESDILAALDAAVEDGV  280

Query  1633  dvlslslgggSAS-FFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGA  1457
             DV+S+SLG      FF DS AIGAFAAM+KGIFVSCAAGN GP   ++ N APW+LTVGA
Sbjct  281   DVISISLGLSEPPPFFNDSTAIGAFAAMQKGIFVSCAAGNSGPFNSSIVNAAPWILTVGA  340

Query  1456  STIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvd  1280
             STIDR I ATA LGNG + DGES FQ  +F PTLLPL Y G    E++A C  GSLD   
Sbjct  341   STIDRRIVATAKLGNGQEFDGESVFQPSSFTPTLLPLAYAGKNGKEESAFCANGSLDDSA  400

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
              +GKVVLC+RGGGIAR+ KG+ VK AGGAAMIL+N + + +++ AD H LPAT +SY  G
Sbjct  401   FRGKVVLCERGGGIARIAKGEEVKRAGGAAMILMNDETNAFSLSADVHALPATHVSYAAG  460

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
             +++K YINST+ PTATI+FKGT IG   AP+VASFSSRGP+  SPGILKPDI+GPGVNIL
Sbjct  461   IEIKAYINSTATPTATILFKGTVIGNSLAPAVASFSSRGPNLPSPGILKPDIIGPGVNIL  520

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAWP   + +  +   TFNI SGTSM+ PHLSGIA LLKS+HP WSPAAIKSAI+T+AD 
Sbjct  521   AAWPFPLSNSTDSKL-TFNIESGTSMSCPHLSGIAALLKSSHPHWSPAAIKSAIMTSADT  579

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              NL    I+DE L P D+FATG GHVNPSRA+DPGL+YD+Q DDYIPYLCGL Y++ E+ 
Sbjct  580   INLGNKLIVDETLQPTDLFATGSGHVNPSRANDPGLVYDIQPDDYIPYLCGLGYSETEVG  639

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGV  380
              I  RK++CS   SIPE +LNYPSF++ LG +S T++RTVTNVGEA+S Y + V+   GV
Sbjct  640   IIAHRKIKCS--ASIPEGELNYPSFSVELG-SSKTFTRTVTNVGEAHSSYDLIVAAPQGV  696

Query  379   DVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDI-DFVQGAIAWVSQRHIVKSPIAIIF  209
             DV V P  L F+EVNQ+ TY+++FS +       ++ QG + WVS +H V+SPI++ F
Sbjct  697   DVKVQPYKLNFSEVNQKETYSVTFSRTGLGNKTQEYAQGFLKWVSTKHTVRSPISVKF  754



>ref|XP_004244588.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=744

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/739 (58%), Positives = 547/739 (74%), Gaps = 17/739 (2%)
 Frame = -1

Query  2401  SVVVCLTLVFHSVASAKYEDTYIVHVSPPAAAINGVSE--DYRSYFRSFVSES---GDEG  2237
             +++ CL+  +HS+ S    +TYIV V  P + I+  S   D  S++ SF+ ++       
Sbjct  9     AILACLS--WHSMQSDL--ETYIVQVESPESQISTQSSRVDLESWYNSFLPKTIAIAGSD  64

Query  2236  ERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNF  2057
             E+S +++SYR+V  GFAA+LS + V EM KK GFISA  QR+ +L+TTH+P+FLGL QN 
Sbjct  65    EKSWLIYSYRNVIKGFAARLSAKQVKEMEKKPGFISAWPQRILSLHTTHTPSFLGLQQNV  124

Query  2056  GFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGAR  1880
             G WR+S+YGKGVI+GVLDTGI+P+HPSF+DE M PPPAKWKGKCE    T CNNKLIGAR
Sbjct  125   GLWRDSNYGKGVIIGVLDTGISPDHPSFSDEGMAPPPAKWKGKCESNFTTKCNNKLIGAR  184

Query  1879  NFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVC  1700
              F          P+DE+GHGTHTASTAAG+FV  A V+G+A+GTAVG+APLAHL+IYKVC
Sbjct  185   TF----PISSDSPIDEDGHGTHTASTAAGSFVKGANVYGNAEGTAVGIAPLAHLAIYKVC  240

Query  1699  TEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAG  1520
                GCA+SDILAAMDAAIDDGVD+LSLSLGG S  F+ D  A+GA++A ++GI VSC+AG
Sbjct  241   DSSGCADSDILAAMDAAIDDGVDILSLSLGGSSIPFYTDPTALGAYSAAQRGILVSCSAG  300

Query  1519  NEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIY  1340
             N GP   TLSNEAPW+LTVGASTIDR +KAT  LGN    +GE+AF  ++   T  PL  
Sbjct  301   NSGPYDSTLSNEAPWILTVGASTIDRKLKATVKLGNQQLFEGETAFNPKDHNSTFSPLFD  360

Query  1339  P--GSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDI  1166
             P   + D +   CGP +L + ++KGK+V+C  GGGI R+ KG+TVKDAGG  MI+++   
Sbjct  361   PSLNATDFERPYCGPDTLSEPEIKGKIVVCKAGGGIPRIVKGKTVKDAGGVGMIIISTAD  420

Query  1165  DGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSR  986
             DG+TI AD HVLPA  ++Y DG+++ DY+N+TS P A I F+GT IG K AP V +FSSR
Sbjct  421   DGFTIPADPHVLPALYITYKDGMEILDYMNTTSKPIARIAFQGTIIGDKHAPVVTAFSSR  480

Query  985   GPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLL  806
             GPS ASPGILKPDI+GPG+NILAAWP   +       +TFNIISGTSM+ PHLSG+A LL
Sbjct  481   GPSIASPGILKPDIIGPGLNILAAWPTSIDNKTNTK-STFNIISGTSMSCPHLSGVAALL  539

Query  805   KSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIY  626
             KS HP WSPAAIKSAI+TTA   NL    ILDERL+PA++FA G GHVNPSRA+DPGLIY
Sbjct  540   KSTHPTWSPAAIKSAIMTTATTVNLANDPILDERLLPANIFAIGAGHVNPSRANDPGLIY  599

Query  625   DLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSR  446
             D +  DY+PYLCGLNYT++++  ++QRKVEC +V  IPEAQLNYPSF+I LG+ S TY+R
Sbjct  600   DTEFKDYLPYLCGLNYTNRQVGNLLQRKVECKEVKHIPEAQLNYPSFSIALGEISQTYTR  659

Query  445   TVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQG  266
             TVTNVGEA S Y+V+++   GV V V P TL F++++Q+L Y ++F+  +   +    QG
Sbjct  660   TVTNVGEAKSSYSVEIASPPGVSVIVKPSTLEFSQLDQKLKYQVTFTKRNNSPNSGIAQG  719

Query  265   AIAWVSQRHIVKSPIAIIF  209
              + W S+ + V+SPIA++ 
Sbjct  720   FLKWSSKNYSVRSPIAVVL  738



>ref|XP_006358842.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=649

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/653 (64%), Positives = 503/653 (77%), Gaps = 9/653 (1%)
 Frame = -1

Query  2155  MRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPS  1976
             M K +GFISAR +R+ +LYTTHS NFLGL++N GFW +S+YGKGVI+GV+DTGI P+HPS
Sbjct  1     MEKMEGFISARPERLLDLYTTHSVNFLGLHENMGFWNDSNYGKGVIIGVIDTGIFPDHPS  60

Query  1975  FNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAA  1796
             FND+ MPPPPAKWKGKCEF  T CNNKLIGAR F S G+       DE GHGTHTASTAA
Sbjct  61    FNDDGMPPPPAKWKGKCEFNVTKCNNKLIGARYFQSSGNETSW---DEIGHGTHTASTAA  117

Query  1795  GNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlsls  1616
             G FV  A +FGSA GTAVG+APLAH+++YKVC+   C+ESD+LAAMD AIDDGVDVLSLS
Sbjct  118   GRFVPGANIFGSANGTAVGVAPLAHVAMYKVCSALTCSESDVLAAMDMAIDDGVDVLSLS  177

Query  1615  lgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTI  1436
             +G  + +F+ED+IA+GAF+AM+KGIFVSCAAGN GP  ++ SNEAPW+LTVGASTIDR I
Sbjct  178   IGTLTNNFYEDNIALGAFSAMQKGIFVSCAAGNSGPSRFSTSNEAPWILTVGASTIDRKI  237

Query  1435  KATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDED--AALCGPGSLdkvdvkgkvV  1262
             KATAVLGN  + DGESAFQ  +FPPTLLPL+YPGS   +  A  C P SL+  +V GK+V
Sbjct  238   KATAVLGNNQEFDGESAFQPSDFPPTLLPLVYPGSNTSNFNAKYCTPDSLNNTNVMGKIV  297

Query  1261  LCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDY  1082
             LC+ G   ARVD+G  V+ AGGA MIL+N +    T LA+ HVLP T +SY  GLK+K Y
Sbjct  298   LCEVGI-TARVDQGIAVEAAGGAGMILMNPEDMANTTLAEVHVLPVTHVSYTAGLKIKKY  356

Query  1081  INSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVg  902
             INST  PTATIVFKGT IG   AP VA FSSRGP+ ASPGILKPDI+GPGVNILAAW + 
Sbjct  357   INSTLIPTATIVFKGTIIGDDRAPVVAGFSSRGPNYASPGILKPDIIGPGVNILAAWHIS  416

Query  901   nntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGT  722
                N     + FN+ISGTSM+ PHLSG+A LLKS HPDWSPAAIKSAI+TTAD  NL   
Sbjct  417   LENNTNTN-SRFNMISGTSMSCPHLSGVAALLKSVHPDWSPAAIKSAIMTTADDLNLRSN  475

Query  721   KILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRK  542
              I DE  +PA+VFATG GHVNPS+A+DPGLIYD++  DY+ YLCGLNYTD+++   +QRK
Sbjct  476   LIEDETYLPANVFATGAGHVNPSKANDPGLIYDIEPSDYLSYLCGLNYTDRQVGIFLQRK  535

Query  541   VECSQVTSIPEAQLNYPSFAIW--LGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGV  368
               CS++TSI E QLNYPSF+I   +  T+  YSRTVTNVG+A S Y V++    G+DV V
Sbjct  536   ANCSEITSILEGQLNYPSFSILVRVNSTAQVYSRTVTNVGQAYSTYRVEIGSPPGLDVKV  595

Query  367   TPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              P TLVF+EV Q+L+Y ++F+P +T  +  F QG   W+S++HIV+S IA+ F
Sbjct  596   EPTTLVFSEVKQKLSYQVTFTPLATLPNTTFSQGYFRWISEKHIVRSQIAVRF  648



>ref|XP_004244715.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=743

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/739 (57%), Positives = 541/739 (73%), Gaps = 14/739 (2%)
 Frame = -1

Query  2398  VVVCLTLVFHSVASAKYEDTYIVHVSPPAAAINGVSE--DYRSYFRSFVSES---GDEGE  2234
             VV C+   F   +     +TYIV V  P + I+  S   D  ++++SF+  +       E
Sbjct  6     VVFCILACFSWPSMQSDLETYIVQVESPESHISTQSSRMDLENWYKSFLPNTIATAGLDE  65

Query  2233  RSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFG  2054
             + ++++SY +V  GFAA+LS + V EM KK GFISA  QR+ +L+TTH+P+FLGL QN G
Sbjct  66    KPQLIYSYHNVIIGFAARLSAKQVKEMEKKPGFISAWPQRILSLHTTHTPSFLGLQQNVG  125

Query  2053  FWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARN  1877
              WR+++YGKGVIVGVLDTGI+P+HPSF+D+ MPPPPAKWKGKCE    T CNNKLIGAR 
Sbjct  126   LWRDANYGKGVIVGVLDTGISPDHPSFSDKGMPPPPAKWKGKCESNFTTKCNNKLIGART  185

Query  1876  FVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCT  1697
             FV+        P+D  GHGTHTASTAAG FV  A V+G+AKGTAVG+APLAHL++YKVC 
Sbjct  186   FVNS-----DSPIDGNGHGTHTASTAAGGFVKGANVYGNAKGTAVGIAPLAHLAMYKVCD  240

Query  1696  EDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGN  1517
               GC++SD+LAAMDAAIDDGVD++SLSLGG    F+ED IA+GA++A ++GI VSC++GN
Sbjct  241   SFGCSDSDVLAAMDAAIDDGVDIMSLSLGGNRKLFYEDPIALGAYSATKRGILVSCSSGN  300

Query  1516  EGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYP  1337
             EGP   TLSNEAPW+LTVGAS+ DR +KAT  LGN   L+GESAF  +    T  PL  P
Sbjct  301   EGPYESTLSNEAPWILTVGASSTDRKLKATVKLGNKKILEGESAFHPKGHNSTFFPLYDP  360

Query  1336  GSK--DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDID  1163
                  D D+  CGPG+L + ++KGK+V+C  GGG +R+DKGQ VKDAGG  MI+ N   D
Sbjct  361   SRNETDFDSLYCGPGTLSETEIKGKIVVCSAGGGYSRIDKGQAVKDAGGVGMIIFNTADD  420

Query  1162  GYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRG  983
             G+T  +D HVLPA  ++Y DG+++ DY+N+TS P A I F+GT IG K  P VASFSSRG
Sbjct  421   GFTKFSDPHVLPALHITYKDGMEILDYMNTTSEPNARIAFQGTIIGDKDVPVVASFSSRG  480

Query  982   PSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLK  803
             PS ASPGILKPDI+GPG+NILAAWP  +  N  N  +TFNIISGTSM+ PHLSG+A LLK
Sbjct  481   PSIASPGILKPDIIGPGLNILAAWP-SSVDNKKNTKSTFNIISGTSMSCPHLSGVAALLK  539

Query  802   SAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYD  623
             S HP WSPAAIKSAI+TTA+  N     ILDERL+PA++FA G GHVNPSRA+DPGLIYD
Sbjct  540   STHPTWSPAAIKSAIMTTANTVNFANDPILDERLLPANIFAIGAGHVNPSRANDPGLIYD  599

Query  622   LQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRT  443
              +  DY+PYLCGLNYT++++  ++QRKV+C  V  I EAQLNYPSF+I LG  S TY+RT
Sbjct  600   TRFKDYLPYLCGLNYTNRQVGNLMQRKVDCRSVKHIREAQLNYPSFSITLGDISQTYART  659

Query  442   VTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGA  263
             VTNVGEA S Y+V+++    V V V P  L F+++NQ+L Y+++F+      +   VQG 
Sbjct  660   VTNVGEAKSSYSVEIALPPRVSVSVKPSILKFSKLNQKLKYHVTFTRRDNSPNSGIVQGF  719

Query  262   IAWVSQRHIVKSPIAIIFQ  206
             + W S+++ V+SPIA++ +
Sbjct  720   LKWNSKKYSVRSPIAVVLE  738



>gb|KHN09747.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=689

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/681 (61%), Positives = 518/681 (76%), Gaps = 7/681 (1%)
 Frame = -1

Query  2236  ERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNF  2057
             E+ R+++SYR+V SGFAA+L+ E +  M KK GFISAR +R+ +  TT++P FLGL +  
Sbjct  10    EQPRMIYSYRNVMSGFAARLTEEELRTMEKKNGFISARPERMLHCLTTNTPQFLGLQKQT  69

Query  2056  GFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGAR-  1880
             G W+ S++GKG+I+GVLD+GITP HPSF+D  MPPPP KWKG+CE   TACNNKLIG R 
Sbjct  70    GLWKESNFGKGIIIGVLDSGITPGHPSFSDAGMPPPPPKWKGRCEINVTACNNKLIGVRA  129

Query  1879  -NFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKV  1703
              N   + +      +DE+GHGTHTASTAAG FV +A + G+AKGTA G+AP AHL+IY+V
Sbjct  130   FNLAEKLAKGAEAAIDEDGHGTHTASTAAGAFVDHAELLGNAKGTAAGIAPYAHLAIYRV  189

Query  1702  CTEDGCAESdilaamdaaiddgvdvlslslgggS-ASFFEDSIAIGAFAAMEKGIFVSCA  1526
             C    C ESDILAAMDAA++DGVDV+S+SLG  +  S F+DS AIGAFAAM+KGIFVSCA
Sbjct  190   CFGKDCHESDILAAMDAAVEDGVDVISISLGSHTPKSIFDDSTAIGAFAAMQKGIFVSCA  249

Query  1525  AGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPL  1346
             AGN GP + +L N APW+LTVGAS IDR+I ATA LGNG + DGES FQ  +F PTLLPL
Sbjct  250   AGNSGPFHGSLINGAPWVLTVGASNIDRSIAATAKLGNGQEFDGESVFQPSDFSPTLLPL  309

Query  1345  IYPGSK-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQD  1169
              Y G    ++AA C  GSL+  D +GKVVLC+RGGGI R+ KG+ VK  GGAAMIL+N +
Sbjct  310   AYAGKNGKQEAAFCANGSLNDSDFRGKVVLCERGGGIGRIPKGEEVKRVGGAAMILMNDE  369

Query  1168  IDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSS  989
              +G+++LAD HVLPAT +SY+ GLK+K YINST+ P ATI+FKGT IG   AP+V SFSS
Sbjct  370   SNGFSVLADVHVLPATHVSYDAGLKIKAYINSTAIPIATILFKGTIIGNSLAPAVTSFSS  429

Query  988   RGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATL  809
             RGP+  SPGILKPDI+GPGVNILAAWP   N +  +  +TFN +SGTSM+ PHLSGIA L
Sbjct  430   RGPNLPSPGILKPDIIGPGVNILAAWPFPLNNDTDSK-STFNFMSGTSMSCPHLSGIAAL  488

Query  808   LKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLI  629
             LKS+HP WSPAAIKSAI+T+AD  N     I+DE L PADVFATG GHVNPSRA+DPGL+
Sbjct  489   LKSSHPHWSPAAIKSAIMTSADIINFERKLIVDETLHPADVFATGSGHVNPSRANDPGLV  548

Query  628   YDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYS  449
             YD+Q DDYIPYLCGL Y+D ++  I  + ++CS+ +SIPE +LNYPSF++ LG    T++
Sbjct  549   YDIQPDDYIPYLCGLGYSDTQVGIIAHKTIKCSETSSIPEGELNYPSFSVVLGSPQ-TFT  607

Query  448   RTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSP-SSTPVDIDFV  272
             RTVTNVGEANS Y V V    GV+V V P+ L F+E NQ+ TY+++FS   S    + +V
Sbjct  608   RTVTNVGEANSSYVVMVMAPEGVEVRVQPNKLYFSEANQKDTYSVTFSRIKSGNETVKYV  667

Query  271   QGAIAWVSQRHIVKSPIAIIF  209
             QG + WVS +HIV+SPI++ F
Sbjct  668   QGFLQWVSAKHIVRSPISVNF  688



>ref|XP_006358408.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=749

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/747 (57%), Positives = 538/747 (72%), Gaps = 16/747 (2%)
 Frame = -1

Query  2413  MAYISVVVCLTLV--FHSVASAKYEDTYIVHVSPPAAAIN--GVSEDYRSYFRSFVSES-  2249
             M ++++++ L +V    S +     +TYIV V  P   I+   +S D  S++ SF+ +S 
Sbjct  1     MKFLNILLVLFIVGCMSSPSMQSNLETYIVQVESPENQISTQSMSMDLESWYNSFLPKSI  60

Query  2248  ---GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNF  2078
                    E  R+++SY +V  GFAA+LS + V EM+KK GF++A  +R+ +L+TT + +F
Sbjct  61    ASTSSNEEVPRLIYSYHNVMKGFAARLSADQVKEMKKKSGFVNAWPERILSLHTTRTQSF  120

Query  2077  LGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACN  1901
             LGL QN G WR+S+YGKGVI+GVLD+GI P+HPSF+D  MPPPPAKWKGKCE    T CN
Sbjct  121   LGLKQNIGLWRDSNYGKGVIIGVLDSGIFPDHPSFSDRGMPPPPAKWKGKCESNFTTKCN  180

Query  1900  NKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAH  1721
             NKLIGAR F  E  SP    +D++GHGTHTASTAAG FV  A V+G+A GTAVG+APLAH
Sbjct  181   NKLIGARIFPKENGSP----IDDDGHGTHTASTAAGGFVKGANVYGNANGTAVGVAPLAH  236

Query  1720  LSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGI  1541
             L+IYKVC   GC++S ILAAMD AIDDGVD+LSLSLG  ++ F+ DSIA+GA++A ++GI
Sbjct  237   LAIYKVCDSFGCSDSGILAAMDVAIDDGVDILSLSLGSSTSPFYSDSIALGAYSATQRGI  296

Query  1540  FVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPP  1361
              VSC+AGN GP   +++NEAPW+LTVGAST+DR IKAT  LGN    +GESAF  + F  
Sbjct  297   LVSCSAGNSGPSESSVANEAPWILTVGASTLDRKIKATVQLGNKKVFEGESAFHSKFFST  356

Query  1360  TLLPLIYP--GSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAM  1187
               +PL  P   + + D++ CG G+L    VKGK+VLC  GGG  R+ KGQ VKDAGG  M
Sbjct  357   KFVPLFDPSLNASESDSSYCGSGTLTDRAVKGKIVLCMIGGGYTRIAKGQAVKDAGGVGM  416

Query  1186  ILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPS  1007
             IL+N+  DG+T  AD HVLPA +++Y DG+K+ DY+NST    A I F+GT +G + AP 
Sbjct  417   ILINRIEDGFTTSADAHVLPAMDVTYEDGMKIIDYMNSTKKHVARITFQGTILGDQNAPV  476

Query  1006  VASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHL  827
             VA FSSRGPS AS GILKPDI+GPGVNILAAWP     N     +TFNIISGTSM+ PHL
Sbjct  477   VAGFSSRGPSIASRGILKPDIIGPGVNILAAWPTSMENNTNTK-STFNIISGTSMSCPHL  535

Query  826   SGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRA  647
             SG+A LLKSAHP WSPAAIKSAI+TTAD  NL    ILDE L+PA +FA G GHVNP RA
Sbjct  536   SGVAALLKSAHPTWSPAAIKSAIMTTADTTNLANGPILDETLLPASIFAFGAGHVNPERA  595

Query  646   SDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGK  467
             +DPGLIYD    DY+PYLCGLNYT++E+  ++QRKV+CS+V SIPEAQLNYPSF+I LG+
Sbjct  596   NDPGLIYDTPVKDYVPYLCGLNYTNREVGNLLQRKVDCSEVKSIPEAQLNYPSFSITLGE  655

Query  466   TSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPV  287
                TY+RTVTNVGEA S Y V++    GV V V P TL F ++NQ+ TY ++FS ++   
Sbjct  656   NPQTYTRTVTNVGEAKSSYIVEIVSSQGVSVTVKPSTLKFLKMNQKKTYQVTFSRTANSS  715

Query  286   DIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
                 VQG + W S RH V+SPIA++ +
Sbjct  716   TSGVVQGFLKWTSNRHSVRSPIAVVLE  742



>gb|ABZ89187.1| putative protein [Coffea canephora]
Length=763

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/761 (58%), Positives = 542/761 (71%), Gaps = 30/761 (4%)
 Frame = -1

Query  2413  MAYISVVVCLTLV-FHSVASAKYED------TYIVHVSPP------AAAINGVSEDYRSY  2273
             M ++ +++ L ++ F S+A+    +      TYIVHV  P      +A+ +  ++D  ++
Sbjct  1     MGFMQILILLFVISFLSIAAKGLHEQESTVQTYIVHVELPTDTQLSSASASPNNDDLENW  60

Query  2272  FRSFV---SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNL  2102
             ++SF+   + S    E  R+++SY +V  GFAAKLS E V EM KK GF+SA  Q + +L
Sbjct  61    YKSFLPTTTISSSSNEAPRMLYSYHNVFRGFAAKLSAEDVKEMEKKPGFLSASPQEMLSL  120

Query  2101  YTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCE  1922
             +TTH+P+FLGL+   GFW++S+YG GVI+GV+DTGI P+HPSF+DE MPPPPAKWKGKCE
Sbjct  121   HTTHTPSFLGLHPGMGFWKDSNYGNGVIIGVMDTGIRPDHPSFSDEGMPPPPAKWKGKCE  180

Query  1921  FEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAV  1742
             F  +ACNNKLIGARNF  E        +DE GHGTHTASTAAGNFV  A V  +A GTA 
Sbjct  181   FNSSACNNKLIGARNFNQE---FSDSALDEVGHGTHTASTAAGNFVQGANVLRNANGTAA  237

Query  1741  GMAPLAHLSIYKVC--------TEDGCAESdilaamdaaiddgvdvlslslgggSASFFE  1586
             G+APLAHL++YKVC          + C ES ILAAMDAAI DGVD+LSLSLGG S  F+ 
Sbjct  238   GIAPLAHLAMYKVCIIVCQGVVCLNICPESAILAAMDAAIHDGVDILSLSLGGSSKPFYT  297

Query  1585  DSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGA  1406
             DS+A+GA+ AMEKGI VSC+AGN GP   +L NEAPW+LTVGASTIDR I ATA+LGN  
Sbjct  298   DSVALGAYTAMEKGILVSCSAGNGGPFNQSLENEAPWILTVGASTIDRKIVATALLGNKE  357

Query  1405  QLDGESAFQVENFPPTLLPLIYPGSKDED--AALCGPGSLdkvdvkgkvVLCDRGGGIAR  1232
             + DGES +  ++F  T  PL Y G    D  +A C   +L+   V+GK+V+CD G GI+ 
Sbjct  358   EFDGESLYNPKHFLSTPFPLYYAGWNASDILSAYCFSSALNSSKVQGKIVVCDYGVGISD  417

Query  1231  VDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTAT  1052
             V KG+ VK AGG  MI++N    GYT  AD HVLPAT LSY DG+KV  YINST  P A 
Sbjct  418   VQKGENVKAAGGVGMIIINGQNQGYTTFADAHVLPATHLSYADGVKVLSYINSTESPVAA  477

Query  1051  IVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNA  872
             I FKGT IG   AP VASFSSRGPS ASPGILKPDI+GPGVNILAAWP  +  NN N  +
Sbjct  478   ISFKGTIIGDDHAPVVASFSSRGPSMASPGILKPDIIGPGVNILAAWP-QSVENNTNTKS  536

Query  871   TFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPA  692
             TFN++SGTSM+ PHLSG+A LLKSAHPDWSPAAIKSAI+TTAD  NL    I DERL+PA
Sbjct  537   TFNMLSGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIMTTADLVNLAKNPIEDERLLPA  596

Query  691   DVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIP  512
             ++FA G GHVNPSRA++PGLIYD++  DY+PYLCGLNYT + +  I+QR+V C++ +SIP
Sbjct  597   NIFAIGSGHVNPSRANNPGLIYDIEPKDYVPYLCGLNYTRRGLLYILQRRVNCTEESSIP  656

Query  511   EAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQ  332
             EAQLNYPSF+I  G     Y+RTVTNVGEA S+YTVKV P  GV+V V P TL F+EV Q
Sbjct  657   EAQLNYPSFSIQFGSPIQRYTRTVTNVGEAKSVYTVKVVPPEGVEVIVKPKTLRFSEVKQ  716

Query  331   QLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             +LTY + FS   T  +    QG+I W S +  V+SPIA I 
Sbjct  717   KLTYQVIFSQLPTAANNTASQGSITWASAKVSVRSPIAAII  757



>ref|XP_006358146.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=741

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/748 (58%), Positives = 543/748 (73%), Gaps = 17/748 (2%)
 Frame = -1

Query  2422  TPNMAYISVVVCLTL----VFHSVASAKYEDTYIVHVS-PPAAAINGVSEDYRSYFRSFV  2258
             TP + Y+SVV    L    +F S    K ++ YIVH+  P  +      ED   +  SF+
Sbjct  2     TPTLVYLSVVSIFFLQSLVIFASYE--KNKEIYIVHLDLPDESQFFSNFEDLHDWHHSFL  59

Query  2257  SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNF  2078
               + D    SR+V+SYR+V +GFAA L+PE V+ ++ K+G IS R +++ +  TTHS NF
Sbjct  60    PSNTDNSSSSRMVYSYRNVLNGFAAMLTPEEVTLLQDKEGIISVRSRQLLDAQTTHSTNF  119

Query  2077  LGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNN  1898
             LGL+QN GFW  S+YGKG+I+GVLD+GITP+HPSF+DE + PPPA+WKGKCEF  T CNN
Sbjct  120   LGLHQNLGFWEKSNYGKGMIIGVLDSGITPDHPSFHDEGVAPPPARWKGKCEFNFTVCNN  179

Query  1897  KLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHL  1718
             KLIGAR F   G      P+DE GHGTHT+STAAGNFV  A   G A GTA GMAPLAH+
Sbjct  180   KLIGARYFHEFG---NGTPLDENGHGTHTSSTAAGNFVDGANFLGLASGTASGMAPLAHV  236

Query  1717  SIYKVCTEDG-CAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGI  1541
             ++YKVC     C+ESDILAA+DAAI+DGVDVLS S+G  S +F+ + +A+G F AM+KGI
Sbjct  237   AMYKVCNASLICSESDILAAIDAAIEDGVDVLSFSIGKNSTNFWSEVVALGGFTAMQKGI  296

Query  1540  FVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPP  1361
              VSC+AGN GP   ++ N APWLLTVGAST DR ++AT  LG+G +++GESAFQ ++F  
Sbjct  297   LVSCSAGNAGPIPGSVFNGAPWLLTVGASTTDRKLRATIRLGDGKEINGESAFQPKDFSE  356

Query  1360  TLLPLIYPGSK--DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAM  1187
             T LPLI+PG+   D  AA C   SL  +DVKGKVVLC  GG I R+ KG  VKDAGGA M
Sbjct  357   TPLPLIFPGTNISDPTAAFCNAESLKNIDVKGKVVLCISGGKITRIGKGSFVKDAGGAGM  416

Query  1186  ILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPS  1007
             IL+N +  G+TILAD HVLPA  +SY DGLK+K YINSTS P AT +FKGT  G   AP+
Sbjct  417   ILMNSEPLGFTILADPHVLPAAHVSYADGLKIKAYINSTSKPQATFLFKGTIFGDDHAPA  476

Query  1006  VASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHL  827
             VA FS RGP+ ASPGILKPDI+GPGVNILAAWP  +  NN +  +TFN++SGTSM+ PH+
Sbjct  477   VAGFSGRGPNLASPGILKPDIIGPGVNILAAWP-KSIENNNDTKSTFNLLSGTSMSCPHV  535

Query  826   SGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRA  647
             SGIATL+KSAHPDWSPAAIKSAI+TTAD  NL    I DER VP D FATG GHVNP RA
Sbjct  536   SGIATLVKSAHPDWSPAAIKSAIMTTADLVNLGEKPIEDERGVPDDFFATGAGHVNPLRA  595

Query  646   SDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGK  467
             SDPGLIYD+Q +DY+PYLCGLNY+++ +   V RKV CS  ++IPEA+LNYPSF+I LG 
Sbjct  596   SDPGLIYDIQPEDYVPYLCGLNYSNRAVSMFVLRKVNCS--SAIPEAELNYPSFSIALGL  653

Query  466   TSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTP-  290
              + TY+RTVTNVGEA   Y V++ P  GVDV V P  L F+E+NQ+ TY ++FS SST  
Sbjct  654   EAQTYTRTVTNVGEAVLSYVVEIVPPQGVDVRVDPPLLNFSELNQKKTYQVTFSRSSTST  713

Query  289   VDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
             ++  FVQG + W S +H V+SPI +  +
Sbjct  714   INATFVQGYLRWTSSKHFVRSPIVVTLE  741



>ref|XP_006358406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=742

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/744 (56%), Positives = 546/744 (73%), Gaps = 15/744 (2%)
 Frame = -1

Query  2413  MAYISVVVCLTLVFHSVASAKYEDTYIVHVSPPAAAINGVSE--DYRSYFRSFVS---ES  2249
             M    V+  +   F   +     +TYIV V  P + I+      D+ S+++SF+    E+
Sbjct  1     MKIFFVIFAILACFSCPSMQSDLETYIVQVESPESQISTQPSRMDFESWYKSFMPKTIEA  60

Query  2248  GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGL  2069
                 E+ R+++SY++V  GFAA+LS + V EM KK GFISAR QR+ +L+TTH+P+FLGL
Sbjct  61    AGSDEKPRLIYSYQNVIIGFAARLSAQQVKEMEKKPGFISARSQRILSLHTTHTPSFLGL  120

Query  2068  YQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTA-CNNKL  1892
              QN G WR+ +YG+GVI+G+LD+G+TP+HPSF+DE MPPPPAKWKGKCE   TA CNNKL
Sbjct  121   QQNVGLWRDENYGEGVIIGLLDSGVTPDHPSFSDEGMPPPPAKWKGKCESNFTAKCNNKL  180

Query  1891  IGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSI  1712
             IGAR+++ +       P+D++GHGTHT+STAAGNFV  A V+G+AKGTAVG+AP AHL+I
Sbjct  181   IGARSYIED----KHSPIDDDGHGTHTSSTAAGNFVKGANVYGNAKGTAVGIAPHAHLAI  236

Query  1711  YKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVS  1532
             YKVCT DGC ESD+LA MD AIDDGVD++SLSLGG S SF++D+IA+GA++A ++GI VS
Sbjct  237   YKVCT-DGCLESDVLAGMDEAIDDGVDIMSLSLGGASRSFYDDAIALGAYSAAKRGILVS  295

Query  1531  CAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLL  1352
             C+AGN GP   TLSNEAPW+LTVGASTIDR +KAT ++GN    +GESAF  +       
Sbjct  296   CSAGNGGPSDSTLSNEAPWILTVGASTIDRELKATVMIGNQKLFEGESAFSPKVPILEFF  355

Query  1351  PLIYPGSKDED--AALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILL  1178
             PLI P     +  +  C PG+L+   +KGK+V+C + G +A V+KGQ VKDAGG  MI+ 
Sbjct  356   PLIDPSLSKLNFYSPYCKPGTLNDPKIKGKIVMC-KLGNVAPVEKGQAVKDAGGVGMIVY  414

Query  1177  NQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVAS  998
             N    G+T  +D HVLPA  ++Y DG+++ DY+NSTS PTA I+F GT IG K AP VA+
Sbjct  415   NIQKYGFTTFSDPHVLPALSITYQDGMEILDYMNSTSEPTARILFHGTIIGDKEAPVVAA  474

Query  997   FSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGI  818
             +SSRGPS ASPGILKPDI+GPG NILAAWP   + +     ATFNII GTSM+ PHLSG+
Sbjct  475   YSSRGPSLASPGILKPDIIGPGNNILAAWPTSVDYDKHTK-ATFNIIQGTSMSCPHLSGV  533

Query  817   ATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDP  638
             A LLKSAHP WSP+AIKSAI+TTA+  NL    ILDERL+PAD+FA G GHVNPSRA+DP
Sbjct  534   AALLKSAHPTWSPSAIKSAIMTTANTLNLANVPILDERLLPADIFAIGAGHVNPSRANDP  593

Query  637   GLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSL  458
             GLIYD    DY+PYLCGLNYT+Q++  IV+ KV+C++V  IPEAQLNYPSF+I  G++S 
Sbjct  594   GLIYDTPVKDYLPYLCGLNYTNQQVGSIVKHKVDCNKVKHIPEAQLNYPSFSIKFGESSQ  653

Query  457   TYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDID  278
             TY+RTVTN+GEANS Y+V++    GV V V P TL F+++NQ+L Y ++F+      +  
Sbjct  654   TYTRTVTNIGEANSSYSVEIDSPPGVTVIVKPSTLKFSQLNQKLKYQVTFTRRDNSTNSG  713

Query  277   FVQGAIAWVSQRHIVKSPIAIIFQ  206
               QG + W  +++ V+SPIA++ Q
Sbjct  714   IAQGFLKWSWKKYSVRSPIAVVLQ  737



>emb|CDP11276.1| unnamed protein product [Coffea canephora]
Length=753

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/751 (56%), Positives = 539/751 (72%), Gaps = 29/751 (4%)
 Frame = -1

Query  2413  MAYISVVVCLTLVFHSVASAKYED-----TYIVHVSPP--------AAAINGVSEDYRSY  2273
             M ++ ++  LT     +A+ ++++     TYIVHV  P          AI G  ED  S 
Sbjct  5     MHFLILICVLTNSHSEIAANEFQEQSNLETYIVHVELPDPDDAEYGTNAITG--EDLESL  62

Query  2272  FRSFVSESGDEGERS-----RIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVY  2108
             + SF+  +      S      IV+SY +V  GFAAKLS E V E+ KK GF+SAR+Q++ 
Sbjct  63    YNSFLPTTATTAAISNATLPHIVYSYHNVFKGFAAKLSAEDVKEIEKKPGFVSARQQKLL  122

Query  2107  NLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGK  1928
             +L TTH+P+FLGL+QN G W+ S+ GKG+I+G+LDTGI P+HPSF+DE MP PPAKWKG+
Sbjct  123   SLCTTHTPSFLGLHQNLGLWKESNCGKGIIIGILDTGIVPDHPSFSDEGMPAPPAKWKGR  182

Query  1927  CEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGT  1748
             CEF  + CNNKLIGAR F          P+DE GHGTHTAS AAGN+V  A VFG+A GT
Sbjct  183   CEFNSSVCNNKLIGARYF----HDGNGSPLDETGHGTHTASIAAGNYVQGANVFGNANGT  238

Query  1747  AVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIG  1568
             AVG+APLAHL++YKVCT  GC ESDILAAMDAAI+DGVD++S SL GG   F+ +S+ +G
Sbjct  239   AVGIAPLAHLAMYKVCTAIGCFESDILAAMDAAIEDGVDIISASLVGGDYQFYANSLLLG  298

Query  1567  AFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGES  1388
             A++AME+GIFVSC+AGN+GP   +LSNEAPW+LTVGASTIDR I+ATAVLGN  +  GE+
Sbjct  299   AYSAMERGIFVSCSAGNDGPSKSSLSNEAPWVLTVGASTIDRNIRATAVLGNKEEFQGET  358

Query  1387  AFQVENFPPTLLPLIYPGSKDED--AALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQT  1214
               Q+++FPPTL PL YPG   ++  +  C   SL+  +V+GK+V+C  GG I+ ++KG+ 
Sbjct  359   INQLKDFPPTLFPLFYPGKNQDNIKSKYCASKSLNNTEVRGKIVVCIDGGTISGIEKGEN  418

Query  1213  VKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGT  1034
             +K AGG  MIL+N   DGYT  AD HVLPAT+LSY DGLKV  YINST  P A I FKGT
Sbjct  419   IKAAGGVGMILINHKNDGYTTFADAHVLPATDLSYADGLKVIAYINSTESPMAAISFKGT  478

Query  1033  FIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIIS  854
               G   AP VASFSSRGPS ASPGILKPDI+GPGVNILAAW    ++   N N  FN++S
Sbjct  479   VFGDNHAPMVASFSSRGPSRASPGILKPDIIGPGVNILAAW---RHSIENNTNTKFNVLS  535

Query  853   GTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATG  674
             GTSM+ PHLSG+A LLKS HP+WSPAAIKSAI+TTAD  N     I D+R  PA++FATG
Sbjct  536   GTSMSCPHLSGVAALLKSVHPNWSPAAIKSAILTTADLVNCAKNPIEDQRHHPANIFATG  595

Query  673   GGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNY  494
              GHVNPS+A++PGLIYD++  DYIPYLCGLNYT++EI  +++RKV C+    +PEAQLNY
Sbjct  596   SGHVNPSKATNPGLIYDIEPKDYIPYLCGLNYTNREIGILLKRKVNCAVELLMPEAQLNY  655

Query  493   PSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNI  314
             PSF+I  G     Y+R VTNV EANS YTVK+ P  GV++ V P TL F++ NQ+LTY +
Sbjct  656   PSFSIIFGSPVQRYTRMVTNVDEANSTYTVKIIPPAGVNLTVKPTTLGFSQANQKLTYEV  715

Query  313   SFSPSSTPVDIDFVQGAIAWVSQRHIVKSPI  221
             +F+  ++P      QG+++W S +  V+SPI
Sbjct  716   TFTLVASPAKSRVSQGSLSWTSTKFSVRSPI  746



>ref|XP_003517445.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=747

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/719 (59%), Positives = 533/719 (74%), Gaps = 16/719 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
             TYIVHV  P       SE+  +++RSF+ E+     ++R++ SYR+VASGFA KL+PE  
Sbjct  38    TYIVHVKKPETIPFLQSEELHNWYRSFLPETT---HKNRMIFSYRNVASGFAVKLTPEEA  94

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
               + +K   +SAR +R  +L+TTH+P+FLGL Q  G W +S+ G+GVI+GV+DTGI P H
Sbjct  95    EALEEKDEIVSARPERTLSLHTTHTPSFLGLQQGVGLWNSSNLGEGVIIGVIDTGIYPFH  154

Query  1981  PSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             PSFNDE MPPPPAKW G CEF G   CNNKLIGARN +      PP   +   HGTHTA+
Sbjct  155   PSFNDEGMPPPPAKWNGHCEFTGQRTCNNKLIGARNLLKSAIEEPP--FENFFHGTHTAA  212

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTED-GCAESdilaamdaaiddgvdv  1628
              AAG FV NA+VFG A+GTA G+AP AH+++YKVC +  GC ES ILAAMD AIDDGVDV
Sbjct  213   EAAGRFVENASVFGMARGTASGIAPNAHVAMYKVCNDKVGCTESAILAAMDIAIDDGVDV  272

Query  1627  lslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTI  1448
             LSLSLG GS  FFED IAIGAFAA++ G+FVSC+A N GP+Y TLSNEAPW+LTVGASTI
Sbjct  273   LSLSLGLGSLPFFEDPIAIGAFAAIQSGVFVSCSAANSGPNYSTLSNEAPWILTVGASTI  332

Query  1447  DRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvkg  1271
             DR I A+AVLGNGA+ +GES FQ +++ P+LLPL+YPG+  + ++  C PGSL+ +DVKG
Sbjct  333   DRKIAASAVLGNGAEYEGESLFQPQDYSPSLLPLVYPGANGNNNSEFCLPGSLNNIDVKG  392

Query  1270  kvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKV  1091
             KVV+CD GGG   V+KGQ V  AGGAAMIL N +  G++  A  +VLP  E+SY  GL +
Sbjct  393   KVVVCDIGGGFPSVEKGQEVLKAGGAAMILANPESFGFSTFAVAYVLPTVEVSYVAGLAI  452

Query  1090  KDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAW  911
             K YINST  PTATI FKGT IG   AP+V SFSSRGPS ASPGILKPDI+GPGVNILAAW
Sbjct  453   KSYINSTYSPTATISFKGTVIGDALAPTVVSFSSRGPSQASPGILKPDIIGPGVNILAAW  512

Query  910   PVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNL  731
              V  +         +NI+SGTSM+ PHLSG+A LLKSAHPDWSPAAIKSAI+TTA+  NL
Sbjct  513   AVSVDNKI----PAYNIVSGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIMTTANTVNL  568

Query  730   NGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIV  551
              GT I+D+R +PAD+FATG GHVNP++A+DPGL+YD+Q +DY+PYLCGL Y D+EI  +V
Sbjct  569   GGTPIVDQRNLPADIFATGAGHVNPNKANDPGLVYDIQPEDYVPYLCGLGYDDREIAILV  628

Query  550   QRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVG  371
             Q +V CS V +IPEAQLNYPSF+I +G +S  YSRT+TNVG A S YTV++   L + + 
Sbjct  629   QSRVRCSSVKAIPEAQLNYPSFSILMGSSSQYYSRTLTNVGPAQSTYTVELDVPLALGMS  688

Query  370   VTPDTLVFTEVNQQLTYNISFSPSSTPV--DIDFVQGAIAW--VSQRHIVKSPIAIIFQ  206
             V P  + FTE NQ++T+++ F P       +  F QG++ W  VS +H V+ PI++IF+
Sbjct  689   VNPSQITFTEANQKVTFSVEFIPQRKENRGNHTFAQGSLTWVRVSDKHAVRIPISVIFK  747



>gb|EPS72428.1| serine protease, partial [Genlisea aurea]
Length=726

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/715 (58%), Positives = 540/715 (76%), Gaps = 17/715 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGD-EGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYIVHV PP    + +  D + ++ SF+ E+ +  G +S IVHSYR+V SGFAAKLS   
Sbjct  24    TYIVHVEPPYDLFDSI--DLQKWYFSFLPETANFTGGKSPIVHSYRNVFSGFAAKLSEVD  81

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             V  +R++KGFISA  QRV  L+TT SP F+GL ++FG W++S YGKGVIVGVLDTGI PN
Sbjct  82    VEFVRRRKGFISATPQRVLQLHTTRSPEFMGLRRDFGLWKDSDYGKGVIVGVLDTGIFPN  141

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             HPSF+   MPPPP +WKGKCEF  TACN+K+IGARNF+         P+D  GHGTH+AS
Sbjct  142   HPSFDAGGMPPPPQRWKGKCEFNFTACNDKIIGARNFID----GEDGPMDRNGHGTHSAS  197

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAG FVG+A+V+G+AKGTA G+AP+AHL+IYK CT+D C ESD+LAAMDAAIDDGVDV+
Sbjct  198   TAAGRFVGDASVYGNAKGTAAGVAPMAHLAIYKSCTDD-CLESDVLAAMDAAIDDGVDVI  256

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
             S+S GG S  +++D+IA+GA++AM++GIFVSC+AGN GP + TLSNEAPW+LTVGASTID
Sbjct  257   SISFGGFSREYYDDNIALGAYSAMQRGIFVSCSAGNNGPFHTTLSNEAPWILTVGASTID  316

Query  1444  RT-IKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG--SKDEDAALCGPGSLdkvdvk  1274
             R  I+ATAVLGN  +L+GES +Q  +FP T  PLI+PG  S +  A  C P S   + + 
Sbjct  317   RKLIRATAVLGNSEELNGESNYQPADFPSTDFPLIFPGLNSTNPRARYCYP-SFGNLTLT  375

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             G +V+C+  GGI ++ KG+ V++AG A +I++N + D YT  +++HV+PAT LSY DG +
Sbjct  376   GTIVVCEDRGGIGKIAKGRVVRNAGAAGLIIVNGEADAYTTPSESHVIPATHLSYADGQR  435

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             +  Y+NST+ PTA I F+GT IG + AP VAS+SSRGP+  S GILKPDI+GPG NILA 
Sbjct  436   LIAYLNSTANPTAAISFRGTIIGDRDAPVVASYSSRGPNTPSRGILKPDIIGPGHNILAG  495

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             W      +  N ++ FNIISGTSMA PHLSG A L+K+AHPDWSPAAIKSA++TTADQ N
Sbjct  496   W----YQSLENTDSHFNIISGTSMACPHLSGAAALIKNAHPDWSPAAIKSALMTTADQTN  551

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             + GT I D+ L PAD FATG GHVN +RAS+PGLIYD+Q DDY+PYLCGLNYTDQ++  I
Sbjct  552   IAGTPIQDQTLNPADAFATGSGHVNIARASNPGLIYDIQPDDYLPYLCGLNYTDQQVGII  611

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDV  374
               R V CS ++SIPEA+LNYPSF++++G  SLT++RTVTNVGEAN +YT + + F  VDV
Sbjct  612   ANRAVNCSNISSIPEAELNYPSFSVFVGDESLTFNRTVTNVGEANEVYTSRYTVFPSVDV  671

Query  373   GVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSP-IAII  212
              + P +L FTEV+Q++TY ++F+     V    +QG++ W S  H V+ P IA+I
Sbjct  672   KIEPSSLQFTEVHQRITYQVTFAKQPDAVSRTIIQGSLTWTSASHSVRCPVIAVI  726



>ref|XP_009609835.1| PREDICTED: subtilisin-like protease SDD1, partial [Nicotiana 
tomentosiformis]
Length=587

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/592 (70%), Positives = 488/592 (82%), Gaps = 6/592 (1%)
 Frame = -1

Query  2155  MRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPS  1976
             M KK GF+SAR +++  L+TTH+PNFLGLYQN GFW+ S+YGKGVI+GVLDTGITP HPS
Sbjct  1     MEKKDGFVSARVEKILALHTTHTPNFLGLYQNMGFWQESNYGKGVIIGVLDTGITPGHPS  60

Query  1975  FNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVSEGssppppPVDEEGHGTHTASTA  1799
             F D NMPPPPAKWKGKCEF G   CN KLIGARNFVS       PP DEEGHGTHT+STA
Sbjct  61    FCDHNMPPPPAKWKGKCEFTGNVTCNKKLIGARNFVS---GSSDPPFDEEGHGTHTSSTA  117

Query  1798  AGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlsl  1619
             AGNFV NA VFG+A GTA GMAPLAH+++YKVCT DGC++ DILAA+DAAIDDGVDVLSL
Sbjct  118   AGNFVDNANVFGNANGTAAGMAPLAHIAMYKVCT-DGCSDVDILAALDAAIDDGVDVLSL  176

Query  1618  slgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRT  1439
             S+GG SA F++D+IA GAFAA++KGIFVS +AGN+GP   TLSNEAPW+LTVGAST DR 
Sbjct  177   SIGGFSAPFYDDNIATGAFAAIQKGIFVSASAGNDGPLNSTLSNEAPWILTVGASTHDRK  236

Query  1438  IKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvdvkgkvVL  1259
             I ATAVLGNG + DGESAFQ  +FP TLLPL+YPG  D++AALC  GSL+  DVKGKVV+
Sbjct  237   IVATAVLGNGKEYDGESAFQPTDFPHTLLPLVYPGLSDQEAALCSSGSLNNTDVKGKVVV  296

Query  1258  CDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYI  1079
             CDRGGG+AR++K QTVKDAGGAAMIL+N +IDG    AD HVLPAT +SYN G K+K YI
Sbjct  297   CDRGGGVARLEKSQTVKDAGGAAMILVNLEIDGDGTFADAHVLPATHVSYNAGEKIKAYI  356

Query  1078  NSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgn  899
             NSTS P+A I FKGT IG K+APSV SFSSRGP+ ASPGI+KPDI+GPGVNILAAWPV  
Sbjct  357   NSTSTPSAGIRFKGTSIGFKSAPSVPSFSSRGPNLASPGIVKPDIIGPGVNILAAWPVSV  416

Query  898   ntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTK  719
                 G    TFNIISGTSM+ PHLSGIA LLKSAHPDWSPAAIKSAI+TTADQ NL G  
Sbjct  417   ENKTGTDL-TFNIISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTTADQSNLEGKP  475

Query  718   ILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKV  539
             ILD+R +PAD+FATG GHVNPS+AS+PGLIYD+Q ++YI YLCGL Y +++I  IVQ+ V
Sbjct  476   ILDQRDLPADIFATGAGHVNPSKASNPGLIYDIQVENYIQYLCGLGYKEKDIGLIVQQSV  535

Query  538   ECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLG  383
             +CSQ++SI EA+LNYPSF+I LG  +  Y+RTVTNVG+A+S+Y V ++   G
Sbjct  536   KCSQLSSISEAELNYPSFSIILGPETQNYTRTVTNVGDASSIYVVNITRIQG  587



>gb|EYU29562.1| hypothetical protein MIMGU_mgv1a001898mg [Erythranthe guttata]
Length=742

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/742 (58%), Positives = 551/742 (74%), Gaps = 28/742 (4%)
 Frame = -1

Query  2404  ISVVVCLTLVFHSVASAKYEDTYIVHVSPPA----AAINGVSEDYRSYFRSFV----SES  2249
             ++ V+C   +F     +  + TYIVHV  P+       + ++ED ++Y+++F+    S S
Sbjct  10    LTCVLCFNTIFVRSKDSNLQ-TYIVHVELPSFPTLTTSSLLTEDLQAYYQTFLASTLSAS  68

Query  2248  GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGL  2069
                 +   I++SY +V  GF+A+LSPE V  M KK GFISAR Q+  +L+TTHSPNFLGL
Sbjct  69    SPSTDEPSIIYSYHNVFHGFSARLSPEQVKAMEKKPGFISARPQKTLSLHTTHSPNFLGL  128

Query  2068  YQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGT--ACNNK  1895
              QN GFWR+S+YG+G+I+GVLD+G+ PNHPSFND+ MPPPPA+W+G+CEF  T   CNNK
Sbjct  129   NQNTGFWRDSNYGRGMIIGVLDSGVNPNHPSFNDDGMPPPPARWRGRCEFNSTIARCNNK  188

Query  1894  LIGARNF-VSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHL  1718
             LIGAR F + +G+       DE+GHGTHTASTAAGNFV  A VFG+A GTA G+APLAH+
Sbjct  189   LIGARFFTIGDGTPS-----DEDGHGTHTASTAAGNFVPGANVFGNANGTAAGVAPLAHV  243

Query  1717  SIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIF  1538
             + YKVCT   C ESDI+AAMDAAIDDGVD++SLSLGG +  FF ++IA+GAF+A+E+GIF
Sbjct  244   ATYKVCTTT-CEESDIVAAMDAAIDDGVDIISLSLGGPAQDFFGENIAVGAFSAIERGIF  302

Query  1537  VSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPT  1358
             VS +AGN GP Y T  N APW+LTVGAS++DR I+ATAVLGN  +LDGES FQ  +FP T
Sbjct  303   VSASAGNNGPFYGTAQNGAPWILTVGASSVDRKIRATAVLGNNEELDGESTFQPSDFPTT  362

Query  1357  LLPLIYPGSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILL  1178
             LLPL Y      + + C P SL  +D++G +VLCD GGGI R+ KG+ V+ AGGAAM+++
Sbjct  363   LLPLFY----SPNDSFCSPASLRSLDLQGMIVLCDNGGGIGRIAKGRAVRAAGGAAMVIV  418

Query  1177  NQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVAS  998
             NQ   G+T  +D+HVLPAT LSY DGL+VK Y+NST+ PTATI FKGT IG   AP VA+
Sbjct  419   NQQRQGFTTNSDSHVLPATHLSYTDGLRVKAYLNSTASPTATISFKGTVIGDDRAPQVAA  478

Query  997   FSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGI  818
             FS+RGP+  SPGILKPDI+GPG NILAAW V    N G   + FNIISGTSM+ PHLSG+
Sbjct  479   FSARGPNPPSPGILKPDIIGPGHNILAAWHVSVENNTGTN-SNFNIISGTSMSCPHLSGV  537

Query  817   ATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDP  638
             A LLKS HPDWSPAAIKSAI+TTAD  NL G  I D+    ADVFA G GHVN  +A+DP
Sbjct  538   AALLKSVHPDWSPAAIKSAIMTTADLVNLAGNPIEDQTQSRADVFAIGSGHVNILKATDP  597

Query  637   GLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSL  458
             GL+YD+   DY+PYLCGLNYTDQ++  IV R V C++++SIPEA+LNYPSF++ +G TS 
Sbjct  598   GLVYDMGPQDYVPYLCGLNYTDQQVAVIVNRVVRCAEISSIPEAELNYPSFSVVIGNTST  657

Query  457   TYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSS---TPV  287
             TY+RTVTNVGEANS+YTV+ +  L VDV V P TL F+ +NQ LTY  +F+ SS   T V
Sbjct  658   TYNRTVTNVGEANSVYTVRAALPL-VDVRVEPTTLQFSAINQTLTYQTTFTRSSGNATIV  716

Query  286   DIDFVQGAIAWVSQRHIVKSPI  221
             ++ +VQG + W S +H V+SPI
Sbjct  717   NV-YVQGFLTWTSAKHTVRSPI  737



>ref|XP_011081166.1| PREDICTED: subtilisin-like protease SDD1 [Sesamum indicum]
Length=1245

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/721 (62%), Positives = 541/721 (75%), Gaps = 16/721 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSE-SGDEGERSRIVHSYRHVASGFAAKLSPE  2168
             +TYIVHV  P   +N + +D  S++ +F+S  +   GER+R ++SYR+V  GFAA+LS +
Sbjct  533   ETYIVHVDGPDGVLNRL-DDLDSWYNTFLSTITVASGERNRRIYSYRNVFKGFAARLSAD  591

Query  2167  MVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITP  1988
              V  M    GFISAR +R  +L+TTHSPNFLGL QN GFW  S+YGKGVI+GVLDTGI P
Sbjct  592   EVKAMEDMPGFISARPERKLSLHTTHSPNFLGLNQNMGFWNESNYGKGVIIGVLDTGIFP  651

Query  1987  NHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARNFVSEGssppppPVDEEGHGTHT  1811
             +HPSF+DE MPPPPAKWKGKC+F   T CNNK+IGAR F S        P+D++GHGTHT
Sbjct  652   DHPSFSDEGMPPPPAKWKGKCDFNLTTKCNNKIIGARYFNS----FDDSPLDDDGHGTHT  707

Query  1810  ASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvd  1631
             ASTAAGNFV  A VFG+A GTAVG+APLAHL+IYKVC+   C+ESDILAAMD AIDDGVD
Sbjct  708   ASTAAGNFVRGANVFGNANGTAVGIAPLAHLAIYKVCSL-FCSESDILAAMDTAIDDGVD  766

Query  1630  vlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAST  1451
             VLSLSLGG + S ++DSIA+GA++AME+GI VSC+AGN GP  ++LSNEAPW+LTVGAST
Sbjct  767   VLSLSLGGFANSLYDDSIALGAYSAMEQGILVSCSAGNAGPYNFSLSNEAPWILTVGAST  826

Query  1450  IDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG---SKDEDAALCGPGSLdkvd  1280
             IDR I+ATA+LG+    DGES FQ  +FPPTLLPL+Y G   + D D   C   SL+  D
Sbjct  827   IDRKIRATALLGDNQTFDGESTFQPMDFPPTLLPLVYAGMLNTSDPDIQFCTAESLNGTD  886

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
             ++GK+V+C+ G    R+ KG  VK+AGGAAMIL+N        L+++HVLPAT +SY DG
Sbjct  887   LRGKIVVCEVGI-TTRISKGIAVKEAGGAAMILVNPARFANLTLSESHVLPATHVSYADG  945

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
             LK+K YINSTS PTATIVF+GT IG   AP VA+FSSRGP+  S  ILKPDILGPGVNIL
Sbjct  946   LKIKAYINSTSTPTATIVFRGTIIGDDRAPVVAAFSSRGPNWVSRNILKPDILGPGVNIL  1005

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAWPV    N        NIISGTSM+ PHLSGIA LLKS+HPDWSPAAIKSAI+TTAD 
Sbjct  1006  AAWPVSVENNTNTNATF-NIISGTSMSCPHLSGIAALLKSSHPDWSPAAIKSAIMTTADV  1064

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              NL    I DER +PA+VFATG GHVNPSRA+DPGLIYDLQ++DYIPYLCGLNYT++E+ 
Sbjct  1065  VNLAQNPIEDERFLPANVFATGSGHVNPSRANDPGLIYDLQAEDYIPYLCGLNYTNREVG  1124

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLG---KTSLTYSRTVTNVGEANSMYTVKVSPF  389
              I+QR+V CS  + IPE QLNYPSFA+  G    T  TY+RTVTNVGE NS Y V++ P 
Sbjct  1125  SILQRRVNCSAESRIPETQLNYPSFALTFGVFQPTVQTYTRTVTNVGEPNSSYVVEIVPP  1184

Query  388   LGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              G+DV V P  L F EVNQ+L Y ++FS  ++   I FVQG + W S +  V+SPIA+I 
Sbjct  1185  PGIDVLVEPTKLDFLEVNQKLQYQVTFSRLNSTTSIGFVQGYLKWNSSKRSVRSPIAVIL  1244

Query  208   Q  206
             +
Sbjct  1245  R  1245


 Score =   241 bits (616),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 146/196 (74%), Gaps = 2/196 (1%)
 Frame = -1

Query  787  WSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDD  608
            WSPAAIKSAI+TTAD  NL    I DE+ VPA +FATG GHVNPSRA+DPGL+YD+Q  D
Sbjct  331  WSPAAIKSAIMTTADVVNLARHPIEDEQFVPASIFATGAGHVNPSRANDPGLVYDIQPKD  390

Query  607  YIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLG--KTSLTYSRTVTN  434
            YIPYLCGLNYT++E+   +QR+V CS  +SIPE QLNYP+FA+      TS TY+RTVTN
Sbjct  391  YIPYLCGLNYTNREVGFFLQRRVNCSLESSIPEGQLNYPAFALTFSSQSTSQTYTRTVTN  450

Query  433  VGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAW  254
            VG+ NS Y V V P  G+D+ V PDTL FTE NQ++ Y ++FS S++  +   VQG +AW
Sbjct  451  VGDPNSSYIVDVVPPPGIDMLVEPDTLSFTETNQKMQYQVTFSRSASAANNTVVQGFLAW  510

Query  253  VSQRHIVKSPIAIIFQ  206
             S RH V+SPIA+I Q
Sbjct  511  NSSRHSVRSPIAVILQ  526


 Score =   238 bits (606),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 147/195 (75%), Gaps = 8/195 (4%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV---SESGDEGERSRIVHSYRHVASGFAAKLSP  2171
             TYIV +  P   +   SED  S+++SF+   + S ++GE +RIV+SYR+V  GFAAKL+ 
Sbjct  33    TYIVLLEGPDGEVTTQSEDLESWYQSFLPASTASSNDGE-ARIVYSYRNVFKGFAAKLTA  91

Query  2170  EMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGIT  1991
             + V  M KK GF+SAR ++V +L+TTH+PNFLGL QN G WR+S+YGKGVI+GVLDTG+ 
Sbjct  92    DDVKNMEKKDGFVSARPEKVLSLHTTHTPNFLGLNQNMGLWRDSNYGKGVIIGVLDTGVF  151

Query  1990  PNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHT  1811
             P HPSF+DE MPPPPAKWKGKCEF  T CNNK+IGAR F +E       P+D++GHGTHT
Sbjct  152   PEHPSFSDEGMPPPPAKWKGKCEFNHTTCNNKIIGARYFETE----DISPLDDDGHGTHT  207

Query  1810  ASTAAGNFVGNAAVF  1766
             ASTAAGNFV  A VF
Sbjct  208   ASTAAGNFVRGANVF  222


 Score = 95.1 bits (235),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -1

Query  1261  LCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDY  1082
             +C+ GGG+ RV KG+ VK AGGA MILLN +    T  A+ HVLPAT +SY  GLK+K Y
Sbjct  255   VCELGGGMTRVGKGEAVKSAGGAGMILLNNERSANTTSAEVHVLPATHVSYAAGLKIKAY  314

Query  1081  INSTSWPTATIVFKGTF  1031
             INSTS PTATI F+GT+
Sbjct  315   INSTSTPTATIRFEGTW  331



>ref|XP_011029125.1| PREDICTED: subtilisin-like protease SDD1 [Populus euphratica]
Length=762

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/715 (59%), Positives = 528/715 (74%), Gaps = 9/715 (1%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYI+ +  P   ++   E+  S+++SF+ + +     + R+VHSY +V +GFAAKL+ + 
Sbjct  54    TYIIFLKKPEDMVSAEREELDSWYQSFLPAVTTSSSNQQRLVHSYHNVVTGFAAKLTEKE  113

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                M  K+G +SA  Q+V+ + TTH+P+FLGL QN GFW +S+YGKGVI+GVLD+GITP+
Sbjct  114   AKAMEMKEGLVSAHPQKVFRVKTTHTPSFLGLQQNLGFWNHSNYGKGVIIGVLDSGITPS  173

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             HPSF+DE MPPPPAKWKGKCE  GT CNNKLIGARNF S G  P    VD+ GHGTHTAS
Sbjct  174   HPSFSDEGMPPPPAKWKGKCELNGTLCNNKLIGARNFYSAGKPP----VDDNGHGTHTAS  229

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDG-CAESdilaamdaaiddgvdv  1628
             TAAG+ V  A+ +    GTAVG+A  AHL+IY+VC   G C ES+ILA MD A++DG DV
Sbjct  230   TAAGSRVQGASFYDQLNGTAVGIASSAHLAIYQVCDGFGSCEESNILAGMDTAVEDGADV  289

Query  1627  lslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTI  1448
             LSLSLGGGS  F+EDSIAIGAF A++KGIFVSCAAGNEGP   +LSNEAPW+LTVGAST+
Sbjct  290   LSLSLGGGSLPFYEDSIAIGAFGAIQKGIFVSCAAGNEGPYKESLSNEAPWILTVGASTV  349

Query  1447  DRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDED-AALCGPGSLdkvdvkg  1271
             DR+I+AT +LGN A  DG+S +Q  NF  TLLPLIY G+   D AA C PGS   VDVKG
Sbjct  350   DRSIRATVLLGNKASYDGQSFYQPTNFSSTLLPLIYAGANGSDTAAFCDPGSSKDVDVKG  409

Query  1270  kvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKV  1091
             KVVLC+ GG    VDKGQ VK AGGAAMI++N ++ G    AD HVLPA++++Y DGL +
Sbjct  410   KVVLCESGGFSESVDKGQEVKYAGGAAMIIMNDELSGNITTADFHVLPASDVTYADGLSI  469

Query  1090  KDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAW  911
             K YI STS P ATI+FKGT  G   AP +A FSSRGPS  SPGILKPDI+GPGV+ILAAW
Sbjct  470   KAYIKSTSSPMATILFKGTVFGVPYAPQLAYFSSRGPSLESPGILKPDIIGPGVDILAAW  529

Query  910   PVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNL  731
             P   + +     +TFN+ISGTSMATPHLSGIA LLKS+HP WSPAAIKSAI+TTA+  NL
Sbjct  530   PYAVDNHRNTK-STFNMISGTSMATPHLSGIAALLKSSHPHWSPAAIKSAIMTTANLTNL  588

Query  730   NGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIV  551
              GT I D+   P DVFA G GHVNP++A DPG +YD+Q DDYIPYLCGL Y + E+  IV
Sbjct  589   GGTPITDDSFGPVDVFAIGSGHVNPTKADDPGFVYDIQPDDYIPYLCGLGYNNTEVGIIV  648

Query  550   QRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVG  371
             QR V CS  +SIPEAQLNYPSF+I LG T  TY+RTVTNVG   S Y  ++    GVDV 
Sbjct  649   QRPVTCSNSSSIPEAQLNYPSFSIKLGSTPQTYTRTVTNVGPFKSSYIAEIIAPQGVDVK  708

Query  370   VTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
             VTP+ + F   + + TY+++F+ ++  V++ F QG + WVS  H+V++PIA+ F+
Sbjct  709   VTPNAIPFGGGDPKATYSVTFTRTAN-VNLPFSQGYLNWVSADHVVRNPIAVTFE  762



>ref|XP_003611185.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES94143.1| subtilisin-like serine protease [Medicago truncatula]
Length=756

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/720 (59%), Positives = 524/720 (73%), Gaps = 17/720 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
             TYIVHV       +  SED  S++ SF+ +  +   + R+V SYRHVASGFA KL+PE  
Sbjct  44    TYIVHVKKSENVASFQSEDLHSWYHSFLPQ--NFPHKHRMVFSYRHVASGFAVKLTPEEA  101

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
               +++K G + AR +R  +L+TTHSP FLGL    G W + + GKGVI+GV+D+GI P+H
Sbjct  102   KSLQEKDGILLARPERTLSLHTTHSPTFLGLKHGQGLWNDDNLGKGVIIGVIDSGIFPSH  161

Query  1981  PSFNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             PSFNDE MPPPPAKWKG CEF GT  CNNKLIGAR+ V    +   PP +   HGTHTA+
Sbjct  162   PSFNDEGMPPPPAKWKGHCEFNGTKICNNKLIGARSLVKS--TIQEPPFENIFHGTHTAA  219

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTED-GCAESdilaamdaaiddgvdv  1628
              AAG F+ +A+VFG+AKG A GMAP AHL+IYKVC +   C ES ILAAMD AI+DGVDV
Sbjct  220   EAAGRFIKDASVFGNAKGVAAGMAPNAHLAIYKVCNDKIECPESAILAAMDIAIEDGVDV  279

Query  1627  lslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTI  1448
             LSLSLG GS  FFED IAIGAFAA + G+FVSC+AGN GP+Y TLSNEAPW+LTVGASTI
Sbjct  280   LSLSLGLGSLPFFEDPIAIGAFAATKNGVFVSCSAGNSGPEYSTLSNEAPWILTVGASTI  339

Query  1447  DRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS-----KDEDAALCGPGSLdkv  1283
             DR I A+A LGNG + +GE+ FQ ++FP  L PL+Y GS     + ++ +LC PGSL  +
Sbjct  340   DRKIVASAKLGNGEEYEGETLFQPKDFPQQLFPLVYAGSLGYGNQTQNQSLCLPGSLKNI  399

Query  1282  dvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYND  1103
             D+ GKVVLCD G  ++   KGQ V +A G A+IL+N + DG++  A  HVLPA E+SY  
Sbjct  400   DLSGKVVLCDIGEDVSTFVKGQEVLNANGVAVILVNSESDGFSTFATAHVLPAVEVSYAA  459

Query  1102  GLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNI  923
             GL +KDYINST  PTAT++FKGT IG   APSV SFSSRGPS  SPGILKPDI+GPGVNI
Sbjct  460   GLTIKDYINSTYNPTATLLFKGTVIGDSLAPSVVSFSSRGPSQQSPGILKPDIIGPGVNI  519

Query  922   LAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTAD  743
             LAAWPV  +         F I SGTSM+ PHLSGIA L+KS+HPDWSPAAIKSAI+TTA+
Sbjct  520   LAAWPVSIDNKT----PPFAITSGTSMSCPHLSGIAALIKSSHPDWSPAAIKSAIMTTAN  575

Query  742   QYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEI  563
               NL G  ILD+RL PADVFATG GHVNP +A+DPGL+YD+Q +DY+PYLCGL YTDQEI
Sbjct  576   TLNLGGIPILDQRLSPADVFATGAGHVNPVKANDPGLVYDIQPEDYVPYLCGLGYTDQEI  635

Query  562   QQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLG  383
             + I Q  V CS V SIPEAQLNYPSF+I LG  S  Y+RT+TNVG ANS Y V++   L 
Sbjct  636   ELIAQWVVNCSNVKSIPEAQLNYPSFSILLGSDSQYYTRTLTNVGLANSTYRVELEVPLA  695

Query  382   VDVGVTPDTLVFTEVNQQLTYNISFSPSSTPV--DIDFVQGAIAWVSQRHIVKSPIAIIF  209
             + + V P  + F EVN++++Y++ F P +     +  + QG++ WVS +H V+ PI++IF
Sbjct  696   LGMSVNPSEITFNEVNEKVSYSVDFIPKTKESRGNNTYAQGSLTWVSDKHAVRIPISVIF  755



>gb|ABG37022.1| serine protease [Nicotiana tabacum]
Length=753

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/726 (59%), Positives = 522/726 (72%), Gaps = 20/726 (3%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVS---EDYRSYFRSFV------SESGDEGERSRIVHSYRHVASGF  2189
             TYIV V  P + I+  S   +D  S++RSF+      + S DE E  R+V+SYR+V  GF
Sbjct  27    TYIVQVESPESRISTQSLSDQDLESWYRSFLPNTIASTRSNDE-EEPRLVYSYRNVMKGF  85

Query  2188  AAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGV  2009
             AA+LS E V EM KK+GFISA  +R+ +L+TTH+P+FLGL QN G WR+S+YGKGVI+GV
Sbjct  86    AARLSAEQVKEMEKKEGFISAWPERILSLHTTHTPSFLGLQQNEGVWRHSNYGKGVIIGV  145

Query  2008  LDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARNFVSEGssppppPVDE  1832
             LDTGI+P+HPSF+DE MPPPPAKWKGKCE    T CNNKLIGAR F          P+D+
Sbjct  146   LDTGISPDHPSFSDEGMPPPPAKWKGKCELNFTTKCNNKLIGARTF----PQANGSPIDD  201

Query  1831  EGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamda  1652
              GHGTHTA TAAG FV  A VFG+A GTAVG+APLAHL+IYKVC   GC++S IL+AMDA
Sbjct  202   NGHGTHTAGTAAGGFVKGANVFGNANGTAVGIAPLAHLAIYKVCDSFGCSDSGILSAMDA  261

Query  1651  aiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWL  1472
             AIDDGVD+LSLSLGG +  F  D IA+GA++A ++GI VSC+AGN GP    + NEAPW+
Sbjct  262   AIDDGVDILSLSLGGSTNPFHSDPIALGAYSATQRGILVSCSAGNTGPFEGAVVNEAPWI  321

Query  1471  LTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG---SKDEDAALCGP  1301
             LTVGAST+DR IKAT  LGN  + +GESAF  +       PL  PG   + D D + CGP
Sbjct  322   LTVGASTLDRKIKATVRLGNKEEFEGESAFHPKVSKTKFFPLFNPGENLTDDSDNSFCGP  381

Query  1300  G-SLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPA  1124
             G +     +KGK+VLC  GGG   ++KGQ VK+AGG  MIL+N+  DG T  AD HVLPA
Sbjct  382   GLTDLSRAIKGKIVLCVAGGGFNSIEKGQAVKNAGGVGMILINRPQDGLTKSADAHVLPA  441

Query  1123  TELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDI  944
              +++  DG  + DY+ ST  P A I F+GT IG K AP +A FSSRGPS ASPGILKPDI
Sbjct  442   LDVASFDGNNIIDYMKSTKKPVARITFQGTIIGDKNAPVLAGFSSRGPSTASPGILKPDI  501

Query  943   LGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKS  764
             +GPGVN+LAAWP           +TFNIISGTSM+ PHLSGIA LLKSAHP WSPAAIKS
Sbjct  502   IGPGVNVLAAWPTPVENKTNTK-STFNIISGTSMSCPHLSGIAALLKSAHPTWSPAAIKS  560

Query  763   AIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGL  584
             AI+TTAD  NL    +LDE L PA +FA G GHVNPSRA+DPGL+YD Q  DYIPYLCGL
Sbjct  561   AIMTTADIVNLGNESLLDEMLAPAKIFAYGSGHVNPSRANDPGLVYDTQFKDYIPYLCGL  620

Query  583   NYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTV  404
             NYTD+++  I+QR   CS+V SIPEAQLNYPSF+I LG    TY+RTVTNVGEA S Y V
Sbjct  621   NYTDRQMGNILQRITSCSKVKSIPEAQLNYPSFSISLGANQQTYTRTVTNVGEAKSSYRV  680

Query  403   KVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSP  224
             ++     V V V P TL FT++NQ+LTY ++FS ++   +++ V G + W S RH V+SP
Sbjct  681   EIVSPRSVSVVVKPSTLKFTKLNQKLTYRVTFSATTNITNMEVVHGYLKWSSNRHFVRSP  740

Query  223   IAIIFQ  206
             IA+I Q
Sbjct  741   IAVILQ  746



>ref|XP_009614059.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=753

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/725 (59%), Positives = 520/725 (72%), Gaps = 18/725 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVS---EDYRSYFRSFV-----SESGDEGERSRIVHSYRHVASGFA  2186
             TYIV V  P + I+  S   +D  S++RSF+     S S +E E  R+V+SYR+V  GFA
Sbjct  27    TYIVQVESPESRISTQSLSDQDLESWYRSFLPNTIASTSSNEQEEPRLVYSYRNVMKGFA  86

Query  2185  AKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVL  2006
             A+LS E V EM KK+GFISA  +R+ +L+TTH+P+FLGL  N G WR+S+YGKGVI+GVL
Sbjct  87    ARLSAEQVKEMEKKEGFISAWPERILSLHTTHTPSFLGLQHNEGVWRHSNYGKGVIIGVL  146

Query  2005  DTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARNFVSEGssppppPVDEE  1829
             DTGI+P+HPSF+DE MPPPPAKWKGKCE    T CNNKLIGAR F          P+D+ 
Sbjct  147   DTGISPDHPSFSDEGMPPPPAKWKGKCESNFTTKCNNKLIGARTF----PQANGSPIDDN  202

Query  1828  GHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaa  1649
             GHGTHTA TAAG FV  A VFG+A GTAVG+APLAHL+IYKVC   GC++S IL+AMD A
Sbjct  203   GHGTHTAGTAAGGFVKGANVFGNANGTAVGIAPLAHLAIYKVCDSFGCSDSGILSAMDVA  262

Query  1648  iddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLL  1469
             IDDGVD+LSLSLGG +  F  D IA+GA++A ++GI VSC+AGN GP   T+ NEAPW+L
Sbjct  263   IDDGVDILSLSLGGSTNPFHSDPIALGAYSATQRGILVSCSAGNTGPFEGTVVNEAPWIL  322

Query  1468  TVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG---SKDEDAALCGPG  1298
             TVGAST+DR IKAT  LGN  + +GESAF  +       PL  PG   + D D + CGPG
Sbjct  323   TVGASTLDRKIKATVRLGNKEEFEGESAFHPKVSKTKFFPLFNPGENLTDDSDNSFCGPG  382

Query  1297  -SLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPAT  1121
              +     +KGK+VLC  GGG   ++KGQ VK+AGG  MIL+N+  DG T  AD HVLPA 
Sbjct  383   LTDLSRAIKGKIVLCVAGGGFNSIEKGQAVKNAGGVGMILINRPQDGLTKSADAHVLPAL  442

Query  1120  ELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDIL  941
             +++  DG  + DY+ ST  P A I F+GT IG K AP +A FSSRGPS ASPGILKPDI+
Sbjct  443   DVASFDGNNIIDYMKSTKKPVARITFQGTIIGDKNAPVLAGFSSRGPSTASPGILKPDII  502

Query  940   GPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSA  761
             GPGVN+LAAWP           +TFNIISGTSM+ PHLSG+A LLKSAHP WSPAAIKSA
Sbjct  503   GPGVNVLAAWPTSVENKTNTK-STFNIISGTSMSCPHLSGVAALLKSAHPTWSPAAIKSA  561

Query  760   IITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLN  581
             I+TTAD  NL    + DE L PA +FA G GHVNPSRA+DPGL+YD Q  DYIPYLCGLN
Sbjct  562   IMTTADIVNLGNESLRDEMLAPAKIFAYGSGHVNPSRANDPGLVYDTQFKDYIPYLCGLN  621

Query  580   YTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVK  401
             YTD+++  I+QR   CS+V SIPEAQLNYPSF+I LG    TY+RTVTNVGEA S Y V+
Sbjct  622   YTDRQMGNILQRITSCSKVKSIPEAQLNYPSFSISLGANQQTYTRTVTNVGEAKSSYRVE  681

Query  400   VSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPI  221
             +     V V V P TL FT++NQ+LTY ++FS ++   +++ V G + W S RH V+SPI
Sbjct  682   IVSPRSVSVVVKPSTLKFTKLNQKLTYRVTFSTATNITNMEIVHGYLKWSSNRHFVRSPI  741

Query  220   AIIFQ  206
             A+I Q
Sbjct  742   AVILQ  746



>emb|CDP09844.1| unnamed protein product [Coffea canephora]
Length=754

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/715 (61%), Positives = 525/715 (73%), Gaps = 8/715 (1%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSE-SGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYIVH+  PA   +    D  S+++SF+ + +    + SR+VHS+RHV +GFAAKLSPE 
Sbjct  43    TYIVHLRLPAGDNSTQLNDLESWYQSFLPKNTTGLNDASRMVHSFRHVFTGFAAKLSPEE  102

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             V EM KK+GF+ AR ++  NL TTHSP FLGLY N  F      G+GVI+G++D+GITP 
Sbjct  103   VKEMEKKEGFLDARPEKTLNLQTTHSPKFLGLYTNSQFQWQYGRGEGVIIGIIDSGITPG  162

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             HPSF+DE M PPP  WKGKCEF GT CN KLIGAR+ +      P  P+DE GHGTHTAS
Sbjct  163   HPSFSDEGMQPPPPSWKGKCEFVGTGCNKKLIGARDLLGP---KPGQPLDEIGHGTHTAS  219

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDG-CAESdilaamdaaiddgvdv  1628
             TAAGNFV  A V   A GTA GMAP AHLSIY+ C   G C ES I+AAMD AI D V +
Sbjct  220   TAAGNFVEGANVMRQANGTAAGMAPRAHLSIYRACYPSGMCTESAIVAAMDFAIQDNVTM  279

Query  1627  lslslgg-gSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAST  1451
             LS+SLGG     FF+D IA+GAF A +KGIFVSC+A N GP+  +LSNEAPW+LTVGAST
Sbjct  280   LSMSLGGPSKLPFFDDPIALGAFQANKKGIFVSCSASNSGPENGSLSNEAPWILTVGAST  339

Query  1450  IDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG-SKDEDAALCGPGSLdkvdvk  1274
             IDR I+ATA+LGNG + DG+S +Q  +FPP LLPL+Y G + D  AALC   SL K  VK
Sbjct  340   IDRDIRATALLGNGDEFDGQSIYQPTDFPPNLLPLVYLGMNGDTFAALCTKNSLKKAGVK  399

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             GKVVLC+    +A V++GQ VKDAGGAAMI++NQ+I+GYTI+AD HVLPAT +S+  G  
Sbjct  400   GKVVLCETSDLMATVEQGQNVKDAGGAAMIIMNQEIEGYTIIADLHVLPATHVSFAAGQA  459

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             +K YINST  P ATI+FKGT +G K AP+VASFSSRGP+NASPGILKPDI+GPGVNILAA
Sbjct  460   IKAYINSTCMPRATILFKGTILGVKNAPAVASFSSRGPNNASPGILKPDIIGPGVNILAA  519

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             WP  +  N  N ++TFNI+SGTSM+ PHL+GIA LLKSAHP+WSPAAIKSAI+TTA   N
Sbjct  520   WP-ESVENITNTSSTFNILSGTSMSCPHLTGIAALLKSAHPNWSPAAIKSAIMTTASFVN  578

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
              N   IL+E++ PADVFATG GHVNP RA DPGL YD+Q DDYIPYLCGL YTD +I +I
Sbjct  579   RNDGHILNEQMFPADVFATGAGHVNPPRAIDPGLTYDIQPDDYIPYLCGLGYTDDQIMKI  638

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDV  374
             VQ  V+CS +  I EA+LNYPSFAI L  +  TY R VTNVGEA S Y V +    GV++
Sbjct  639   VQSPVKCSAIHRIQEAELNYPSFAIQLKSSKQTYKRVVTNVGEALSTYYVDIDKIQGVEI  698

Query  373   GVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              V P  L F +VNQ++TY ISF   +  V   + QGAI W S++H V+SPI++ F
Sbjct  699   DVQPRVLNFRKVNQKITYQISFRRLNMSVGNWYEQGAITWNSEKHRVRSPISVKF  753



>ref|XP_010910929.1| PREDICTED: subtilisin-like protease SDD1 [Elaeis guineensis]
Length=759

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/729 (58%), Positives = 538/729 (74%), Gaps = 15/729 (2%)
 Frame = -1

Query  2362  ASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAA  2183
             A A    TY+VHV P  + +   S D  +++ SF+ ++      +R+VH Y +VASGFAA
Sbjct  35    AEASELRTYVVHVQPSLSTVFATSTDRETWYNSFLPKT-----PARMVHMYTNVASGFAA  89

Query  2182  KLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLD  2003
             +LS   + +M+KK GF+ A   R+Y+L TTH+P FLGL  N GFW +++YGKGVIVG+LD
Sbjct  90    RLSEHELEDMKKKPGFLHAYPDRLYSLQTTHTPEFLGLQLNSGFWNDANYGKGVIVGMLD  149

Query  2002  TGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGss------ppppP  1841
             TGI P+HPSF+ + MPPPPAKWKG+C+F  + CNNKLIGAR F+S   +         PP
Sbjct  150   TGIFPDHPSFSGDGMPPPPAKWKGRCDFNASLCNNKLIGARTFISGAMAMKGRGVAAAPP  209

Query  1840  VDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaa  1661
             VD+ GHGTHTASTAAG  V  A V G+AKGTA GMAPLAHL+IYKVC+E GCA+SDILAA
Sbjct  210   VDDVGHGTHTASTAAGARVAGANVLGNAKGTAAGMAPLAHLAIYKVCSEFGCADSDILAA  269

Query  1660  mdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEA  1481
             MDAA+ DGVDVLSLS+GG S  F++DSIAIG F A++ G+FVSCAAGN GP+  +LSNEA
Sbjct  270   MDAAVADGVDVLSLSIGGDSVPFYQDSIAIGGFGAIKNGVFVSCAAGNSGPNVSSLSNEA  329

Query  1480  PWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDE-DAALCG  1304
             PWLLTV AST+DR I+ T  LGNG + +GES +Q E + PT  PL+Y G+  + DA  CG
Sbjct  330   PWLLTVAASTMDRNIRVTVKLGNGLEFNGESLYQPEWYNPTFYPLVYAGAGPKPDAIFCG  389

Query  1303  PGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPA  1124
              GSLD +DVKGK+VLCDRGG IAR+DKG TV+ AGG  +IL N  +DGY+ LAD HVLPA
Sbjct  390   NGSLDGLDVKGKIVLCDRGGDIARIDKGVTVQGAGGVGLILTNGRLDGYSTLADPHVLPA  449

Query  1123  TELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDI  944
             + + Y+DG+K+K YI+++S PT + +FKGT +GT  AP++ SFSSRGPS ASPGILKPDI
Sbjct  450   SHIGYSDGVKIKSYISASSNPTVSFIFKGTILGTSPAPAITSFSSRGPSLASPGILKPDI  509

Query  943   LGPGVNILAAWPVgnntnngngNA-TFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIK  767
              GPGV++LAAWP     +  N    TFNIISGTSM+TPHLSGIA LLK+ HPDW PAAIK
Sbjct  510   TGPGVSVLAAWPFDVGPSTVNSTGPTFNIISGTSMSTPHLSGIAALLKAVHPDWPPAAIK  569

Query  766   SAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCG  587
             SAI+TTAD  + +G  I++E+ +PA++FA G GHVNP +A+DPGL+YDL +DDYIPYLCG
Sbjct  570   SAIMTTADILDRSGEPIVNEQYLPANLFAVGAGHVNPVKANDPGLVYDLSADDYIPYLCG  629

Query  586   LNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLG--KTSLTYSRTVTNVGEANSM  413
             L YT  ++  IV+R V C  V +I EA+LNYPS ++ LG   T +T  RTV NVGEA S 
Sbjct  630   LGYTSTQVTAIVRRSVNCLVVKNITEAELNYPSISVSLGAATTFITVERTVKNVGEAMSE  689

Query  412   YTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIV  233
             Y V+V    GV+V V+P  L F+EVNQ++ + ++ S SS+     F QG + WVS++ +V
Sbjct  690   YLVEVDTPYGVEVSVSPVKLQFSEVNQEMKFYVTLSASSSRGGARFSQGYLNWVSEKRMV  749

Query  232   KSPIAIIFQ  206
             +SPI++ F 
Sbjct  750   RSPISVTFS  758



>ref|XP_006358372.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=734

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/719 (58%), Positives = 519/719 (72%), Gaps = 14/719 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESG----DEGERSRIVHSYRHVASGFAAKL  2177
             DTYIV V  P +    +S D  S++ SF+ +S        E  R+++SYR+V  GFAA+L
Sbjct  23    DTYIVQVQSPES--QSLSMDLESWYNSFLPKSIASTISNKEAPRLIYSYRNVMKGFAARL  80

Query  2176  SPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTG  1997
             S E V EM KK GF++   +R+ +L+TT +P+FLGL QN G WR+S+YGKGVI+GVLDTG
Sbjct  81    SAEQVKEMEKKSGFVNVWPERLLSLHTTRTPSFLGLKQNIGLWRDSNYGKGVIIGVLDTG  140

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARNFVSEGssppppPVDEEGHG  1820
             I P+HPSF+D+ MPPPPAKWKGKCE    T CNNKLIGAR F  E   P    +D++GHG
Sbjct  141   ILPDHPSFSDKGMPPPPAKWKGKCESNFTTKCNNKLIGARTFPKENGLP----IDDDGHG  196

Query  1819  THTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaidd  1640
             THTASTAAG FV  A V+G+A GTAVG+APLAHL+IYK C   GC  S++LAAMDAAIDD
Sbjct  197   THTASTAAGGFVRGANVYGNANGTAVGVAPLAHLAIYKACDSFGCIVSNVLAAMDAAIDD  256

Query  1639  gvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVG  1460
             GVD++SLSLGG ++ F  D IA+GA++A E+GI VSC+AGN GP   ++SNEAPW+LTVG
Sbjct  257   GVDIISLSLGGYTSPFHSDPIALGAYSATERGILVSCSAGNTGPSKSSVSNEAPWILTVG  316

Query  1459  ASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG--SKDEDAALCGPGSLdk  1286
             AST+DR IKAT  LGN    +GESAF  +       PL  P   + +   + CG G+L  
Sbjct  317   ASTLDRKIKATVHLGNKKWFEGESAFHPKAVSTKFFPLFVPALNASEFRRSYCGSGTLSD  376

Query  1285  vdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYN  1106
               VKGK+VLC  GG  +R+ KGQ VKDAGG  MIL+N+  DG+T  A  HVLPA +++Y 
Sbjct  377   RAVKGKIVLCMMGGDYSRIAKGQAVKDAGGVGMILINRAEDGFTTSATAHVLPAMDVTYE  436

Query  1105  DGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVN  926
             DG+K+ DY+NST  P A I F+GT +G + AP VA+FSSRGPS AS GILKPDI+GPGVN
Sbjct  437   DGMKIIDYMNSTKKPVAQITFQGTILGDQNAPVVAAFSSRGPSIASRGILKPDIIGPGVN  496

Query  925   ILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTA  746
             ILAAWP     +     +TFNIISGTSM+ PHLSG+A LLKSAHP WSPAAIKSAI+TTA
Sbjct  497   ILAAWPTSMENSTNTK-STFNIISGTSMSCPHLSGVAALLKSAHPTWSPAAIKSAIMTTA  555

Query  745   DQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQE  566
             D  NL    ILDE L+PA +FA G GHVNP RA+DPGLIYD    DY+PYLCGLNYT++E
Sbjct  556   DTTNLANGPILDETLLPASIFAFGAGHVNPERANDPGLIYDTPVKDYVPYLCGLNYTNRE  615

Query  565   IQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFL  386
             +  ++QRKV+CS+V SIPEAQLNYPSF+I LG+   TY+RTVTNVGEA S Y V++   L
Sbjct  616   VGNLLQRKVDCSEVKSIPEAQLNYPSFSITLGENPQTYTRTVTNVGEAKSSYIVEIVSPL  675

Query  385   GVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             GV V V P TL F+++NQ+ TY ++FS +        VQG   W S RH V+SPIAI+ 
Sbjct  676   GVSVTVKPSTLKFSKMNQKKTYRVTFSKTDNSSTSGVVQGFFKWTSNRHSVRSPIAIVL  734



>ref|XP_002303548.2| hypothetical protein POPTR_0003s11840g [Populus trichocarpa]
 gb|EEE78527.2| hypothetical protein POPTR_0003s11840g [Populus trichocarpa]
Length=749

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/716 (61%), Positives = 525/716 (73%), Gaps = 9/716 (1%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPE  2168
             +TYIV +      ++   ED  ++++SF+ + +     + R++HSY HV +GFAAKL+ +
Sbjct  40    ETYIVFLKKSEGMVSAKPEDLDNWYQSFLPAVTTSSSNQQRLIHSYHHVVTGFAAKLTKQ  99

Query  2167  MVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITP  1988
                 M  K+GF+SA  Q+V N+ TTH+PNFLGL QN GFW +S+YGKGVIVGVLDTG+TP
Sbjct  100   EAKAMETKEGFVSAWPQKVLNVKTTHTPNFLGLEQNLGFWNHSNYGKGVIVGVLDTGVTP  159

Query  1987  NHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTA  1808
             NHPSF+DE MPPPP KWKGKCEF GT CNNKLIGARNF S G+ P    +D  GHGTHTA
Sbjct  160   NHPSFSDEGMPPPPPKWKGKCEFNGTLCNNKLIGARNFYSAGTPP----IDGHGHGTHTA  215

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDG-CAESdilaamdaaiddgvd  1631
             STAAGN V  A+ F    GTAVG+A  AHL+IY+VC+E G C+ESDILA MD A++DGVD
Sbjct  216   STAAGNPVPGASFFEQYNGTAVGIASSAHLAIYQVCSEFGSCSESDILAGMDTAVEDGVD  275

Query  1630  vlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAST  1451
             VLSLSLGG S  F+EDSIAIGAF A++KGIFVSCAAGN GP   +LSNEAPW+LTVGAST
Sbjct  276   VLSLSLGGPSVPFYEDSIAIGAFGAIQKGIFVSCAAGNSGPFNESLSNEAPWILTVGAST  335

Query  1450  IDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvk  1274
             +DR+I+AT +L N AQ DGES +Q  NF   LLPL Y GS  +E AA C PGSL  VDV+
Sbjct  336   VDRSIRATVMLENNAQYDGESFYQPTNFSSFLLPLFYAGSNGNESAAFCDPGSLKDVDVR  395

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             GKVVLC+RGG    V KGQ VKDAGGAAMI++N +  G    A  HVLPA+ ++Y DGL 
Sbjct  396   GKVVLCERGGYSGLVYKGQEVKDAGGAAMIVMNDEFYGNVTTASLHVLPASHVTYADGLS  455

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             +K YINSTS P ATI+FKGT  G   AP VA FSSRGPS ASPGILKPDILGPGV ILAA
Sbjct  456   IKAYINSTSSPMATILFKGTVFGVPYAPQVAIFSSRGPSLASPGILKPDILGPGVRILAA  515

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             W +    N  N    FN+ISGTSMATPHLSGIA LLKS+HPDWSPAAIKSAI+TTA+  N
Sbjct  516   W-LHPVDNRLNTTPGFNVISGTSMATPHLSGIAALLKSSHPDWSPAAIKSAIMTTANLTN  574

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             L G  I D+  VP DVF  G GHVNP++A DPGL+YD+Q DDYIPYLCGL Y D  I  I
Sbjct  575   LGGMPITDQFFVPVDVFGIGSGHVNPTKADDPGLVYDIQPDDYIPYLCGLGYNDTAIGII  634

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDV  374
             +QR V CS  +SIPEAQLNYPSF+I LG     Y+RTVTNVG   S Y  ++    GVDV
Sbjct  635   LQRPVTCSNSSSIPEAQLNYPSFSIKLGSGPQAYTRTVTNVGPLKSSYIAEIISPQGVDV  694

Query  373   GVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
              VTP  + F   + + TY+++F+ ++  V + F QG + WVS  H+V+SPIA+IF+
Sbjct  695   KVTPSAIEFGGGSSKATYSVTFTRTAN-VKVPFAQGYLNWVSADHVVRSPIAVIFE  749



>ref|XP_003611195.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES94153.1| subtilisin-like serine protease [Medicago truncatula]
Length=756

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/721 (58%), Positives = 529/721 (73%), Gaps = 17/721 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
             TYIVHV       +  SED  S++ SF+ +  +   + R+V SYRHVASGFA KL+PE  
Sbjct  44    TYIVHVKKSENVASFQSEDLHSWYHSFLPQ--NFPHKDRMVFSYRHVASGFAVKLTPEEA  101

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
               +++K G + AR +R  +L+TTHSP FLGL    G W + + GKGVI+GV+D+GI P H
Sbjct  102   KSLQEKDGILLARPERTLSLHTTHSPTFLGLKHGQGLWNDDNLGKGVIIGVIDSGIYPYH  161

Query  1981  PSFNDENMPPPPAKWKGKCEFEG-TACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             PSFNDE MPPPPAKWKG CEF G   CNNKLIGAR+ V    +    P+++  HGTHTA+
Sbjct  162   PSFNDEGMPPPPAKWKGHCEFTGGKICNNKLIGARSLVKS--TIQELPLEKHFHGTHTAA  219

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTED-GCAESdilaamdaaiddgvdv  1628
              AAG FV +A+VFG+AKG A GMAP AH+++YKVCT++  CAES ILAAMD AI+DGVDV
Sbjct  220   EAAGRFVEDASVFGNAKGVAAGMAPNAHIAMYKVCTDNIPCAESSILAAMDIAIEDGVDV  279

Query  1627  lslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTI  1448
             LSLSLG GS  FFED IAIGAFAA + G+FVSC+A N GP Y TLSNEAPW+LTVGASTI
Sbjct  280   LSLSLGLGSLPFFEDPIAIGAFAATQNGVFVSCSAANSGPGYSTLSNEAPWVLTVGASTI  339

Query  1447  DRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS-----KDEDAALCGPGSLdkv  1283
             DR I A A LGNG + +GE+ FQ ++F   L+PL+Y GS     + ++ +LC PGSL  +
Sbjct  340   DRKIVALAKLGNGNEYEGETLFQPKDFSEQLMPLVYSGSFGFGNQTQNQSLCLPGSLKNI  399

Query  1282  dvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYND  1103
             D+ GKVV+CD GG ++ + KGQ V ++GG AMIL N +  G++  A  HVLPA +LSY  
Sbjct  400   DLSGKVVVCDVGGRVSTIVKGQEVLNSGGVAMILANSETLGFSTSATAHVLPAVQLSYAA  459

Query  1102  GLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNI  923
             GL +K+YI ST  P+AT++FKGT IG   APSV SFSSRGPS  SPGILKPDI+GPGVNI
Sbjct  460   GLTIKEYIKSTYNPSATLIFKGTVIGDSLAPSVVSFSSRGPSQESPGILKPDIIGPGVNI  519

Query  922   LAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTAD  743
             LAAW V  +         FNI+SGTSM+ PHLSGI+ L+KS+HPDWSPAAIKSAI+TTA+
Sbjct  520   LAAWGVSVDNKI----PAFNIVSGTSMSCPHLSGISALIKSSHPDWSPAAIKSAIMTTAN  575

Query  742   QYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEI  563
               NL G  ILD+RL+PAD+FATG GHVNP +A+DPGL+YD++ +DY+PYLCGL Y+D+EI
Sbjct  576   TLNLGGIPILDQRLLPADIFATGAGHVNPVKANDPGLVYDIEPEDYVPYLCGLGYSDKEI  635

Query  562   QQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLG  383
             + IVQRKV+CS V SIPEAQLNYPSF+I LG  S  Y+RT+TNVG ANS Y V++   L 
Sbjct  636   EVIVQRKVKCSNVKSIPEAQLNYPSFSILLGSDSQYYTRTLTNVGFANSTYKVELEVPLA  695

Query  382   VDVGVTPDTLVFTEVNQQLTYNISFSPS--STPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             + + V P  + FTEVN++++++I F P          F QG++ WVS +H V+ PI++IF
Sbjct  696   LGMSVNPSEITFTEVNEKVSFSIEFIPQIKENRRSQTFAQGSLTWVSDKHAVRIPISVIF  755

Query  208   Q  206
             +
Sbjct  756   K  756



>ref|XP_004300736.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=762

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/755 (57%), Positives = 550/755 (73%), Gaps = 16/755 (2%)
 Frame = -1

Query  2440  IIAMKGTPNMAYISVVVCLTLV--FHSVASAKYEDTYIVHVSPPAAAINGVS--EDYRSY  2273
             II + G   M Y+S+   +  V     +A      TYIV V  P++     S  ED  S+
Sbjct  11    IIYLLGFSCMFYLSLAASVEKVAALKPLAGTNGMQTYIVWVEKPSSNFLAQSDHEDLESW  70

Query  2272  FRSFVSES---GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNL  2102
             ++SF+ ++    ++ E+ R+V++Y +VA+GFAA+L+ E V EM KK+GFISA  +R   L
Sbjct  71    YQSFLPQTIANSNQLEKPRMVYAYHNVATGFAARLTAEEVKEMEKKEGFISAHPERKLQL  130

Query  2101  YTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCE  1922
             +TTHSPNFLGL Q  G W+ S YG+GVI+GVLDTGITP HPSF+D+ +P PPAKWKGKC+
Sbjct  131   HTTHSPNFLGLQQQVGLWKGSHYGEGVIIGVLDTGITPGHPSFSDKGVPAPPAKWKGKCD  190

Query  1921  FEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAV  1742
             F+GT CN+KLIGAR+F   G +   PPVD  GHGTHT+STAAGNFV  A+VFG AKGTA 
Sbjct  191   FKGTGCNDKLIGARSF-DGGKTTGGPPVDAAGHGTHTSSTAAGNFVDGASVFGMAKGTAA  249

Query  1741  GMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAF  1562
             GMAPLAHL++Y+VC+EDGC +SDI+A +D A+ DGVDV+S+SLGGGSA F+ DSIA+GA+
Sbjct  250   GMAPLAHLAMYQVCSEDGCYDSDIIAGIDTAVGDGVDVISISLGGGSAPFYGDSIALGAY  309

Query  1561  AAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAF  1382
              A++KGIFVSC+AGNEGPDY +LSNEAPW+LTVGASTIDR I+ATA LGNG + DGES F
Sbjct  310   GAIQKGIFVSCSAGNEGPDYSSLSNEAPWILTVGASTIDRNIRATAKLGNGEEHDGESLF  369

Query  1381  QVENFPPTLLPLIYPGSKDEDA-ALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKD  1205
             Q ++F   L PL+Y  +   D+ A C  G+L  V+ K    +C+ GG + R+ KG  VK 
Sbjct  370   QPKDFGSELFPLVYAAAHSNDSTAFCDVGTLSNVEGKIV--VCELGGEVKRIAKGIEVKR  427

Query  1204  AGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIG  1025
             AGG AMIL+N D  G T +AD HVLPAT +SY  G+ ++ YINSTS PTATI+FKGT IG
Sbjct  428   AGGVAMILVNPDFGGDTTIADAHVLPATHVSYAAGVSIQAYINSTSTPTATILFKGTVIG  487

Query  1024  TKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTS  845
              + AP V+ FSSRGPS  SPGILKPDI+GPGV+ILAAWP   +        TF+I+SGTS
Sbjct  488   DQLAPKVSFFSSRGPSIESPGILKPDIIGPGVSILAAWPFSVDNTTEYK--TFDIVSGTS  545

Query  844   MATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGH  665
             M+ PHLSGIA LLKS+HPDWSPAAIKSAI+TTA+  NL G+ I+DE L  A++FA G GH
Sbjct  546   MSCPHLSGIAALLKSSHPDWSPAAIKSAIMTTAEVDNLAGSAIIDETLNSANLFAIGAGH  605

Query  664   VNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSF  485
             VNPS+A+DPGLIYDL+  DYIPYLCGLNYTD+ I  I Q+ V+CS+V SIPEAQLNYPSF
Sbjct  606   VNPSKANDPGLIYDLKPQDYIPYLCGLNYTDRHIAIITQKTVKCSEVGSIPEAQLNYPSF  665

Query  484   AIWLGKTS--LTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNIS  311
             +++L        Y+RTVTNVG A S Y + V     VD+ V P+ L FTEV Q +TY++ 
Sbjct  666   SLFLDPAGEPQNYTRTVTNVGPAKSTYELAVVSPHKVDISVQPEQLTFTEVGQTMTYHVV  725

Query  310   FSPS-STPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             F+       D    QG ++WVS +H V+S I++IF
Sbjct  726   FAAQYDAGKDGITSQGYLSWVSDQHSVRSQISVIF  760



>ref|XP_006363697.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=745

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/726 (58%), Positives = 538/726 (74%), Gaps = 20/726 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSE--DYRSYFRSF-------VSESGDEGERSRIVHSYRHVASG  2192
             +TYIVHV  P + I+  S   D  SY+ SF       +S SG+E E + +++SY +V  G
Sbjct  25    ETYIVHVESPESLISTQSSLTDLDSYYLSFLPKTTTAISSSGNE-EAASMIYSYHNVMKG  83

Query  2191  FAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVG  2012
             F+A+L+ E V EM KK GF+SA++QR+ +L+TTH+P+FLGL QN G W++S+YGKGVI+G
Sbjct  84    FSARLTAEQVKEMEKKHGFVSAQKQRILSLHTTHTPSFLGLQQNMGLWKDSNYGKGVIIG  143

Query  2011  VLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppPVD  1835
             V+DTGI P+HPSF+D  MPPPPAKWKG CE   T  CNNKLIGAR++          P+D
Sbjct  144   VIDTGIHPDHPSFSDVGMPPPPAKWKGVCESNFTNKCNNKLIGARSY----QLANGSPID  199

Query  1834  EEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamd  1655
             ++GHGTHTASTAAG FV  A VFG+A GTAVG+APLAH+++YKVC+  GC+ESDILAAMD
Sbjct  200   DDGHGTHTASTAAGAFVKGANVFGNANGTAVGVAPLAHIAVYKVCSSHGCSESDILAAMD  259

Query  1654  aaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPW  1475
             AAIDDGVD+LS+SLGG    F+EDSIA+GA++A E+GI VSC+AGN GP   +++N APW
Sbjct  260   AAIDDGVDILSISLGGRPIPFYEDSIALGAYSATERGILVSCSAGNGGPFNGSVANSAPW  319

Query  1474  LLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDED---AALCG  1304
             +L+VGAST+DR IKAT  LGN  + +GESA++ +    T   L   G    D      C 
Sbjct  320   ILSVGASTLDRKIKATVKLGNTEEFEGESAYRPQISNSTFFTLFDAGKNASDEFETPYCI  379

Query  1303  PGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPA  1124
             PGSL    ++GK+++C  GGG+  VDKGQ VKDAGG  MI++N+   G T  AD HVLPA
Sbjct  380   PGSLTDPAIRGKMIICLAGGGVLSVDKGQAVKDAGGVGMIIINRPYYGVTKSADAHVLPA  439

Query  1123  TELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDI  944
              ++S  DG K+  Y+NSTS P ATI F+GT IG + AP VA+FSSRGPS ASPGILKPDI
Sbjct  440   LDVSDADGTKILAYMNSTSNPVATITFQGTIIGDENAPIVAAFSSRGPSRASPGILKPDI  499

Query  943   LGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKS  764
             +GPGVNILAAWP   + N     +TFNIISGTSM+ PHLSG+A LLKS HPDWSPAAIKS
Sbjct  500   IGPGVNILAAWPTSVDDNKNTK-STFNIISGTSMSCPHLSGVAALLKSTHPDWSPAAIKS  558

Query  763   AIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGL  584
             AI+TTAD  NL  + ILDE+L+ AD+FA G GHVNPSRA+DPGL+YD   +DY+PYLCGL
Sbjct  559   AIMTTADTLNLASSPILDEKLLHADIFAIGAGHVNPSRANDPGLVYDTPFEDYLPYLCGL  618

Query  583   NYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAI-WLGKTSLTYSRTVTNVGEANSMYT  407
             NYT++++  ++QR+V CS+V SIPEAQLNYPSF++  LG T  TY+RTVTNVG+A S Y 
Sbjct  619   NYTNRQVGNLLQRRVNCSEVKSIPEAQLNYPSFSVSELGSTPQTYTRTVTNVGDATSSYK  678

Query  406   VKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKS  227
             V+V+   GV V V P  L F+E+NQ+LTY ++FS +++  +I+  +G + W S RH V+S
Sbjct  679   VEVASPKGVVVEVEPSELNFSELNQKLTYQVTFSKTTSSSNIEVAEGFLKWTSNRHSVRS  738

Query  226   PIAIIF  209
             PIA++ 
Sbjct  739   PIAVVL  744



>ref|XP_010918673.1| PREDICTED: subtilisin-like protease SDD1 [Elaeis guineensis]
Length=760

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/722 (57%), Positives = 531/722 (74%), Gaps = 15/722 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
              TY+VHV PP + + G S D  ++++SF+ E+      +RIVH Y +VASGFAA+L+   
Sbjct  42    QTYVVHVQPPTSTVFGTSTDRETWYKSFLPET-----PARIVHMYTNVASGFAARLTELE  96

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             + +M+KK GF+ A   R+Y+L TTH+P FLGL  N G W +++YGKGVIVG+LDTGI P+
Sbjct  97    LEDMKKKPGFLHAYPDRLYSLQTTHTPEFLGLQLNSGIWNDANYGKGVIVGMLDTGIFPD  156

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPV------DEEGH  1823
             HPSF+ + MPPPPAKWKG+C+F  + CNNKLIGAR F+S   +     V      D+ GH
Sbjct  157   HPSFSGDGMPPPPAKWKGRCDFNASLCNNKLIGARTFISGAMAMKGRGVAVTPPVDDVGH  216

Query  1822  GTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaid  1643
             GTHTASTAAG  V  A V G+A GTA GMAPLAHL++YKVCTEDGCAESDILA MDAA+ 
Sbjct  217   GTHTASTAAGARVAGANVLGNANGTASGMAPLAHLAMYKVCTEDGCAESDILAGMDAAVA  276

Query  1642  dgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTV  1463
             DGVDVLSLSLGG S  F+ DSIAIG F A++ GIFVSCAAGN GP+  +LSNEAPWLLTV
Sbjct  277   DGVDVLSLSLGGNSVPFYNDSIAIGGFGAIKNGIFVSCAAGNSGPNASSLSNEAPWLLTV  336

Query  1462  GASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDE-DAALCGPGSLdk  1286
              AST+DR I+ T  LGNG + +GES +Q + + PT  PL+Y G+  + DA  CG GSLD 
Sbjct  337   AASTMDRNIRVTVKLGNGLEFNGESVYQPQMYTPTFYPLVYAGAGPKPDAIFCGNGSLDG  396

Query  1285  vdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYN  1106
             +DVKGK+VLC RGGGIAR+DKG TV+ AGG   IL N  +DGY+ + D HVLPA+ + Y+
Sbjct  397   LDVKGKMVLCQRGGGIARIDKGVTVESAGGVGFILANGPLDGYSTITDPHVLPASHVGYS  456

Query  1105  DGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVN  926
             DG+K+K YI+++S PTA+ +FKGT +G   AP++ SFSSRGPS ASPGILKPDI GPGV+
Sbjct  457   DGVKIKSYISTSSNPTASFIFKGTILGISPAPAITSFSSRGPSLASPGILKPDITGPGVS  516

Query  925   ILAAWPVgnntnngngNA-TFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITT  749
             +LAAWP        N    TFNIISGTSM+TPHLSGIA LLK+AHPDWSPAAIKSAI+TT
Sbjct  517   VLAAWPSNVGPPTVNSTGPTFNIISGTSMSTPHLSGIAALLKAAHPDWSPAAIKSAIMTT  576

Query  748   ADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQ  569
             AD  + +G  I++E+ +PA++FA G GHVNP +A+DPGL+YDL +DDYI YLCGL YT  
Sbjct  577   ADILDRSGDPIVNEQHLPANLFAVGAGHVNPVKANDPGLVYDLSADDYISYLCGLGYTSS  636

Query  568   EIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLG--KTSLTYSRTVTNVGEANSMYTVKVS  395
             ++  IV++ V C  + +I EA+LNYPS ++ LG   TS+T  RTV NVGEA S+Y+  + 
Sbjct  637   QVTAIVRQSVNCLVIKNITEAELNYPSISVSLGPATTSITVERTVKNVGEAMSVYSADID  696

Query  394   PFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAI  215
                GV V V+P  L F+EVNQ++ + ++FS SS+     F  G + W S++ +V+SPI++
Sbjct  697   TPYGVAVSVSPMKLQFSEVNQEMKFYVTFSASSSRGAARFSPGYLNWASEKRMVRSPISV  756

Query  214   IF  209
              F
Sbjct  757   TF  758



>ref|XP_009604592.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=742

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/746 (58%), Positives = 526/746 (71%), Gaps = 28/746 (4%)
 Frame = -1

Query  2422  TPNMAYISVVVCLTLVFHSVASAKYE-------DTYIVHVSPPAAAINGVSEDYRSYFRS  2264
             T ++ ++  +VC+ L+ HS A+           +TYIVH+  P       S D   + +S
Sbjct  13    TMDLRFVFTLVCI-LILHSSATIAGHFTNQNDLETYIVHLEFPDDIFFSDSNDLYLWHQS  71

Query  2263  FV-SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHS  2087
             F+ + S +    SRI++SYRHV +GFAA LS E V  M KK GF+SAR QRV  ++TTHS
Sbjct  72    FLPTTSTNSDHSSRIIYSYRHVFNGFAALLSSEEVKMMEKKPGFVSARPQRVLQMHTTHS  131

Query  2086  PNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTA  1907
             P+FLGL+QN G W  S+ GKGV++G+LD+GI P HPSFND  MP PPAKWKGKCEF    
Sbjct  132   PDFLGLHQNVGLWNASNSGKGVVIGLLDSGIAPRHPSFNDNGMPSPPAKWKGKCEFNLII  191

Query  1906  CNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPL  1727
             CNNKLIGARNF          P DEEGHGTHT+STAAGNFV  A + G+A GTA G+AP 
Sbjct  192   CNNKLIGARNFARS---INLSPFDEEGHGTHTSSTAAGNFVEGANLLGNANGTASGIAPR  248

Query  1726  AHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEK  1547
             AH+++YKVCT DGC ESDI+A +DAAI DGVDVLS+SLG      +ED+IAIGA++A+EK
Sbjct  249   AHVAMYKVCTSDGCQESDIVAGIDAAIGDGVDVLSISLGTAPVPLYEDNIAIGAYSAIEK  308

Query  1546  GIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENF  1367
             GIFVSC+AGN GP   T+SN APWLLTVGAST DR I A AVLGNG Q +GES FQ  NF
Sbjct  309   GIFVSCSAGNSGPFNATVSNAAPWLLTVGASTTDRKISAVAVLGNGQQYEGESVFQPRNF  368

Query  1366  PPTLLPLIYPGSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGI-ARVDKGQTVKDAGGAA  1190
                LLPLI  GS +  A +   G +         VLCD  G + +RV KG+ VK AGGAA
Sbjct  369   SRKLLPLIDGGSCELFAPIDVKGKI---------VLCDTSGLMYSRVQKGEQVKKAGGAA  419

Query  1189  MILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAP  1010
             MIL+N    G T  AD HVLPAT +SYNDG ++ +Y  STS P ATI FKGT IG K AP
Sbjct  420   MILMNIKARGDTTFADVHVLPATLISYNDGQQILNYTKSTSAPVATISFKGTRIGDKHAP  479

Query  1009  SVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPH  830
             +VA FSSRGPS  S GILKPDI+GPG+NILAAWP  +     +  +TFNIISGTSM+ PH
Sbjct  480   TVAFFSSRGPSMVSQGILKPDIIGPGLNILAAWPT-SVGEKTSSKSTFNIISGTSMSCPH  538

Query  829   LSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSR  650
             L+G+A LLKSAHPDWSPAAIKSAI+TTAD  +L    I DE L PAD+F+ G GHVNPS+
Sbjct  539   LAGVAALLKSAHPDWSPAAIKSAIMTTADFVSLANNPIPDETLNPADLFSIGSGHVNPSK  598

Query  649   ASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLG  470
             A+DPGL+YD+Q +DY+PYLCGLNYT+ ++  IV+R V C+  +SI EA+LNYPSFAI LG
Sbjct  599   ANDPGLVYDIQPEDYVPYLCGLNYTNDQVSAIVRRNVHCT--SSIAEAELNYPSFAINLG  656

Query  469   KTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTP  290
              T  TY+RTVTNVGEANS YTV+V    GV + + P TL F+ +NQ+L+Y ++F  S   
Sbjct  657   STVQTYTRTVTNVGEANSTYTVEVFGVKGVKLSIKPTTLKFSALNQKLSYKVTFKRS---  713

Query  289   VDIDFVQGAIAWVSQRHIVKSPIAII  212
             V  D  QG I W S ++ V+SP+AI 
Sbjct  714   VSADSSQGYITWSSTKYSVRSPVAIF  739



>ref|XP_004300735.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=756

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/757 (58%), Positives = 556/757 (73%), Gaps = 18/757 (2%)
 Frame = -1

Query  2440  IIAMKGTPNMAYISVVVCL--TLVFHSVASAKYEDTYIVHVSPPAAAINGVS--EDYRSY  2273
             II + G   M Y+S+ V +    V   +  A    TYIV +  P +     S  ED   +
Sbjct  3     IIYLLGFSCMFYLSLAVDIEKVAVLEPLDDADSMQTYIVLIERPTSNFGPQSDHEDLERW  62

Query  2272  FRSFVSES---GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNL  2102
             ++SF+ ++    ++  + R++++Y +V +GFAAKL+ E V EM KK GFI+A  +R   L
Sbjct  63    YQSFLPQTIVNSNQLVKPRMIYAYHNVVTGFAAKLTAEEVEEMEKKDGFITAHPERNLQL  122

Query  2101  YTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCE  1922
             +TTHSPNFLGL Q  G W+ S+YG+GVI+GVLDTGITP HPSF+D+ +PPPPAKWKGKC+
Sbjct  123   HTTHSPNFLGLQQGVGLWKGSNYGEGVIIGVLDTGITPGHPSFSDKGVPPPPAKWKGKCD  182

Query  1921  FEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAV  1742
             F  T CNNKLIGAR+F   G +   PPVD  GHGTHT+STAAGNFV  A+VFG A GTA 
Sbjct  183   FNATFCNNKLIGARSF-QGGKTTGAPPVDIIGHGTHTSSTAAGNFVKGASVFGMANGTAS  241

Query  1741  GMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAF  1562
             GMAP AHL++Y+VC E GC ESDILAAMD A+DDGVDVLS+SLGGGSA+F+ D IAIG++
Sbjct  242   GMAPYAHLAMYQVCNEQGCDESDILAAMDTAVDDGVDVLSISLGGGSATFYWDYIAIGSY  301

Query  1561  AAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAF  1382
              A++ GIFVSC+AGN+GPDY +++NEAPW+LTVGAS+IDR I ATA LGNG + DGES F
Sbjct  302   GAIQNGIFVSCSAGNDGPDYSSVTNEAPWILTVGASSIDRHIIATAKLGNGEEYDGESVF  361

Query  1381  QVENFPPTLLPLIYPGSKDEDA-ALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKD  1205
             Q ++F   L PL+Y G   +D+ A C  GSL  V+ K    +C+ GG IAR+ KG  VK 
Sbjct  362   QPKDFDSKLYPLVYAGPHSKDSTAFCDVGSLTDVEGKVV--VCEVGGDIARIAKGIEVKR  419

Query  1204  AGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIG  1025
             AGG AMIL+NQD  GYT +AD HVLPAT +SY  G+ +K YINSTS PTATI+FKGT IG
Sbjct  420   AGGVAMILVNQDFGGYTTIADAHVLPATHVSYAAGVSIKTYINSTSTPTATILFKGTVIG  479

Query  1024  TKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTS  845
              + AP V+ FSSRGPS A+PGILKPDI+GPGV+ILAAWP   + +  +  ATF+IISGTS
Sbjct  480   DQLAPKVSFFSSRGPSMATPGILKPDIIGPGVSILAAWPFLVDNSTQSK-ATFDIISGTS  538

Query  844   MATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGH  665
             M+ PHLSGIA LLKS+HPDWSPAAIKSAI+TTA+  NL G+ I+DE L  A++FA G GH
Sbjct  539   MSCPHLSGIAALLKSSHPDWSPAAIKSAIMTTAEVDNLAGSPIVDETLYAANLFAIGAGH  598

Query  664   VNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSF  485
             VNPS+A+DPGLIYD Q +DYIPY CGLNYTDQ+IQ I Q+KV+CS+V +IPEAQLNYP+F
Sbjct  599   VNPSKANDPGLIYDTQPEDYIPYFCGLNYTDQQIQIITQQKVKCSEVGAIPEAQLNYPTF  658

Query  484   AIWL---GKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNI  314
             ++++   GK    Y+RTVTNVG A S Y + V     +D+ V P+ L FTEV Q++TY++
Sbjct  659   SLFIDPAGKPQ-NYTRTVTNVGPAKSTYELAVVSPHKMDIRVQPEKLTFTEVGQKMTYHV  717

Query  313   SFSPSSTPVD--IDFVQGAIAWVSQRHIVKSPIAIIF  209
              F+  +      I   QG ++WVS +H V+S I+++F
Sbjct  718   VFTAQNGAGKDGITMSQGYLSWVSDQHAVRSQISVVF  754



>ref|XP_004244590.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=738

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/743 (57%), Positives = 532/743 (72%), Gaps = 13/743 (2%)
 Frame = -1

Query  2413  MAYISVVVCLTLV--FHSVASAKYEDTYIVHVSPPAAAIN--GVSEDYRSYFRSFVSES-  2249
             M  +++++ L +V      +  +  DTYIV V  P   I+   +S D  S++ SF+ ++ 
Sbjct  1     MKLLNILLVLFIVCCLSRPSMQRSLDTYIVQVESPENRISTQSMSMDLESWYNSFLPKTI  60

Query  2248  GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGL  2069
              +E E  R+V+SYR+V  GFAA+LS E V EM KK GF++A  +R+ +L+TT +P+FLGL
Sbjct  61    SNEEEGPRLVYSYRNVMKGFAARLSAEQVKEMEKKSGFVNAWPERILSLHTTRTPSFLGL  120

Query  2068  YQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKL  1892
              QN G W+NS+YGKGVI+GVLDTGITP+HPSF+D+ MPPPPAKWKGKCE    T CNNK+
Sbjct  121   KQNIGLWKNSNYGKGVIIGVLDTGITPDHPSFSDQGMPPPPAKWKGKCELNFTTKCNNKI  180

Query  1891  IGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSI  1712
             IGAR F  E   P    +D++GHGTHTASTAAG FV  A V+G+A GTAVG+APLAHL+I
Sbjct  181   IGARTFPKENGLP----IDDDGHGTHTASTAAGGFVRGANVYGNANGTAVGVAPLAHLAI  236

Query  1711  YKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVS  1532
             YK C   GC  S++LAAMDAAIDDGVD++SLSLGG ++ F  DSIA+GA++A E+GI VS
Sbjct  237   YKACDSFGCIVSNVLAAMDAAIDDGVDIISLSLGGYTSPFHSDSIALGAYSATERGILVS  296

Query  1531  CAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLL  1352
             C+AGN GP   ++SNEAPW+LTVGAST+DR IKAT  LGN    +GESAF  +       
Sbjct  297   CSAGNTGPSKSSVSNEAPWILTVGASTLDRKIKATVQLGNKKMFEGESAFHPKAVNTKFF  356

Query  1351  PLIYP--GSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILL  1178
             PL  P   + +   + CG G+L   DVKGK+VLC  GG  +R++KGQTV+DAGG  MIL+
Sbjct  357   PLFVPTLNASEFRRSYCGSGTLSDRDVKGKIVLCMIGGDYSRIEKGQTVEDAGGVGMILI  416

Query  1177  NQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVAS  998
             N   DG+T  A  HVLPA +++Y DG+K+ +Y+NST  P A I F+GT +G + AP VA+
Sbjct  417   NGAEDGFTTSATAHVLPAMDVTYADGMKIIEYMNSTKKPVAQITFQGTILGDQNAPVVAA  476

Query  997   FSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGI  818
             FSSRGPS AS GILKPDI+GPGVNILAAWP     N     +TFNIISGTSM+ PHLSG+
Sbjct  477   FSSRGPSIASRGILKPDIIGPGVNILAAWPTSMENNTNTK-STFNIISGTSMSCPHLSGV  535

Query  817   ATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDP  638
             A LLKSAHP WSPAAIKSAI+TTAD  NL    ILDE L+PA +FA G GHVNP RA+DP
Sbjct  536   AALLKSAHPTWSPAAIKSAIMTTADTTNLANGPILDETLLPASIFAVGAGHVNPERANDP  595

Query  637   GLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSL  458
             GLIYD    DY+PYLCGLNYT++E+  ++Q KV+CS V SIPEAQLNYPSF+I L +   
Sbjct  596   GLIYDTPVKDYVPYLCGLNYTNREVGNLLQHKVDCSGVKSIPEAQLNYPSFSITLRENPQ  655

Query  457   TYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDID  278
             TY+RTVTNVGEA S Y V++    GV V V P TL F+  NQ+ TY ++FS +       
Sbjct  656   TYTRTVTNVGEAKSSYIVEIVSPQGVSVSVKPSTLKFSNKNQKRTYRVTFSRTDNSSTSG  715

Query  277   FVQGAIAWVSQRHIVKSPIAIIF  209
              VQG + W S RH  +SPIAI+ 
Sbjct  716   VVQGFLKWTSNRHSGRSPIAIVL  738



>gb|EYU28957.1| hypothetical protein MIMGU_mgv1a020114mg [Erythranthe guttata]
Length=744

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/745 (60%), Positives = 547/745 (73%), Gaps = 19/745 (3%)
 Frame = -1

Query  2416  NMAYISVVVCLTLVFHSVASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFV-SES---  2249
             NM  ++ +   T      A++ +E TYIVH+  PA     +SED   ++ SF+ SE+   
Sbjct  4     NMFLLAAICIFTYHLGISANSSFE-TYIVHLDLPAEFGQLLSEDLEPWYDSFLPSETAAE  62

Query  2248  --GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFL  2075
               G+    SRIVH+YR+V +GFAAKLSP+ V EM KK+GF+ AR QR Y  +TTHSPNFL
Sbjct  63    LNGNNPSSSRIVHAYRNVITGFAAKLSPDEVKEMEKKRGFLYARPQRKYGFHTTHSPNFL  122

Query  2074  GLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGT-ACNN  1898
             GL+Q  G W  S+YG+GVI+G++D+GITP HPSF+DE MPPPPAKWKGKCE  GT +CNN
Sbjct  123   GLHQFVGSWPGSNYGEGVIIGMIDSGITPAHPSFDDEGMPPPPAKWKGKCELNGTLSCNN  182

Query  1897  KLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHL  1718
             KLIGARNF SE    P PPVD+ GHGTHTAST+AGNFV  A VFG A GTA G+APLAHL
Sbjct  183   KLIGARNFASE---LPGPPVDDFGHGTHTASTSAGNFVSGANVFGQANGTASGIAPLAHL  239

Query  1717  SIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIF  1538
             +IYKV +     ESDILA MDAAI+DGVDV+SLS+GG S  F+EDSIAIGAF+A+EKGIF
Sbjct  240   AIYKVGSLGSLLESDILAGMDAAIEDGVDVISLSIGGPSTPFYEDSIAIGAFSAIEKGIF  299

Query  1537  VSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPT  1358
             VSC+AGN GPD  +LSNEAPW+LTVGASTIDR IKATA +G     DGES +Q +     
Sbjct  300   VSCSAGNGGPDDSSLSNEAPWILTVGASTIDRKIKATAFVGYKEAYDGESLYQPKG-SSK  358

Query  1357  LLPLIYPGSKDEDAALC-GPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMIL  1181
             LLPL+Y G  D   A C   G L  VDVKGKVVLC+ GG I  V++GQ VKDAGGAAMIL
Sbjct  359   LLPLVY-GGNDTIGAWCDDSGFLADVDVKGKVVLCEMGGDIGPVEQGQVVKDAGGAAMIL  417

Query  1180  LNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTS-WPTATIVFKGTFIGTKTAPSV  1004
             +N +IDGY  +   HVLPAT +S++ G+K+K YINS+S  P A I F GT IG K AP+V
Sbjct  418   MNDEIDGYFTIPLPHVLPATLVSHDAGVKIKAYINSSSTTPIAAISFGGTVIGDKNAPTV  477

Query  1003  ASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLS  824
              SFSSRGP++ASPGILKPDI+GPG +ILAAWP+ +  N  N  ATFN+ISGTSM+ PHLS
Sbjct  478   TSFSSRGPNSASPGILKPDIIGPGASILAAWPL-SIDNYTNEKATFNMISGTSMSCPHLS  536

Query  823   GIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRAS  644
             G+A L+KSAHPDWSPA IKSAI+T++ Q NL    ILDE+ +PADVFA G GHVNP  A 
Sbjct  537   GVAALIKSAHPDWSPAMIKSAIMTSSTQINLGNNPILDEQHLPADVFAIGAGHVNPPMAL  596

Query  643   DPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECS--QVTSIPEAQLNYPSFAIWLG  470
             DPGL+YD+ +DDYI YLC L YT+Q++  IV +K+ C+  + T +PEAQLNYPSF++ LG
Sbjct  597   DPGLVYDISTDDYILYLCFL-YTEQQVATIVHKKINCNGPKYTGVPEAQLNYPSFSVVLG  655

Query  469   KTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTP  290
              T   YSRTVTNVGEA S Y  +V    GV+V V P  L FTEV QQ TY + FS     
Sbjct  656   YTGYIYSRTVTNVGEAESTYYARVESVPGVNVTVEPTVLSFTEVKQQSTYKVYFSRQEFT  715

Query  289   VDIDFVQGAIAWVSQRHIVKSPIAI  215
              +  +VQG+IAW+S +H+V+ PI++
Sbjct  716   TNGSYVQGSIAWISTKHVVRIPISV  740



>ref|XP_003611198.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES94156.1| subtilisin-like serine protease [Medicago truncatula]
Length=753

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/721 (58%), Positives = 526/721 (73%), Gaps = 17/721 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
             TYIVHV       +  SED  S++ SF+ ++    ER  +V SYR VASGFA KL+PE  
Sbjct  41    TYIVHVKKSENVASLQSEDLHSWYHSFLPQTFPHKER--MVFSYRKVASGFAVKLTPEEA  98

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
               +++K   +SAR +R   L+TTH+P FLGL Q  G W + + GKGVI+G++D+GI P H
Sbjct  99    KSLQEKGEIVSARPERTLELHTTHTPTFLGLKQGQGLWSDDNLGKGVIIGIIDSGIFPLH  158

Query  1981  PSFNDENMPPPPAKWKGKCEFEG-TACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             PSFNDE MPPPPAKWKG CEF G   CNNKLIGARN V      PP   +   HGTHTA+
Sbjct  159   PSFNDEGMPPPPAKWKGHCEFTGGQVCNNKLIGARNMVKNAIQEPP--FENFFHGTHTAA  216

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTED-GCAESdilaamdaaiddgvdv  1628
              AAG FV +A+VFG+AKG A GMAP AH+++YKVC ++  C ES +LAA+D AI+DGVDV
Sbjct  217   EAAGRFVEDASVFGNAKGVAAGMAPNAHIAMYKVCDDNIRCFESSVLAAIDIAIEDGVDV  276

Query  1627  lslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTI  1448
             LSLSLG GS  FFED IAIGAFAA + G+FVSC+A N GP Y TLSNEAPW+LTVGASTI
Sbjct  277   LSLSLGLGSLPFFEDPIAIGAFAATQNGVFVSCSAANSGPGYSTLSNEAPWILTVGASTI  336

Query  1447  DRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS-----KDEDAALCGPGSLdkv  1283
             DR I A+A LGNG + +GE+ FQ ++F   LLPL+Y GS     + ++ +LC PGSL  +
Sbjct  337   DRKIVASAKLGNGNEYEGETLFQPKDFSEQLLPLVYAGSFGFGNQTQNQSLCLPGSLKNI  396

Query  1282  dvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYND  1103
             D+ GKVVLCD GG +    KGQ V ++GG A+IL+N + DG++  A  HVLPA E+SY  
Sbjct  397   DLSGKVVLCDIGGRVPSTVKGQEVLNSGGVAVILVNSESDGFSTFATAHVLPAVEVSYKA  456

Query  1102  GLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNI  923
             GL +KDYINST  PTAT++FKGT IG   APSV SFSSRGPS  SPGILKPDI+GPGVNI
Sbjct  457   GLTIKDYINSTYNPTATLIFKGTVIGDSLAPSVVSFSSRGPSQESPGILKPDIIGPGVNI  516

Query  922   LAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTAD  743
             LAAW V  +         FNI+SGTSM+ PHLSGIA L+KS+HPDWSPAAIKSAI+TTA+
Sbjct  517   LAAWGVSVDNKI----PAFNIVSGTSMSCPHLSGIAALIKSSHPDWSPAAIKSAIMTTAN  572

Query  742   QYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEI  563
               NL G  ILD+RL+PAD+FATG GHVNP +A+DPGL+YD++ +DY+PYLCGL Y+D+EI
Sbjct  573   TLNLGGIPILDQRLLPADIFATGAGHVNPFKANDPGLVYDIEPEDYVPYLCGLGYSDKEI  632

Query  562   QQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLG  383
             + IVQ KV+CS V SIPEAQLNYPSF+I LG  S  Y+RT+TNVG ANS Y V++   L 
Sbjct  633   EVIVQWKVKCSNVKSIPEAQLNYPSFSILLGSDSQYYTRTLTNVGFANSTYRVELEVPLA  692

Query  382   VDVGVTPDTLVFTEVNQQLTYNISFSPS--STPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             + + V P  + FTEVN+++++++ F P       +  F QG++ WVS +H V+ PI++IF
Sbjct  693   LGMSVNPSEITFTEVNEKVSFSVEFIPQIKENRRNQTFGQGSLTWVSDKHAVRVPISVIF  752

Query  208   Q  206
             +
Sbjct  753   K  753



>ref|XP_002325705.1| hypothetical protein POPTR_0019s00970g [Populus trichocarpa]
 gb|EEF00087.1| hypothetical protein POPTR_0019s00970g [Populus trichocarpa]
Length=697

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/696 (60%), Positives = 520/696 (75%), Gaps = 8/696 (1%)
 Frame = -1

Query  2290  EDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQR  2114
             ED  S++RSF+ + +     + R+VHSY +V +GFAAKL+ +    M  K+G +SAR Q+
Sbjct  7     EDVDSWYRSFLPTATTSSSNQQRLVHSYHNVVTGFAAKLTEQEAKAMEMKEGVVSARPQK  66

Query  2113  VYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWK  1934
             ++++ TTH+P+FLGL QN GFW +SSYGKGVI+GVLDTGI  +HPSF+DE MPPPPAKWK
Sbjct  67    IFHVKTTHTPSFLGLQQNLGFWNHSSYGKGVIIGVLDTGIKASHPSFSDEGMPPPPAKWK  126

Query  1933  GKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAK  1754
             GKC+F  T CNNKLIGAR+    G  P    VD+ GHGTHTASTAAG++V  A+ +G   
Sbjct  127   GKCDFNATLCNNKLIGARSLYLPGKPP----VDDNGHGTHTASTAAGSWVQGASFYGQLN  182

Query  1753  GTAVGMAPLAHLSIYKVCTEDG-CAESdilaamdaaiddgvdvlslslgggSASFFEDSI  1577
             GTAVG+APLAHL+IY+VC   G CA+SDILA MD A++DGVDVLSLSLGG S  F+EDSI
Sbjct  183   GTAVGIAPLAHLAIYRVCNGFGSCADSDILAGMDTAVEDGVDVLSLSLGGPSIPFYEDSI  242

Query  1576  AIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLD  1397
             AIGAF A++KG+FVSCAAGN GP   TLSNEAPW+LTVGA T+DR I+A  +LGN A  D
Sbjct  243   AIGAFGAIQKGVFVSCAAGNSGPFNQTLSNEAPWILTVGAGTVDRNIRAKVLLGNNASYD  302

Query  1396  GESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQ  1217
             G+S +Q  NF  TLLPLIY G+   D+A C PGSL  VDVKGKVVLC+  G    VDKGQ
Sbjct  303   GQSFYQPTNFSSTLLPLIYAGANGNDSAFCDPGSLKDVDVKGKVVLCESRGFSGAVDKGQ  362

Query  1216  TVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKG  1037
              VK AGGAAMIL+N +  G    AD HVLPA++++Y DGL +K YINSTS P ATI+F+G
Sbjct  363   EVKYAGGAAMILMNAESFGNITTADLHVLPASDVTYADGLSIKAYINSTSSPMATILFEG  422

Query  1036  TFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNII  857
             T  G   AP +A FSSRGPS ASPGILKPDI+GPGV+ILAAWP   + N    +A FN+I
Sbjct  423   TVFGVPYAPQLAYFSSRGPSLASPGILKPDIIGPGVDILAAWPYAVDNNGNTKSA-FNMI  481

Query  856   SGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFAT  677
             SGTSMATPHL+GIA LLKS+HPDWSPAAIKSA++TTA+  NL GT I D+   P +VF+ 
Sbjct  482   SGTSMATPHLTGIAALLKSSHPDWSPAAIKSAMMTTANLTNLGGTPITDDTFDPVNVFSI  541

Query  676   GGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLN  497
             G GHVNP++A DPGLIYD+Q DDYIPYLCGL Y D  I  IVQR V C   +SIPEAQLN
Sbjct  542   GSGHVNPTKADDPGLIYDIQPDDYIPYLCGLGYNDTAIGIIVQRSVTCRNSSSIPEAQLN  601

Query  496   YPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYN  317
             YPSF++ L  +  TY+RTVTNVG  NS Y  ++    GVDV VTP  + F+E + + TY+
Sbjct  602   YPSFSLNLTSSPQTYTRTVTNVGPFNSSYNAEIIAPQGVDVKVTPGVIQFSEGSPKATYS  661

Query  316   ISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             ++F+ ++   ++ F QG + WVS  H+V+SPIA++F
Sbjct  662   VTFTRTAN-TNLPFSQGYLNWVSADHVVRSPIAVLF  696



>ref|XP_009608769.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana tomentosiformis]
Length=744

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/748 (55%), Positives = 523/748 (70%), Gaps = 18/748 (2%)
 Frame = -1

Query  2413  MAYISVVV-CLTLVFHSVASAKYEDTYIVHVSPPAAAINGVSE--DYRSYFRSFV----S  2255
             M ++ +++ C+   F   +     +TYIV V PP + I+  S   D  SY+ SF+    S
Sbjct  1     MGFLKILLFCIFCTFLWPSIQSDLETYIVQVEPPESQISTQSSSLDLESYYHSFLPKTTS  60

Query  2254  ESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFL  2075
              S  E E  R+++SY +V  GFAA+L+   V EM KK+GF+SA+ +R+  L+TTH+P+FL
Sbjct  61    ISSSENEEPRMIYSYHNVMKGFAARLTAAQVKEMEKKQGFVSAQPKRILPLHTTHTPSFL  120

Query  2074  GLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNN  1898
             GL QN G W++S+YGKGVI+GVLDTGI P+HPSF+D  MPPPPAKWKG CE    T CNN
Sbjct  121   GLQQNMGLWKDSNYGKGVIIGVLDTGIFPDHPSFSDVGMPPPPAKWKGLCESNFTTKCNN  180

Query  1897  KLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHL  1718
             KLIG R++          P+D++GHGTHTA TAAG FV  A VFG+A GTAVG+APLAH+
Sbjct  181   KLIGLRSY----QLANSSPIDDDGHGTHTAGTAAGAFVNGANVFGNANGTAVGVAPLAHI  236

Query  1717  SIYKVCTEDGCAE-SdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGI  1541
             +IYKVC  DGCA+   + A   A  D    +     G  S+ F  D IA+GA++A E+GI
Sbjct  237   AIYKVCISDGCADVDILAAMDAAIDDGVDILSISIGGSRSSPFHNDPIALGAYSATERGI  296

Query  1540  FVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPP  1361
              VSC+AGN GP   +++N+APW+LTVGAST DR +KAT  LGN  + +GESA++ +N   
Sbjct  297   LVSCSAGNNGPFSGSVANDAPWILTVGASTHDRKLKATVKLGNKEEFEGESAYRPKNSNS  356

Query  1360  TLLPLIYPGSKDED---AALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAA  1190
             T   L   G    D   A  C PGSL    ++GK+ LC  GGG+ RVDKGQ+VKDAGG  
Sbjct  357   TFFTLFDAGKNASDEFEAPYCKPGSLTDPAIRGKIALCLVGGGVRRVDKGQSVKDAGGVG  416

Query  1189  MILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAP  1010
             MI++N+  DG T  AD  VLP+ ++S  +G K++ Y+NST  P ATI F+GT IG K AP
Sbjct  417   MIIINEPDDGVTKSADALVLPSLDVSDTNGTKIQAYMNSTLNPVATITFQGTIIGEKIAP  476

Query  1009  SVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPH  830
              VASFSSRGPS ASPGILKPDI+GPGVNILAAWP   + N      TFN+ISGTSM+ PH
Sbjct  477   IVASFSSRGPSVASPGILKPDIIGPGVNILAAWPTSVDDNKNTKY-TFNVISGTSMSCPH  535

Query  829   LSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSR  650
             LSG+A LLKSAHP+W+PAAIKSAI+TTAD  NL    ILDE+L+PAD+FA G GHVNPSR
Sbjct  536   LSGVAALLKSAHPNWTPAAIKSAIMTTADTLNLAKNPILDEKLIPADIFAIGAGHVNPSR  595

Query  649   ASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLG  470
             A+DPGLIYD   +DY+PYLCGLNYT++E+  ++QRKV+CS+V  IPEAQLNYPSF+I LG
Sbjct  596   ANDPGLIYDTPFEDYVPYLCGLNYTNREVGNLLQRKVDCSKVKIIPEAQLNYPSFSIKLG  655

Query  469   KTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTP  290
              T  TY+RTVTNVG+A S Y V++    GV V V P  L F+++NQ+LTY ++FS ++  
Sbjct  656   STPQTYTRTVTNVGDATSSYKVEIVSPKGVFVNVNPSQLNFSKLNQKLTYQVTFSKTTNN  715

Query  289   VDI-DFVQGAIAWVSQRHIVKSPIAIIF  209
              +  D VQG + W S RH V+SPIA + 
Sbjct  716   SNTDDVVQGFLKWTSNRHSVRSPIAAVL  743



>ref|XP_003549875.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=749

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/724 (58%), Positives = 534/724 (74%), Gaps = 8/724 (1%)
 Frame = -1

Query  2362  ASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFVSES-GDEGERSRIVHSYRHVASGFA  2186
             ++A    TYI+HV  P       SED  S++ SF+  +     E+ R+++SYR+V SGFA
Sbjct  27    SAASSSKTYIIHVEGPQGKNLAQSEDLESWYHSFMPPTIMSSEEQPRMIYSYRNVMSGFA  86

Query  2185  AKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVL  2006
             A+L+ E +  ++KK GFI A+ +R+ +  TTH+P FLGL Q+ GFW+ S++GKGVIVGV+
Sbjct  87    ARLTEEELRAVQKKNGFIYAQPERILHRQTTHTPQFLGLQQDMGFWKESNFGKGVIVGVV  146

Query  2005  DTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNF--VSEGssppppPVDE  1832
             D+GITP HPSF+D  MPPPP KWKGKCE   TACNNKLIGAR+F   +        P+DE
Sbjct  147   DSGITPGHPSFSDAGMPPPPPKWKGKCELNATACNNKLIGARSFNLAATAMKGADSPIDE  206

Query  1831  EGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamda  1652
             +GHGTHTASTAAG FV +A + G+AKGTA G+AP AHL++Y+VC  + C ESDILAA+DA
Sbjct  207   DGHGTHTASTAAGAFVDHAELLGNAKGTAAGIAPHAHLAMYRVCFGEDCPESDILAALDA  266

Query  1651  aiddgvdvlslslgggSAS-FFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPW  1475
             A++DGVDV+S+SLG      FF DS AIGAFAAM+KGIFVSCAAGN GP + +L N APW
Sbjct  267   AVEDGVDVISISLGLSEPPPFFHDSTAIGAFAAMQKGIFVSCAAGNSGPFHGSLINGAPW  326

Query  1474  LLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPG  1298
             +LTVGAS IDR+I ATA LGNG + DGES FQ  +F PTLLPL Y G    ++AA C  G
Sbjct  327   VLTVGASNIDRSIAATAKLGNGQEFDGESVFQPSDFSPTLLPLAYAGKNGKQEAAFCANG  386

Query  1297  SLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATE  1118
             SL+  D +GKVVLC+RGGGI R+ KG+ VK  GGAAMIL N + +G+++ AD HVLPAT 
Sbjct  387   SLNDSDFRGKVVLCERGGGIGRIPKGEEVKRVGGAAMILANDESNGFSLSADVHVLPATH  446

Query  1117  LSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILG  938
             +SY+ GLK+K YINST+ P ATI+FKGT IG   AP+V SFSSRGP+  SPGILKPDI+G
Sbjct  447   VSYDAGLKIKAYINSTAIPIATILFKGTIIGNSLAPAVTSFSSRGPNLPSPGILKPDIIG  506

Query  937   PGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAI  758
             PGVNILAAWP   N +  +  +TFN +SGTSM+ PHLSGIA LLKS+HP WSPAAIKSAI
Sbjct  507   PGVNILAAWPFPLNNDTDSK-STFNFMSGTSMSCPHLSGIAALLKSSHPHWSPAAIKSAI  565

Query  757   ITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNY  578
             +T+AD  N     I+DE L PADVFATG GHVNPSRA+DPGL+YD+Q DDYIPYLCGL Y
Sbjct  566   MTSADIINFERKLIVDETLHPADVFATGSGHVNPSRANDPGLVYDIQPDDYIPYLCGLGY  625

Query  577   TDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKV  398
             +D ++  I  + ++CS+ +SIPE +LNYPSF++ LG    T++RTVTNVGEANS Y V V
Sbjct  626   SDTQVGIIAHKTIKCSETSSIPEGELNYPSFSVVLGSPQ-TFTRTVTNVGEANSSYVVMV  684

Query  397   SPFLGVDVGVTPDTLVFTEVNQQLTYNISFSP-SSTPVDIDFVQGAIAWVSQRHIVKSPI  221
                 GV+V + P+ L F+  NQ+  Y++SFS   S     ++ QG + WVS +H V+SPI
Sbjct  685   MAPEGVEVRIQPNKLTFSGENQKEIYSVSFSRIESGNETAEYAQGFLQWVSAKHSVRSPI  744

Query  220   AIIF  209
              + F
Sbjct  745   LVNF  748



>ref|XP_009762964.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana sylvestris]
Length=744

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/748 (57%), Positives = 540/748 (72%), Gaps = 18/748 (2%)
 Frame = -1

Query  2413  MAYISVVV-CLTLVFHSVASAKYEDTYIVHVSPPAAAINGVSE--DYRSYFRSFVSES--  2249
             M ++ +++ C+   F   +     +TYI+ V PP   I+  S   D  SY+ SF+ ++  
Sbjct  1     MGFLKILLFCIVCSFPWPSFQTDLETYIIQVEPPETQISTQSSSLDLESYYHSFLPKTTA  60

Query  2248  --GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFL  2075
                   E  R+++SY +V  GFAA+L+   V EM KK+GF SAR QR+ +L TTH+P+FL
Sbjct  61    INSRNNEEPRMIYSYHNVMKGFAARLTAAEVKEMEKKQGFFSARPQRILSLQTTHTPSFL  120

Query  2074  GLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNN  1898
             GL QN G W++S+YGKGVI+GVLDTGI P+HPSF+D  MPPPPAKWKG CE    T CNN
Sbjct  121   GLQQNMGLWKDSNYGKGVIIGVLDTGIFPDHPSFSDVGMPPPPAKWKGVCESNFTTKCNN  180

Query  1897  KLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHL  1718
             KLIG R++          P+D++GHGTHTA TAAG FV  A V+G+A GTAVG+APLAH+
Sbjct  181   KLIGLRSY----QLANGSPIDDDGHGTHTAGTAAGAFVKGANVYGNANGTAVGVAPLAHI  236

Query  1717  SIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSAS-FFEDSIAIGAFAAMEKGI  1541
             +IYKVCT DGCA+ DILAAMDAAIDDGVD+LS+S+GG  +  F  D IA+GA++A E+GI
Sbjct  237   AIYKVCTSDGCADVDILAAMDAAIDDGVDILSISIGGSRSRPFHTDPIALGAYSATERGI  296

Query  1540  FVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPP  1361
              VSC+AGN GP    ++N+APW+LTVGAST DR +KAT  LGN  + +GESA++ +    
Sbjct  297   LVSCSAGNNGPFSGFVTNDAPWILTVGASTHDRKLKATVKLGNKEEFEGESAYRPKTSNS  356

Query  1360  TLLPLIYPGSKDED---AALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAA  1190
             T   L   G    D   A  C PGSL    ++GK+VLC  GGG+ RVDKGQ VKDAGG  
Sbjct  357   TFFLLFDAGKNASDEFEAPYCKPGSLTDPAIRGKIVLCLVGGGVRRVDKGQAVKDAGGVG  416

Query  1189  MILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAP  1010
             MI++N+  DG T  AD  VLP+ ++S   G K++ Y+NSTS P ATI F+GT IG K AP
Sbjct  417   MIIINEPDDGVTKSADAFVLPSLDVSDVSGTKIQAYMNSTSNPVATITFQGTIIGDKNAP  476

Query  1009  SVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPH  830
              VASFS+RGPS ASPGILKPDI+GPGVNILAAWP  +  +N N  +TFNIISGTSM+ PH
Sbjct  477   IVASFSARGPSVASPGILKPDIIGPGVNILAAWPT-SLDDNKNTKSTFNIISGTSMSCPH  535

Query  829   LSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSR  650
             LSGIA LLKSAHP+WSPAAIKSAI+TTAD  NL    ILDERL+PAD+FA G GHVNPSR
Sbjct  536   LSGIAALLKSAHPNWSPAAIKSAIMTTADTLNLAKNPILDERLIPADIFAIGAGHVNPSR  595

Query  649   ASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLG  470
             A+DPGLIYD   +DY+PYLCGLNYT++E+  ++QRK++C +V SIPEAQLNYPSF+I LG
Sbjct  596   ANDPGLIYDTPFEDYVPYLCGLNYTNREVGSLLQRKLDCLKVKSIPEAQLNYPSFSIKLG  655

Query  469   KTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTP  290
              T  TY+RTVTNVG+A S Y +++    GV + V P  L+F+++NQ+LTY ++FS ++  
Sbjct  656   STPQTYTRTVTNVGDATSTYKLEIVSPKGVAINVNPSQLIFSKLNQKLTYQVTFSKTTNN  715

Query  289   VDI-DFVQGAIAWVSQRHIVKSPIAIIF  209
              +  D VQG + W S RH V+SPIA +F
Sbjct  716   SNTDDVVQGFLKWTSNRHFVRSPIAAVF  743



>gb|EYU22359.1| hypothetical protein MIMGU_mgv1a023284mg [Erythranthe guttata]
Length=731

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/745 (58%), Positives = 548/745 (74%), Gaps = 33/745 (4%)
 Frame = -1

Query  2413  MAYISVVVCLTLVFHSVASAKYEDTYIVHVSPPA----AAINGVSEDYRSYFRSFV----  2258
             M Y ++ + LT      +      TYIVHV  P+       + ++ED ++Y+++F+    
Sbjct  1     MGYYTLFLTLT------SKDSNLQTYIVHVELPSFPTLTTSSLLTEDLQAYYQTFLASTL  54

Query  2257  SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNF  2078
             S S    +   I++SY +V  GF+A+LSPE V  M KK GFISAR Q+  +L+TTHSPNF
Sbjct  55    SASSPSTDEPSIIYSYHNVFHGFSARLSPEQVKAMEKKPGFISARPQKTLSLHTTHSPNF  114

Query  2077  LGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGT--AC  1904
             LGL QN GFWR+S+YG+G+I+GVLD+G+ PNHPSFND+ MPPPPA W+G+CEF  T   C
Sbjct  115   LGLNQNTGFWRDSNYGRGMIIGVLDSGVNPNHPSFNDDGMPPPPASWRGRCEFNSTIARC  174

Query  1903  NNKLIGARNF-VSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPL  1727
             NNKLIGAR F + +G+       DE+GHGTHTASTAAGNFV  A VFG+A GTA G+APL
Sbjct  175   NNKLIGARFFTIGDGTPS-----DEDGHGTHTASTAAGNFVPGANVFGNANGTAAGVAPL  229

Query  1726  AHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEK  1547
             AH++ YKVCT   C ESDI+AAMDAAIDDGVD++SLSLGG +  FF ++IA+GAF+A+E+
Sbjct  230   AHVATYKVCTTT-CEESDIVAAMDAAIDDGVDIISLSLGGPAQDFFGENIAVGAFSAIER  288

Query  1546  GIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENF  1367
             GIFVS +AGN GP Y T  N APW+LTVGAS++DR I+ATAVLGN  +LDGES FQ  +F
Sbjct  289   GIFVSASAGNNGPFYGTAQNGAPWILTVGASSVDRKIRATAVLGNNEELDGESTFQPSDF  348

Query  1366  PPTLLPLIYPGSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAM  1187
             P TLLPL Y      + + C P SL  +D++G +VLCD GGGI R+ KG+ V+ AGGAAM
Sbjct  349   PTTLLPLFY----SPNDSFCSPASLRSLDLQGMIVLCDNGGGIGRIAKGRAVRAAGGAAM  404

Query  1186  ILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPS  1007
             +++NQ   G+T  +D+HVLPAT LSY DGL+VK Y+NST+ PTATI FKGT IG   AP 
Sbjct  405   VIVNQQRQGFTTNSDSHVLPATHLSYTDGLRVKAYLNSTASPTATISFKGTVIGDDRAPQ  464

Query  1006  VASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHL  827
             VA+FS+RGP+  SPGILKPDI+GPG NILAAW V    N G   + FNIISGTSM+ PHL
Sbjct  465   VAAFSARGPNPPSPGILKPDIIGPGHNILAAWHVSVENNTGTN-SNFNIISGTSMSCPHL  523

Query  826   SGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRA  647
             SG+A LLKS HPDWSPAAIKSAI+TTAD  NL G  I D+    ADVFA G GH+N  +A
Sbjct  524   SGVAALLKSVHPDWSPAAIKSAIMTTADLVNLAGNPIEDQTQSRADVFAIGSGHINILKA  583

Query  646   SDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGK  467
             +DPGL+YD+   DY+PYLCGLNYTDQ++  IV R V C++++SIPEA+LNYPSF++ +G 
Sbjct  584   TDPGLVYDMGPQDYVPYLCGLNYTDQQVAVIVNRVVRCAEISSIPEAELNYPSFSVGIGN  643

Query  466   TSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSS---  296
             TS TY+RTVTNVGEANS+YTV+ +  L VDV V P TL F+ +NQ LTY  +F+ +S   
Sbjct  644   TSTTYNRTVTNVGEANSIYTVRAALPL-VDVRVEPTTLQFSAINQTLTYQTTFTRASGNT  702

Query  295   TPVDIDFVQGAIAWVSQRHIVKSPI  221
             T V++  VQG + W S RH V+SPI
Sbjct  703   TIVNV-IVQGFLTWTSGRHTVRSPI  726



>ref|XP_008238729.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=758

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/747 (58%), Positives = 546/747 (73%), Gaps = 26/747 (3%)
 Frame = -1

Query  2380  LVFHSVASAKYE-----DTYIVHVSPPAAAINGVS--EDYRSYFRSFVSES---GDEGER  2231
             +   SVA+ K +      TYIV V  PA+        ED  S+++SF+ E+    ++  +
Sbjct  14    MALESVAADKNDGSNDMQTYIVWVQKPASQKFSAESHEDLESWYQSFLPETDANSNQLTK  73

Query  2230  SRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGF  2051
              R+V++Y +VA+GFAA+L+PE V  M   +GF+SAR +++  + TTHSP+FLGL+Q FG 
Sbjct  74    QRMVYAYHNVATGFAARLTPEEVKTMETIEGFVSARPEKILPVQTTHSPDFLGLHQGFGL  133

Query  2050  WRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFV  1871
             W  ++YG+GVI+G+LDTGITP+HPSF+DE MPPPPAKWKGKCEF GT CNNKLIGARNF+
Sbjct  134   WEATNYGEGVIIGLLDTGITPDHPSFSDEGMPPPPAKWKGKCEFNGTLCNNKLIGARNFM  193

Query  1870  SEGssppppP--VDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCT  1697
               G   PPP    D +GHGTHT+STAAG FV  A+VFG A GTA GMAP AHL++YKVC+
Sbjct  194   GVGKGQPPPGPPFDIDGHGTHTSSTAAGRFVEGASVFGQANGTAAGMAPKAHLAVYKVCS  253

Query  1696  EDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGN  1517
               GCAE+DILAA+D A+DDGVDVLSLSLGG S  F++D IAIGAFAA++KGIF SCAAGN
Sbjct  254   GFGCAEADILAALDVAVDDGVDVLSLSLGGPSLPFYKDVIAIGAFAAIQKGIFFSCAAGN  313

Query  1516  EGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGA--QLDGESAFQVENFPPTL---L  1352
              GP  ++LSNEAPW+LTVGAST DR +K+ A +G+      DG+S  Q ++F  T+   L
Sbjct  314   FGPFNHSLSNEAPWILTVGASTTDRILKSEAQIGDNKNNHFDGKSLSQPQDFDSTVSLPL  373

Query  1351  PLIYPGS-KDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLN  1175
             PL+Y GS   + +A C  G+L+ V+ K    LC+ GGG+  + KG+ VK AGGAAMIL+N
Sbjct  374   PLVYAGSVGAQPSAFCKEGTLENVEGKIV--LCETGGGVTNIAKGEEVKRAGGAAMILMN  431

Query  1174  QDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASF  995
             Q+ DG++ LA++H LP T +SY  GL++K YI+STS PTATI+F GT IG   AP VA F
Sbjct  432   QETDGFSTLAESHALPTTHVSYAAGLQIKSYISSTSSPTATILFNGTVIGDALAPRVAFF  491

Query  994   SSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIA  815
             SSRGP+ ASPGILKPDI+GPGV+ILAAWPV  +    +  ATFNIISGTSMA PHLSGIA
Sbjct  492   SSRGPNKASPGILKPDIIGPGVDILAAWPVSVDNATQSK-ATFNIISGTSMACPHLSGIA  550

Query  814   TLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPG  635
              L+KS+HPDWSPAAIKSAI+TTAD  NL G  I+D+   PA+VFA G GHVNPS+A+DPG
Sbjct  551   ALVKSSHPDWSPAAIKSAIMTTADVLNLAGMPIVDQDQKPANVFAMGAGHVNPSKANDPG  610

Query  634   LIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKT---  464
             LIYD Q +DYIPYLCGLNYTD+EIQ I Q+KV CSQV  IPEAQLNYPSF+I +G     
Sbjct  611   LIYDTQPEDYIPYLCGLNYTDKEIQIITQQKVNCSQVEVIPEAQLNYPSFSIKIGSNESQ  670

Query  463   SLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISF--SPSSTP  290
             S  Y+RTV NVG A++ Y + +     + + V P  L FTEVNQ++T+++ F     +  
Sbjct  671   SQYYTRTVRNVGPASTTYNLDLLVPHKMGMSVNPGVLTFTEVNQEITFHVEFIAQDGAGK  730

Query  289   VDIDFVQGAIAWVSQRHIVKSPIAIIF  209
               + F QG + WVS +H V SPIA++F
Sbjct  731   DGVAFGQGYLRWVSDKHNVTSPIAVVF  757



>ref|XP_006358405.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=743

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/721 (57%), Positives = 527/721 (73%), Gaps = 14/721 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSE--DYRSYFRSFVS---ESGDEGERSRIVHSYRHVASGFAAK  2180
             +TYIV V  P + I+  S   D  S+++SF+    E+    E+ ++++SY +V  GFAA+
Sbjct  24    ETYIVQVESPESQISTQSSRMDLESWYKSFLPKTIETAGLDEKPQLIYSYHNVIIGFAAR  83

Query  2179  LSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDT  2000
             LS + V E+    GFISA +QR+   +TTH+P+FLGL QN G WR+++YGKGVI+GVLDT
Sbjct  84    LSAKQVKEIEMTPGFISAWQQRILFPHTTHTPSFLGLQQNIGLWRDANYGKGVIIGVLDT  143

Query  1999  GITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARNFVSEGssppppPVDEEGH  1823
             GI+P+HPSF+D+ MPPPPAKWKGKCE    T CNNKLIGAR F++         +D+ GH
Sbjct  144   GISPDHPSFSDKGMPPPPAKWKGKCESNFTTKCNNKLIGARTFLNS-----DSLIDDVGH  198

Query  1822  GTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaid  1643
             GTHTASTAAG FV  A V+G+A GTAVG+APLAHL+IYKVC   GC++SD+LAAMDAAID
Sbjct  199   GTHTASTAAGGFVKGANVYGNANGTAVGIAPLAHLAIYKVCDSFGCSDSDVLAAMDAAID  258

Query  1642  dgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTV  1463
             DGVD+LS+SLGG    F+ED IA+GA++A ++GI VSC+AGNEGP   TLSNEAPW+LTV
Sbjct  259   DGVDILSISLGGNRKLFYEDPIALGAYSATKRGILVSCSAGNEGPYESTLSNEAPWILTV  318

Query  1462  GASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK--DEDAALCGPGSLd  1289
             GAS+IDR +KAT  LGN   L+GESAF  +       PL  P     D D+  CGPG+L 
Sbjct  319   GASSIDRKLKATVKLGNQKILEGESAFHPKGHNSIFSPLYDPSRNETDFDSLYCGPGTLS  378

Query  1288  kvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSY  1109
               ++KGK+V+C  GGG +R+DKGQ VKDAGG  MI+ N   DG+T  +D HVLPA  ++Y
Sbjct  379   DSEIKGKIVVCSAGGGYSRIDKGQAVKDAGGVGMIIFNTADDGFTKFSDPHVLPALHITY  438

Query  1108  NDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGV  929
              DGL++ DY+NSTS P A I F+GT IG K AP +A+FSSRGP+ ASPGILKPDI+GPG+
Sbjct  439   KDGLEILDYMNSTSKPIARIAFQGTIIGDKDAPVIAAFSSRGPNIASPGILKPDIIGPGL  498

Query  928   NILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITT  749
             NILAAWP   +       +TFNIISGTSM+ PHLSG+A LLK  HP WSPAAIKSAI+TT
Sbjct  499   NILAAWPTSIDNKKNTK-STFNIISGTSMSCPHLSGVAALLKGTHPTWSPAAIKSAIMTT  557

Query  748   ADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQ  569
             A   N     ILDERL+PA++FA G GHVNPS+A+DPGLIYD    DY+PYLCGLNYT++
Sbjct  558   AYTVNFASDPILDERLLPANIFAIGAGHVNPSKANDPGLIYDTHFKDYLPYLCGLNYTNR  617

Query  568   EIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPF  389
             ++  ++QRKV+C  V  IPEAQLNYPSF+I LG  S TY+RTVTNVGEA S Y+V+++  
Sbjct  618   QVGNLMQRKVDCRSVKHIPEAQLNYPSFSITLGDISQTYTRTVTNVGEAKSSYSVEIALP  677

Query  388   LGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              GV V V P  L F+++NQ L Y ++F+      +   VQG + W S+++ V+SPIA++ 
Sbjct  678   PGVSVTVKPSILKFSKLNQNLKYQVTFTRRDNSPNSGIVQGFLKWSSKKYSVRSPIAVVL  737

Query  208   Q  206
             Q
Sbjct  738   Q  738



>gb|AES94159.2| subtilisin-like serine protease [Medicago truncatula]
Length=776

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/721 (58%), Positives = 523/721 (73%), Gaps = 17/721 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
             TYIVHV       +  SED  S++ SF+ +  +   + R+V SYRHVASGFA KL+PE  
Sbjct  64    TYIVHVKKSENVASFQSEDLHSWYHSFLPQ--NFPHKDRMVFSYRHVASGFAVKLTPEEA  121

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
               +++K G + AR +R  +L+TTHSP FLGL    G W + + GKGVI+GV+D+GI P+H
Sbjct  122   KSLQEKDGILLARPERTLSLHTTHSPTFLGLKHGQGLWNDDNLGKGVIIGVIDSGIFPSH  181

Query  1981  PSFNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             PSFNDE MPPPPAKWKG CEF G   CNNKLIGAR+ V    +   PP +   HGTHTA+
Sbjct  182   PSFNDEGMPPPPAKWKGHCEFNGMKICNNKLIGARSLVKS--TIQEPPFENIFHGTHTAA  239

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTED-GCAESdilaamdaaiddgvdv  1628
              AAG F+ +A+VFG+AKG A GMAP AHL+IYKVC +   C ES ILAAMD AI+DGVDV
Sbjct  240   EAAGRFIKDASVFGNAKGVAAGMAPNAHLAIYKVCNDKIECPESAILAAMDIAIEDGVDV  299

Query  1627  lslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTI  1448
             LSLSLG GS  FFED IAIGAFAA + GIFVSC+A N GP+Y TLSNEAPW+LTVGASTI
Sbjct  300   LSLSLGLGSLPFFEDPIAIGAFAATQNGIFVSCSAANSGPEYSTLSNEAPWILTVGASTI  359

Query  1447  DRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS-----KDEDAALCGPGSLdkv  1283
             DR I A+A LGNG + +GE+ FQ ++FP  L PL+Y GS     + ++ +LC PGSL  +
Sbjct  360   DRKIVASAKLGNGEEYEGETLFQPKDFPQQLFPLVYAGSLGYGNQTQNQSLCLPGSLKNI  419

Query  1282  dvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYND  1103
             D+ GKVVLCD G  ++   KGQ V +A G A+IL+N + DG++  A  HVLPA E+SY  
Sbjct  420   DLSGKVVLCDIGEDVSTFVKGQEVLNANGVAVILVNSESDGFSTFATAHVLPAVEVSYAA  479

Query  1102  GLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNI  923
             GL +KDYINST  PTAT++FKGT IG   APSV SFSSRGPS  SPGILKPDI+GPGVNI
Sbjct  480   GLTIKDYINSTYNPTATLLFKGTVIGDSLAPSVVSFSSRGPSQQSPGILKPDIIGPGVNI  539

Query  922   LAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTAD  743
             LAAWPV  +         F I SGTSM+ PHLSGIA L+KS+HPDWSPAAIKSAI+TTA+
Sbjct  540   LAAWPVSIDNKT----PPFAITSGTSMSCPHLSGIAALIKSSHPDWSPAAIKSAIMTTAN  595

Query  742   QYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEI  563
               NL G  ILD+RL PADVFATG GHVNP +A+DPGL+YD+Q +DY+PYLCGL YTDQEI
Sbjct  596   TLNLGGIPILDQRLSPADVFATGAGHVNPVKANDPGLVYDIQPEDYVPYLCGLGYTDQEI  655

Query  562   QQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLG  383
             + I Q  V CS V SIPEAQL+YPSF+I LG  S  Y+RT+TNVG ANS Y V++   L 
Sbjct  656   ELIAQWVVNCSNVKSIPEAQLSYPSFSILLGSDSQYYTRTLTNVGLANSTYRVELEVPLA  715

Query  382   VDVGVTPDTLVFTEVNQQLTYNISFSPSSTPV--DIDFVQGAIAWVSQRHIVKSPIAIIF  209
               + V P  + F+EV+++++Y++ F P +     +  + QG++ WVS +H V+ PI++IF
Sbjct  716   FGMSVNPSEITFSEVDEKVSYSVDFIPKTKESRGNNTYAQGSLTWVSDKHAVRIPISVIF  775

Query  208   Q  206
             +
Sbjct  776   K  776



>ref|XP_003611201.1| Subtilisin-like serine protease [Medicago truncatula]
Length=756

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/721 (58%), Positives = 523/721 (73%), Gaps = 17/721 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
             TYIVHV       +  SED  S++ SF+ +  +   + R+V SYRHVASGFA KL+PE  
Sbjct  44    TYIVHVKKSENVASFQSEDLHSWYHSFLPQ--NFPHKDRMVFSYRHVASGFAVKLTPEEA  101

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
               +++K G + AR +R  +L+TTHSP FLGL    G W + + GKGVI+GV+D+GI P+H
Sbjct  102   KSLQEKDGILLARPERTLSLHTTHSPTFLGLKHGQGLWNDDNLGKGVIIGVIDSGIFPSH  161

Query  1981  PSFNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             PSFNDE MPPPPAKWKG CEF G   CNNKLIGAR+ V    +   PP +   HGTHTA+
Sbjct  162   PSFNDEGMPPPPAKWKGHCEFNGMKICNNKLIGARSLVKS--TIQEPPFENIFHGTHTAA  219

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTED-GCAESdilaamdaaiddgvdv  1628
              AAG F+ +A+VFG+AKG A GMAP AHL+IYKVC +   C ES ILAAMD AI+DGVDV
Sbjct  220   EAAGRFIKDASVFGNAKGVAAGMAPNAHLAIYKVCNDKIECPESAILAAMDIAIEDGVDV  279

Query  1627  lslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTI  1448
             LSLSLG GS  FFED IAIGAFAA + GIFVSC+A N GP+Y TLSNEAPW+LTVGASTI
Sbjct  280   LSLSLGLGSLPFFEDPIAIGAFAATQNGIFVSCSAANSGPEYSTLSNEAPWILTVGASTI  339

Query  1447  DRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS-----KDEDAALCGPGSLdkv  1283
             DR I A+A LGNG + +GE+ FQ ++FP  L PL+Y GS     + ++ +LC PGSL  +
Sbjct  340   DRKIVASAKLGNGEEYEGETLFQPKDFPQQLFPLVYAGSLGYGNQTQNQSLCLPGSLKNI  399

Query  1282  dvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYND  1103
             D+ GKVVLCD G  ++   KGQ V +A G A+IL+N + DG++  A  HVLPA E+SY  
Sbjct  400   DLSGKVVLCDIGEDVSTFVKGQEVLNANGVAVILVNSESDGFSTFATAHVLPAVEVSYAA  459

Query  1102  GLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNI  923
             GL +KDYINST  PTAT++FKGT IG   APSV SFSSRGPS  SPGILKPDI+GPGVNI
Sbjct  460   GLTIKDYINSTYNPTATLLFKGTVIGDSLAPSVVSFSSRGPSQQSPGILKPDIIGPGVNI  519

Query  922   LAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTAD  743
             LAAWPV  +         F I SGTSM+ PHLSGIA L+KS+HPDWSPAAIKSAI+TTA+
Sbjct  520   LAAWPVSIDNKT----PPFAITSGTSMSCPHLSGIAALIKSSHPDWSPAAIKSAIMTTAN  575

Query  742   QYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEI  563
               NL G  ILD+RL PADVFATG GHVNP +A+DPGL+YD+Q +DY+PYLCGL YTDQEI
Sbjct  576   TLNLGGIPILDQRLSPADVFATGAGHVNPVKANDPGLVYDIQPEDYVPYLCGLGYTDQEI  635

Query  562   QQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLG  383
             + I Q  V CS V SIPEAQL+YPSF+I LG  S  Y+RT+TNVG ANS Y V++   L 
Sbjct  636   ELIAQWVVNCSNVKSIPEAQLSYPSFSILLGSDSQYYTRTLTNVGLANSTYRVELEVPLA  695

Query  382   VDVGVTPDTLVFTEVNQQLTYNISFSPSSTPV--DIDFVQGAIAWVSQRHIVKSPIAIIF  209
               + V P  + F+EV+++++Y++ F P +     +  + QG++ WVS +H V+ PI++IF
Sbjct  696   FGMSVNPSEITFSEVDEKVSYSVDFIPKTKESRGNNTYAQGSLTWVSDKHAVRIPISVIF  755

Query  208   Q  206
             +
Sbjct  756   K  756



>ref|XP_002509656.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51043.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=741

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/734 (58%), Positives = 532/734 (72%), Gaps = 17/734 (2%)
 Frame = -1

Query  2395  VVCLTLVFHSVASAKYE--DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRI  2222
             ++  T VF S  + K E  +TYIV V      ++  S+D   +++SF++ S     + R+
Sbjct  17    LLSFTSVFRSFLAIKEERLETYIVFVEKSEDQVSLQSKDLDRWYQSFLTVSTASSIKPRM  76

Query  2221  VHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRN  2042
             +HSYR+V +GFAAK++    + M +KKGF+SAR  +V  L+TTH+P+FLGL QN GFW N
Sbjct  77    LHSYRNVVTGFAAKMTAHQANSMEEKKGFVSARLAKVLPLHTTHTPSFLGLQQNVGFWNN  136

Query  2041  SSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEG-TACNNKLIGARNFVSE  1865
             SSYGKGVI+G+LDTGITP+HPSFNDE MP PP KWKGKCEF   T CNNKLIGARN VS 
Sbjct  137   SSYGKGVIIGILDTGITPDHPSFNDEGMPSPPEKWKGKCEFNNKTVCNNKLIGARNLVSA  196

Query  1864  GssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGC  1685
             G     PPVD+ GHGTHTASTAAG+ +  A  FG   GTA G+APLAHL++Y+VC E GC
Sbjct  197   G----SPPVDDMGHGTHTASTAAGSPLQGANYFGQVNGTASGIAPLAHLALYRVCDESGC  252

Query  1684  AESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPD  1505
              ES+ILAAMDA ++DGVDV+SLSLGG S  F+ D IAIGA+ A+ KGIFVSCAAGN GP+
Sbjct  253   GESEILAAMDAGVEDGVDVISLSLGGPSLPFYSDVIAIGAYGAINKGIFVSCAAGNSGPN  312

Query  1504  YYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKD  1325
               +LSNEAPW+LTVGASTIDR I+AT +LGN  +L GES FQ ++FP  LLPL+YPG   
Sbjct  313   EESLSNEAPWILTVGASTIDRAIRATVLLGNNTKLRGESLFQPKDFPSKLLPLVYPGG--  370

Query  1324  EDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILA  1145
               A+ C  GSL  VDVKGK+VLC+RGG +  +DKGQ VKD GGAAMIL+N +  GY I A
Sbjct  371   -GASKCKAGSLKNVDVKGKIVLCNRGGDVGVIDKGQEVKDNGGAAMILVNDEYSGYDISA  429

Query  1144  DTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASP  965
             D HVLPA+ + Y DGL +K Y++STS P ATI+F+GT  G   AP VA+FSSRGPS ASP
Sbjct  430   DLHVLPASHVDYVDGLTIKSYLHSTSSPVATILFEGTVTGVADAPQVATFSSRGPSQASP  489

Query  964   GILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDW  785
             GILKPDI+GPGVNILAAWP     +  N    FN+ISGTSM+ PHLSGIA L+KSAHPDW
Sbjct  490   GILKPDIIGPGVNILAAWP----ESTDNSVNRFNMISGTSMSCPHLSGIAALIKSAHPDW  545

Query  784   SPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDY  605
             SPAAIKSAI+TTA   +L+G  I D++ V + VF  G GHVNP+ A++PGL+YD+  +DY
Sbjct  546   SPAAIKSAIMTTASLSSLSGNPISDQQFVTSTVFDIGAGHVNPTEANNPGLVYDILPEDY  605

Query  604   IPYLCGLNYTDQEIQQIVQRKVECSQVT--SIPEAQLNYPSFAIWLGKTSLTYSRTVTNV  431
             IPYL GL Y+D+++  IVQ  +  S  +  +IPEAQLNYPSF++ LG    TY+RTVTNV
Sbjct  606   IPYLRGLGYSDKQVGLIVQHTMGSSNSSFRTIPEAQLNYPSFSVKLGSDPQTYTRTVTNV  665

Query  430   GEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWV  251
             G   + +T ++    GVDV VTPD LVF  VNQ+  Y+++F+         F QG + W 
Sbjct  666   GVPGTSFTYEIIQPQGVDVAVTPDKLVFNAVNQKAAYSVTFTKKEDGTGT-FAQGYLTWK  724

Query  250   SQRHIVKSPIAIIF  209
             +  + V+SPIA+ F
Sbjct  725   TDLYTVRSPIAVFF  738



>gb|EYU39031.1| hypothetical protein MIMGU_mgv1a025139mg, partial [Erythranthe 
guttata]
Length=693

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/700 (61%), Positives = 524/700 (75%), Gaps = 16/700 (2%)
 Frame = -1

Query  2281  RSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNL  2102
              S++ SF+  S   G R RIV+SYR+V  GFAA+LS + V  M    GFISA  +R  ++
Sbjct  2     ESWYTSFLPTSISNGRR-RIVYSYRNVFKGFAARLSADEVKAMESNPGFISAEPERKLDM  60

Query  2101  YTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCE  1922
             +TTHSPNFLGL QN GFW++S+YGKGVI+GVLD+GI P+HPSF+DE MPPPPAKWKGKCE
Sbjct  61    HTTHSPNFLGLNQNMGFWQDSNYGKGVIIGVLDSGIFPSHPSFSDEGMPPPPAKWKGKCE  120

Query  1921  FEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAV  1742
             F  T CNNK+IGAR F          P+D+ GHGTHTASTAAG+FV  A VFG+A GTA 
Sbjct  121   FNPTVCNNKIIGARYFT----LFDDSPLDDGGHGTHTASTAAGSFVAGANVFGNANGTAS  176

Query  1741  GMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAF  1562
             G+APLAHL+IYKVC+   C ES ILAAMDAAI+DGVD+LSLSLGGGS SF+ DSIA+GAF
Sbjct  177   GIAPLAHLAIYKVCSFI-CFESSILAAMDAAIEDGVDILSLSLGGGSRSFYLDSIALGAF  235

Query  1561  AAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAF  1382
             +AMEKGI VSC+AGN GP  ++ SNEAPW+LTVGASTIDR I+ATA+LGN   +DGE+ F
Sbjct  236   SAMEKGILVSCSAGNSGPFNFSTSNEAPWILTVGASTIDRKIRATALLGNNISVDGETLF  295

Query  1381  QVENFPPTLLPLIYPGS---KDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTV  1211
             Q  +FP TLLPL+Y GS    D     C P SL K++++G +V+C+ G  +  V KG  V
Sbjct  296   QPSDFPSTLLPLVYAGSLNTSDPGIQYCTPESLTKINLRGMIVVCESGL-VTDVSKGVAV  354

Query  1210  KDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTF  1031
             K AGGAA+IL+N  +D     +D HVLPAT++ Y DGLK+K YINST+ P ATI+FKGT 
Sbjct  355   KIAGGAAIILVNHRLDANMTFSDAHVLPATDVGYADGLKIKTYINSTTTPMATILFKGTI  414

Query  1030  IGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISG  851
             IG   AP VA+FSSRGP++ASPGILKPDI+GPGVNILAAWPV    N     A+FNIISG
Sbjct  415   IGDDRAPIVAAFSSRGPNSASPGILKPDIIGPGVNILAAWPVSVENNTNTN-ASFNIISG  473

Query  850   TSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGG  671
             TSM+ PHLSG+A LLKS+HPDWSPAAIKSAI+TTAD  NL    I DER +PA +FATG 
Sbjct  474   TSMSCPHLSGVAALLKSSHPDWSPAAIKSAIMTTADVVNLAQNPIEDERFIPASLFATGS  533

Query  670   GHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYP  491
             GHVNPSRA+DPGLIYDL+S+DY PYLCGLNYT+ ++  IVQ+ V+CS    IPEAQLNYP
Sbjct  534   GHVNPSRANDPGLIYDLKSEDYFPYLCGLNYTNLQVSIIVQKIVDCSVEARIPEAQLNYP  593

Query  490   SFAIWLGKT---SLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTY  320
             SFAI  G++   + TY+RTVTNVGE    Y V++ P  G+ V V P TL FTE N  L Y
Sbjct  594   SFAITFGRSEQITQTYTRTVTNVGEHVLSYVVEIVPPPGISVVVEPTTLDFTEANPILQY  653

Query  319   NISFSP-SSTPVDIDFVQGAIAWVS-QRHIVKSPIAIIFQ  206
              ++F+   ST  +  ++QG + W S  ++ V++PIA+I Q
Sbjct  654   QVTFTRLDSTTNNAGYIQGYLKWNSGAKYSVRTPIAVILQ  693



>ref|XP_006358905.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=650

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/654 (63%), Positives = 501/654 (77%), Gaps = 13/654 (2%)
 Frame = -1

Query  2155  MRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPS  1976
             M K +GF+SAR + + +LYTTHS NF+GL QN GFW +S+YGKGVI+GV+DTGI P+HPS
Sbjct  1     MEKMEGFVSARPEGLLDLYTTHSVNFMGLNQNMGFWNDSNYGKGVIIGVIDTGIFPDHPS  60

Query  1975  FNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAA  1796
             F+D+ MPPPPAKWKG C+F  T CNNK+IGAR F          P DE GHGTHTASTAA
Sbjct  61    FSDDGMPPPPAKWKGICQFNTTKCNNKIIGARYF----RYTENDPWDENGHGTHTASTAA  116

Query  1795  GNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlsls  1616
             G FV  A +FG+A GTAVG+APLAH++IYK C+  GC+ SD+LAA+D AI+DGVDVLS+S
Sbjct  117   GRFVPGANIFGNANGTAVGVAPLAHVAIYKTCSAIGCSGSDVLAAIDMAIEDGVDVLSIS  176

Query  1615  lgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTI  1436
             LG  +  F+ED IA+GAF+AME+GIFVSC+AGN GP  +++SN+APW+LTVGASTIDR I
Sbjct  177   LGSRARQFYEDIIALGAFSAMERGIFVSCSAGNSGPYIFSISNDAPWILTVGASTIDRKI  236

Query  1435  KATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDED--AALCGPGSLdkvdvkgkvV  1262
             KATAVLGN  + DGESAFQ  +FPPTLLPLIYPG    D  A  C P SL   +V GK+V
Sbjct  237   KATAVLGNNQEFDGESAFQPSDFPPTLLPLIYPGINTSDILAKYCYPTSLSNTNVMGKIV  296

Query  1261  LCDRGGGIAR-VDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKD  1085
             LC    GI R VDKG  VK AGGAAMI++N +    T LA+ HVLP T ++Y DGLK+++
Sbjct  297   LCV--AGITRAVDKGIAVKAAGGAAMIIMNPEYWANTTLAEAHVLPMTHVTYADGLKIQE  354

Query  1084  YINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPV  905
             YINST+ PTATIVFKGT IG    P VA FSSRGPS ASP ILKPDI+GPGVNILAAW +
Sbjct  355   YINSTTTPTATIVFKGTIIGDNRNPVVAGFSSRGPSYASPRILKPDIIGPGVNILAAWHI  414

Query  904   gnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNG  725
                 +     +TFN+ISGTS++ PHLSG+A LLKS HPDWSPAAIKSAI+TTAD  NL  
Sbjct  415   SLENDMRTN-STFNMISGTSVSCPHLSGVAALLKSIHPDWSPAAIKSAIMTTADVINLKS  473

Query  724   TKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQR  545
               I DE  +PADVFATG GHVNPS+A+DPGLIYD++  DYIPYLCGLNYT++++  IVQR
Sbjct  474   NLIEDETYLPADVFATGAGHVNPSKANDPGLIYDIKPSDYIPYLCGLNYTNRQVTVIVQR  533

Query  544   KVECSQVTSIPEAQLNYPSFAIWLGKTS--LTYSRTVTNVGEANSMYTVKVSPFLGVDVG  371
             KV CS++TSI E QLNYPSF+I +   S    YSRTVTNVG+ANS Y V +    G+DV 
Sbjct  534   KVNCSEITSILEGQLNYPSFSIQVRSNSEVQVYSRTVTNVGKANSTYRVDIDSPRGLDVK  593

Query  370   VTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             V P TLVF+EV Q+L+Y ++F+P +TP  I + QG++ W+S+ HIV+SPIA+ F
Sbjct  594   VEPTTLVFSEVKQKLSYQVTFTPFATPSTI-YTQGSLRWISENHIVRSPIAVGF  646



>ref|XP_003611190.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES94148.1| subtilisin-like serine protease [Medicago truncatula]
Length=754

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/718 (58%), Positives = 529/718 (74%), Gaps = 19/718 (3%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGE-RSRIVHSYRHVASGFAAKLSPEM  2165
             TYIVHV+ P+       E    ++ S + ++  E + + RI+ SYR++ +GFA KL+PE 
Sbjct  48    TYIVHVNKPSLQ---SKESLHGWYHSLLPQATTETQNQQRIIFSYRNIVAGFAVKLTPEE  104

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                + + +  +S R +++++L+TTH+P+FLGL QN   W NS+ GKG+I+G+LDTGIT +
Sbjct  105   AKVLEENEEVLSIRPEKIFSLHTTHTPSFLGLQQNQELWGNSNQGKGIIIGMLDTGITLS  164

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVSEGssppppPVDEEGHGTHTA  1808
             HPSF+DE MP PPAKW G CEF G   CN K+IGARN V+          D  GHGTHTA
Sbjct  165   HPSFSDEGMPSPPAKWNGHCEFTGERICNKKIIGARNIVNSSLPY-----DYVGHGTHTA  219

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdv  1628
             STAAG  V  A VFG+A GTA+GMAP AHL+IYKVC   GCAES ILA MD A+DDGVDV
Sbjct  220   STAAGRPVKGANVFGNANGTAIGMAPYAHLAIYKVCGVFGCAESVILAGMDVAVDDGVDV  279

Query  1627  lslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTI  1448
             LSLSLG  S SFFE  IA+GAF+A++KGIFVSC+AGN GP + TL+NEAPW+LTVGASTI
Sbjct  280   LSLSLGQPSTSFFESGIALGAFSAIQKGIFVSCSAGNSGPFHGTLANEAPWILTVGASTI  339

Query  1447  DRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG---SKDEDAALCGPGSLdkvdv  1277
             DR I+A A LG+G +  GES FQ ++F  TLLPL+Y G   + D+  A C P S++ VDV
Sbjct  340   DRKIEAVAKLGDGTEYLGESVFQPKDFASTLLPLVYAGAINTSDDFIAFCNPFSMENVDV  399

Query  1276  kgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGL  1097
             KGKVV+C++ G + RV KGQ VKDAGGAAMILLN + + +  +AD HVLPA  +SY+ GL
Sbjct  400   KGKVVVCEQDGSVERVAKGQAVKDAGGAAMILLNGEDEAFNPIADVHVLPAVHVSYSAGL  459

Query  1096  KVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILA  917
              +KDYINSTS P ATI+FKGT IG   +P VASFSSRGPS  SPGILKPDI+GPG+NILA
Sbjct  460   SIKDYINSTSTPMATILFKGTVIGNPLSPQVASFSSRGPSKTSPGILKPDIIGPGLNILA  519

Query  916   AWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQY  737
              WP+  + +     ++FNII+GTSM+ PHLSGIA LLK++HPDWSPAAIKSAI+TTA+  
Sbjct  520   GWPISLDNST----SSFNIIAGTSMSCPHLSGIAALLKNSHPDWSPAAIKSAIMTTANHV  575

Query  736   NLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQ  557
             NL+G  ILD+RL+PADVFATG GHVNPS+A+DPGL+YD++++DY+PYLCGLNYTD ++  
Sbjct  576   NLHGKPILDQRLLPADVFATGAGHVNPSKANDPGLVYDIETNDYVPYLCGLNYTDIQVGI  635

Query  556   IVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVD  377
             I+Q+KV+CS V SIP+AQLNYPS +I LG TS  YSRT+TNVG  N+ Y V +   + V 
Sbjct  636   ILQQKVKCSDVKSIPQAQLNYPSISIRLGNTSQFYSRTLTNVGPVNTTYNVVIDVPVAVR  695

Query  376   VGVTPDTLVFTEVNQQLTYNISFSPSSTPVDID--FVQGAIAWVSQRHIVKSPIAIIF  209
             + V P  + FTEV Q++TY + F P       D    QG+I W+S ++ V  PIA++F
Sbjct  696   MSVRPSQITFTEVKQKVTYWVDFIPEDKENRGDNFIAQGSIKWISAKYSVSIPIAVVF  753



>gb|EYU39032.1| hypothetical protein MIMGU_mgv1a023804mg, partial [Erythranthe 
guttata]
Length=720

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/721 (60%), Positives = 527/721 (73%), Gaps = 17/721 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             +TYIVHV      +    E+  S++ SF+  S   G R RIV+S+R V  GFAA+LS + 
Sbjct  9     ETYIVHVDV-NLGLFARFEELESWYTSFLRTSNSNG-RGRIVYSFRKVFRGFAARLSADE  66

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             V  M    GFISAR ++ ++++TTHSPNFLGL QN GFW  S+YGKGVI+GVLD GI P+
Sbjct  67    VKAMESNPGFISARPEKKFDVHTTHSPNFLGLNQNMGFWEGSNYGKGVIIGVLDYGIFPS  126

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             HPSF+DE MPPPPAKWKGKC+F  T CNNK+IGAR F S        P+D  GHGTHTAS
Sbjct  127   HPSFSDEGMPPPPAKWKGKCQFNQTTCNNKIIGARYFNS----LDDSPLDNNGHGTHTAS  182

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAG+FV  A +FG+A GTA G+AP+AHL+IYKVC+ D C ESDILAAMD AI+DGVD+L
Sbjct  183   TAAGSFVAGANLFGNANGTATGIAPMAHLAIYKVCS-DSCHESDILAAMDTAIEDGVDIL  241

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
             S+SLGG + +F++D IA+GAF+AME GI VSC+AGN GP   +L NEAPW+LTVGASTID
Sbjct  242   SISLGGLNINFYDDGIALGAFSAMENGILVSCSAGNSGPFNISLENEAPWILTVGASTID  301

Query  1444  RTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS---KDEDAALCGPGSLdkvdvk  1274
             R I+ATA+LGN    DGES FQ  +FP TLLPL+Y GS    D +   C   SL+K D++
Sbjct  302   RKIRATALLGNNETFDGESTFQPLDFPSTLLPLVYAGSLNTSDPNIQYCTATSLNKTDLR  361

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             G +V+C+ G  + R+ KG  VK+AGGAAMIL+N      T  A  HVLPAT +SY DGLK
Sbjct  362   GMIVVCEIGV-VGRLSKGIAVKNAGGAAMILVNSLYSANTTAAQAHVLPATHVSYADGLK  420

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             +K YINST+ P ATI+FKGT IG   AP VASFSSRGP+  SPGILKPDILGPGVNILAA
Sbjct  421   IKTYINSTTTPMATILFKGTIIGDDRAPVVASFSSRGPNYISPGILKPDILGPGVNILAA  480

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             WPV    N     +TFNIISGTSM+ PHLSG+A L+KS HPDWSPAAIKSAI+TTAD  N
Sbjct  481   WPVSVENNANTN-STFNIISGTSMSCPHLSGVAALIKSGHPDWSPAAIKSAIMTTADVVN  539

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             L    I DER VPA++FATG GHVNPSRA+DPGLIYD+  +DY PYLCGLNYT++++  I
Sbjct  540   LALNPIEDERYVPANIFATGSGHVNPSRANDPGLIYDIHPEDYFPYLCGLNYTNRQVGII  599

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWLGKT---SLTYSRTVTNVGEANSMYTVKVSPFLG  383
             +Q+ V+CS    IPEAQLNYPSFAI  G++   + TY+RTVTNVGE  S Y V++ P  G
Sbjct  600   LQKIVDCSVEARIPEAQLNYPSFAITFGRSQPITQTYTRTVTNVGEPVSSYVVEIVPPPG  659

Query  382   VDVGVTPDTLVFTEVNQQLTYNISFSP-SSTPVDIDFVQGAIAWVS-QRHIVKSPIAIIF  209
             + V V P TL FTE N  L Y ++F+   ST  +  ++QG + W S  ++ V++PIA+I 
Sbjct  660   IGVLVEPTTLEFTEANPILQYQVTFTRLDSTTNNAGYIQGYLKWNSGAKYSVRTPIAVIL  719

Query  208   Q  206
             Q
Sbjct  720   Q  720



>ref|XP_003611196.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES94154.1| subtilisin-like serine protease [Medicago truncatula]
Length=748

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/752 (56%), Positives = 533/752 (71%), Gaps = 28/752 (4%)
 Frame = -1

Query  2404  ISVVVCLTLVFHSVASAKYED----------TYIVHVSPPAAAINGVSEDYRSYFRSFVS  2255
             + ++V L  +  S++    E+          TYIVHV       +  SED  S++ SF+ 
Sbjct  6     LRLLVSLIFILCSISMLAAEENLEHDQINLMTYIVHVKKSENVASHQSEDLHSWYHSFLP  65

Query  2254  ESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFL  2075
             ++    ER  +V SYR VASGFA KL+PE    +++K   +SAR +R   L+TTH+P FL
Sbjct  66    QTFPHKER--MVFSYRKVASGFAVKLTPEEAKSLQEKGEIVSARPERTLELHTTHTPTFL  123

Query  2074  GLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEG-TACNN  1898
             GL Q  G W + + GKGVI+G++DTGI P HPSFNDE MPPPPAKWKG CEF G   CNN
Sbjct  124   GLKQGQGLWSDDNLGKGVIIGIIDTGIFPLHPSFNDEGMPPPPAKWKGHCEFTGGQVCNN  183

Query  1897  KLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHL  1718
             KLIGARN V      PP   +   HGTHTA+ AAG F+ +A+VFG+AKG A GMAP AHL
Sbjct  184   KLIGARNLVKSAIQEPP--FENFFHGTHTAAEAAGRFIEDASVFGNAKGVAAGMAPNAHL  241

Query  1717  SIYKVCTED-GCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGI  1541
             +IYKVC +  GC ES ILAAMD AI+DGVDVLSLSLG GS  FFED IAIGAFAA + G+
Sbjct  242   AIYKVCNDKIGCTESAILAAMDIAIEDGVDVLSLSLGLGSLPFFEDPIAIGAFAATQNGV  301

Query  1540  FVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPP  1361
             FVSC+A N GP Y TLSNEAPW+LTVGASTIDR I A+A LGNG + +GE+ FQ ++F  
Sbjct  302   FVSCSAANSGPGYSTLSNEAPWILTVGASTIDRKIVASAKLGNGEEYEGETLFQPKDFSQ  361

Query  1360  TLLPLIYPGS-----KDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGG  1196
              LLPL+YPGS     + ++ +LC PGSL  +D+ GKVVLCD G  ++ + KGQ V ++GG
Sbjct  362   QLLPLVYPGSFGYGNQTQNQSLCLPGSLKNIDLSGKVVLCDVGN-VSSIVKGQEVLNSGG  420

Query  1195  AAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKT  1016
              AMIL N +  G++  A  HVLPA E+SY  GL +K YI ST  PTAT++FKGT IG   
Sbjct  421   IAMILANSEALGFSTFAIAHVLPAVEVSYAAGLTIKSYIKSTYNPTATLIFKGTIIGDSL  480

Query  1015  APSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMAT  836
             APSV  FSSRGPS  SPGILKPDI+GPGVNILAAW V  +         F+I+SGTSM+ 
Sbjct  481   APSVVYFSSRGPSQESPGILKPDIIGPGVNILAAWAVSVDNKI----PAFDIVSGTSMSC  536

Query  835   PHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNP  656
             PHLSGIA L+KS+HPDWSPAAIKSAI+TTA+  NL G  ILD+RL PAD+FATG GHVNP
Sbjct  537   PHLSGIAALIKSSHPDWSPAAIKSAIMTTANTLNLGGIPILDQRLFPADIFATGAGHVNP  596

Query  655   SRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIW  476
              +A+DPGL+YD++ +DY+PYLCGL Y+D+EI+ IVQ KV+CS V SIPEAQLNYPSF+I 
Sbjct  597   VKANDPGLVYDIEPEDYVPYLCGLGYSDKEIEVIVQWKVKCSNVKSIPEAQLNYPSFSIL  656

Query  475   LGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPS-  299
             LG  S  Y+RT+TNVG ANS Y V++   L + + V P  + FTEVN+++++++ F P  
Sbjct  657   LGSDSQYYTRTLTNVGFANSTYKVELEVPLALGMSVNPSEITFTEVNEKVSFSVEFIPQI  716

Query  298   -STPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
                  +  F QG++ WVS RH V+ PI++IF+
Sbjct  717   KENRRNHTFGQGSLTWVSDRHAVRIPISVIFK  748



>ref|XP_002509665.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51052.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=743

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/730 (58%), Positives = 535/730 (73%), Gaps = 16/730 (2%)
 Frame = -1

Query  2377  VFHSVASAKYED----TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSY  2210
             V+ S  +   ED    TYIV +  P       S+D  S+++SF+ ++     + R++HSY
Sbjct  24    VYSSTVANVKEDRNLQTYIVLLEKPEGNQFTESKDLDSWYQSFLPDNSFSSNQPRLLHSY  83

Query  2209  RHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYG  2030
             RHV +GFAAKL+ + V  M KKKGF+SAR +R+  L+TTH+P+FLGL QN GFW  S+YG
Sbjct  84    RHVVTGFAAKLTADEVQAMNKKKGFVSARPRRMVPLHTTHTPSFLGLQQNLGFWNYSNYG  143

Query  2029  KGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGsspp  1850
             KGV++G++D+GIT +HPSF+ E +PPPPAKWKGKC+  GT CNNKLIG RNF ++     
Sbjct  144   KGVVIGLIDSGITADHPSFSGEGLPPPPAKWKGKCD-NGTLCNNKLIGVRNFATD----S  198

Query  1849  ppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCA-ESd  1673
                +DE  HGTHTASTAAG+ V NA  FG A GTA+GMAPLAHL++YKV    G A +S+
Sbjct  199   NNTLDEYMHGTHTASTAAGSPVQNANYFGQANGTAIGMAPLAHLAMYKVSGRFGKAGDSE  258

Query  1672  ilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTL  1493
             ILAAMDAAI+DGVDVLSLSLG GS  F++D IA+GA+AA++KGIFVSC+AGN GPD  +L
Sbjct  259   ILAAMDAAIEDGVDVLSLSLGIGSHPFYDDVIALGAYAAIQKGIFVSCSAGNSGPDSSSL  318

Query  1492  SNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG-SKDEDA  1316
             SNEAPW+LTVGAS++DR I+AT +LGN  +L+GES FQ  + P TLLPL+Y G S    +
Sbjct  319   SNEAPWILTVGASSVDRAIRATVLLGNNTELNGESLFQPNDSPSTLLPLVYAGASGTGSS  378

Query  1315  ALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTH  1136
             A C PGSL   DVKGK+VLC+RGG    V KGQ VKD GG AMI++N + DG+   A+ H
Sbjct  379   AYCEPGSLSNFDVKGKIVLCERGGSYETVLKGQEVKDNGGFAMIVMNDEFDGFVTEAEFH  438

Query  1135  VLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGIL  956
             VLPA+ +SY  GL +K YINSTS P ATIVFKGT +G   AP VA FSSRGPS ASPGIL
Sbjct  439   VLPASHVSYMAGLAIKTYINSTSTPKATIVFKGTVLGLPEAPQVADFSSRGPSVASPGIL  498

Query  955   KPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPA  776
             KPDI+GPGV ILAAWPV  +         F++ISGTSM+ PHLSGI  LL+SAHPDWSPA
Sbjct  499   KPDIIGPGVRILAAWPVSVDNTTN----RFDMISGTSMSCPHLSGIGALLRSAHPDWSPA  554

Query  775   AIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPY  596
             AIKSAI+TTA+  NL G  I D+  V + VF  G GHVN S A+DPGLIYD+Q DDYIPY
Sbjct  555   AIKSAIMTTANMVNLGGKLISDQEFVLSTVFDIGAGHVNASGANDPGLIYDIQPDDYIPY  614

Query  595   LCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANS  416
             LCGL Y+D+++  IVQR V+CS  +SIPEAQLNYPSF+I LG T  TY+RTVTNVG+ +S
Sbjct  615   LCGLGYSDKQVGLIVQRAVKCSNDSSIPEAQLNYPSFSINLGPTPQTYTRTVTNVGKPDS  674

Query  415   MYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHI  236
              Y ++ S  LGVD+ VTP  L+F+ VNQ+ TY+++FS +       FV G + WV+  + 
Sbjct  675   TYFIEYSAPLGVDIEVTPAELIFSRVNQKATYSVTFSKNGNAGGT-FVDGYLKWVANGYN  733

Query  235   VKSPIAIIFQ  206
             V+S IA+ F+
Sbjct  734   VRSVIAVTFE  743



>ref|XP_011081168.1| PREDICTED: subtilisin-like protease SDD1, partial [Sesamum indicum]
Length=740

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/741 (57%), Positives = 546/741 (74%), Gaps = 15/741 (2%)
 Frame = -1

Query  2416  NMAYISVVVCLTLVFHSVASAKYE---DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESG  2246
             ++A++++++ L     S+A A  E   +TYIVHV      +   SE+  S++ SF++ S 
Sbjct  7     SLAFLALLISL---HSSLAFANEESDLETYIVHVEASDGKVFENSEELESWYHSFLTTST  63

Query  2245  DEGERS-RIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGL  2069
                +RS R+V++Y++V  GFAA+LSP+ V  +++ +GF+ AR QR   L+ THSP+FLGL
Sbjct  64    SSSDRSPRMVYTYKNVIKGFAARLSPDEVELIQEYEGFVHARPQRKLPLHMTHSPDFLGL  123

Query  2068  YQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLI  1889
             +QNFGFW++S+YGKGV++GV+DTG+ P+HPSF+DE MPPPPAKWKGKCEF  TACNNKLI
Sbjct  124   HQNFGFWKDSNYGKGVVIGVIDTGVFPSHPSFSDEGMPPPPAKWKGKCEFNFTACNNKLI  183

Query  1888  GARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIY  1709
             GAR F          P+DE+GHGT TAS AAGNFV  A  FG A GTAVG+APLAHL++Y
Sbjct  184   GARYFT----FGNGTPLDEDGHGTSTASAAAGNFVPGANFFGQANGTAVGVAPLAHLAVY  239

Query  1708  KVCT-EDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVS  1532
             KVC+    C+ESD+LAAMD AI+DGVDVLSLSLG  S SF  DSIA+GA++A++KGIFVS
Sbjct  240   KVCSGSRRCSESDVLAAMDVAIEDGVDVLSLSLGRPSTSFTFDSIALGAYSAVQKGIFVS  299

Query  1531  CAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLL  1352
             C+A N GP+Y TLSNEAPW+LTVGASTIDR +KAT +LGN  +++GE+  Q  NF  TLL
Sbjct  300   CSATNRGPEYGTLSNEAPWILTVGASTIDRKLKATVILGNKEEIEGEAIIQPNNFSQTLL  359

Query  1351  PLIYPG--SKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILL  1178
             PL++PG  + + +A  C  GSL  ++VKGKVV+C+    I+  +  + V++AGG+A+I +
Sbjct  360   PLVFPGKSTTNPNARFCTSGSLTSINVKGKVVVCELDVAISLSETVKEVEEAGGSAIIFM  419

Query  1177  NQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVAS  998
             NQ+  G T +    +LP  ++ + DGL++K YINSTS P AT+ FKGT IG   AP+VAS
Sbjct  420   NQESAGVTKMLVPILLPTAQVGFADGLRIKRYINSTSKPMATLSFKGTVIGDDHAPTVAS  479

Query  997   FSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGI  818
             FSSRGPS  SPGILKPDI+GPGVNIL AWPV   ++       F I SGTS + PHLSG+
Sbjct  480   FSSRGPSLQSPGILKPDIIGPGVNILVAWPVSVESSKNTKLG-FLIGSGTSASCPHLSGV  538

Query  817   ATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDP  638
             A LLKSAHPDWSPAAIKSAI+TTAD  NL    I D+ L PADVFATG GHVNPSRA+DP
Sbjct  539   AALLKSAHPDWSPAAIKSAIMTTADVVNLAHNPIEDQNLQPADVFATGAGHVNPSRANDP  598

Query  637   GLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSL  458
             GL+YD+Q +DYIPYLCGL YTD+E+  I Q+KV CS+++ IPE+QLNYPSF++  G    
Sbjct  599   GLVYDIQPNDYIPYLCGLEYTDREVGIITQQKVNCSKISWIPESQLNYPSFSVLFGSRVQ  658

Query  457   TYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDID  278
             TY+RTVTNVGEANS Y V++SP  GV V V P+ L F E  Q+ TY ++FS   +  + +
Sbjct  659   TYTRTVTNVGEANSSYVVEISPPPGVHVAVKPEKLEFMEQKQKATYEVTFSRLPSAGNSN  718

Query  277   FVQGAIAWVSQRHIVKSPIAI  215
             F QG + W S++  V+SPI+I
Sbjct  719   FSQGFLMWTSEKCFVRSPISI  739



>ref|XP_002509661.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51048.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=745

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/716 (58%), Positives = 531/716 (74%), Gaps = 14/716 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             +TYI+ +          S+D RS+++SF+  +    E SR+VHSYRHV +GFAAKL+ E 
Sbjct  41    ETYIILLEKSEGREFKESKDLRSWYQSFLPANTSSSELSRLVHSYRHVVTGFAAKLTAEE  100

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                M  ++GF+ AR QR+  L+TTH+P+FLGL QN GFW++S++GKGVI+GV+D+GITP+
Sbjct  101   AKAMEMREGFVLARPQRMVPLHTTHTPSFLGLQQNLGFWKHSNFGKGVIIGVVDSGITPD  160

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppPVDEEGHGTHTA  1808
             HPSF+ E MPPPP KW GKCE +GT +CNNKLIGARNF +          DE  HGTHTA
Sbjct  161   HPSFSGEGMPPPPEKWTGKCELKGTLSCNNKLIGARNFATN----SNDLFDEVAHGTHTA  216

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTE-DGCAESdilaamdaaiddgvd  1631
             STAAG+ V  A+ FG A GTA+GMAPLAHL++YKV        ES+ILAAMDAAI++GVD
Sbjct  217   STAAGSPVQGASYFGQANGTAIGMAPLAHLAMYKVSGRGRKVGESEILAAMDAAIEEGVD  276

Query  1630  vlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAST  1451
             +LSLSLG G+  F++D +A+GA+AA++KGIFVSC+AGN GPD  +LSNEAPW+LTVGAST
Sbjct  277   ILSLSLGIGTHPFYDDVVALGAYAAIQKGIFVSCSAGNSGPDNSSLSNEAPWILTVGAST  336

Query  1450  IDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvk  1274
             +DR I+AT +LGN A+L+GES FQ + FP TLLPL+Y G+  +  +A C  G+L  VDVK
Sbjct  337   VDRAIRATVLLGNKAELNGESLFQPKYFPSTLLPLVYAGANGNALSASCDDGTLRNVDVK  396

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             GK+VLC+  GG   + KGQ VK+ GGAAMI++N + +G++  A  HVLPA+ ++Y  G  
Sbjct  397   GKIVLCE--GGSGTISKGQEVKENGGAAMIVMNYENEGFSTEASLHVLPASHVNYEAGSA  454

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             +K YINSTS P ATI+FKGT +G   AP VA FSSRGPS ASPGILKPDI+GPGV ILAA
Sbjct  455   IKAYINSTSSPKATILFKGTVVGLTDAPQVAYFSSRGPSMASPGILKPDIIGPGVRILAA  514

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             WPV  +         FN+ISGTSM+ PHLSGIA LLKSAHPDWSPAAIKSAI+TTA+  N
Sbjct  515   WPVSVDNTTN----RFNMISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTTANLDN  570

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             L G  I DE  VP+ VF  G GHVNPSRA+DPGLIYD+Q DDYIPYLCGL Y+D+ ++ I
Sbjct  571   LGGKPISDEDFVPSTVFDMGAGHVNPSRANDPGLIYDIQPDDYIPYLCGLGYSDKHVRVI  630

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDV  374
             VQRKV+C+ VTSIPEAQLNYPSF+I LG    TY+RTVTN G+ NS Y  ++    GVD+
Sbjct  631   VQRKVKCTNVTSIPEAQLNYPSFSIILGSKPQTYTRTVTNFGQPNSAYDFEIFAPKGVDI  690

Query  373   GVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
              VTP  + F+ + Q+ TY+++FS +    +  F QG + W++  + V SPIAIIF+
Sbjct  691   LVTPHRISFSGLKQKATYSVTFSRNGK-ANGSFAQGYLKWMADGYKVNSPIAIIFE  745



>ref|XP_003538510.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=748

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/720 (58%), Positives = 533/720 (74%), Gaps = 16/720 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
              TYIVHV  P       SE+  +++ SF+ ++     ++R+V SYR+VASGFA KL+PE 
Sbjct  38    QTYIVHVKKPETISFLQSEELHNWYYSFLPQTT---HKNRMVFSYRNVASGFAVKLTPEE  94

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                +++K   +SAR +R  +L+TTH+P+FLGL Q  G W +S+ G+GVI+GV+DTGI P 
Sbjct  95    AKVLQEKDEIVSARPERTLSLHTTHTPSFLGLRQGVGLWNSSNLGEGVIIGVIDTGIYPF  154

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppPVDEEGHGTHTA  1808
             HPSFNDE +PPPPAKW G CEF G   CNNKLIGARN +      PP   +   HGTHTA
Sbjct  155   HPSFNDEGIPPPPAKWNGHCEFTGQRTCNNKLIGARNLLKNAIEEPP--FENFFHGTHTA  212

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTED-GCAESdilaamdaaiddgvd  1631
             + AAG FV NA+VFG A+GTA G+AP +H+++YKVC ++ GC ES ILAAMD AIDDGVD
Sbjct  213   AEAAGRFVENASVFGMAQGTASGIAPNSHVAMYKVCNDEVGCTESAILAAMDIAIDDGVD  272

Query  1630  vlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAST  1451
             VLSLSLG GS  FFED IAIGAF A++ G+FVSC+A N GPDY TLSNEAPW+LTVGAST
Sbjct  273   VLSLSLGLGSLPFFEDPIAIGAFVAIQSGVFVSCSAANSGPDYSTLSNEAPWILTVGAST  332

Query  1450  IDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvk  1274
             IDR I A+AVLGNGA+ +GES FQ ++F P+LLPL+Y G+  + ++  C PGSL+ VDVK
Sbjct  333   IDRKIAASAVLGNGAEYEGESLFQPQDFSPSLLPLVYSGANGNNNSEFCLPGSLNNVDVK  392

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             GKVV+CD GGG   V KGQ V  AGGAAMIL N +  G++  A  +VLP  E+SY  GL 
Sbjct  393   GKVVVCDIGGGFPSVGKGQEVLKAGGAAMILANPEPLGFSTFAVAYVLPTVEVSYFAGLA  452

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             +K YINS+  PTATI FKGT IG + AP+V SFSSRGPS ASPGILKPDI+GPGVNILAA
Sbjct  453   IKSYINSSYSPTATISFKGTVIGDELAPTVVSFSSRGPSQASPGILKPDIIGPGVNILAA  512

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             W V  +         +N++SGTSM+ PHLSG+A LLKSAHPDWSPAAIKSAI+TTA   N
Sbjct  513   WAVSVDNKI----PAYNVVSGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIMTTAYTVN  568

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             L GT I+D+R +PAD+FATG GHVNP++A+DPGL+YD+Q +DY+PYLCGL Y D+EI+ +
Sbjct  569   LGGTPIVDQRNLPADIFATGAGHVNPNKANDPGLVYDIQPEDYVPYLCGLGYEDREIEIL  628

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDV  374
             VQR+V CS   +IPEAQLNYPSF+I +G +S  Y+RT+TNVG A S YTV++   L + +
Sbjct  629   VQRRVRCSGGKAIPEAQLNYPSFSILMGSSSQYYTRTLTNVGPAQSTYTVQLDVPLALGI  688

Query  373   GVTPDTLVFTEVNQQLTYNISFSPS--STPVDIDFVQGAIAW--VSQRHIVKSPIAIIFQ  206
              V P  + FTEVNQ++T+++ F P       +  F QG++ W  VS +H V+ PI++IF+
Sbjct  689   SVNPSQITFTEVNQKVTFSVEFIPEIKENRGNHTFAQGSLTWVRVSDKHAVRIPISVIFK  748



>ref|XP_008804041.1| PREDICTED: subtilisin-like protease SDD1 [Phoenix dactylifera]
Length=761

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/728 (56%), Positives = 533/728 (73%), Gaps = 15/728 (2%)
 Frame = -1

Query  2362  ASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAA  2183
             A A    TY+VHV PP + +   S D   +++SF+ E+      +R+VH Y +VASGFAA
Sbjct  37    AEASELQTYVVHVQPPLSTVFATSTDREMWYKSFLPET-----PARMVHMYTNVASGFAA  91

Query  2182  KLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLD  2003
             +L+ + + +++KK GF+ A   R+Y+L TTH+P FLGL  N G W++++YG+GVIVGVLD
Sbjct  92    RLTEQELEDIKKKPGFVHAYPDRLYSLQTTHTPEFLGLQLNRGVWKDANYGEGVIVGVLD  151

Query  2002  TGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppP------  1841
             TGI P+HPSF+ + +PPPPAKWKG+C+F  + CNNKLIGAR+F+S   +           
Sbjct  152   TGIFPDHPSFSGDGVPPPPAKWKGRCDFNASLCNNKLIGARSFISGAMAMKGRGTAATPP  211

Query  1840  VDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaa  1661
             VD+EGHGTHTASTAAG  V  A V G+AKGTA GMAPLAHL+IYKVC EDGCA+SDILAA
Sbjct  212   VDDEGHGTHTASTAAGARVAGANVLGNAKGTASGMAPLAHLAIYKVCAEDGCADSDILAA  271

Query  1660  mdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEA  1481
             MDAA+ DG DVLSLSLGG S  F+ D IAIGAF A++ G+FVSCAAGN GP+  +LSNEA
Sbjct  272   MDAAVGDGADVLSLSLGGDSVPFYIDGIAIGAFGAIKNGVFVSCAAGNSGPNASSLSNEA  331

Query  1480  PWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDE-DAALCG  1304
             PW+LTV AST+DR I+ T  LGNG + +GES +Q + + PT  PL+Y G+  + DAA CG
Sbjct  332   PWILTVAASTMDRNIRVTVKLGNGQEFNGESLYQPQMYTPTFYPLVYAGAGPKPDAAFCG  391

Query  1303  PGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPA  1124
              GSLD +DVKGK+VLC RGG +AR+ KG TV+ AGG  ++L N  +DGY+ LAD HVLPA
Sbjct  392   NGSLDGLDVKGKIVLCQRGGDVARIAKGITVQSAGGVGLVLTNGPLDGYSTLADAHVLPA  451

Query  1123  TELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDI  944
             + + Y+DG+K+K YI ++S PTA+ +FKGT +G   AP++ SFSSRGPS ASPGILKPDI
Sbjct  452   SYVGYSDGVKIKSYIAASSNPTASFIFKGTVLGVSPAPAITSFSSRGPSLASPGILKPDI  511

Query  943   LGPGVNILAAWPVgnntnngngNA-TFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIK  767
              GPGV++LAAWP             TFNIISGTSM+TPHLSGIA L+K+AHPDWSPAAIK
Sbjct  512   TGPGVSVLAAWPFQVGPPTFISTGPTFNIISGTSMSTPHLSGIAALVKAAHPDWSPAAIK  571

Query  766   SAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCG  587
             SAI+TTAD  + +G  I++E+ +PA++FA G GHVNP +A DPGL+YDL + DYIPYLCG
Sbjct  572   SAIMTTADILDHSGKPIVNEQHLPANLFALGAGHVNPVKADDPGLVYDLSAGDYIPYLCG  631

Query  586   LNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGK--TSLTYSRTVTNVGEANSM  413
             L YT  ++  I ++ V C  + +I EA+LNYPS ++ LG   TS+T  RTV NVGEA S 
Sbjct  632   LGYTSSQVTTIARQHVNCLLIKNITEAELNYPSISVSLGAATTSITVERTVKNVGEAMSE  691

Query  412   YTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIV  233
             Y+  V    GV V V+P  L F+EVNQ++ + ++FS S +   + F QG + WVS++ +V
Sbjct  692   YSADVDAPYGVAVSVSPAKLQFSEVNQEMKFYVTFSASRSGGGVRFSQGYLNWVSEKRMV  751

Query  232   KSPIAIIF  209
             +SPI++ F
Sbjct  752   RSPISVTF  759



>ref|XP_004515784.1| PREDICTED: subtilisin-like protease SDD1-like [Cicer arietinum]
Length=753

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/719 (58%), Positives = 531/719 (74%), Gaps = 11/719 (2%)
 Frame = -1

Query  2338  YIVHVSPPAAAINGVSEDYRSYFRSFVSES--GDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             YI+HV+ P   +   SED  S+  SF+  +    + ++ R+++SYR+V SGFAA+L+ E 
Sbjct  36    YIIHVNEPEGKMFSQSEDLESWHHSFMPPTVMTSKEQQPRMIYSYRNVLSGFAARLTQEE  95

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             +  +++K GFISA  +R+    TTH+P+FLGL Q+ G W++S++GKGVI+GVLD+GITP+
Sbjct  96    LRAVQQKNGFISAHPERMLRRQTTHTPDFLGLQQDIGLWKDSNFGKGVIIGVLDSGITPD  155

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppP----VDEEGHGT  1817
             HPSF+D  + PPP KWKG+CE  GTACNNKLIGAR+F +   +         +DE+GHGT
Sbjct  156   HPSFSDAGILPPPLKWKGRCELNGTACNNKLIGARSFNNAAKARKGEKGEAPIDEDGHGT  215

Query  1816  HTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddg  1637
             HTASTAAG FV  A V G+AKGTA GMAP AHL+IYKVC  + C ESDILAA+DAA++DG
Sbjct  216   HTASTAAGAFVDKAQVLGNAKGTAAGMAPHAHLAIYKVCFGEDCPESDILAALDAAVEDG  275

Query  1636  vdvlslslgggSAS-FFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVG  1460
             VDV+S+SLG      FF DS AIGAFAA++KGIFVSCAAGN GP   +L N APW+LTVG
Sbjct  276   VDVISISLGLSQPPPFFNDSTAIGAFAAIQKGIFVSCAAGNFGPFDGSLVNGAPWILTVG  335

Query  1459  ASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAA-LCGPGSLdkv  1283
             ASTIDR+I ATA LGN  + +GES FQ  NF PTLLPL Y G   + A+  C  GSL  +
Sbjct  336   ASTIDRSIVATARLGNAEEFNGESVFQPSNFSPTLLPLAYAGKNGKQASTFCANGSLSDI  395

Query  1282  dvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYND  1103
             D +GKVVLC+RGGGI R+ KG+ VK AGGAAMIL N  I+G+++ AD HVLPAT +SY  
Sbjct  396   DFRGKVVLCERGGGIGRIAKGEEVKRAGGAAMILTNDKINGFSLSADVHVLPATHVSYAA  455

Query  1102  GLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNI  923
             GLK+K YINST+ PTA I FKGT IG   +P+VASFSSRGP+  SPGILKPDI+GPGVNI
Sbjct  456   GLKIKAYINSTATPTANISFKGTIIGNSLSPAVASFSSRGPNLPSPGILKPDIIGPGVNI  515

Query  922   LAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTAD  743
             LAAWP   N N  +     NI+SGTSM+ PHLSGIA LLKS+HP WSPAAIKSAI+T+AD
Sbjct  516   LAAWPFPLNNNTNSNLNF-NIMSGTSMSCPHLSGIAALLKSSHPHWSPAAIKSAIMTSAD  574

Query  742   QYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEI  563
               NL    I+DE+L PA++ ATG GHVNPS+A+DPGL+YD+Q DDYIPYLCGL Y+D E+
Sbjct  575   TLNLRNKPIVDEKLQPANLLATGSGHVNPSKANDPGLVYDIQPDDYIPYLCGLGYSDVEV  634

Query  562   QQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLG  383
               I  + ++CS+ +SI E +LNYPSF++ LG +S T++RTVTNVGEA+S Y V VS   G
Sbjct  635   GIIAHKTIKCSETSSIAEGELNYPSFSVVLG-SSQTFTRTVTNVGEAHSTYGVTVSAPKG  693

Query  382   VDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDI-DFVQGAIAWVSQRHIVKSPIAIIF  209
             VDV V P  L+F++ NQ+ TY+++F+         ++ QG + W S +H V+SPI + F
Sbjct  694   VDVKVQPKKLIFSKANQKETYSVTFNRIGLGNKTEEYAQGFLKWASAKHSVRSPILVKF  752



>ref|XP_002509658.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51045.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=738

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/716 (58%), Positives = 529/716 (74%), Gaps = 14/716 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             +TYI+ +  P  A      D   ++ SF+  +    E+SR+VHSYRHV +GFAAKL+ E 
Sbjct  34    ETYIILLEKPQGADFMEFNDLHGWYLSFLPANTFSSEQSRLVHSYRHVVTGFAAKLTAEE  93

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                M  ++GF+ AR QR+  L+TTH+P+FLGL QN GFW++S++GKGVI+GV+D+GITP+
Sbjct  94    AKAMEMREGFVLARPQRMVPLHTTHTPSFLGLQQNLGFWKHSNFGKGVIIGVVDSGITPD  153

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppPVDEEGHGTHTA  1808
             HPSF+ E MPPPPAKW GKCE +GT +CNNKLIGARNF +          D+  HGTHTA
Sbjct  154   HPSFSGEGMPPPPAKWTGKCELKGTLSCNNKLIGARNFATN----SNDLFDKVAHGTHTA  209

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCA-ESdilaamdaaiddgvd  1631
             STAAG+ V  A+ FG A GTA+GMAPLAHL++YKV      A ES+ILAAMDAAI++GVD
Sbjct  210   STAAGSPVQGASYFGQANGTAIGMAPLAHLAMYKVSGRARKAGESEILAAMDAAIEEGVD  269

Query  1630  vlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAST  1451
             +LSLSLG G+  F++D IA+GA+AA++K IFVSC+AGN GP   +LSNEAPW+LTVGAST
Sbjct  270   ILSLSLGIGTHPFYDDVIALGAYAAIQKRIFVSCSAGNSGPYSCSLSNEAPWILTVGAST  329

Query  1450  IDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvk  1274
             +DR I+AT +LGN  +L+GES FQ ++FP TLLPL+Y G+  +  +A C  GSL  VDVK
Sbjct  330   VDRAIRATVLLGNKVELNGESLFQPKDFPSTLLPLVYAGANGNASSASCDHGSLKNVDVK  389

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             GK+VLC+  GGI  + KGQ VKD GGAAMI++N D++G+      HVLPA+ +SY  G  
Sbjct  390   GKIVLCE--GGIETISKGQEVKDNGGAAMIVMNDDLEGFITAPRLHVLPASHVSYEAGSS  447

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             +K YINS S P ATI+FKGT +G   AP VA FSSRGPS ASPGILKPDI+GPGV ILAA
Sbjct  448   IKAYINSASSPKATILFKGTVVGLSDAPQVAYFSSRGPSCASPGILKPDIIGPGVRILAA  507

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             WPV  +  +      FN+ISGTSM+ PHL+GIA LLKSAHPDWSPAAIKSAI+TTA   N
Sbjct  508   WPVSVDNTSN----RFNMISGTSMSCPHLTGIAALLKSAHPDWSPAAIKSAIMTTASLDN  563

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             L G  I D+  VPA VF  G GHVNPSRA+DPGL+YD+Q DDYIPYLCGL Y+D+ ++ I
Sbjct  564   LGGKPISDQDYVPATVFDMGAGHVNPSRANDPGLVYDIQPDDYIPYLCGLGYSDKHVRVI  623

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDV  374
             VQRKV+C+ V +IPEAQLNYPSF+I LG +  TY+RTVTN G+ NS Y +++    GVDV
Sbjct  624   VQRKVKCTNVATIPEAQLNYPSFSIKLGSSPQTYTRTVTNFGQPNSAYYLEIFAPKGVDV  683

Query  373   GVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
              VTP  + F  VNQ+ TY+ +FS +     + F QG + WV++ + V SPIA+IF+
Sbjct  684   MVTPQKITFNGVNQKATYSATFSKNGNANGL-FAQGYLKWVAEGYSVGSPIAVIFE  738



>ref|XP_004147599.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN50169.1| hypothetical protein Csa_5G157280 [Cucumis sativus]
Length=734

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/725 (59%), Positives = 538/725 (74%), Gaps = 22/725 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSES--GDEGERSRIVHSYRHVASGFAAKLSP  2171
              TYIVHV  P   I G + D ++++ SF+ E+      E+SR+++SYRHV SGF+A+L+ 
Sbjct  14    QTYIVHVKQPEVEILGDTIDLQNWYTSFLPETIEASSNEQSRLLYSYRHVISGFSARLTK  73

Query  2170  EMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGIT  1991
             E V  M +K GFISA  +   NL+TTH+P +LGL Q+FG W+NS++GKGVI+GVLDTGI 
Sbjct  74    EQVKTMEEKDGFISAMPETTLNLHTTHTPEYLGLNQHFGLWKNSNFGKGVIIGVLDTGIH  133

Query  1990  PNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNF-VSEGssppppPVDEEGHGTH  1814
             PNHPSFNDE MP PPAKWKG+CEF  + CNNKLIGAR F ++   S    P DE GHGTH
Sbjct  134   PNHPSFNDEGMPSPPAKWKGRCEFGASICNNKLIGARTFNLANNVSIGKSPNDENGHGTH  193

Query  1813  TASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgv  1634
             TASTAAG FV  A   G+A+G AVGMAPLAH+++YKVC+  GC+ SDILAA+DAAIDDGV
Sbjct  194   TASTAAGTFVKGAEALGNARGKAVGMAPLAHIAVYKVCSPKGCSSSDILAALDAAIDDGV  253

Query  1633  dvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAS  1454
             DVLSLSLG  S  FF+D+IA+GAFAA++KGIFVSC+AGN GP   TL+NEAPW+LTVGAS
Sbjct  254   DVLSLSLGAPSTPFFKDTIAVGAFAAIKKGIFVSCSAGNSGPSKNTLANEAPWILTVGAS  313

Query  1453  TIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG-SKDEDAALCGPGSLdkvdv  1277
             TIDR I A A L +G    GES FQ  +F    LPL+Y G S  E +  C  GSL+K++V
Sbjct  314   TIDRKIVALAKLESGKVFTGESLFQPRDFSSKFLPLVYAGKSGIEGSEYCVEGSLEKLNV  373

Query  1276  kgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGL  1097
              GK+V+C+RGGGI R+ KG  VK+ GGAAMIL+NQ  DG++ LA+ HVLP T LSY DGL
Sbjct  374   TGKIVVCERGGGIGRIAKGLVVKNGGGAAMILVNQKPDGFSTLAEAHVLPTTHLSYEDGL  433

Query  1096  KVKDYINSTSWPTATIVFKGTFIGTKT---APSVASFSSRGPSNASPGILKPDILGPGVN  926
             K+K+YINS+  P A+I F+GT +G +    +P++ASFSSRGP  ASPGILKPDI GPGVN
Sbjct  434   KIKEYINSSHNPKASISFEGTLLGNRATTFSPAMASFSSRGPCQASPGILKPDITGPGVN  493

Query  925   ILAAWPV-gnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITT  749
             ILAAWP   NN  N N  +TFN+ISGTSM+ PHLSGIA L+KS HP+WSPAAIKSAI+T+
Sbjct  494   ILAAWPFPLNNNTNTNTKSTFNVISGTSMSCPHLSGIAALIKSNHPNWSPAAIKSAIMTS  553

Query  748   ADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQ  569
             AD  N  G  I+D+ L PA+ FA G GHVNPS+A++PGL+YD+Q DDY+PYLC L YTD 
Sbjct  554   ADVRNPQGKPIVDQDLKPANFFAMGSGHVNPSKAANPGLVYDIQPDDYVPYLCHL-YTDA  612

Query  568   EIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPF  389
             ++  IV+R+V CS V+ I E  LNYPSFA+ LG  S  ++RTVTNVG+ANS+Y   V   
Sbjct  613   QVSIIVRRQVTCSTVSRIREGDLNYPSFAVSLGADSQAFNRTVTNVGDANSVYYAIVKAP  672

Query  388   LGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFV-------QGAIAWVSQRHIVK  230
              GV V VTP  L F+++N++LTY+++FS       IDFV       +G + WVS +HIV+
Sbjct  673   AGVSVRVTPRNLKFSKLNEKLTYSVTFS------RIDFVRTRSEFSEGYLIWVSNKHIVR  726

Query  229   SPIAI  215
             SPI++
Sbjct  727   SPISV  731



>ref|XP_006358407.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=743

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/744 (56%), Positives = 536/744 (72%), Gaps = 14/744 (2%)
 Frame = -1

Query  2413  MAYISVVVCLTLVFHSVASAKYEDTYIVHVSPPAAAINGVSE--DYRSYFRSFVS---ES  2249
             M    V+  +   F   +     +TYIV V  P + I+  S   D  S+++SF+    E+
Sbjct  1     MKIFFVIFAILACFSCPSMQSDLETYIVQVESPESQISTQSSRMDLESWYKSFLPKTIET  60

Query  2248  GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGL  2069
              D  E+ R+++SY +V  GFAA+LS + V EM KK GFISA  QR+ +L+TTH+P+FL L
Sbjct  61    ADSEEKPRLIYSYHNVIIGFAARLSAKQVKEMEKKPGFISAWPQRILSLHTTHTPSFLQL  120

Query  2068  YQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTA-CNNKL  1892
              QN G WR+  YGKGVI+GVLDTG+TP+HPSF+DE MPPPPAKWKGKC+   TA CNNKL
Sbjct  121   QQNVGLWRDDKYGKGVIIGVLDTGVTPDHPSFSDEGMPPPPAKWKGKCDSNFTAKCNNKL  180

Query  1891  IGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSI  1712
             IGAR+++ +       P+D++GHGTHT+STAAGNFV  A V+G+AKGTAVG+APLAHL+I
Sbjct  181   IGARSYIDD----KHSPIDDDGHGTHTSSTAAGNFVKGANVYGNAKGTAVGIAPLAHLAI  236

Query  1711  YKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVS  1532
             YKVC E GCA++DILA MD AIDDGVD+LSLSLGG S SF++D IA+GA++A ++GI VS
Sbjct  237   YKVCQEFGCADADILAGMDEAIDDGVDILSLSLGGPSRSFYDDPIALGAYSAAKRGILVS  296

Query  1531  CAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLL  1352
             C+A N+GP    +SNEAPW+LTVGASTIDR +KAT +LGN     GESAF  +       
Sbjct  297   CSASNDGPSNGIISNEAPWILTVGASTIDRELKATVMLGNQKLFVGESAFSPKVPILDFF  356

Query  1351  PLIYPGSKDED--AALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILL  1178
             PLI P     +  +  C PG+L+   +KGK+V+C  G     V+KGQ VKDAGG  MIL+
Sbjct  357   PLIDPSLSKLNFYSPYCEPGTLNDPKIKGKIVVCKLGNA-GNVEKGQAVKDAGGVGMILV  415

Query  1177  NQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVAS  998
             +    G+T LAD HVLPA  +++NDG ++  Y+NSTS PTA I+F GT IG K AP VA+
Sbjct  416   SIPELGFTKLADPHVLPALFITFNDGTEILQYMNSTSEPTARILFHGTIIGDKEAPVVAA  475

Query  997   FSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGI  818
             +SSRGPS A+PGILKPDI+GPG NILAAWP   +       +TFNII GTSM+ PHLSG+
Sbjct  476   YSSRGPSKATPGILKPDIIGPGNNILAAWPTSVDYVKHTK-STFNIIQGTSMSCPHLSGV  534

Query  817   ATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDP  638
             A LLKS HP WSP+AIKSAI+TTA+  NL    ILDERL+PAD+FA G GHVNPSRA+DP
Sbjct  535   AALLKSTHPTWSPSAIKSAIMTTANTLNLANVPILDERLLPADIFAIGAGHVNPSRANDP  594

Query  637   GLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSL  458
             GLIYD   DDY+PYLCGLNYT+Q++  IV+ KV+C +V  IPEAQLNYPSF+I  G++S 
Sbjct  595   GLIYDTPFDDYLPYLCGLNYTNQQVGSIVKHKVDCKKVKHIPEAQLNYPSFSIEFGESSQ  654

Query  457   TYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDID  278
             TY+RTVTNVGEA S YTV++    GV V V P TL F+++NQ+L Y + F+      +  
Sbjct  655   TYTRTVTNVGEAKSSYTVEIDSPPGVTVIVKPSTLKFSQLNQKLKYQVMFTRRDNSTNSG  714

Query  277   FVQGAIAWVSQRHIVKSPIAIIFQ  206
               QG + W S+++ V+SPIA++ Q
Sbjct  715   IAQGFLKWSSKKYSVRSPIAVVLQ  738



>ref|XP_006363698.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=747

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/743 (57%), Positives = 532/743 (72%), Gaps = 23/743 (3%)
 Frame = -1

Query  2392  VCLTLVFHSVASAKYE---DTYIVHVSPPAAAINGVSE--DYRSYFRSF-------VSES  2249
             + L L+F S      +   +TYIVHV  P   I+  S   D  SY+ SF       +S S
Sbjct  6     ILLILIFCSFLKPSIQSDLETYIVHVESPENQISSQSSLTDLESYYLSFLPKSTNAISSS  65

Query  2248  GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGL  2069
             GDE E + +++SY +V  GFAA+L+   V EM KK GF+SA++QR+ +L+TTH+P+FLGL
Sbjct  66    GDE-EAASMIYSYHNVMKGFAARLTAAQVKEMEKKHGFVSAQKQRILSLHTTHTPSFLGL  124

Query  2068  YQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKL  1892
              QN G W++S++GKGVI+GVLDTGI P+HPSF+D  MPPPPAKWKG CE    T CNNKL
Sbjct  125   QQNMGLWKDSNFGKGVIIGVLDTGILPDHPSFSDVGMPPPPAKWKGVCESNFTTKCNNKL  184

Query  1891  IGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSI  1712
             IGAR++          P+D+ GHGTHTA TAAG FV  A VFG+A GTAVG+APLAH+++
Sbjct  185   IGARSY----QLGSGSPIDDNGHGTHTAGTAAGAFVKGANVFGNANGTAVGVAPLAHIAV  240

Query  1711  YKVCTEDG-CAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFV  1535
             YKVC+ DG C++SDILAAMDAAIDDGVD+LS+SLGG +  F +D IA+G ++A E+GIFV
Sbjct  241   YKVCSSDGGCSDSDILAAMDAAIDDGVDILSISLGGSTKPFHDDGIALGTYSAAERGIFV  300

Query  1534  SCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTL  1355
             S AAGN GP   T++NEAPW+LTVGAST DR +KA   LGN  + +GESA+  +    T 
Sbjct  301   SAAAGNSGPSVGTVANEAPWILTVGASTHDRKLKAAVKLGNSEEFEGESAYHPKTSNSTF  360

Query  1354  LPLIYPGSKDED---AALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMI  1184
               L   G  + D   A  C PGSL    +KGK+VLC R   + +VD+GQ+VKDAGG  MI
Sbjct  361   FTLYDAGKNESDQFSAPFCSPGSLSDPAIKGKIVLCLRSRSLLKVDQGQSVKDAGGVGMI  420

Query  1183  LLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSV  1004
             L+N+  +G T  A+ HVLPA ++S  DG K+  Y+NS+S P A I F GT IG K AP V
Sbjct  421   LINEQEEGVTKSAEAHVLPALDVSNADGKKILAYMNSSSNPVALITFHGTVIGDKNAPIV  480

Query  1003  ASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLS  824
             ASFSSRGPS ASPGILKPDI+GPGVN+LAAWP   + N     +TFNIISGTSM+ PHLS
Sbjct  481   ASFSSRGPSVASPGILKPDIIGPGVNVLAAWPTSVDDNKNTK-STFNIISGTSMSCPHLS  539

Query  823   GIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRAS  644
             G+A LLKSAHPDWS AAIKSAI+TTAD  NL  + ILDERL+ AD+FA G GHVNPSRAS
Sbjct  540   GVAALLKSAHPDWSAAAIKSAIMTTADTLNLANSPILDERLISADLFAIGAGHVNPSRAS  599

Query  643   DPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKT  464
             DPGLIYD   +DY+PYLCGLNYT++E+ +++QRKV CS+V SI E QLNYPSF+I LG T
Sbjct  600   DPGLIYDTPFEDYVPYLCGLNYTNREVGKVLQRKVNCSEVKSITEEQLNYPSFSIRLGST  659

Query  463   SLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVD  284
               TY+RTVTNVG+A S Y V++    GV V V P  L F+ +NQ+LTY ++F+ +S    
Sbjct  660   PQTYTRTVTNVGDAKSSYKVEIVSPKGVVVKVEPSALNFSMLNQKLTYQVTFTKTSNIST  719

Query  283   IDFVQGAIAWVSQRHIVKSPIAI  215
                V+G + W S RH V+SPIA+
Sbjct  720   TSDVEGFLKWNSNRHSVRSPIAV  742



>ref|XP_006358371.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=757

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/730 (58%), Positives = 527/730 (72%), Gaps = 25/730 (3%)
 Frame = -1

Query  2341  TYIVHVSPPAAAIN--GVSEDYRSYFRSFV-------SESGDEGERSRIVHSYRHVASGF  2189
             TYIVHV  P + I+   +S D  S+++SF+       S S +E E SR+V+SYR+V  GF
Sbjct  27    TYIVHVESPESQISTQSLSGDLESWYQSFLPNTIARTSASSNE-EASRLVYSYRNVMKGF  85

Query  2188  AAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGV  2009
             AA+L+ E V EM KK GFI+A  +R+ +L+TTHSP+FLGL+QN G W+NS+YGKGVI+GV
Sbjct  86    AARLTAEQVKEMEKKPGFIAAWPERILSLHTTHSPSFLGLHQNIGLWKNSNYGKGVIIGV  145

Query  2008  LDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARNFVSEGssppppPVDE  1832
             LDTGI+P+HPSF+DE MPPPPAKWKGKCE    T CNNKLIGAR F          P+D+
Sbjct  146   LDTGISPDHPSFSDEGMPPPPAKWKGKCESNFTTKCNNKLIGARTF----PQANGSPIDD  201

Query  1831  EGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamda  1652
              GHGTHTAST AG+FV  A VFG+A GTAVG+APLAHL+IYKVC    C++S +L+AMDA
Sbjct  202   NGHGTHTASTIAGSFVKGANVFGNAIGTAVGIAPLAHLAIYKVCDSFSCSDSGVLSAMDA  261

Query  1651  aiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWL  1472
             AIDDGVD+LSLSLGG +  F  D IA+GA++A ++GI VSC+AGN GP   T+ NEAPW+
Sbjct  262   AIDDGVDILSLSLGGTTNPFHSDPIALGAYSATQRGILVSCSAGNNGPFESTVVNEAPWI  321

Query  1471  LTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK------DEDAAL  1310
             LTVGAST+DR IKAT  LGN  + +GESAF  +       PL  P         D D   
Sbjct  322   LTVGASTLDRKIKATLRLGNKEEFEGESAFHPKVSNNKFFPLFDPSENATDPDSDSDILF  381

Query  1309  CGPG-SLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHV  1133
             CGPG +      KGK+VLC  GGG  R++KGQ VK+AGG  MIL N+  DG T  AD HV
Sbjct  382   CGPGLTELSAVAKGKIVLCKVGGGFNRIEKGQAVKNAGGVGMILTNRPQDGSTKSADAHV  441

Query  1132  LPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILK  953
             LPA +++ +D   + DY+ ST  P A I F+GT IG KTAP VA+FS+RGPS ASPGILK
Sbjct  442   LPALDVTSSDRNSITDYMKSTKNPVARITFQGTIIGDKTAPVVAAFSARGPSTASPGILK  501

Query  952   PDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAA  773
             PDI+GPGVNILAAW   +  N  N  +TFNIISGTSM+ PHLSG+A LLKSAHP WSP+A
Sbjct  502   PDIIGPGVNILAAWH-NSVENKTNTKSTFNIISGTSMSCPHLSGVAALLKSAHPTWSPSA  560

Query  772   IKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYL  593
             IKSAI+TTAD  NLN    L E L PA +FA G GHVNPSRA+DPGL+YD Q  DY+PYL
Sbjct  561   IKSAIMTTADIVNLNNESFLSETLTPARIFAFGAGHVNPSRANDPGLVYDTQFKDYLPYL  620

Query  592   CGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSM  413
             CGLNY+++E+  ++QRK  CS+V SIPEAQLNYPSF+I LG+   TY+RTVTNVGE  S 
Sbjct  621   CGLNYSNREVGNLLQRKANCSKVKSIPEAQLNYPSFSISLGEKPQTYTRTVTNVGEVKST  680

Query  412   YTVK-VSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHI  236
             Y V+ VSP + V V V P  L F+++NQ++TY ++FS ++   +++ V G + W S +H 
Sbjct  681   YRVEIVSPRM-VSVVVKPSILKFSKLNQKMTYRVTFSTTTVIRNMEVVHGYMKWTSNKHF  739

Query  235   VKSPIAIIFQ  206
             V+SPIA++ Q
Sbjct  740   VRSPIAVVLQ  749



>ref|XP_009614060.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana tomentosiformis]
Length=748

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/721 (58%), Positives = 525/721 (73%), Gaps = 14/721 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAA--AINGVSEDYRSYFRSF----VSESGDEGERSRIVHSYRHVASGFAA  2183
             + YIV V  P +  +I     +  S++ SF    ++ +G   ++ R+++SY +V  GFAA
Sbjct  27    EIYIVQVESPESRISIQSTRTNLESWYSSFLPKTIATTGSNEDQPRLIYSYHNVMKGFAA  86

Query  2182  KLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLD  2003
             +LS E V EM KK GFISAR QR+  L+TTHSP+FLGL QN G W++S+YGKGVI+GVLD
Sbjct  87    RLSVEQVKEMEKKPGFISARPQRILFLHTTHSPSFLGLQQNMGLWKDSNYGKGVIIGVLD  146

Query  2002  TGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARNFVSEGssppppPVDEEG  1826
             TGI P+HPSF+D+ MPPPPAKWKGKCE    T CNNKLIGAR F          P+D+ G
Sbjct  147   TGIYPDHPSFSDKGMPPPPAKWKGKCESNFTTKCNNKLIGARTFAQ----ASESPLDDNG  202

Query  1825  HGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaai  1646
             HGTHTAST AG FV  A V G+A GTAVG+APLAHL+IYKVC   GC++SDILAAMDAAI
Sbjct  203   HGTHTASTIAGRFVDGANVNGNANGTAVGIAPLAHLAIYKVCDSFGCSDSDILAAMDAAI  262

Query  1645  ddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLT  1466
             DDGVD+LSLSLGG S +F+ D IA+GA++A ++GI VSC+A N GP   TLSNEAPW++T
Sbjct  263   DDGVDILSLSLGGSSKAFYNDPIALGAYSATQRGILVSCSASNNGPYDSTLSNEAPWIMT  322

Query  1465  VGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG--SKDEDAALCGPGSL  1292
             VGASTIDR +KAT  LGN  + +GESAF  +       PL  P   + D D+  CG G+L
Sbjct  323   VGASTIDRKLKATVKLGNRKEFEGESAFHPKGHNSAFFPLFDPALNATDFDSPYCGTGTL  382

Query  1291  dkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELS  1112
             +  D+KGK+VLC  GGG +R++KGQ VKDAGG  MI+ +   DG+T  AD HVLPA  ++
Sbjct  383   NDPDIKGKIVLCMAGGGYSRIEKGQAVKDAGGVGMIIFSSPDDGFTKFADAHVLPALYIT  442

Query  1111  YNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPG  932
             Y DG+++ DY+N+TS P A + F+GT IG K AP VA+FSSRGPS ASPGILKPDI+GPG
Sbjct  443   YKDGIEILDYMNATSKPIARLAFQGTIIGDKDAPVVAAFSSRGPSLASPGILKPDIIGPG  502

Query  931   VNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIIT  752
             VNILAAWP  +  N  N    F + SGTSM+ PHLSG+A LLKSAHP WSPA IKSAI+T
Sbjct  503   VNILAAWP-PSPENKPNIKPNFFLASGTSMSCPHLSGVAALLKSAHPTWSPAVIKSAIMT  561

Query  751   TADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTD  572
             TA+  NL    ILDERL+PA++FA G GHVNPSRA+DPGL+YD Q  DY+PYLCGLNYT+
Sbjct  562   TANTVNLANDPILDERLLPANIFAVGAGHVNPSRANDPGLVYDTQFKDYLPYLCGLNYTN  621

Query  571   QEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSP  392
             +++  ++QRKV+C QV SIP+AQLNYPSF+I LG  S TY+RTVTNVG A S Y V++  
Sbjct  622   RQVGNLLQRKVDCKQVKSIPQAQLNYPSFSITLGANSQTYTRTVTNVGVAKSSYNVEIGS  681

Query  391   FLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAII  212
               GV V V P TL F+++NQ+L Y ++FS  +   +   VQG + W   +H V+SPIA++
Sbjct  682   PPGVSVIVKPSTLNFSKLNQKLKYQVTFSIRANSSNSGVVQGFLKWTCNKHSVRSPIAVV  741

Query  211   F  209
              
Sbjct  742   L  742



>ref|XP_009373361.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=780

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/760 (57%), Positives = 543/760 (71%), Gaps = 37/760 (5%)
 Frame = -1

Query  2383  TLVFHSVASAKYED------------------TYIVHVSPPAAAINGV--SEDYRSYFRS  2264
             ++ F S+A A YE+                  TYIV V  P +    +  +ED  S+++S
Sbjct  21    SMFFTSLAVADYEEVVLEQLADVTNDEKNSMQTYIVWVEKPVSQKFSLQSNEDLESWYQS  80

Query  2263  FVSES---GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTT  2093
             F+ ES    ++    R+VHSYR++A+GFAAKL+PE V EM  K+GF+SAR QR+  L TT
Sbjct  81    FLPESIASSNQQMNQRMVHSYRNIATGFAAKLTPEEVREMVTKEGFVSARPQRILPLQTT  140

Query  2092  HSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEG  1913
             H+P+FLGL+Q  G W  ++YGKGVI+G+LDTGI P+HPSFNDE MPPPPAKWKGKCEF  
Sbjct  141   HTPDFLGLHQGSGLWEAATYGKGVIIGLLDTGIVPDHPSFNDEGMPPPPAKWKGKCEFNE  200

Query  1912  TACNNKLIGARNF--VSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVG  1739
             T CNNKLIGARNF  V +G      P D +GHG+HT+STAAG FV  A+V+G A GTA G
Sbjct  201   TLCNNKLIGARNFIGVGKGQPKRRFPFDIDGHGSHTSSTAAGRFVEGASVYGQANGTAAG  260

Query  1738  MAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFA  1559
             MAP AHL++YKVC   GCA++DI AA+D AIDDGVDVLSLSLGG S  F++D IAIGAFA
Sbjct  261   MAPYAHLAMYKVCEGFGCADADIFAALDVAIDDGVDVLSLSLGGPSLPFYDDVIAIGAFA  320

Query  1558  AMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQ--LDGESA  1385
             A++KGIF SCA GN GP   +LSNEAPW+LTVGAST DR + +   +G+  Q   DG+S 
Sbjct  321   AIQKGIFFSCAGGNSGPWNRSLSNEAPWILTVGASTTDRILTSGLQIGDEKQYHFDGKSL  380

Query  1384  FQVENFPPT-LLPLIYPGSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVK  1208
              Q E+F  T LLPL+  GS    ++ C  GSL   +V+GK+VLC+ GGG+  + KG+ VK
Sbjct  381   SQPEDFDSTVLLPLVDAGSFGNQSSFCKAGSL--ENVEGKIVLCETGGGVTNIAKGEEVK  438

Query  1207  DAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFI  1028
              AGGAAMIL+N++IDG++ LA+ HVLPAT +SY  GL++K YI+STS P  TI+F GT I
Sbjct  439   RAGGAAMILMNKEIDGFSTLAEAHVLPATHVSYAAGLQIKLYISSTSTPKGTILFNGTVI  498

Query  1027  GTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnng-ngNATFNIISG  851
             G   AP VASFSSRGP+ ASPGILKPD++GPGV+ILAAWP   +     N  A FNIISG
Sbjct  499   GDALAPKVASFSSRGPNIASPGILKPDVIGPGVSILAAWPYNVDNVTHPNPKALFNIISG  558

Query  850   TSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDER-LVPADVFATG  674
             TSMA PHLSGIA LLKS HPDWSPAAIKSAI+TTAD  NL G+ I+DE  L PADVFA G
Sbjct  559   TSMACPHLSGIAALLKSTHPDWSPAAIKSAIMTTADVLNLLGSPIVDESGLKPADVFAIG  618

Query  673   GGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNY  494
              GHVNPS+A+DPGLI+DL+ +DYIPYLCGLNY D  I+ I Q+ V+CSQV +IPEAQLNY
Sbjct  619   AGHVNPSKANDPGLIFDLKPEDYIPYLCGLNYNDTAIKIITQQAVKCSQVGAIPEAQLNY  678

Query  493   PSFAIWLGKTSLT---YSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLT  323
             PSFAI +G+       Y+RTV NVG A S Y +++     + + V P  L FTEVNQ++T
Sbjct  679   PSFAITIGRNQTRTQYYTRTVRNVGPATSTYNLELLVPHEMGMSVNPQVLTFTEVNQEIT  738

Query  322   YNISFSP--SSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             YN+ F+    +    + F QG + W S +H V +PIA++F
Sbjct  739   YNVEFNAHDGAGKDGVPFGQGYLRWFSDKHNVTTPIAVLF  778



>ref|XP_007210956.1| hypothetical protein PRUPE_ppa023717mg [Prunus persica]
 gb|EMJ12155.1| hypothetical protein PRUPE_ppa023717mg [Prunus persica]
Length=729

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/729 (58%), Positives = 538/729 (74%), Gaps = 21/729 (3%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVS--EDYRSYFRSFVSES---GDEGERSRIVHSYRHVASGFAAKL  2177
             TYIV V  PA+        ED  S+++SF+ E+    ++  + R+V++Y +VA+GFAA+L
Sbjct  3     TYIVWVQKPASQKFSAESHEDLESWYQSFLPETDANSNQLTKQRMVYAYHNVATGFAARL  62

Query  2176  SPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTG  1997
             +PE V  M   +GF+SAR +++  L TTHSP+FLGL+Q FG W  ++YG+GVI+G+LDTG
Sbjct  63    TPEEVKTMETIEGFVSARPEKILPLQTTHSPDFLGLHQGFGLWEATNYGEGVIIGLLDTG  122

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNF--VSEGssppppPVDEEGH  1823
             ITP+HPSF+DE MPPPPAKWKGKCEF GT CNNKLIGARNF  V +   PP PP D +GH
Sbjct  123   ITPDHPSFSDEGMPPPPAKWKGKCEFNGTLCNNKLIGARNFKGVGKDQPPPGPPFDIDGH  182

Query  1822  GTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaid  1643
             GTHT+STAAG FV  A+VFG A GTA GMAP AHL++YKVC+  GCAE+DILAA+D A+D
Sbjct  183   GTHTSSTAAGRFVEGASVFGQANGTAAGMAPKAHLAVYKVCSGFGCAEADILAALDVAVD  242

Query  1642  dgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTV  1463
             DGVDVLSLSLGG S  F++D IAIGAFAA++KGIF SCA GN GP   +LSNEAPW+LTV
Sbjct  243   DGVDVLSLSLGGPSLPFYKDVIAIGAFAAIQKGIFFSCAGGNFGPFNRSLSNEAPWILTV  302

Query  1462  GASTIDRTIKATAVLGNGA--QLDGESAFQVENFPPTL---LPLIYPGS-KDEDAALCGP  1301
             GAST DR +K+ A +G+      DG+S  Q ++F  T+   LPL+Y GS  ++ +A C  
Sbjct  303   GASTTDRILKSEAQIGDDKNNHFDGKSLSQPQDFDSTVSLPLPLVYAGSVGNQPSAFCKK  362

Query  1300  GSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPAT  1121
             G+L+ V+ K    LC+ GGG+  + KG+ VK AGGAAMIL+NQ+ DG++ LA++H LP T
Sbjct  363   GTLENVEGKIV--LCETGGGVTNIAKGEEVKRAGGAAMILMNQETDGFSTLAESHALPTT  420

Query  1120  ELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDIL  941
              +SY  GL++K YI+STS PTATI+F GT IG   AP VA FSSRGP+ ASPGILKPDI+
Sbjct  421   HVSYAAGLQIKSYISSTSSPTATILFNGTVIGDALAPRVAFFSSRGPNKASPGILKPDII  480

Query  940   GPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSA  761
             GPGV+ILAAWPV  +    +  ATFNIISGTSMA PHLSGIA L+KS+HPDWSPAAIKSA
Sbjct  481   GPGVDILAAWPVSVDNATQSK-ATFNIISGTSMACPHLSGIAALVKSSHPDWSPAAIKSA  539

Query  760   IITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLN  581
             I+TTAD  NL G  I+D+   PA+VFA G GHVNPS+A+DPGLIYD Q +DYIPYLCGLN
Sbjct  540   IMTTADVLNLAGLPIVDQDQRPANVFAIGAGHVNPSKANDPGLIYDTQPEDYIPYLCGLN  599

Query  580   YTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKT---SLTYSRTVTNVGEANSMY  410
             YTD+EIQ I Q+KV CSQV  I EAQLNYPSF+I +G     S  Y+RTV NVG A++ Y
Sbjct  600   YTDKEIQIITQQKVNCSQVGVISEAQLNYPSFSIKIGSNESQSQYYTRTVRNVGPASTTY  659

Query  409   TVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISF--SPSSTPVDIDFVQGAIAWVSQRHI  236
              + +     + + V P  L FTEVNQ++T+++ F     +    + F QG + WVS +H 
Sbjct  660   NLDLLVPHKMGMSVNPGVLTFTEVNQEITFHVEFIAQDGAGKDGVAFGQGYLRWVSDKHN  719

Query  235   VKSPIAIIF  209
             V SPIA++F
Sbjct  720   VTSPIAVVF  728



>gb|EYU39026.1| hypothetical protein MIMGU_mgv1a019074mg, partial [Erythranthe 
guttata]
Length=725

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/699 (61%), Positives = 523/699 (75%), Gaps = 16/699 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             +TYI+HV       +   E+  S++ SF+  S +   R RIV+SYR V  GFAA+LS + 
Sbjct  9     ETYIIHVDGNLGLFDRF-ENLESWYTSFLPTS-NSNSRGRIVYSYRKVFKGFAARLSADE  66

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             V  M     FISAR +R  + +TTHSPNFLGL QN GFW+ S+YGKGVI+GVLDTG+ P+
Sbjct  67    VKAMENHPAFISARPERKLDKHTTHSPNFLGLNQNMGFWQGSNYGKGVIIGVLDTGVLPS  126

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             HPSF+DE MPPPPAKWKGKCEF  TACNNK+IGAR F S        P+D++GHGTHTAS
Sbjct  127   HPSFSDEGMPPPPAKWKGKCEFNQTACNNKIIGARYFNS----FDDSPLDDDGHGTHTAS  182

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAG+FV  A VFG+A GTA G+AP+AHL+IYKVC+   C+ESDILAAMD AI+DGVD+L
Sbjct  183   TAAGSFVRGANVFGNANGTAAGIAPMAHLAIYKVCSL-FCSESDILAAMDTAIEDGVDIL  241

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
             SLSLGG S SF++DSIA+GAF+AME GI VSC+AGN+GP   +LSNEAPW+LTVGASTID
Sbjct  242   SLSLGGLSFSFYDDSIALGAFSAMENGILVSCSAGNDGPFNISLSNEAPWILTVGASTID  301

Query  1444  RTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS---KDEDAALCGPGSLdkvdvk  1274
             R I+AT +LGN   LDGES FQ  +FPPTL+PL+Y GS    D +   C P SL+K D++
Sbjct  302   RKIRATILLGNNETLDGESTFQPSDFPPTLMPLVYAGSLNTSDPNIQFCTPTSLNKSDLR  361

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             G VV+C+ G  +ARV KG  VK+AGG+AMIL+N  I     LA+ HVLPA  +SY DGLK
Sbjct  362   GMVVVCEIGV-VARVSKGIAVKNAGGSAMILVNPRIYANMTLAEAHVLPAAHVSYADGLK  420

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             +K YINST  PTATI+FKGT IG   AP VA FSSRGP+  SPGILKPDILGPGVNILAA
Sbjct  421   IKTYINSTITPTATILFKGTIIGDDRAPVVAGFSSRGPNYISPGILKPDILGPGVNILAA  480

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             WPV    N    +   NIISGTSM+ PHLSG+A LLKS+HP+WSPAAIKSAI+TTAD  N
Sbjct  481   WPVSVENNTNTNSTF-NIISGTSMSCPHLSGVAALLKSSHPNWSPAAIKSAIMTTADVVN  539

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             L    I DER VPA++FATG GHVNPSRA+DPGL+YD++ +DYIPYLCGLNYT++++  I
Sbjct  540   LALNPIEDERYVPANIFATGSGHVNPSRANDPGLVYDIKPEDYIPYLCGLNYTNRQVGFI  599

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWLGKT---SLTYSRTVTNVGEANSMYTVKVSPFLG  383
             +QRKV+CS  + IPEAQLNYPSFAI  G++   S TY+R+VTNVGE  S Y V++ P  G
Sbjct  600   LQRKVDCSVESKIPEAQLNYPSFAIRFGRSQPISQTYTRSVTNVGEPVSSYVVEIVPPPG  659

Query  382   VDVGVTPDTLVFTEVNQQLTYNISFS-PSSTPVDIDFVQ  269
             + V V P  L F+E NQ L Y ++F+ P ST     ++Q
Sbjct  660   IGVLVEPSNLDFSEANQTLQYQVTFTGPESTTNTTVYIQ  698



>gb|KHN09746.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=686

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/681 (60%), Positives = 514/681 (75%), Gaps = 10/681 (1%)
 Frame = -1

Query  2236  ERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNF  2057
             E+ R+++SYR+V SGFAA+L+ E +  ++KK GFI A+ +R+ +  TTH+P FLGL Q+ 
Sbjct  10    EQPRMIYSYRNVMSGFAARLTEEELRAVQKKNGFIYAQPERILHRQTTHTPQFLGLQQDM  69

Query  2056  GFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARN  1877
             GFW+ S++GKGVIVGV+D+GI P+HPSF+D  MPP   KWKGKCE   TACNNKLIGAR+
Sbjct  70    GFWKESNFGKGVIVGVVDSGIEPDHPSFSDAGMPP---KWKGKCELNATACNNKLIGARS  126

Query  1876  F--VSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKV  1703
             F   +        P+DE+GHGTHTASTAAG FV +A + G+AKGTA G+AP AHL++Y+V
Sbjct  127   FNLAATAMKGADSPIDEDGHGTHTASTAAGAFVDHAELLGNAKGTAAGIAPYAHLAMYRV  186

Query  1702  CTEDGCAESdilaamdaaiddgvdvlslslgggSAS-FFEDSIAIGAFAAMEKGIFVSCA  1526
             C  + C ESDILAA+DAA++DGVDV+S+SLG      FF DS AIGAFAAM+KGIFVSCA
Sbjct  187   CFGEDCPESDILAALDAAVEDGVDVISISLGLSEPPPFFHDSTAIGAFAAMQKGIFVSCA  246

Query  1525  AGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPL  1346
             AGN GP + +L N APW+LTVGAS IDR+I ATA LGNG + DGES FQ  +F PTLLPL
Sbjct  247   AGNSGPFHGSLINGAPWVLTVGASNIDRSIAATAKLGNGQEFDGESVFQPSDFSPTLLPL  306

Query  1345  IYPGSK-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQD  1169
              Y G    ++AA C  GSL+  D +GKVVLC+RGGGI R+ KG+ VK  GGAAMIL+N +
Sbjct  307   AYAGKNGKQEAAFCANGSLNDSDFRGKVVLCERGGGIGRIPKGEEVKRVGGAAMILMNDE  366

Query  1168  IDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSS  989
              +G+++LAD HVLPAT +SY+ GLK+K YINST+ P ATI+FKGT IG   AP+V SFSS
Sbjct  367   SNGFSVLADVHVLPATHVSYDAGLKIKAYINSTAIPIATILFKGTIIGNSLAPAVTSFSS  426

Query  988   RGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATL  809
             RGP+  SPGILKPDI+GPGVNILAAWP   N +  +  +TFN +SGTSM+ PHLSGIA L
Sbjct  427   RGPNLPSPGILKPDIIGPGVNILAAWPFPLNNDTDSK-STFNFMSGTSMSCPHLSGIAAL  485

Query  808   LKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLI  629
             LKS+HP WSPAAIKSAI+T+AD  N     I+DE L PADVFATG GHVNPSRA+DPGL+
Sbjct  486   LKSSHPHWSPAAIKSAIMTSADIINFERKLIVDETLHPADVFATGSGHVNPSRANDPGLV  545

Query  628   YDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYS  449
             YD+Q DDYIPYLCGL Y+D ++  I  + ++CS+ +SIPE +LNYPSF++ LG    T++
Sbjct  546   YDIQPDDYIPYLCGLGYSDTQVGIIAHKTIKCSETSSIPEGELNYPSFSVVLGSPQ-TFT  604

Query  448   RTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSP-SSTPVDIDFV  272
             RTVTNVGEANS Y V V    GV+V + P+ L F+  NQ+  Y++SFS   S     ++ 
Sbjct  605   RTVTNVGEANSSYVVMVMAPEGVEVRIQPNKLTFSGENQKEIYSVSFSRIESGNETAEYA  664

Query  271   QGAIAWVSQRHIVKSPIAIIF  209
             QG + WVS +H V+SPI + F
Sbjct  665   QGFLQWVSAKHSVRSPILVNF  685



>ref|XP_009608768.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana tomentosiformis]
Length=745

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/748 (57%), Positives = 532/748 (71%), Gaps = 19/748 (3%)
 Frame = -1

Query  2413  MAYISVVV-CLTLVFHSVASAKYEDTYIVHVSPPAAAINGVSE--DYRSYFRSFV----S  2255
             M ++ +++ C+   F   +     +TYIV V  P + I+  S   D  SY+ SF+    S
Sbjct  1     MGFLKILLFCIFCSFPLPSFQSDLETYIVQVEAPESQISTQSSSMDLESYYHSFLPKTTS  60

Query  2254  ESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFL  2075
              S  E E  R+V+SY +V  GFAA+L+   V EM KK+GF+SA  QR+ +L+TTH+P+FL
Sbjct  61    ISSRENEEPRMVYSYHNVMKGFAARLTTTQVKEMEKKQGFVSAEPQRILSLHTTHTPSFL  120

Query  2074  GLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNN  1898
             GL QN G W++S+YGKGVI+GVLDTGI P+HPSF+D  MPPPPAKWKG CE    T CNN
Sbjct  121   GLQQNMGLWKDSNYGKGVIIGVLDTGIFPDHPSFSDVGMPPPPAKWKGFCESNFTTKCNN  180

Query  1897  KLIGARNF-VSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAH  1721
             KLIGAR+F ++ GS      +DE GHGTHTA TAAG FV  A VFG+A GTAVG+APLAH
Sbjct  181   KLIGARSFPLTNGSP-----IDENGHGTHTAGTAAGAFVKGANVFGNANGTAVGVAPLAH  235

Query  1720  LSIYKVCTEDG-CAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKG  1544
             ++IYKVC   G C++ +ILAAMDAAIDDGVD+LS+SLGG S  F  D IA+GA++A E+G
Sbjct  236   IAIYKVCDSGGSCSDVEILAAMDAAIDDGVDILSISLGGTSNPFHNDKIALGAYSATERG  295

Query  1543  IFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFP  1364
             I VSC+AGN GP   T++N+APW+LTVGAST DR +KAT  LGN  + +GESA+  +   
Sbjct  296   ILVSCSAGNSGPSQRTVANDAPWILTVGASTHDRKLKATVKLGNKEEFEGESAYHPKTSN  355

Query  1363  PTLLPLIYPGS---KDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGA  1193
              T   L        +  DA  C PGSL    ++GK+V+C  GGG+ RVDKGQ VKDAGG 
Sbjct  356   STFFTLFDVEKIVHEQFDAPFCVPGSLTDPAIRGKIVVCLVGGGVRRVDKGQVVKDAGGV  415

Query  1192  AMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTA  1013
              MIL+N   DG T  A+ HVLPA ++S  DG K+  YINSTS P A I F GT IG K A
Sbjct  416   GMILINNPEDGVTKSAEAHVLPALDVSDVDGKKILAYINSTSNPVAAITFHGTVIGDKNA  475

Query  1012  PSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATP  833
             P VASFSSRGPS AS GILKPDI+GPGVN+LAAWP   + N     +TFNIISGTSM+ P
Sbjct  476   PIVASFSSRGPSEASRGILKPDIIGPGVNVLAAWPTSVDNNKNTK-STFNIISGTSMSCP  534

Query  832   HLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPS  653
             HLSGIA LLKSAHP+WSPAAIKSAI+TT D  NL    ILDERL+PAD+FA G GHVNPS
Sbjct  535   HLSGIAALLKSAHPNWSPAAIKSAIMTTTDTLNLAKNPILDERLIPADIFAIGAGHVNPS  594

Query  652   RASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWL  473
             RA+DPGLIYD   +DY+PYLCGLNYT++E+ +++Q KV CS+V SIPEAQLNYPSF+I L
Sbjct  595   RANDPGLIYDTPFEDYVPYLCGLNYTNREVGKLLQGKVNCSEVKSIPEAQLNYPSFSIRL  654

Query  472   GKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSST  293
               T  TY+RTVTNVG A S+Y V++    GV V V P  L F+ +NQ+LTY ++FS ++ 
Sbjct  655   RSTPQTYTRTVTNVGNATSIYKVEIVSPKGVAVKVKPSKLNFSILNQKLTYQVTFSKTTN  714

Query  292   PVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
               D +  QG + W S RH V SPIA++ 
Sbjct  715   NSDREVGQGFLKWNSDRHSVSSPIAVVL  742



>gb|KDO63673.1| hypothetical protein CISIN_1g039265mg, partial [Citrus sinensis]
Length=708

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/718 (59%), Positives = 534/718 (74%), Gaps = 20/718 (3%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGE-RSRIVHSYRHVASGFAAKLSPEM  2165
             TYIV V  P  +    SE   ++ RSF+  S +  + + R  +SY++V SGFAAKL+ E 
Sbjct  5     TYIVSVQQPEGSDLAESEYVENWHRSFLPYSLESSDVQQRPFYSYKNVISGFAAKLTEEE  64

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             V +M+KK GF+SAR +R   L TTHSP+FLGL+Q  G W+ S++GKGVI+G+LD GI P+
Sbjct  65    VQDMKKKNGFVSARPERKVRLQTTHSPSFLGLHQGMGVWKESNFGKGVIIGILDGGINPD  124

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppP-VDEEGHGTHTA  1808
             HPSF+DE MPPPPAKWKG+C+F  + CNNKLIGAR F  EG+     P +D +GHGTH A
Sbjct  125   HPSFSDEGMPPPPAKWKGRCDF--STCNNKLIGARTFNIEGNVKGTEPPIDVDGHGTHVA  182

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVC--TEDGCAESdilaamdaaiddgv  1634
              TAAG FV NA   G+AKGTA GMAP AHL+IYKVC   +  C ESD+LA +DAAI+DGV
Sbjct  183   GTAAGAFVKNAESLGNAKGTAAGMAPYAHLAIYKVCFGGDVDCTESDLLAGLDAAIEDGV  242

Query  1633  dvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAS  1454
             DVLS+S+GGGS  FF DSIA+G+FAA++KGIFVSCAAGN GP   T+SNEAPW+LTVGAS
Sbjct  243   DVLSISIGGGSVPFFNDSIAVGSFAAIQKGIFVSCAAGNSGPFNSTISNEAPWILTVGAS  302

Query  1453  TIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDE-DAALCGPGSLdkvdv  1277
             T+DR+I ATA LGN  + DGES FQ ++FP T LPL+Y G   + ++A CG GSL  +DV
Sbjct  303   TLDRSIVATAKLGNREEFDGESVFQPKDFPQTPLPLVYAGMNGKPESAFCGNGSLSGIDV  362

Query  1276  kgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGL  1097
             KGKVVLC+RGGGIAR+ KG+ VK+AGGAAMIL+N + + ++++AD HVLPAT +S + GL
Sbjct  363   KGKVVLCERGGGIARIFKGEQVKNAGGAAMILMNDEPNAFSVIADPHVLPATHVSNDAGL  422

Query  1096  KVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILA  917
             K+K YINST+ P ATI+FKGT IG   AP+V SFSSRGP+ ASPGILKPDI+GPG++ILA
Sbjct  423   KIKSYINSTATPMATIIFKGTVIGNSLAPTVVSFSSRGPNLASPGILKPDIIGPGLSILA  482

Query  916   AWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQY  737
             AW       N N  + FNI+SGTSMA PHLSGIA LLKS+HP WSPAAIKSA++TTAD  
Sbjct  483   AW-FEPLDFNTNPKSIFNIMSGTSMACPHLSGIAALLKSSHPYWSPAAIKSALMTTADLL  541

Query  736   NLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQ  557
             N+NG +I+DE L PAD+FA G GHVNPSRA+DPGL+YD+Q DDYIPYLCGL Y+D+E+  
Sbjct  542   NMNGERIVDETLRPADIFAIGAGHVNPSRANDPGLVYDIQPDDYIPYLCGLGYSDKEVGI  601

Query  556   IVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVD  377
             +V R          P AQLNYPSF++ LG    T++RTVTNVG+  S Y V V    GV 
Sbjct  602   LVHR----------PVAQLNYPSFSVTLGPAQ-TFTRTVTNVGQVYSSYAVNVVAPQGVV  650

Query  376   VGVTPDTLVFTEVNQQLTYNISFSPS-STPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
             V V P  L F++VNQ+ TY+++F+ S S      F QG I WVS ++ V+SPI++  Q
Sbjct  651   VSVKPSKLYFSKVNQKATYSVTFTRSGSGYTSGQFAQGYITWVSAKYSVRSPISVRLQ  708



>ref|XP_004244716.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=767

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/721 (57%), Positives = 531/721 (74%), Gaps = 13/721 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSE--DYRSYFRSFVSES---GDEGERSRIVHSYRHVASGFAAK  2180
             +TYIV V  P + I+  S   D  ++++SF+ ++      GE+ R+++SY +V SGFAA+
Sbjct  47    ETYIVQVESPESQISTQSSRMDLENWYKSFLPKTIATSSSGEKPRLIYSYHNVISGFAAR  106

Query  2179  LSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDT  2000
             LS + V EM KK GFISA  QR+ +L+TTH+P+FLGL QN G WR+++YGKGVI+GV+DT
Sbjct  107   LSAKQVKEMEKKPGFISAWPQRILSLHTTHTPSFLGLQQNVGLWRDANYGKGVIIGVIDT  166

Query  1999  GITPNHPSFNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVSEGssppppPVDEEGH  1823
             GI P+HPSF+D+ MPPPPAKWKGKCE   T  CNNKLIGAR F          P+DE GH
Sbjct  167   GIDPDHPSFSDKGMPPPPAKWKGKCESNFTKKCNNKLIGARTF----PLGSDSPIDEAGH  222

Query  1822  GTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaid  1643
             GTHTASTAAG FV  A V G+AKGTAVG+APLAHL++YKVC   GC +SD+LAAMDAAID
Sbjct  223   GTHTASTAAGGFVKGANVNGNAKGTAVGVAPLAHLAMYKVCQSFGCDDSDVLAAMDAAID  282

Query  1642  dgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTV  1463
             DGVD+LS+SLGG S SF++D IA+GA++A ++GI VSC+A N GP   TLSN+APW++TV
Sbjct  283   DGVDILSISLGGSSRSFYQDPIALGAYSAAQRGILVSCSAANNGPYESTLSNDAPWIMTV  342

Query  1462  GASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYP--GSKDEDAALCGPGSLd  1289
             GAST+DR +KAT  LGN    +GESAF   +      PL  P   + D D+  CG G+L+
Sbjct  343   GASTLDRKLKATVTLGNQKVFEGESAFHPNDHNSAFSPLFDPSLNATDFDSPYCGTGTLN  402

Query  1288  kvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSY  1109
               ++KGK+V+C  GGG +   +GQ VKDAGG  MI+++    G T+  D HVLPA  ++Y
Sbjct  403   DPEIKGKIVICMVGGGYSMTQQGQAVKDAGGVGMIVVSTADYGVTMFVDAHVLPALYITY  462

Query  1108  NDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGV  929
              DG+++ DY+N TS PTA I+F+GT IG K AP VA+FSSRGPS ASPGILKPDI+GPGV
Sbjct  463   KDGMEILDYMNKTSKPTAKILFQGTIIGDKDAPVVAAFSSRGPSLASPGILKPDIIGPGV  522

Query  928   NILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITT  749
             NILAAWP           +TFNIISGTSM+ PHLSG+A LLKS+HP WSP+AIKSAI+TT
Sbjct  523   NILAAWPTSVENKTNTK-STFNIISGTSMSCPHLSGVAALLKSSHPTWSPSAIKSAIMTT  581

Query  748   ADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQ  569
             A   N     ILDERL+PA++FA G GHVN SRA+DPGLIYD    DY+PYLCGLNYT++
Sbjct  582   AYTVNFANDPILDERLLPANIFAIGAGHVNLSRANDPGLIYDTPFKDYLPYLCGLNYTNR  641

Query  568   EIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPF  389
             ++  ++QRKV+C +V SIPEAQLNYPSF+I LG+ S TY+RTVTNVGEA S Y+V+V+  
Sbjct  642   QVGNLLQRKVDCREVKSIPEAQLNYPSFSITLGEVSQTYTRTVTNVGEAKSSYSVEVASP  701

Query  388   LGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              G+ V V P TL F+++NQ+L Y ++F+      +   ++G + W S++H V+SPIA++ 
Sbjct  702   PGISVTVKPSTLKFSKLNQKLKYKVTFTKRVNRTNGGVIEGFLKWTSEKHSVRSPIAVVL  761

Query  208   Q  206
             +
Sbjct  762   E  762



>ref|XP_004245680.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 emb|CAA06414.1| P69F protein [Solanum lycopersicum]
Length=747

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/724 (57%), Positives = 527/724 (73%), Gaps = 20/724 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSE--DYRSYFRSF-------VSESGDEGERSRIVHSYRHVASG  2192
             +TYIVHV  P   I+  S   D  SY+ SF       +S SGDE E + +++SY +V  G
Sbjct  25    ETYIVHVESPENQISTQSSLTDLESYYLSFLPKTTTAISSSGDE-EAASMIYSYHNVMKG  83

Query  2191  FAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVG  2012
             FAA+L+   V EM KK GF+SA++QR+++L+TTH+P+FLGL QN G W++S++G GVI+G
Sbjct  84    FAARLTAAQVKEMEKKHGFVSAQKQRIFSLHTTHTPSFLGLQQNMGLWKDSNFGVGVIIG  143

Query  2011  VLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARNFVSEGssppppPVD  1835
             VLDTGI P+HPSF+D  MPPPPAKWKG CE    T CNNKLIGAR++          P+D
Sbjct  144   VLDTGILPDHPSFSDVGMPPPPAKWKGVCESNFTTKCNNKLIGARSY----QLGNGSPID  199

Query  1834  EEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDG-CAESdilaam  1658
             + GHGTHTA TAAG FV  A +FG+A GTAVG+APLAH+++YKVC+ DG C++SDILAAM
Sbjct  200   DNGHGTHTAGTAAGAFVKGANIFGNANGTAVGVAPLAHIAVYKVCSSDGGCSDSDILAAM  259

Query  1657  daaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAP  1478
             DAAIDDGVD+LS+SLGG +  F +D IA+G ++A E+GIFVS +AGN GP   T++NEAP
Sbjct  260   DAAIDDGVDILSISLGGSTKPFHDDGIALGTYSATERGIFVSASAGNSGPSLGTVANEAP  319

Query  1477  WLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDED---AALC  1307
             W+LTVGAST DR +K T  LGN  + +GESA+  +    T  PL   G  + D   A  C
Sbjct  320   WILTVGASTHDRKLKVTVKLGNSEEFEGESAYHPKTSNSTFFPLYDAGKNESDQFSAPFC  379

Query  1306  GPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLP  1127
              PGSL+   +KGK+VLC R   + RV +GQ+VKDAGG  MIL+N+  +G T  A+ HVLP
Sbjct  380   SPGSLNDPAIKGKIVLCLRSISLLRVAQGQSVKDAGGVGMILINEQEEGVTKSAEAHVLP  439

Query  1126  ATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPD  947
             A ++S  DG K+  Y+NS+S P A+I F GT IG K AP VASFSSRGPS ASPGILKPD
Sbjct  440   ALDVSNADGKKILAYMNSSSNPVASITFHGTVIGDKNAPIVASFSSRGPSVASPGILKPD  499

Query  946   ILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIK  767
             I+GPGVN+LAAWP   + N     +TFNI+SGTSM+ PHLSG+A LLKSAHPDWSPAAIK
Sbjct  500   IIGPGVNVLAAWPTSVDNNKNTK-STFNIVSGTSMSCPHLSGVAALLKSAHPDWSPAAIK  558

Query  766   SAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCG  587
             SA++TTAD  NL  + ILDERL+ AD+FA G GHVNPSRASDPGL+YD   +DYIPYLCG
Sbjct  559   SAMMTTADTVNLANSPILDERLISADLFAMGAGHVNPSRASDPGLVYDTPFEDYIPYLCG  618

Query  586   LNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYT  407
             LNYT++E+ +++QRKV CS+V  IPE QLNYPSF+I LG T  TY+RTVTNVG+A S Y 
Sbjct  619   LNYTNREVGKVLQRKVNCSEVKRIPEGQLNYPSFSIRLGSTPQTYTRTVTNVGDAKSSYK  678

Query  406   VKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKS  227
             V++    GV V V P  L F+ +NQ+LTY + F+ ++       V+G + W S RH V+S
Sbjct  679   VEIVSPKGVVVKVEPSALNFSTLNQKLTYQVIFTKTTNISTTSDVEGFLKWNSNRHSVRS  738

Query  226   PIAI  215
             PIA+
Sbjct  739   PIAV  742



>ref|NP_001233982.1| subtilisin-like protease precursor [Solanum lycopersicum]
 emb|CAA71234.1| subtilisin-like protease [Solanum lycopersicum]
 emb|CAA76725.1| P69B protein [Solanum lycopersicum]
Length=745

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/725 (57%), Positives = 526/725 (73%), Gaps = 20/725 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVS--EDYRSYFRSF-------VSESGDEGERSRIVHSYRHVASG  2192
             +TYIVHV  P + +   S   D  SY+ SF       +S SG+E E + +++SY +V +G
Sbjct  25    ETYIVHVESPESLVTTQSLLTDLGSYYLSFLPKTATTISSSGNE-EAATMIYSYHNVMTG  83

Query  2191  FAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVG  2012
             FAA+L+ E V EM KK GF+SA++QR+ +L+TTH+P+FLGL QN G W++S+YGKGVI+G
Sbjct  84    FAARLTAEQVKEMEKKHGFVSAQKQRILSLHTTHTPSFLGLQQNMGVWKDSNYGKGVIIG  143

Query  2011  VLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppPVD  1835
             V+DTGI P+HPSF+D  MPPPPAKWKG CE   T  CNNKLIGAR++          P+D
Sbjct  144   VIDTGIIPDHPSFSDVGMPPPPAKWKGVCESNFTNKCNNKLIGARSY----QLGNGSPID  199

Query  1834  EEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamd  1655
               GHGTHTASTAAG FV  A V+G+A GTAVG+APLAH++IYKVC   GC+ESD+LAAMD
Sbjct  200   SIGHGTHTASTAAGAFVKGANVYGNADGTAVGVAPLAHIAIYKVCNSVGCSESDVLAAMD  259

Query  1654  aaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPW  1475
             +AIDDGVD+LS+SL GG   F  D+IAIGA++A E+GI VSC+AGN GP + T  N APW
Sbjct  260   SAIDDGVDILSMSLSGGPIPFHRDNIAIGAYSATERGILVSCSAGNSGPSFITAVNTAPW  319

Query  1474  LLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAA---LCG  1304
             +LTVGAST+DR IKAT  LGNG + +GESA++ +    T   L       +D +    C 
Sbjct  320   ILTVGASTLDRKIKATVKLGNGEEFEGESAYRPKISNATFFTLFDAAKNAKDPSETPYCR  379

Query  1303  PGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPA  1124
              GSL    ++GK+VLC   G +A VDKGQ VKDAGG  MI++N    G T  AD HVLPA
Sbjct  380   RGSLTDPAIRGKIVLCSALGHVANVDKGQAVKDAGGVGMIIINPSQYGVTKSADAHVLPA  439

Query  1123  TELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDI  944
               +S  DG K+  Y+NSTS P ATI F+GT IG K AP VA+FSSRGPS ASPGILKPDI
Sbjct  440   LVVSAADGTKILAYMNSTSSPVATIAFQGTIIGDKNAPMVAAFSSRGPSRASPGILKPDI  499

Query  943   LGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKS  764
             +GPG NILAAWP   + N     +TFNIISGTSM+ PHLSG+A LLK  HPDWSPA IKS
Sbjct  500   IGPGANILAAWPTSVDDNKNTK-STFNIISGTSMSCPHLSGVAALLKCTHPDWSPAVIKS  558

Query  763   AIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGL  584
             A++TTAD  NL  + ILDERL+PAD++A G GHVNPSRA+DPGL+YD   +DY+PYLCGL
Sbjct  559   AMMTTADTLNLANSPILDERLLPADIYAIGAGHVNPSRANDPGLVYDTPFEDYVPYLCGL  618

Query  583   NYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIW-LGKTSLTYSRTVTNVGEANSMYT  407
              YTDQ++  ++QR+V CS+V SI EAQLNYPSF+I+ LG T  TY+RTVTNVG+A S Y 
Sbjct  619   KYTDQQVGNLIQRRVNCSEVKSILEAQLNYPSFSIFGLGSTPQTYTRTVTNVGDATSSYK  678

Query  406   VKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKS  227
             V+V+   GV + V P  L F+E+NQ+LTY ++FS ++   + + ++G + W S RH V+S
Sbjct  679   VEVASPEGVAIEVEPSELNFSELNQKLTYQVTFSKTTNSSNPEVIEGFLKWTSNRHSVRS  738

Query  226   PIAII  212
             PIA++
Sbjct  739   PIAVV  743



>emb|CDP10007.1| unnamed protein product [Coffea canephora]
Length=744

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/746 (59%), Positives = 542/746 (73%), Gaps = 28/746 (4%)
 Frame = -1

Query  2413  MAYISVVVCLTLVFHSVASAKYEDTYIVHVSPP-------AAAINGVSEDYRSYFRSFVS  2255
             M  +++   L+L   ++ SA  E TYIVHV  P        ++I+  +ED  S++ SF+ 
Sbjct  4     MHILNLFSVLSLQLLAI-SANLE-TYIVHVELPESYTQLSTSSISSPNEDLDSWYNSFLP  61

Query  2254  ES-GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNF  2078
              +     E  R+V+ Y +V  GF+AKLS E V  M KK GF+SAR QR+ +L+TTHSP F
Sbjct  62    TTIASTNEAPRMVYCYHNVFKGFSAKLSAEDVKVMEKKPGFLSARPQRMLSLHTTHSPIF  121

Query  2077  LGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNN  1898
             LGL+QN GFWR S+YGKGVI+GVLDTGI PNHPSF+DE MPPPPAKWKGKCEF    CN 
Sbjct  122   LGLHQNSGFWRESNYGKGVIIGVLDTGIEPNHPSFSDEGMPPPPAKWKGKCEFNTPVCNK  181

Query  1897  KLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHL  1718
             KLIGAR F  +G+  P    DE GHGTHTA TAAGNFV  A VFG+A GTAVG+AP AHL
Sbjct  182   KLIGAR-FFQDGNGSP---ADESGHGTHTAGTAAGNFVMGANVFGNANGTAVGVAPHAHL  237

Query  1717  SIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIF  1538
             +IYKVCT  GC+ESDILAAMD AIDDGVD+LSLSLGG S  F  D+IA+GA++AMEKGI 
Sbjct  238   AIYKVCTT-GCSESDILAAMDVAIDDGVDILSLSLGGSSVPFHNDNIALGAYSAMEKGIL  296

Query  1537  VSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPT  1358
             VSC+AGN GP   TLSN+APW+LTVGASTIDR I+ATAVLGN  +LDG+S +Q ++F P 
Sbjct  297   VSCSAGNNGPFGSTLSNDAPWILTVGASTIDRQIRATAVLGNKEELDGQSLYQPKDFHPR  356

Query  1357  LLPLIYPG--SKDEDA-ALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAM  1187
             L PL YPG    D DA   C    L+   VKGK+V+C+ G  I    KG  VK AGG  M
Sbjct  357   LYPLFYPGLNQSDTDADRYCTEALLNITQVKGKIVICEVGL-IPPTSKGTNVKAAGGVGM  415

Query  1186  ILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPS  1007
             I++N + +GYT  AD HVLPAT ++Y DGLK+  Y+ STS P AT  FKGT IG   AP+
Sbjct  416   IMINSEQEGYTTRADAHVLPATNINYADGLKLIAYLESTSSPVATFSFKGTIIGDSHAPA  475

Query  1006  VASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHL  827
             VASFSSRGPS +SPGILKPDI+GPGVNILAA+   +  N+ N  A F+++SGTSM+ PHL
Sbjct  476   VASFSSRGPSYSSPGILKPDIIGPGVNILAAYH-ESVENSTNTKANFHVLSGTSMSCPHL  534

Query  826   SGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRA  647
             SG+A LLKSAHPDWSPAAIKSA++TTAD  NL    I DE+ +PAD+F  G GHVNP+RA
Sbjct  535   SGVAALLKSAHPDWSPAAIKSAMMTTADLVNLAQNPIEDEKHLPADLFTMGSGHVNPARA  594

Query  646   SDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGK  467
             ++PGLIYD++  DYIPYLCGLNY+D+E+ +I+QRK  C   + I E QLNYPSF+I +G 
Sbjct  595   NNPGLIYDIEPKDYIPYLCGLNYSDREVGRILQRKANCKAESRISETQLNYPSFSIVVGS  654

Query  466   TSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSS---  296
             T   Y+RTVTNVG+ANS+Y VK+    GV+V V P  L F++VNQ+L+Y+I+F+P S   
Sbjct  655   TIQKYTRTVTNVGDANSIYRVKIDQPGGVNVTVKPRILSFSKVNQKLSYDITFTPLSPYE  714

Query  295   TPVDIDFVQGAIAWVSQRHIVKSPIA  218
             TP D     G++ W S ++ V+SPIA
Sbjct  715   TPSD-----GSLTWTSAKYSVRSPIA  735



>ref|XP_009762965.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana sylvestris]
Length=744

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/723 (58%), Positives = 522/723 (72%), Gaps = 17/723 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSE--DYRSYFRSFVSE----SGDEGERSRIVHSYRHVASGFAA  2183
             +TYIV V PP + I+  S   D  SY+ SF+ +    S  E E  R+++SY +V  GFAA
Sbjct  25    ETYIVQVEPPESQISTQSSSMDLESYYHSFLPKTTTISSRENEEPRMIYSYHNVMKGFAA  84

Query  2182  KLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLD  2003
             +L+   V EM KK+GF+SA+ QR+ +L+TTH+P+FLGL QN G W++S+YGKGVI+GVLD
Sbjct  85    RLTAAQVKEMEKKQGFVSAKPQRILSLHTTHTPSFLGLQQNMGLWKDSNYGKGVIIGVLD  144

Query  2002  TGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARNFVSEGssppppPVDEEG  1826
             TGI P+HPSF+D  M PPPAKWKG CE    T CNNKLIGAR+F          P+DE G
Sbjct  145   TGIVPDHPSFSDVGMSPPPAKWKGFCESNFTTKCNNKLIGARSF-----PLGNGPIDENG  199

Query  1825  HGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDG-CAESdilaamdaa  1649
             HGTHTA TAAG FV  A VFG+A GTAVG+APLAH++IYKVC  DG C++ +ILAAMDAA
Sbjct  200   HGTHTAGTAAGAFVKGANVFGNANGTAVGVAPLAHIAIYKVCDSDGSCSDVEILAAMDAA  259

Query  1648  iddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLL  1469
             IDDGVD+LS+SLGG S  F  DSIA+GA++A E+GI VSC+AGN GP   T++N+APW+L
Sbjct  260   IDDGVDILSISLGGTSNPFHTDSIALGAYSATERGILVSCSAGNNGPSQRTVANDAPWIL  319

Query  1468  TVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS---KDEDAALCGPG  1298
             TVGAST DR +KAT  LGN  + +GESA+  +    T   L        +  DA  C PG
Sbjct  320   TVGASTHDRKLKATVKLGNKEEFEGESAYHPKTSNSTFFTLFDVEKIVHEQFDAPFCVPG  379

Query  1297  SLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATE  1118
             SL    ++GK+V+C  GGG++RV+KGQ VKDAGG  MIL+N   DG T  A+ HVLPA +
Sbjct  380   SLTDPSIRGKIVVCLVGGGVSRVNKGQVVKDAGGVGMILINNPNDGVTKSAEAHVLPALD  439

Query  1117  LSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILG  938
             +S  DG K+  YINSTS P A I F GT +G K AP VASFSSRGPS AS GILKPDI+G
Sbjct  440   VSDADGKKILAYINSTSNPVAAITFHGTVLGDKNAPIVASFSSRGPSEASRGILKPDIIG  499

Query  937   PGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAI  758
             PGVN+LAAWP   + N     +TFNIISGTSM+ PHLSGIA LLKSAHPDWSPAAIKSAI
Sbjct  500   PGVNVLAAWPTSVDNNKNTK-STFNIISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAI  558

Query  757   ITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNY  578
             +TT    NL    ILDERL+PAD+FA G GHVNPSRA+DPGL+YD   +DY+PYLCGLNY
Sbjct  559   MTTTYTLNLAKNPILDERLIPADIFAIGAGHVNPSRANDPGLVYDTPFEDYVPYLCGLNY  618

Query  577   TDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKV  398
             T++E+ +++Q KV CS+V SIPEAQLNYPSF+I L  T  TY+RTVTNVG A S+Y V++
Sbjct  619   TNREVGKLLQGKVNCSEVKSIPEAQLNYPSFSIRLRSTPQTYTRTVTNVGNATSIYKVEI  678

Query  397   SPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIA  218
                 GV V V P  L F+ +NQ+LTY ++F+ ++   D +  QG + W S RH V SPIA
Sbjct  679   VSPKGVAVKVKPSKLNFSILNQKLTYQVTFTKTTNNSDREVGQGFLKWNSNRHSVSSPIA  738

Query  217   IIF  209
             ++ 
Sbjct  739   VVL  741



>ref|XP_009767059.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=752

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/724 (59%), Positives = 524/724 (72%), Gaps = 17/724 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVS---EDYRSYFRSFV-----SESGDEGERSRIVHSYRHVASGFA  2186
             TYIV V  P + I+  S   +D   ++RSF+     S S +E E  R+V+SYR+V  GFA
Sbjct  27    TYIVQVESPKSQISTQSLSDQDLEGWYRSFLPNTIASTSSNEEEEPRLVYSYRNVMKGFA  86

Query  2185  AKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVL  2006
             A+LS E V EM KK+GFISA  +R+ +L+TT +P+FLGL QN G WR+S+YGKGVI+GVL
Sbjct  87    ARLSAEEVKEMEKKEGFISAWPERILSLHTTRTPSFLGLQQNEGVWRHSNYGKGVIIGVL  146

Query  2005  DTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARNFVSEGssppppPVDEE  1829
             DTGI+P+HPSF+DE MPPPPAKWKGKCE    T CNNKLIGAR F          P+D+ 
Sbjct  147   DTGISPDHPSFSDEGMPPPPAKWKGKCESNFTTKCNNKLIGARTF----PQANGSPIDDN  202

Query  1828  GHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaa  1649
             GHGTHTA TAAG FV  A VFG+A GTAVG+APLAHL+IYKVC   GC++S IL+AMDAA
Sbjct  203   GHGTHTAGTAAGGFVKGANVFGNANGTAVGIAPLAHLAIYKVCDSFGCSDSGILSAMDAA  262

Query  1648  iddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLL  1469
             IDDGVD+LSLSLGG +  F  D IA+GA++A ++GI VSC+AGN GP   T+ NEAPW+L
Sbjct  263   IDDGVDILSLSLGGSTNPFHSDPIALGAYSATQRGILVSCSAGNNGPFESTVVNEAPWIL  322

Query  1468  TVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG--SKDEDAALCGPG-  1298
             TVGAST+DR IKAT  LGN  + +GESAF  +       PL  PG  S D D + CGPG 
Sbjct  323   TVGASTLDRKIKATVRLGNKEEFEGESAFHPKVSKTKFFPLFNPGENSTDSDNSFCGPGL  382

Query  1297  SLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATE  1118
             +     +KGK+VLC  GGG  R++KGQ VK+AGG  MIL+N+  DG T  AD HVLPA +
Sbjct  383   TDLSRAIKGKIVLCIAGGGFNRIEKGQAVKNAGGVGMILINRPQDGLTKSADAHVLPALD  442

Query  1117  LSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILG  938
             ++  DG  + +Y+ ST  P A I F+GT IG K AP +A FSSRGPS ASPGILKPDI+G
Sbjct  443   VASFDGNNIIEYMKSTMKPVARITFQGTIIGDKNAPVLAGFSSRGPSIASPGILKPDIIG  502

Query  937   PGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAI  758
             PGVNILAAWP           +TFNIISGTSM+ PHLSG+A LLKSAHP WSPAAIKSAI
Sbjct  503   PGVNILAAWPTSVENKTNTK-STFNIISGTSMSCPHLSGVAALLKSAHPTWSPAAIKSAI  561

Query  757   ITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNY  578
             +TTAD  NL+   +LDE L PA +FA G GHVNPSRA+DPGL+YD Q  DYIPYLCGLNY
Sbjct  562   MTTADIVNLSNESLLDEMLSPARIFAYGSGHVNPSRANDPGLVYDTQFKDYIPYLCGLNY  621

Query  577   TDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKV  398
             TD+++  ++QRK  CS+V SIPEAQLNYPSF+I LG    TY+RTVTNVGEA S Y V++
Sbjct  622   TDRQMGSLLQRKTSCSKVKSIPEAQLNYPSFSISLGANQQTYTRTVTNVGEAKSSYRVEI  681

Query  397   SPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIA  218
                  V V V P TL FT++NQ+LTY ++FS ++   +++ V G + W S +H V+SPIA
Sbjct  682   VSPRSVSVVVKPSTLKFTKLNQKLTYRVTFSTTTNITNMEVVHGYLKWTSNKHFVRSPIA  741

Query  217   IIFQ  206
             +I Q
Sbjct  742   VILQ  745



>emb|CAA76727.1| P69D protein [Solanum lycopersicum]
Length=747

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/724 (57%), Positives = 525/724 (73%), Gaps = 20/724 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSE--DYRSYFRSF-------VSESGDEGERSRIVHSYRHVASG  2192
             +TYIVHV  P   I+  S   D  SY+ SF       +S SGDE E + +++SY +V  G
Sbjct  25    ETYIVHVESPENQISTQSSLTDLESYYLSFLPKTTTAISSSGDE-EAASMIYSYHNVMKG  83

Query  2191  FAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVG  2012
             FAA+L+   V EM KK GF+SA++QR+++L+TTH+P+FLGL QN G W++S++G GVI+G
Sbjct  84    FAARLTAAQVKEMEKKHGFVSAQKQRIFSLHTTHTPSFLGLQQNMGLWKDSNFGVGVIIG  143

Query  2011  VLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARNFVSEGssppppPVD  1835
             VLDTGI P+HPSF+D  MPPPPAKWKG CE    T CNNKLIGAR++          P+D
Sbjct  144   VLDTGILPDHPSFSDVGMPPPPAKWKGVCESNFTTKCNNKLIGARSY----QLGNGSPID  199

Query  1834  EEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDG-CAESdilaam  1658
             + GHGTHTA TAAG FV    +FG+A GTAVG+APLAH+++YKVC+ DG C++SDILAAM
Sbjct  200   DNGHGTHTAGTAAGAFVKGVNIFGNANGTAVGVAPLAHIAVYKVCSSDGGCSDSDILAAM  259

Query  1657  daaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAP  1478
             DAAIDDGVD+LS+SLGG +  F +D IA+G ++A E+GIFVS +AGN GP   T++NEAP
Sbjct  260   DAAIDDGVDILSISLGGSTKPFHDDGIALGTYSATERGIFVSASAGNSGPSLGTVANEAP  319

Query  1477  WLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDED---AALC  1307
             W+LTVGAST DR +K T  LGN  + +GESA+  +    T  PL   G  + D   A  C
Sbjct  320   WILTVGASTHDRKLKVTVKLGNSEEFEGESAYHPKTSNSTFFPLYDAGKNESDQFSAPFC  379

Query  1306  GPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLP  1127
              PGSL+   +KGK+VLC R   + RV +GQ+VKDAGG  MIL+N+   G T  A+ HVLP
Sbjct  380   SPGSLNDPAIKGKIVLCLRSISLLRVAQGQSVKDAGGVGMILINEQKRGVTKSAEAHVLP  439

Query  1126  ATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPD  947
             A ++S  DG K+  Y+NS+S P A+I F GT IG K AP VASFSSRGPS ASPGILKPD
Sbjct  440   ALDVSNADGKKILAYMNSSSNPVASITFHGTVIGDKNAPIVASFSSRGPSVASPGILKPD  499

Query  946   ILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIK  767
             I+GPGVN+LAAWP   + N     +TFNI+SGTSM+ PHLSG+A LLKSAHPDWSPAAIK
Sbjct  500   IIGPGVNVLAAWPTSVDNNKNTK-STFNIVSGTSMSCPHLSGVAALLKSAHPDWSPAAIK  558

Query  766   SAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCG  587
             SA++TTAD  NL  + ILDERL+ AD+FA G GHVNPSRASDPGL+YD   +DYIPYLCG
Sbjct  559   SAMMTTADTVNLANSPILDERLISADLFAMGAGHVNPSRASDPGLVYDTPFEDYIPYLCG  618

Query  586   LNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYT  407
             LNYT++E+ +++QRKV CS+V  IPE QLNYPSF+I LG T  TY+RTVTNVG+A S Y 
Sbjct  619   LNYTNREVGKVLQRKVNCSEVKRIPEGQLNYPSFSIRLGSTPQTYTRTVTNVGDAKSSYK  678

Query  406   VKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKS  227
             V++    GV V V P  L F+ +NQ+LTY + F+ ++       V+G + W S RH V+S
Sbjct  679   VEIVSPKGVVVKVEPSALNFSTLNQKLTYQVIFTKTTNISTTSDVEGFLKWNSNRHSVRS  738

Query  226   PIAI  215
             PIA+
Sbjct  739   PIAV  742



>ref|XP_009776157.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=748

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/721 (57%), Positives = 517/721 (72%), Gaps = 13/721 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAIN--GVSEDYRSYFRSFVSE---SGDEGERSRIVHSYRHVASGFAAK  2180
             +TYIV V  P   I+   +S D  S+++SF+     S    E SR+++SY +V  GFAA+
Sbjct  26    ETYIVQVESPENKISTQSLSHDLESWYQSFLPNTISSTSSNEESRLIYSYHNVMKGFAAR  85

Query  2179  LSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDT  2000
             LS E V EM KK GF+ A  +R+ +L+TTH+P+FLGL QN G W++S+YGKGVI+GVLD+
Sbjct  86    LSAEEVKEMEKKPGFVYAWPERILSLHTTHTPSFLGLQQNMGMWKDSNYGKGVIIGVLDS  145

Query  1999  GITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARNFVSEGssppppPVDEEGH  1823
             GI P+HPSF+D+ MPPPP KWKGKCE    T CNNKLIGAR F          P+D++GH
Sbjct  146   GIFPDHPSFSDKGMPPPPVKWKGKCESNFSTKCNNKLIGARTF----PQANGSPIDDDGH  201

Query  1822  GTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaid  1643
             GTHTASTAAG FV  A V+G+A GTAVG+APLAHL+IYK+C   GC++S ILAAMDAAID
Sbjct  202   GTHTASTAAGGFVEGANVYGNANGTAVGIAPLAHLAIYKICDSFGCSDSGILAAMDAAID  261

Query  1642  dgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTV  1463
             DGVD+LSLSLG  ++ F  D IA+GA++A ++GI V C+AGN GP   ++ NEAPW+LTV
Sbjct  262   DGVDILSLSLGTSTSPFHNDPIALGAYSATQRGILVVCSAGNSGPSESSVLNEAPWILTV  321

Query  1462  GASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG--SKDEDAALCGPGSLd  1289
             GAST+DR IKAT  LGN    +GESAF  + F     PL  P     + D++ CG G+L 
Sbjct  322   GASTLDRKIKATVQLGNKKVFEGESAFHPKAFSTKFFPLFDPALDGSEFDSSYCGTGTLT  381

Query  1288  kvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSY  1109
                +KGK+VLC  GGG +R+ KGQ V+DAGG  MIL+N   DG+T  AD HVLPA +++Y
Sbjct  382   NPAIKGKIVLCMVGGGYSRIVKGQAVQDAGGVGMILINSIDDGFTTSADAHVLPAMDVTY  441

Query  1108  NDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGV  929
             +DG+K+ +Y+NST    A I  +GT IG K AP VA FSSRGPS A+ GILKPDILGPGV
Sbjct  442   DDGMKITEYMNSTKKSIARITLQGTIIGDKNAPIVAGFSSRGPSIATRGILKPDILGPGV  501

Query  928   NILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITT  749
             NILAAWP     N     +TFNIISGTSM+ PHLSG+A LLKSAHP WSPAAIKSAI+TT
Sbjct  502   NILAAWPTSVENNTNTK-STFNIISGTSMSCPHLSGVAALLKSAHPTWSPAAIKSAIMTT  560

Query  748   ADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQ  569
             AD  NL    ILDE L PA +FA G GHVNPSRA+DPGL+YD +  DY+PYLCGLNYT++
Sbjct  561   ADTVNLANNPILDEMLRPASIFAIGAGHVNPSRANDPGLVYDTKFKDYLPYLCGLNYTNR  620

Query  568   EIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPF  389
             E+  ++QRKV CS+V +IPEAQLNYPSF+I  G  S TY+RT TNVGEA   Y V++   
Sbjct  621   EVGNLLQRKVNCSEVKTIPEAQLNYPSFSITFGTHSQTYTRTATNVGEAKFSYNVEIVSP  680

Query  388   LGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              GV V V P  L F+++NQ+ +Y ++FS ++       VQG + W S RH V++PIA++ 
Sbjct  681   PGVSVTVKPSILKFSKLNQKRSYQVTFSRTANSSTSGVVQGFLKWTSNRHSVRNPIAVVL  740

Query  208   Q  206
             +
Sbjct  741   E  741



>ref|XP_004166925.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease-like 
[Cucumis sativus]
Length=733

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/725 (59%), Positives = 537/725 (74%), Gaps = 23/725 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSES--GDEGERSRIVHSYRHVASGFAAKLSP  2171
              TYIVHV  P   I G + D ++++ SF+ E+      E+SR+++SYRHV SGF+A+L+ 
Sbjct  14    QTYIVHVKQPEVEILGDTIDLQNWYTSFLPETIEASSNEQSRLLYSYRHVISGFSARLTK  73

Query  2170  EMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGIT  1991
             E V  M +K GFISA  +   NL+TTH+P +LGL Q+FG W+NS++GKGVI+GVLDTGI 
Sbjct  74    EQVKTMEEKDGFISAMPETTLNLHTTHTPEYLGLNQHFGLWKNSNFGKGVIIGVLDTGIH  133

Query  1990  PNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNF-VSEGssppppPVDEEGHGTH  1814
             PNHPSFNDE MP PPAKWKG+CEF  + CNNKLIGAR F ++   S    P DE GHGTH
Sbjct  134   PNHPSFNDEGMPSPPAKWKGRCEFGASICNNKLIGARTFNLANNVSIGKSPNDENGHGTH  193

Query  1813  TASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgv  1634
             TASTAAG FV  A   G+A+G AVGMAPLAH+++YKVC+  GC+ SDILAA+DAAIDDGV
Sbjct  194   TASTAAGTFVKGAEALGNARGKAVGMAPLAHIAVYKVCSPKGCSSSDILAALDAAIDDGV  253

Query  1633  dvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAS  1454
             DVLSLSLG  S  FF+D+IA+GAFAA++KGIFVSC+AGN GP   TL+NEAPW+LTVGAS
Sbjct  254   DVLSLSLGAPSTPFFKDTIAVGAFAAIKKGIFVSCSAGNSGPSKNTLANEAPWILTVGAS  313

Query  1453  TIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG-SKDEDAALCGPGSLdkvdv  1277
             TIDR I A A L +G    GES FQ  +F    LPL+Y G S  E +  C  GSL+K++V
Sbjct  314   TIDRKIVALAKLESGKVFTGESLFQPRDFSSKFLPLVYAGKSGIEGSEYCVEGSLEKLNV  373

Query  1276  kgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGL  1097
              GK+V+C+RGGGI R+ KG  VK+ GGAAMIL+NQ  DG++ LA+ HVLP T LSY DGL
Sbjct  374   TGKIVVCERGGGIGRIAKGLVVKNGGGAAMILVNQKPDGFSTLAEAHVLPTTHLSYEDGL  433

Query  1096  KVKDYINSTSWPTATIVFKGTFIGTKT---APSVASFSSRGPSNASPGILKPDILGPGVN  926
             K+K+YINS+  P A+I F+GT +G +    +P++ASFSSRGP  ASPGILKPDI GPGVN
Sbjct  434   KIKEYINSSHNPKASISFEGTLLGNRATTFSPAMASFSSRGPCQASPGILKPDITGPGVN  493

Query  925   ILAAWPV-gnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITT  749
             ILAAWP   NN  N N  +TFN+ISGTSM+ PHLSGIA L+KS HP+WSPAAIKSAI+T+
Sbjct  494   ILAAWPFPLNNNTNTNTKSTFNVISGTSMSCPHLSGIAALIKSNHPNWSPAAIKSAIMTS  553

Query  748   ADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQ  569
             AD  N  G  I+D+ L PA+ FA G GHVNPS+A++PGL+YD+Q DDY+PYLC L YTD 
Sbjct  554   ADVRNPQGKPIVDQDLKPANFFAMGSGHVNPSKAANPGLVYDIQPDDYVPYLCHL-YTDA  612

Query  568   EIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPF  389
             ++  IV+R+V CS V+ I E  LNYPSFA+ LG  S  ++RTVTNVG+ANS+Y   V   
Sbjct  613   QVSIIVRRQVTCSTVSRIREGDLNYPSFAVSLG-ASQAFNRTVTNVGDANSVYYAIVKAP  671

Query  388   LGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFV-------QGAIAWVSQRHIVK  230
              GV V VTP  L F+++N++LTY+++FS        DFV       +G + WVS +HIV+
Sbjct  672   AGVSVRVTPRNLKFSKLNEKLTYSVTFS------RXDFVRTRSELSEGYLIWVSNKHIVR  725

Query  229   SPIAI  215
             SPI++
Sbjct  726   SPISV  730



>emb|CAA07250.1| serine protease [Solanum lycopersicum]
Length=747

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/727 (56%), Positives = 525/727 (72%), Gaps = 21/727 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSE--DYRSYFRSF-------VSESGDEGERSRIVHSYRHVASG  2192
             +TY+VHV  P + I+  S   D  SY+ SF       +S SG+E E + +++SY +V +G
Sbjct  25    ETYLVHVESPESLISTQSSLTDLDSYYLSFLPKTTTAISSSGNE-EAATMIYSYHNVMTG  83

Query  2191  FAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVG  2012
             FAA+L+ E V EM K  GF+SA++QR  +L TTH+ +FLGL QN G W++S+YGKGVI+G
Sbjct  84    FAARLTAEQVKEMEKIHGFVSAQKQRTLSLDTTHTSSFLGLQQNMGVWKDSNYGKGVIIG  143

Query  2011  VLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppPVD  1835
             V+DTGI P+HPSF+D  MPPPPAKWKG CE   T  CNNKLIGAR++          P+D
Sbjct  144   VIDTGILPDHPSFSDVGMPPPPAKWKGVCESNFTNKCNNKLIGARSY----QLGHGSPID  199

Query  1834  EEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamd  1655
             ++GHGTHTASTAAG FV  A VFG+A GTA G+AP AH+++YKVC  DGCA++D+LAAMD
Sbjct  200   DDGHGTHTASTAAGAFVNGANVFGNANGTAAGVAPFAHIAVYKVCNSDGCADTDVLAAMD  259

Query  1654  aaidd-gvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAP  1478
             AAIDD    +     GGGS+ F+ + IA+GA++A E+GI VSC+AGN GP   ++ NEAP
Sbjct  260   AAIDDGVDILSISLGGGGSSDFYSNPIALGAYSATERGILVSCSAGNNGPSTGSVGNEAP  319

Query  1477  WLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDED---AALC  1307
             W+LTVGAST DR +KAT  LGNG + +GESA++ +    T   L   G    D      C
Sbjct  320   WILTVGASTQDRKLKATVKLGNGEEFEGESAYRPKISNSTFFALFDAGKNASDEFETPYC  379

Query  1306  GPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLP  1127
               GSL    ++GK+V+C  GGG+ RVDKGQ VKDAGG  MI++NQ   G T  AD HVLP
Sbjct  380   RSGSLTDPVIRGKIVICLAGGGVPRVDKGQAVKDAGGVGMIIINQQRSGVTKSADAHVLP  439

Query  1126  ATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPD  947
             A ++S  DG K+  Y+NSTS P ATI F+GT IG K AP VA+FSSRGPS AS GILKPD
Sbjct  440   ALDISDADGTKILAYMNSTSNPVATITFQGTIIGDKNAPIVAAFSSRGPSGASIGILKPD  499

Query  946   ILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIK  767
             I+GPGVNILAAWP   + N     +TFNIISGTSM+ PHLSG+A LLKS HPDWSPAAIK
Sbjct  500   IIGPGVNILAAWPTSVDDNKNTK-STFNIISGTSMSCPHLSGVAALLKSTHPDWSPAAIK  558

Query  766   SAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCG  587
             SA++TTAD  NL  + ILDERL+PAD++A G GHVNPSRA+DPGL+YD   +DY+PYLCG
Sbjct  559   SAMMTTADTLNLANSPILDERLLPADIYAIGAGHVNPSRANDPGLVYDTPFEDYVPYLCG  618

Query  586   LNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIW-LGKTSLTYSRTVTNVGEANSMY  410
             LNYT++++  ++QRKV CS+V SI EAQLNYPSF+I+ LG T  TY+RTVTNVG+A S Y
Sbjct  619   LNYTNRQVGNLLQRKVNCSEVKSILEAQLNYPSFSIYDLGSTPQTYTRTVTNVGDAKSSY  678

Query  409   TVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVK  230
              V+V+   GV + V P  L F+E+NQ+LTY ++FS ++   + + ++G + W S RH V+
Sbjct  679   KVEVASPEGVAIEVEPSELNFSELNQKLTYQVTFSKTANSSNTEVIEGFLKWTSNRHSVR  738

Query  229   SPIAIIF  209
             SPIA++ 
Sbjct  739   SPIALLL  745



>ref|XP_008437177.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=754

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/752 (57%), Positives = 545/752 (72%), Gaps = 31/752 (4%)
 Frame = -1

Query  2398  VVVCLTLVFHSVASAKYE---------DTYIVHVSPPAAAINGVSEDYRSYFRSFVSES-  2249
             + +   L FH   + K E          TYIVHV  P   I G + D ++++ SF+ E+ 
Sbjct  7     ICIFFFLNFHGYVAMKTELSSTSNTNLQTYIVHVKQPVLEILGDTIDLQNWYTSFLPETI  66

Query  2248  -GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLG  2072
                  E+ R+++SYRHV SGF+A+L+ E V  M +K GFISA  +   NL+TTH+P +LG
Sbjct  67    EASSDEQPRLLYSYRHVMSGFSARLTKEQVKAMEEKDGFISAMPETTLNLHTTHTPEYLG  126

Query  2071  LYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKL  1892
             L ++FG W+NS++GKGVI+GVLDTGI PNHPSFNDE M  PPAKWKG+CEF  + CNNKL
Sbjct  127   LNKHFGLWKNSNFGKGVIIGVLDTGIHPNHPSFNDEGMSSPPAKWKGRCEFGASICNNKL  186

Query  1891  IGARNF-VSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLS  1715
             IGAR F ++        P DE GHGTHTASTAAG FV  A   G+A+G AVGMAPLAH++
Sbjct  187   IGARTFNLANNFVIGKSPNDENGHGTHTASTAAGTFVKGAEALGNARGKAVGMAPLAHIA  246

Query  1714  IYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFV  1535
             +YKVC+ +GC+ SDILAA+DAAIDDGVDVLSLSLG  S  FF D+IA+GAFAA++KGIFV
Sbjct  247   MYKVCSPNGCSSSDILAALDAAIDDGVDVLSLSLGAPSTPFFRDTIAMGAFAAIKKGIFV  306

Query  1534  SCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTL  1355
             SC+AGN GP   TL+NEAPW+LTVGASTIDR I A A LG+G    GES FQ  NFP   
Sbjct  307   SCSAGNSGPSKNTLANEAPWILTVGASTIDRKIVALAKLGSGEVYTGESLFQPRNFPSKF  366

Query  1354  LPLIYPG-SKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILL  1178
             LPL+Y G S  E +  C  GSL+K++V GKVV+C+RGGGI+RV KG  VK+ GGAAMIL+
Sbjct  367   LPLVYAGKSGIEGSEYCIQGSLEKLNVTGKVVVCERGGGISRVAKGLVVKNGGGAAMILI  426

Query  1177  NQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKT---APS  1007
             NQ  +G++ LA+ HVLP T LSY DGLK+K YINS+  P A+I FKGT +G +    +P+
Sbjct  427   NQKPEGFSTLAEAHVLPTTHLSYEDGLKIKAYINSSHNPKASISFKGTLLGNRATTFSPA  486

Query  1006  VASFSSRGPSNASPGILKPDILGPGVNILAAWPV-gnntnngngNATFNIISGTSMATPH  830
             +ASFSSRGP  ASPGILKPDI GPGVNILAAWP   NN  N N  +TFN+ISGTSM+ PH
Sbjct  487   MASFSSRGPCQASPGILKPDITGPGVNILAAWPFPLNNNTNTNTKSTFNVISGTSMSCPH  546

Query  829   LSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSR  650
             LSGIA L+KS HP+WSPAAIKSAI+T+AD  N  G  I+D+ L PA+ FA G GHVNPS+
Sbjct  547   LSGIAALIKSYHPNWSPAAIKSAIMTSADVRNPQGKPIMDQDLKPANFFAMGSGHVNPSK  606

Query  649   ASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLG  470
             A++PGL+YD+Q DDYIPYLC L YTD ++  IV+++V CS V  I E  LNYPSFA+ LG
Sbjct  607   AANPGLVYDIQPDDYIPYLCHL-YTDAQVSIIVRKQVTCSTVPRIREGDLNYPSFAVSLG  665

Query  469   KTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTP  290
               S T++RTVTNVG+ANS+Y   V    GV V VTP  L F+++N+++TY+++FS     
Sbjct  666   AGSQTFNRTVTNVGDANSVYYPIVEAPAGVSVKVTPSNLKFSKLNEKVTYSVTFS-----  720

Query  289   VDIDFV-------QGAIAWVSQRHIVKSPIAI  215
               IDFV       +G + WVS++ +V+SPI++
Sbjct  721   -RIDFVRTTSEFSEGYLIWVSKKLMVRSPISV  751



>ref|XP_007158429.1| hypothetical protein PHAVU_002G152500g [Phaseolus vulgaris]
 gb|ESW30423.1| hypothetical protein PHAVU_002G152500g [Phaseolus vulgaris]
Length=765

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/722 (60%), Positives = 535/722 (74%), Gaps = 17/722 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVS---EDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLS  2174
             TYIV V       +G S    D  S++ S + S +  + +++RI   YR+V  GF+ +L+
Sbjct  49    TYIVRVKKGDEGGDGDSLGSMDLHSWYHSLLPSSTRSDQKQNRITFLYRNVMDGFSVELT  108

Query  2173  PEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGF-WRNSSYGKGVIVGVLDTG  1997
             PE    +++K+  +S R +R ++L+TTH+P+FLGL Q  G  W NS  GKG+I+G+LDTG
Sbjct  109   PEEADALQEKEEVVSVRPERTFSLHTTHTPSFLGLQQGLGGLWSNSDSGKGIIIGILDTG  168

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppPVDEEGHG  1820
             ITP+HPSF+DE MP PPAKWKG CEF G   CNNKLIGAR+F+    S    P+D  GHG
Sbjct  169   ITPDHPSFSDEGMPFPPAKWKGLCEFSGRRTCNNKLIGARHFIKS--SNSSLPLDHVGHG  226

Query  1819  THTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaidd  1640
             THTASTA G FV  A VFG+AKGTAVGMAP AHL+IYKVC   GC+ES ILA MD AI+D
Sbjct  227   THTASTATGRFVQGANVFGNAKGTAVGMAPDAHLAIYKVCDIFGCSESAILAGMDTAIED  286

Query  1639  gvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVG  1460
             GVDVLSLS+GG S   F+D IA+GAF+A++KGIFVSC+AGN GP Y TLSNEAPW+LTVG
Sbjct  287   GVDVLSLSIGGRSGPLFDDPIALGAFSAIQKGIFVSCSAGNSGPGYTTLSNEAPWILTVG  346

Query  1459  ASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS-KDEDAALCGPGSLdkv  1283
             ASTIDR I A A LGNG   +GES FQ  NF  TLLPL+Y GS  +  ++LC PGSL+ V
Sbjct  347   ASTIDRRIVAAAKLGNGQVFNGESVFQPNNFTSTLLPLVYAGSIGNSSSSLCAPGSLENV  406

Query  1282  dvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYND  1103
             DVKGKVVLC+ GG I RV KGQ VK+AGG AMIL+N   + +   AD HVLPAT +SY  
Sbjct  407   DVKGKVVLCEVGGFIRRVSKGQEVKNAGGVAMILMNSLKEDFNPFADVHVLPATHVSYPA  466

Query  1102  GLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNI  923
             GL +K YINSTS PTATI+F GT IG+ +AP+V SFSSRGPS ASPGILKPDI+GPG NI
Sbjct  467   GLAIKSYINSTSTPTATILFGGTVIGSVSAPAVTSFSSRGPSFASPGILKPDIIGPGQNI  526

Query  922   LAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTAD  743
             LAAWPV  + N      +FNI+SGTSM+ PHLSGIA LLK++HPDWSPAAIKSAI+T+A+
Sbjct  527   LAAWPVSLDNNV----PSFNILSGTSMSCPHLSGIAALLKNSHPDWSPAAIKSAIMTSAN  582

Query  742   QYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEI  563
               NL G  ILDERL+PADVFATG GHVNP +A+DPGL+YD++ +DYIPYLCGLNYTD+E+
Sbjct  583   AVNLGGKSILDERLLPADVFATGAGHVNPLKANDPGLVYDIEPNDYIPYLCGLNYTDEEV  642

Query  562   QQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLG  383
               I+ + V+CSQV SIP+AQLNYPSF+I LG TS  Y+RT+TNVG A+  Y V++   LG
Sbjct  643   GLILNQNVDCSQVKSIPQAQLNYPSFSIRLGSTSQFYTRTLTNVGAASVTYNVEIEAPLG  702

Query  382   VDVGVTPDTLVFTEVNQQLTYNISFSPSSTPV--DIDFVQGAIAWVS--QRHIVKSPIAI  215
             V + ++P  + FTEV Q++TY++ F P       +  F QG+I WVS   ++ V  PIA+
Sbjct  703   VGISISPAEITFTEVKQKVTYSVGFVPEDKKNRGNHPFSQGSIRWVSGNGKYSVSIPIAV  762

Query  214   IF  209
             +F
Sbjct  763   VF  764



>ref|XP_009760953.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=748

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/721 (57%), Positives = 524/721 (73%), Gaps = 14/721 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAA--AINGVSEDYRSYFRSF----VSESGDEGERSRIVHSYRHVASGFAA  2183
             + YIV V  P +   I     D  S++ SF    ++ +G   ++ R+++SY +V  GFAA
Sbjct  27    EIYIVQVESPESRIGIQSSRTDLESWYSSFLPKTIATTGSNEDQPRLIYSYHNVMKGFAA  86

Query  2182  KLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLD  2003
             +LS E V EM+KK GFISAR QR+  L+TTHSP+FLGL QN G WR+S+YGKGVIVGVLD
Sbjct  87    RLSVEHVKEMQKKPGFISARPQRILFLHTTHSPSFLGLQQNMGLWRDSNYGKGVIVGVLD  146

Query  2002  TGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARNFVSEGssppppPVDEEG  1826
             TGI P+HPSF+D+ MPPPPAKWKGKCE    T CNNKLIGAR F          P+D+ G
Sbjct  147   TGIYPDHPSFSDKGMPPPPAKWKGKCESNFTTKCNNKLIGARTF----GQASETPLDDNG  202

Query  1825  HGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaai  1646
             HGTHTAST AG FV  A V G+A GTAVG+APLAHL+IYKVC   GC++SDILAAMDAAI
Sbjct  203   HGTHTASTIAGRFVDGANVNGNANGTAVGIAPLAHLAIYKVCDSFGCSDSDILAAMDAAI  262

Query  1645  ddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLT  1466
             DDGVD+LSLSLGGGS +F+ D IA+GA++A ++GI VSC+  N GP   TLSNEAPW++T
Sbjct  263   DDGVDILSLSLGGGSKAFYNDPIALGAYSATQRGILVSCSGANNGPYDSTLSNEAPWIMT  322

Query  1465  VGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG--SKDEDAALCGPGSL  1292
             VGASTIDR +KAT  LGN  + +GESAF  +       PL  P   + D D+  CG G+L
Sbjct  323   VGASTIDRKLKATVKLGNRKEFEGESAFHPKGHNSAFFPLFDPALNATDFDSPYCGTGTL  382

Query  1291  dkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELS  1112
             +  D+KGK+VLC  GGG +R++KGQ VKDAGG  MI+ +   DG+T  AD HVLPA  ++
Sbjct  383   NDPDIKGKIVLCMAGGGYSRIEKGQAVKDAGGVGMIIYSSPDDGFTKFADAHVLPALYIT  442

Query  1111  YNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPG  932
             Y DG+++ DY+N+TS P A + F+GT IG K AP VA+FSSRGPS+ASPGILKPDI+GPG
Sbjct  443   YKDGIEILDYMNTTSKPIARLAFQGTIIGDKDAPVVAAFSSRGPSSASPGILKPDIIGPG  502

Query  931   VNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIIT  752
             VNILAAWP  +  N       F + SGTSM+ PHLSG+A LLKSAHP WSPA IKSAI+T
Sbjct  503   VNILAAWP-PSPDNKPTIKPNFFLASGTSMSCPHLSGVAALLKSAHPTWSPAVIKSAIMT  561

Query  751   TADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTD  572
             TA+  NL    ILDERL+PA++FA G GHVNPS+A+DPGL+YD +  DY+PYLCGLNYT+
Sbjct  562   TANIVNLANDPILDERLLPANIFAVGAGHVNPSKANDPGLVYDTRFKDYLPYLCGLNYTN  621

Query  571   QEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSP  392
             +++  ++QR+V+C QV SIPEAQLNYPSF+I LG  S  Y+RTVTN G+A S Y V++  
Sbjct  622   RQVGNLLQRRVDCKQVKSIPEAQLNYPSFSITLGANSQIYTRTVTNTGDAKSSYNVEIGS  681

Query  391   FLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAII  212
               GV V V P TL F+++NQ+  Y ++FS  +   +   VQG + W S ++ V+SPIA++
Sbjct  682   PPGVSVIVKPSTLKFSKLNQKFKYQVTFSKRANSSNSGIVQGFLKWTSNKYSVRSPIAVV  741

Query  211   F  209
              
Sbjct  742   L  742



>gb|KDP25554.1| hypothetical protein JCGZ_20710 [Jatropha curcas]
Length=746

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/716 (58%), Positives = 529/716 (74%), Gaps = 16/716 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             +TYIV +  P  A+   S+D  S+++SF+ +      + R+VHSY  V +GFAAKL+ E 
Sbjct  44    ETYIVFLEKPEGAVFKDSKDLDSWYQSFLPDDTFSSNQPRLVHSYHQVVTGFAAKLTTEE  103

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             V E+ KK+GF+SAR +R+  L+TTH+P+FLGL QN GFW  S+YGKGVI+G++D+GITP+
Sbjct  104   VKEIAKKEGFVSARPRRMVPLHTTHTPSFLGLQQNIGFWNYSNYGKGVIIGLIDSGITPD  163

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppPVDEEGHGTHTA  1808
             HPSF+ E MPPPPAKWKGKCE  GT +CNNKLIGARNF  + ++      DE  HGTHTA
Sbjct  164   HPSFSGEGMPPPPAKWKGKCELNGTYSCNNKLIGARNFALDSNNTD----DEYHHGTHTA  219

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCA-ESdilaamdaaiddgvd  1631
             STAAGN V  A+ FG A GTAVGMAPLAHL++YKV      A +S+ILAAMDAA++D VD
Sbjct  220   STAAGNPVEGASYFGHANGTAVGMAPLAHLAMYKVSGRASEAGDSEILAAMDAAVEDNVD  279

Query  1630  vlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAST  1451
             VLSLSLG GS  F++D IA+GA+AA++KGIFVSC+AGN GP   +LSNEAPW+LTVGAST
Sbjct  280   VLSLSLGIGSHPFYDDVIALGAYAAIQKGIFVSCSAGNSGPWNSSLSNEAPWILTVGAST  339

Query  1450  IDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvk  1274
             +DR I+AT +LGN  +L+GES FQ  +FP TLLPL+Y G+  +E +A C PGSL  +DVK
Sbjct  340   VDRAIRATVLLGNNVELNGESLFQPADFPSTLLPLVYAGADGNESSAYCEPGSLANIDVK  399

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             GK+VLC+  GG   + KG+ VK+ GG AMI +N + DG+   A  HVLPA+ +SY DGL 
Sbjct  400   GKIVLCE--GGYGSISKGEEVKNNGGVAMIAMNGEYDGFVTGAQLHVLPASRVSYMDGLA  457

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             +K YI ST  P ATI+FKGT  G   AP +A FSSRGP+ ASPGILKPDI+GPGV ILAA
Sbjct  458   IKAYIYSTPSPNATILFKGTVTGLPNAPQLAEFSSRGPNIASPGILKPDIIGPGVKILAA  517

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             WPV  + +       F +ISGTSM+ PHLSGIA LLK+AHPDWSPAAIKSAI+T A+  +
Sbjct  518   WPVSVDNS-----TKFAMISGTSMSCPHLSGIAALLKNAHPDWSPAAIKSAIMTAANLVD  572

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             L G  I DE+ V   VF  G GHVNPSRA+DPGLIYD+Q DDYIPYLCGL Y+D+++  I
Sbjct  573   LGGKPISDEQFVTTTVFDIGAGHVNPSRANDPGLIYDIQPDDYIPYLCGLGYSDKQVGLI  632

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDV  374
             VQ  V CS  +++ EAQLNYPSF+I LG T  TY+RTVTNVG+ NS+YT+++    GV++
Sbjct  633   VQHTVTCSNDSNVLEAQLNYPSFSIKLGSTPQTYTRTVTNVGQPNSIYTLEILAPEGVNI  692

Query  373   GVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
              VTPDT+ F  VNQ+ TY+++FS           QG + WV+  + V+SPIA+IF+
Sbjct  693   KVTPDTINFNGVNQKATYSVTFSRDEYASGA--TQGYLNWVADGYSVRSPIAVIFE  746



>ref|XP_007210332.1| hypothetical protein PRUPE_ppa002068mg [Prunus persica]
 gb|EMJ11531.1| hypothetical protein PRUPE_ppa002068mg [Prunus persica]
Length=721

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/721 (56%), Positives = 506/721 (70%), Gaps = 43/721 (6%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSE--SGDEGERSRIVHSYRHVASGFAAKLSP  2171
              TYIVHV  P   +   +ED +S+  SF+    +    E+ R+++SY+ V SGFAA+L+ 
Sbjct  36    QTYIVHVRKPEGRVFAQTEDLKSWHESFLPAITTASSDEQPRMLYSYQEVISGFAARLTQ  95

Query  2170  EMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGIT  1991
             E V  M++  GF++A  +RV+   TTH+PNFLGL+Q  G W+ S++GKGVI+GVLD GI 
Sbjct  96    EQVRAMKEMDGFVAAHPERVFRRKTTHTPNFLGLHQQKGIWKESNFGKGVIIGVLDGGIE  155

Query  1990  PNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGAR--NFVSEGssppppPV--DEEGH  1823
             PNHPSF+   +PPPPAKWKG+C+F  + CNNKLIGAR  N  ++      P    D +GH
Sbjct  156   PNHPSFSGAGIPPPPAKWKGRCDFNASDCNNKLIGARAFNLAAQALKGDQPEAPNDIDGH  215

Query  1822  GTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaid  1643
             GTHTASTAAG FV NA V G+AK        +  +S+     ED                
Sbjct  216   GTHTASTAAGAFVQNADVLGNAKAAVQDGVDVISISL----GED----------------  255

Query  1642  dgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTV  1463
                          S  FF DS AIG+FAA++KGIFVSC+AGN GP   TLSNEAPW+LTV
Sbjct  256   -------------SVPFFNDSTAIGSFAAIQKGIFVSCSAGNSGPFNGTLSNEAPWILTV  302

Query  1462  GASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDE-DAALCGPGSLdk  1286
             GASTIDR I ATA LGNG + DGES FQ ++FP TLLPL+Y G   + ++ALC  GSL  
Sbjct  303   GASTIDRRIVATAKLGNGEEFDGESLFQPKDFPSTLLPLVYAGVNGKANSALCAEGSLKG  362

Query  1285  vdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYN  1106
             + VKGKVVLC+RGGGI R+ KG+ VK+AGGAAMIL+N++ DG++  AD HVLPAT +S+ 
Sbjct  363   LSVKGKVVLCERGGGIGRIAKGEEVKNAGGAAMILVNEETDGFSTSADVHVLPATHVSHA  422

Query  1105  DGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVN  926
              GLK+K YINST+ PTATI+FKGT IG  + P+VASFSSRGPS ASPGILKPDI+GPGV+
Sbjct  423   AGLKIKAYINSTATPTATILFKGTVIGDSSTPAVASFSSRGPSLASPGILKPDIIGPGVS  482

Query  925   ILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTA  746
             ILAAWP   +    +    FNIISGTSM+ PHLSGIA LLKS+HP WSPAAIKSAI+T+A
Sbjct  483   ILAAWPFPVDNTTNSK-VNFNIISGTSMSCPHLSGIAALLKSSHPYWSPAAIKSAIMTSA  541

Query  745   DQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQE  566
             D  NL G  I DE L PADV ATG GHVNPS+A+DPGL+YD+Q DDYIPYLCGL Y D E
Sbjct  542   DLLNLEGKPIPDETLQPADVLATGVGHVNPSKANDPGLVYDIQPDDYIPYLCGLGYKDDE  601

Query  565   IQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFL  386
             +  +V R ++CS+V+SIPE +LNYPSF++ LG  S T++RTVTNVGEA S Y VKV+   
Sbjct  602   VSILVHRPIKCSKVSSIPEGELNYPSFSVALGP-SQTFTRTVTNVGEAYSSYAVKVNAPE  660

Query  385   GVDVGVTPDTLVFTEVNQQLTYNISFSP-SSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              V V + P TL F++VNQ+L+Y+++FS   S     +F QG + WVS +H+V+SPI++  
Sbjct  661   EVYVSINPKTLYFSKVNQKLSYSVTFSRIGSRGKAGEFTQGFLTWVSAKHVVRSPISVKL  720

Query  208   Q  206
             Q
Sbjct  721   Q  721



>ref|XP_006363699.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=742

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/724 (57%), Positives = 521/724 (72%), Gaps = 19/724 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSF-------VSESGDEGERSRIVHSYRHVASGFA  2186
             +TYIVHV    ++ + ++ D  SY+ SF       +S SG+E E + +++SY  V  GFA
Sbjct  25    ETYIVHVESQISSQSSLT-DLESYYLSFLPKSTTTISSSGNE-EAASMIYSYHSVMKGFA  82

Query  2185  AKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVL  2006
             A+L+   V EM KK+GF+SA++QR+ +L+TTH+P+FLGL QN G W++S+YGKGVI+G +
Sbjct  83    ARLTAAQVKEMEKKRGFVSAQKQRILSLHTTHTPSFLGLQQNIGVWKDSNYGKGVIIGDI  142

Query  2005  DTGITPNHPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppPVDEE  1829
             D GI P+HPSF+D  MPPPPAKW G CE   T   NNKLIGAR++          P+D+ 
Sbjct  143   DNGIFPDHPSFSDVGMPPPPAKWNGVCESNFTNKYNNKLIGARSY----QLGNGSPIDDT  198

Query  1828  GHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaa  1649
             GHGTH A TAAG FV  A VFG+A GTAVG+APLAH++IYKVC  DGCAE DI+AAMDAA
Sbjct  199   GHGTHIAGTAAGAFVKGANVFGNANGTAVGVAPLAHIAIYKVCNSDGCAEIDIIAAMDAA  258

Query  1648  iddgvdvlslsl-gggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWL  1472
             I DGVD+LSLSL       F  D+IA+GA++A E+GI VSC+AGN GP   ++ N APW+
Sbjct  259   IADGVDILSLSLGERSRLPFHSDNIALGAYSATERGILVSCSAGNSGPFRGSVENTAPWI  318

Query  1471  LTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG---SKDEDAALCGP  1301
             LTVGASTIDR +KAT  LGN  + +GESA+  +    T   L   G   S   +   C P
Sbjct  319   LTVGASTIDRKMKATVKLGNREEFEGESAYHPKISNSTFFTLFDAGENISDQSETPYCKP  378

Query  1300  GSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPAT  1121
             GSL+   V+GK+VLC   GG+  VD+GQ VKDAGG  MI++N   D  T  AD HVLPA 
Sbjct  379   GSLNDTAVRGKIVLCLADGGVPGVDQGQAVKDAGGVGMIIINSPDDRVTKSADAHVLPAM  438

Query  1120  ELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDIL  941
             ++S  DG K++ Y+NSTS P ATI F+GT IG K AP+VASFSSRGPS  SPGILKPDI+
Sbjct  439   DVSAADGTKIRAYMNSTSNPVATITFQGTIIGDKNAPAVASFSSRGPSRVSPGILKPDII  498

Query  940   GPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSA  761
             GPGVNILAAWP   + N     +TFNIISGTSMA PHLSG+A LLKSAHPDWSPAAIKSA
Sbjct  499   GPGVNILAAWPTFVDDNKNTK-STFNIISGTSMACPHLSGVAALLKSAHPDWSPAAIKSA  557

Query  760   IITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLN  581
             I+TTAD  NL  + ILDERL+PAD+FA G GHVNPSRA+DPGLIYD   +DY+PYLCGL 
Sbjct  558   IMTTADTLNLANSPILDERLIPADIFAIGAGHVNPSRANDPGLIYDTPFEDYVPYLCGLK  617

Query  580   YTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVK  401
             YT +E+  ++QRKV+CS+V SIPEAQLNYPSF+I LG T  TY+RTVTNVG+A S Y V+
Sbjct  618   YTSREVGYLLQRKVKCSEVKSIPEAQLNYPSFSIRLGSTPQTYTRTVTNVGDAKSSYKVE  677

Query  400   VSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPI  221
             ++   GV + V P  L F+ +NQ+LTY ++FS ++   +   ++G + W S RH V+SPI
Sbjct  678   IASPKGVVMKVKPSKLNFSMLNQKLTYQVTFSKTTNSSNPGVIEGFLKWTSNRHSVRSPI  737

Query  220   AIIF  209
             AI+ 
Sbjct  738   AIVL  741



>gb|EYU39029.1| hypothetical protein MIMGU_mgv1a019332mg, partial [Erythranthe 
guttata]
Length=718

 Score =   752 bits (1942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/721 (59%), Positives = 522/721 (72%), Gaps = 19/721 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             +TYIVHV           +D  S++ SF+  S   G   R+V+SYR V  GFAA+LS + 
Sbjct  9     ETYIVHVDVNLGFFARF-KDLESWYTSFLPTSNGRG---RLVYSYRKVFKGFAARLSADE  64

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             V  M    GF+SAR +R    +TTHSPNFLGL QN GFW  S+YGKGVI+GVLD+G+ P+
Sbjct  65    VKAMENNPGFVSARPERKLEKHTTHSPNFLGLNQNMGFWEGSNYGKGVIIGVLDSGVFPS  124

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             HPSF+DE MPPPPAKWKGKCEF  T CNNK+IGAR F    S     P+D++GHGTHTAS
Sbjct  125   HPSFSDEGMPPPPAKWKGKCEFNPTTCNNKIIGARYF----SVFDDSPLDDDGHGTHTAS  180

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAG+FV  A VFG+A GTA G+AP+AHL+IYKVC+   C ESDI+AAMD AI+DGVD+L
Sbjct  181   TAAGSFVAGANVFGNANGTAAGIAPMAHLAIYKVCSL-FCFESDIIAAMDTAIEDGVDIL  239

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
             SLSLGG S SF +DSIA+GAF+AME GI VSC+AGN GP   +L NEAPW+LTVGASTID
Sbjct  240   SLSLGGFSFSFHDDSIALGAFSAMENGILVSCSAGNSGPFNLSLENEAPWILTVGASTID  299

Query  1444  RTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS---KDEDAALCGPGSLdkvdvk  1274
             R I+ATA+LGN    DGESAFQ  +FP TLLPL+Y GS    D     C   SL+K +++
Sbjct  300   RKIRATALLGNNETFDGESAFQPLDFPSTLLPLVYAGSLNTSDPYIRFCTAESLNKTNLQ  359

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             G +V+CD  G +AR+ KG  VK+AGGAAMIL+N      T  A  HVLPAT + Y DGLK
Sbjct  360   GMIVVCD-AGVVARLSKGIAVKNAGGAAMILVNHQYSANTTAAQAHVLPATHVGYADGLK  418

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             +K YINST  P ATI+FKGT IG   AP VA+FSSRGP+  SPGILKPDILGPGVNILAA
Sbjct  419   IKTYINSTITPMATILFKGTIIGDDRAPVVAAFSSRGPNYISPGILKPDILGPGVNILAA  478

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             WP     N    +   NIISGTSM+ PHLSG+A L+KS HPDWSPA+IKSAI+TTAD  N
Sbjct  479   WPFSIENNTNTNSTF-NIISGTSMSCPHLSGVAALIKSVHPDWSPASIKSAIMTTADVVN  537

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             L    I DER VPA++FATG GHVNPSRASDPGL+YD+  +DY+PYLCGLNYT++++  I
Sbjct  538   LALNPIEDERFVPANIFATGSGHVNPSRASDPGLVYDIHPEDYLPYLCGLNYTNRQVGTI  597

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWLGKT---SLTYSRTVTNVGEANSMYTVKVSPFLG  383
             +QR+V CS    IP+AQLNYPSFAI  G++   + TY+RTVTNVGE  S Y V++ P  G
Sbjct  598   LQRRVNCSVEARIPDAQLNYPSFAITFGRSQPITQTYTRTVTNVGEPVSSYVVEIVPPPG  657

Query  382   VDVGVTPDTLVFTEVNQQLTYNISFSP-SSTPVDIDFVQGAIAWVSQ-RHIVKSPIAIIF  209
             + V V P TL FTEVN  L Y ++F+   ST  +  ++QG + W S  ++ V++PIA+I 
Sbjct  658   IGVVVEPTTLDFTEVNPILQYQVTFTRLDSTTNNAGYIQGYLKWNSGVKYSVRTPIAVIL  717

Query  208   Q  206
             +
Sbjct  718   R  718



>ref|XP_004511627.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=763

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/727 (57%), Positives = 520/727 (72%), Gaps = 24/727 (3%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
             TYIVHV     A    S+D   +F SF+ ++     ++R+V +YR+VASGFA KL+PE  
Sbjct  46    TYIVHVKKSENAATLQSQDLHEWFHSFLPQTS---HKNRMVFTYRNVASGFAVKLTPEEA  102

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
               +++K+  +SAR +R  +L+TTH+P FLGL Q  G W   + GKGVI+G++DTGI P H
Sbjct  103   KSLQEKEEIVSARPERKLSLHTTHTPTFLGLKQGQGLWNYDNLGKGVIIGIIDTGINPFH  162

Query  1981  PSFNDENMPPPPAKWKGKCEF-EGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             PSFNDE M PPPAKWKG CEF  G  CNNKL+GARN V       P   ++  HGTHTA+
Sbjct  163   PSFNDEGMAPPPAKWKGYCEFTRGRTCNNKLLGARNLVKSAMQELPN--EDVFHGTHTAA  220

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCT---EDGCAESdilaamdaaiddgv  1634
              AAG FV +A+VFG+A G A GMAP AH++IYKVCT   E GC ES ILAAMD AI+DGV
Sbjct  221   EAAGRFVEDASVFGNAGGVAAGMAPNAHIAIYKVCTIIDEIGCPESAILAAMDMAIEDGV  280

Query  1633  dvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAS  1454
             DVLSLSLG GS  FFEDSIAIGAFAA + GIFVSC+AGN GPDY TLSNEAPW+LTVGAS
Sbjct  281   DVLSLSLGLGSLPFFEDSIAIGAFAATQNGIFVSCSAGNSGPDYSTLSNEAPWILTVGAS  340

Query  1453  TIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS---------KDEDAALCGP  1301
             TIDR I A+A LG+G + +GE+ FQ ++F   L PL+Y GS         +  D +LC P
Sbjct  341   TIDRKIVASAKLGDGEEYEGETLFQPKDFSQQLFPLVYAGSYGNSNQSETQTSDQSLCFP  400

Query  1300  GSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPAT  1121
             GSL  VD++GKVVLCD GGGI    KGQ V ++GG AMIL N +  G +  A  +VLPA 
Sbjct  401   GSLKNVDLRGKVVLCDAGGGIPSDLKGQEVLNSGGVAMILANPEELGVSTFATPNVLPAV  460

Query  1120  ELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDIL  941
             E+SY  GL +K YIN T+ PT+T++FKGT IG   APSV +FSSRGP+  SPGILKPDI+
Sbjct  461   EVSYAAGLSIKSYINLTNTPTSTLLFKGTVIGDSLAPSVVTFSSRGPNQESPGILKPDII  520

Query  940   GPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSA  761
             GPGVNILAAW +  +         +NI+SGTSM+ PHLSGIA LLKS+HPDWSPAAIKSA
Sbjct  521   GPGVNILAAWGISVDNKI----PPYNIVSGTSMSCPHLSGIAALLKSSHPDWSPAAIKSA  576

Query  760   IITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLN  581
             I+TTA   NL G  I+D+RL+PADVFATG GHVNP +A+DPGL+YD++ +DY+ YLCGL 
Sbjct  577   IMTTATTKNLAGLPIMDQRLLPADVFATGAGHVNPVKANDPGLVYDIKPEDYVSYLCGLG  636

Query  580   YTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVK  401
             Y+D+EI+ I+Q KV C  V SI EA+LNYPSF+I LG  S  Y+RT+TNVG  NS Y VK
Sbjct  637   YSDKEIEIIIQWKVNCFDVKSIAEAELNYPSFSIRLGSDSQFYTRTLTNVGPVNSTYRVK  696

Query  400   VSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPV--DIDFVQGAIAWVSQRHIVKS  227
             +   L + + V P  + F+EVNQ+++Y++ F P       +  F QG+I WVS +H V+ 
Sbjct  697   IEEPLALGMSVNPTEITFSEVNQKVSYSVDFIPQGKENRGNATFAQGSITWVSDKHAVRV  756

Query  226   PIAIIFQ  206
             PI++IF+
Sbjct  757   PISVIFK  763



>ref|XP_010317341.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=730

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/744 (57%), Positives = 527/744 (71%), Gaps = 33/744 (4%)
 Frame = -1

Query  2416  NMAYISVVVCLTLVFHSVASAKYED---------TYIVHVSPPAAAINGVSEDYRSYFRS  2264
             ++  IS++     +FHS  S  + D         TYIV +  P   +   + D   + +S
Sbjct  2     DLKLISLIFFWVFLFHS--SKTFGDHFTNRSDLHTYIVQLEFPDDIVLSDTNDLHLWHQS  59

Query  2263  FV-SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHS  2087
             F+ + S +    SRI++SYRHV  GFAA LS + V E+  K GF+SAR QR+  L TTH+
Sbjct  60    FLPTTSANSHLSSRIIYSYRHVFHGFAAMLSSDEVKEIELKPGFVSARPQRIVELDTTHT  119

Query  2086  PNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTA  1907
             P+FLGL+QN G W  S+ G+GVI+G+LD+GITP HPSF+D  MPPPPAKWKGKCEF   A
Sbjct  120   PSFLGLHQNVGLWNTSNSGEGVIIGLLDSGITPKHPSFSDNEMPPPPAKWKGKCEFNSKA  179

Query  1906  CNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPL  1727
             CNNKLIGARNFV+        P+D EGHGTHT+STAAGNFV  A + G+A GTAVG+AP 
Sbjct  180   CNNKLIGARNFVT----TSASPLDVEGHGTHTSSTAAGNFVNGANLLGNANGTAVGIAPR  235

Query  1726  AHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEK  1547
             AHL++Y+VC +  C ES ILA +++A++DGVDVLS+SLGG    F+EDS+AIGAF+A++K
Sbjct  236   AHLAMYRVCDDGVCPESYILAGLESAVEDGVDVLSISLGGTPVPFYEDSLAIGAFSAIQK  295

Query  1546  GIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENF  1367
             GIFVSC+AGN+GP+  TL N APW+LTV A+T DR I+A AVLGNGA+  GESA+Q  N 
Sbjct  296   GIFVSCSAGNKGPEVGTLKNGAPWILTVAAATTDRKIRAVAVLGNGAKYVGESAYQPTNL  355

Query  1366  PPTLLPLIYPGSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAM  1187
                 LPL+       +A  C   SL  +DVKGK+VLCD  G ++R++KG+ VK+AGGAAM
Sbjct  356   SGKWLPLV-------NANGC--ESLSTIDVKGKIVLCDTSGDLSRIEKGEAVKNAGGAAM  406

Query  1186  ILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPS  1007
             IL+N+   GYT +AD HVLPAT +SY +GLK+ +YI ST  P ATI FKGT +G+K  P+
Sbjct  407   ILMNEKKRGYTTIADVHVLPATHVSYFNGLKIINYIKSTPSPVATISFKGTELGSKHVPT  466

Query  1006  VASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHL  827
             VASFSSRGP   SPGILKPDI GPGVNILAAWP    +      +TFNIISGTSMA PHL
Sbjct  467   VASFSSRGPFLPSPGILKPDISGPGVNILAAWPT---SLGEMITSTFNIISGTSMACPHL  523

Query  826   SGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRA  647
             +G+A LLKSAHPDWSPAAIKSAI+TTAD  NL    I DERL  A++F  G G+VNPSRA
Sbjct  524   AGVAALLKSAHPDWSPAAIKSAIMTTADIINLKKHPIEDERLNRANLFTIGSGNVNPSRA  583

Query  646   SDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGK  467
             SDPGLIYD+  +DYIPYLCGL YTDQ++  IV+RKV C+  +SI EA+LNYPSF+I    
Sbjct  584   SDPGLIYDIHPEDYIPYLCGLKYTDQQVSSIVRRKVHCT--SSIAEAELNYPSFSISSKS  641

Query  466   TSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPV  287
              + TY+RTVTNVGEANS YTV+V    GV V V P TL F+ +NQ+ +YN++        
Sbjct  642   RAQTYTRTVTNVGEANSTYTVEVYGLNGVKVAVNPTTLKFSGLNQKASYNVTVKHLK---  698

Query  286   DIDFVQGAIAWVSQRHIVKSPIAI  215
                  QG I W S R+ V SPI I
Sbjct  699   HRSHSQGYITWSSSRYSVTSPIQI  722



>gb|KDP25558.1| hypothetical protein JCGZ_20714 [Jatropha curcas]
Length=733

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/727 (59%), Positives = 541/727 (74%), Gaps = 18/727 (2%)
 Frame = -1

Query  2368  SVASAKYE---DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVA  2198
             S+ + K E   +TYIV +  P  A+   S+D  S+++SF+  +    ++ R+VHSYR V 
Sbjct  19    SIETVKKENNLETYIVLLKKPEGAVFTQSKDLDSWYQSFLPVNSFSSDQPRLVHSYRQVV  78

Query  2197  SGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVI  2018
             +GFAAKL+ + V EM KK GF+SAR +R+  L+TTH+P+FLGL QN GFW  SSYGKGVI
Sbjct  79    TGFAAKLTADEVKEMEKKDGFVSARPRRMVPLHTTHTPSFLGLQQNSGFWNYSSYGKGVI  138

Query  2017  VGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppP  1841
             +G++D+GITP+HPSF+ E MPPPP KWKGKCE  GT +CNNKLIGARNF ++ ++     
Sbjct  139   IGLIDSGITPDHPSFSGEGMPPPPKKWKGKCELNGTYSCNNKLIGARNFATDSNNTD---  195

Query  1840  VDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDG-CAESdila  1664
              DE  HGTHTASTAAG+ V  A  FG   GTA GMAPLAHL++YKV    G   +S+ILA
Sbjct  196   -DEYHHGTHTASTAAGSPVQGANFFGQVNGTASGMAPLAHLAMYKVSGRIGKGGDSEILA  254

Query  1663  amdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNE  1484
             AMDAAI+DGVDVLSLSLG GS  F++D IA+G +AA++KGIFVSC+AGN GP+  +LSNE
Sbjct  255   AMDAAIEDGVDVLSLSLGIGSHPFYDDVIALGTYAAIQKGIFVSCSAGNSGPENTSLSNE  314

Query  1483  APWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALC  1307
             APW+LTVGAST+DR I+AT +LGN A+L+G+S +Q  NFP T+LPL+Y G+  +E +A C
Sbjct  315   APWILTVGASTVDREIRATVLLGNKAELNGQSLYQ-PNFPSTMLPLVYAGANGNESSAYC  373

Query  1306  GPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLP  1127
              PGSL  +DVKGK+VLC+  GG   + KGQ VK+ GGAAMI++N   DG+   A  HVLP
Sbjct  374   EPGSLANIDVKGKIVLCE--GGFGTISKGQEVKNNGGAAMIVMNDKSDGFVTTASLHVLP  431

Query  1126  ATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPD  947
             A+ +SYN G ++K YINSTS PTATI+FKGT  G K AP VA FSSRGPS ASPGILKPD
Sbjct  432   ASHVSYNAGSEIKAYINSTSSPTATILFKGTVTGLKDAPQVADFSSRGPSMASPGILKPD  491

Query  946   ILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIK  767
             I+GPGV ILAAWPV  + +       F +ISGTSM+ PHLSGIA LLKSAHPDWSPAAIK
Sbjct  492   IIGPGVKILAAWPVSVDNSTHR----FAMISGTSMSCPHLSGIAALLKSAHPDWSPAAIK  547

Query  766   SAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCG  587
             SAIIT+A+  NL G  I DE+ VPA +F  G GHVNP  A+DPGLIYD+Q DDYIPYLCG
Sbjct  548   SAIITSANLNNLGGKAISDEQFVPATIFDIGAGHVNPPGANDPGLIYDIQPDDYIPYLCG  607

Query  586   LNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYT  407
             L Y+D ++  IVQ+ V+CS  +SIPEAQLNYPSF+I LG +  TY+RTVTNVG+ NS Y 
Sbjct  608   LGYSDTQVGLIVQQTVKCSNDSSIPEAQLNYPSFSIKLGSSPKTYTRTVTNVGQPNSAYA  667

Query  406   VKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKS  227
             +++S   GVDV VTPD + F+  NQ+ TY+++FS +    +  F QG I WV+    V++
Sbjct  668   LEISAPKGVDVKVTPDKISFSGANQKATYSVTFSKNKNATE-SFAQGYIKWVADGKSVRT  726

Query  226   PIAIIFQ  206
             PIA+IF 
Sbjct  727   PIAVIFN  733



>ref|XP_004245677.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=749

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/746 (56%), Positives = 536/746 (72%), Gaps = 24/746 (3%)
 Frame = -1

Query  2392  VCLTLVFHSVASAKYE---DTYIVHVSPPAAAINGVSE--DYRSYFRSF-------VSES  2249
             V L L+F S      +   + YIVHV  P + I+  S   D  SY+ SF       +S S
Sbjct  6     VLLVLIFCSFPWPTIQSGLEIYIVHVESPESLISTKSSLTDLDSYYHSFLPKTTTAISSS  65

Query  2248  GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGL  2069
             G+E E + +++SY +V  GFAA+L+   V EM KK+GF+SA++QR+ +L TTH+P+FLGL
Sbjct  66    GNE-EAATMIYSYHNVMKGFAARLTESHVKEMEKKRGFVSAQKQRILSLDTTHTPSFLGL  124

Query  2068  YQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEG-TACNNKL  1892
              QN G W++S+YG+GVI+GV+DTGI P+HPSF+D  MPPPPAKWKG CE      CNNKL
Sbjct  125   QQNMGVWKDSNYGEGVIIGVIDTGILPDHPSFSDVGMPPPPAKWKGVCESNFINKCNNKL  184

Query  1891  IGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSI  1712
             IGAR++          P+D  GHGTHTASTAAG FV  A V+G+A GTAVG+APLAH+++
Sbjct  185   IGARSY----HLGNGSPIDGNGHGTHTASTAAGAFVKGANVYGNANGTAVGVAPLAHIAV  240

Query  1711  YKVCTEDG-CAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFV  1535
             YKVC+ DG C++SDILAAMD+AIDDGVD+LS+S+GG   SF++D IA+GA++A  +G+FV
Sbjct  241   YKVCSSDGGCSDSDILAAMDSAIDDGVDILSISIGGSPNSFYDDPIALGAYSATARGVFV  300

Query  1534  SCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTL  1355
             SC+AGN GP   ++ N APW+LTVGAST+DR IKAT  LGNG + +GESA++ +    T 
Sbjct  301   SCSAGNRGPLLASVGNAAPWILTVGASTLDRKIKATVKLGNGEEFEGESAYRPQISNSTF  360

Query  1354  LPLIYPGSKDEDAA---LCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMI  1184
               L       +D +    C PGSL    ++GK+VLC  GGG++ V KG+ VKDAGG  MI
Sbjct  361   FTLFDAAKHAKDPSETPYCKPGSLKGPVIRGKIVLCLAGGGVSSVAKGKVVKDAGGVGMI  420

Query  1183  LLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSV  1004
             ++     G T  AD HVLPA ++S  DGL+++ Y NS   P ATI F+GT IG + AP V
Sbjct  421   VIKTSQYGVTKTADAHVLPALDISDADGLRIRAYTNSILNPVATITFQGTTIGDENAPIV  480

Query  1003  ASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLS  824
             A+FSSRGPS ASPGILKPDI+GPGVNILAAWP   + +     +TFNIISGTSM+ PHLS
Sbjct  481   AAFSSRGPSRASPGILKPDIIGPGVNILAAWPTPVDDDKNTK-STFNIISGTSMSCPHLS  539

Query  823   GIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRAS  644
             G+A LLKSAHPDWSPA IKSAI+TTAD  NL  + ILDERL+PAD+F TG GHVNPSRA+
Sbjct  540   GVAALLKSAHPDWSPAVIKSAIMTTADTLNLANSPILDERLLPADIFTTGAGHVNPSRAN  599

Query  643   DPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAI-WLGK  467
             DPGL+YD   +DY+PYLCGLNYT+ ++ ++++R+V CS+V SIPEAQLNYPSF I  LG 
Sbjct  600   DPGLVYDTPFEDYVPYLCGLNYTNPQVGKLLRRRVNCSEVESIPEAQLNYPSFCISRLGS  659

Query  466   TSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPV  287
             T  TY+RTVTNVG+A S YTV+++   GV V V P  L F+E+NQ+LTY ++FS +    
Sbjct  660   TPQTYTRTVTNVGDAKSSYTVQIASPKGVVVKVKPSKLNFSELNQKLTYQVTFSKTINSS  719

Query  286   DIDFVQGAIAWVSQRHIVKSPIAIIF  209
                 V+G + W S RH V+SPIA++ 
Sbjct  720   MSGVVEGFLKWNSNRHSVRSPIAVVL  745



>gb|EYU29564.1| hypothetical protein MIMGU_mgv1a023796mg [Erythranthe guttata]
Length=738

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/739 (56%), Positives = 520/739 (70%), Gaps = 19/739 (3%)
 Frame = -1

Query  2395  VVCLTLVFHSVASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFV----SESGDEGERS  2228
             ++C+ L F+    A+    YIVHV P        S+D  +++ SF+    + + +  ++ 
Sbjct  9     IICI-LNFNQFLKAENLGVYIVHVEPTQ------SDDLETFYNSFLPTTSNVTSNSEDQP  61

Query  2227  RIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFW  2048
             RI++ YRHV SGFAAKLS   V EMRKKKGFISAR +R+ +L+TTHSPNFLGL QN G W
Sbjct  62    RILYRYRHVFSGFAAKLSAAHVDEMRKKKGFISARPERMMHLHTTHSPNFLGLNQNTGLW  121

Query  2047  RNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGT--ACNNKLIGARNF  1874
             +NSSYGKG+I+G++DTGITP+HPS ND+ +PPPPAKWKGKCEF      CNNKLIGAR F
Sbjct  122   KNSSYGKGIIIGLVDTGITPDHPSLNDQGVPPPPAKWKGKCEFTSPRWTCNNKLIGARYF  181

Query  1873  VSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTE  1694
                      P +D+ GHGTHT+  AAGNFVG A  +G+A+GTA G APLAH++IY+ CT 
Sbjct  182   YRSPPLFVTPLIDQIGHGTHTSGIAAGNFVGGADFYGNARGTASGTAPLAHVAIYQPCTG  241

Query  1693  DGCAESdilaamdaaiddgvdvlslslgggSASFFEDSI-AIGAFAAMEKGIFVSCAAGN  1517
               C  S I AA+DAAI+DGVDVLS+SLGG     F D I AIG F AME+GI VSC+AGN
Sbjct  242   SHCGSSGIAAAIDAAIEDGVDVLSMSLGGALHLHFADDIMAIGTFRAMERGIVVSCSAGN  301

Query  1516  EGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPT-LLPLIY  1340
             +GP   TL NEAPW++TVGAST DR I   AVLGNG +L+GE+      FP    L L+Y
Sbjct  302   DGPKNKTLYNEAPWIMTVGASTTDRKITVNAVLGNGEELEGETG---TGFPSIEKLDLVY  358

Query  1339  PGSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDG  1160
             P S D   + C  G  +       VV       + RV +G TVK AGGAAMILLN   DG
Sbjct  359   PRSNDTGMSRCFDGHFNTDIKGKIVVCEGMKYLVTRVQQGITVKGAGGAAMILLNNKFDG  418

Query  1159  YTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGP  980
              T   + HVLPA +++Y D LK+K Y+NSTS PTAT+ F+GT IG   AP VA+FSSRGP
Sbjct  419   DTTFEEPHVLPAMQITYADSLKLKAYLNSTSNPTATMSFQGTIIGNNRAPVVATFSSRGP  478

Query  979   SNASPGILKPDILGPGVNILAAWPVgnntnngngNA-TFNIISGTSMATPHLSGIATLLK  803
             S  SPGILKPDI+GPGVNIL++WP   + +  +  + TFN+ISGTSM+ PHLSG+A LLK
Sbjct  479   SVPSPGILKPDIIGPGVNILSSWPASVDNSKTDTKSPTFNMISGTSMSCPHLSGVAALLK  538

Query  802   SAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYD  623
             S HPDWSPAAIKSAI+TTAD  NL G  I DE+L PA+VFA G GHVNPSRA+DPGL+YD
Sbjct  539   SVHPDWSPAAIKSAIMTTADSVNLQGNPIEDEQLQPANVFAIGSGHVNPSRANDPGLVYD  598

Query  622   LQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRT  443
             +  DDYIPYLCGLNYT+QE+  IV RKV+CS+  +IPEAQLNYPSF+I  G +  TY+RT
Sbjct  599   IMPDDYIPYLCGLNYTNQEVGIIVARKVDCSKEKTIPEAQLNYPSFSIIFGSSPQTYTRT  658

Query  442   VTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGA  263
             +TNVG+ANS Y V++    GV+V V P  LVF ++  + +Y+++F+ ++  V     QG 
Sbjct  659   LTNVGKANSSYDVEIGSPDGVNVKVEPKKLVFPKLGDKSSYSVTFTRTNKGVMNSSTQGF  718

Query  262   IAWVSQRHIVKSPIAIIFQ  206
             I W +  + V+SPIA++FQ
Sbjct  719   IRWHTAEYSVRSPIAVVFQ  737



>ref|XP_003611192.1| Subtilisin-like serine protease [Medicago truncatula]
Length=753

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/719 (57%), Positives = 524/719 (73%), Gaps = 17/719 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGE-RSRIVHSYRHVASGFAAKLSPEM  2165
             TYIVHV  P+       E    ++ S +  +  + + + R++ SY++V +GFA KL+PE 
Sbjct  43    TYIVHVEKPSLQ---SKESLDGWYNSLLPAATIKTQNQQRVIFSYQNVMNGFAVKLTPEE  99

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                + +K+  +S R + + +L+TTH+P+FLGL Q+ G W NS+ GKG+I+G+LDTGI+ +
Sbjct  100   AKALEEKEEVLSIRPENILSLHTTHTPSFLGLQQSQGLWINSNLGKGIIIGILDTGISLS  159

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVSEGssppppPVDEEGHGTHTA  1808
             HPSF+DE MP PPAKW G CEF G   CN KLIGARNFV++  +    P D+ GHGTHTA
Sbjct  160   HPSFSDEGMPSPPAKWNGHCEFTGERICNKKLIGARNFVTD--TNLSLPFDDVGHGTHTA  217

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdv  1628
             STAAG  V  A VFG+AKGTA GMAP AHL+IYKVC+  GC ES  LA MDAA++DGVDV
Sbjct  218   STAAGRLVQGANVFGNAKGTATGMAPDAHLAIYKVCSSSGCPESATLAGMDAAVEDGVDV  277

Query  1627  lslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTI  1448
             LS+SL G +  FFED IA+GAF+A +KGIFVSC+AGN GPDY T SNEAPW+LTVGAST 
Sbjct  278   LSISLNGPTNPFFEDVIALGAFSANQKGIFVSCSAGNFGPDYGTTSNEAPWILTVGASTT  337

Query  1447  DRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS---KDEDAALCGPGSLdkvdv  1277
             DR I+A A LGNG +  GES FQ + F  TLLPL+Y GS    D   A CGP S+  +DV
Sbjct  338   DRKIEAIAKLGNGEKYIGESVFQPKEFASTLLPLVYAGSVNISDNSIAFCGPISMKNIDV  397

Query  1276  kgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTH-VLPATELSYNDG  1100
             KGKVVLC+ GG +++  K Q VKDAGG+AMIL+N  + G+   +D    LPA  +SY+ G
Sbjct  398   KGKVVLCEEGGLVSQAAKAQAVKDAGGSAMILMNSKLQGFDPKSDVQDNLPAALVSYSAG  457

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
             L +KDYINSTS P ATI+F GT IG   AP VA FSSRGP+  SPGILKPDI+GPGVNIL
Sbjct  458   LSIKDYINSTSTPMATILFNGTVIGNPNAPQVAYFSSRGPNQESPGILKPDIIGPGVNIL  517

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAW V  + N       +NIISGTSM+ PHLSGIA LLK++HPDWSPAAIKSAI+TTA +
Sbjct  518   AAWHVSLDNNI----PPYNIISGTSMSCPHLSGIAALLKNSHPDWSPAAIKSAIMTTAYE  573

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              NL G  ILD+RL PAD+FATG GHVNPS+A+DPGL+YD++ +DY+PYLCGLNYTD+ + 
Sbjct  574   VNLQGKAILDQRLKPADLFATGAGHVNPSKANDPGLVYDIEPNDYVPYLCGLNYTDRHVG  633

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGV  380
              I+Q+KV+CS + SIP+AQLNYPSF+I LG TS  Y+RTVTNVG  N  Y V++   L V
Sbjct  634   IILQQKVKCSDIKSIPQAQLNYPSFSILLGSTSQFYTRTVTNVGPINMTYNVEIDVPLAV  693

Query  379   DVGVTPDTLVFTEVNQQLTYNISFSPSS--TPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             D+ + P  + FTE  Q++TY+++F+P +     D +  QG+I WVS ++ V+ PI++IF
Sbjct  694   DISIKPAQITFTEKKQKVTYSVAFTPENIVNRGDKEISQGSIKWVSGKYTVRIPISVIF  752



>ref|XP_004308725.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=767

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/731 (57%), Positives = 525/731 (72%), Gaps = 25/731 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGV-SEDYRSYFRSFVSES----GDEGERSRIVHSYRHVASGFAAK  2180
              TY V V  P   ++ + S+D  S++++F+ ES     ++    R+++SYR+VA+GFAAK
Sbjct  43    QTYFVWVQKPTDKVSALNSQDLESWYQTFLPESTTASSNKPSIPRMLYSYRNVATGFAAK  102

Query  2179  LSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDT  2000
             L+PE +  M KK GF+ A  +R   L+TTHSPNFLGL Q FGFW+ ++YG+G+I+GVLDT
Sbjct  103   LTPEEIKAMEKKDGFVHAHPERFLPLHTTHSPNFLGLQQVFGFWKKTNYGEGMIIGVLDT  162

Query  1999  GITPNHPSFNDENMPPPPAKWKGKCEFE---GTACNNKLIGARNFVSEGssppppPVDEE  1829
             GI+P HPSF+DE +PPPP KWKGKCEF+    T CNNKLIGARNF     +    P  EE
Sbjct  163   GISPGHPSFSDEGVPPPPEKWKGKCEFKFNGRTVCNNKLIGARNFQGGKETKEVSPFGEE  222

Query  1828  GHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaa  1649
             GHGT T+S AAGNFV  A+VFG A GTA G+AP AHL+IYKVCTE GCAESDILAA+D A
Sbjct  223   GHGTLTSSIAAGNFVEGASVFGMANGTASGIAPYAHLAIYKVCTEAGCAESDILAAIDIA  282

Query  1648  iddgvdvlslslgggSA-SFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWL  1472
             ++DGVDVLSLS+G  S+  F ED +AIGAF A  KGIFVSC+AGN GP Y ++SNEAPW+
Sbjct  283   VEDGVDVLSLSIGFASSVPFHEDMVAIGAFGAFRKGIFVSCSAGNSGPSYSSMSNEAPWI  342

Query  1471  LTVGASTIDRTIKATAVLGNGAQL--DGESAFQVENFPPT-LLPLIYPGS-KDEDAALCG  1304
             LTVGASTIDR I + A LG+  +    GES F  +NF  + LLPL+YPG+  +     C 
Sbjct  343   LTVGASTIDRKISSIAQLGDSPKYFYSGESLFDPKNFSTSPLLPLVYPGAIHNNKTEFCA  402

Query  1303  PGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPA  1124
              GSL  V+ K    LC+RGGG+    KG+ VK AGGAAMIL+N+  DGY+ LA+ +VLPA
Sbjct  403   LGSLVNVEGKVV--LCERGGGVGGTAKGEEVKRAGGAAMILVNEVTDGYSTLANAYVLPA  460

Query  1123  TELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDI  944
             T + +  GL +K YINST+ P AT+    T IG   AP VASFSSRGPS ASPGILKPDI
Sbjct  461   TNVGFQAGLSIKTYINSTTTPIATVYSPRTVIGDALAPMVASFSSRGPSIASPGILKPDI  520

Query  943   LGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKS  764
             +GPGVNILAAWPV  +         F+I+SGTS++ PHLSGIA L+KS+HPDWSPAAIKS
Sbjct  521   IGPGVNILAAWPVSVDNV-----TKFDILSGTSVSCPHLSGIAALIKSSHPDWSPAAIKS  575

Query  763   AIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGL  584
             AI+TTAD  NL GT I+D    PAD+++TG GHVNPS+A+DPGLIYD++ DDYIPYLCGL
Sbjct  576   AIMTTADLLNLKGTPIVDRSNTPADIYSTGSGHVNPSKANDPGLIYDIRPDDYIPYLCGL  635

Query  583   NYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGK-TSLTYSRTVTNVGEANSMYT  407
             NYT+ +I+ I Q++V+CS+V  I EAQLNYPSF+I +G   +  Y+RTV NVG A S Y 
Sbjct  636   NYTNNQIEMITQQRVDCSEVGVIAEAQLNYPSFSITIGSYQTQNYTRTVKNVGPAYSTYK  695

Query  406   VKVSP----FLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRH  239
              ++       + V+VGVTP  L FTEVNQ +TYN+ FS      D  F+QG + WVS  H
Sbjct  696   SEIGEPQKWGVIVNVGVTPSVLTFTEVNQTITYNVEFSTKLVGQDGSFLQGHLRWVSDNH  755

Query  238   IVKSPIAIIFQ  206
              V SPIA+IF 
Sbjct  756   SVYSPIAVIFH  766



>ref|XP_003525749.1| PREDICTED: subtilisin-like protease SDD1-like [Glycine max]
Length=748

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/749 (56%), Positives = 539/749 (72%), Gaps = 19/749 (3%)
 Frame = -1

Query  2410  AYISVVVCLTLVFHSVASAKYE--------DTYIVHVSPPAAAINGVSEDYRSYFRSFVS  2255
             A++ +V    L F +  +   E         TYI+HV  P       +ED  S++ SF+ 
Sbjct  3     AFLFIVFTFVLSFQTHFAQGSELPRTTSSSKTYIIHVKGPQDKSLDQTEDLESWYHSFMP  62

Query  2254  ES-GDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNF  2078
              +     E+ R+++SY +V SGFAA+L+ E +  + KK GFISAR +R+ +  TT++P F
Sbjct  63    PTIMSSEEQPRMIYSYLNVMSGFAARLTEEELIAVEKKDGFISARPERILHRQTTNTPQF  122

Query  2077  LGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNN  1898
             LGL +  G W+ S++GKG+I+GVLDTGITP HPSF+D  M PPP KWKG+CE   TACNN
Sbjct  123   LGLQKQTGLWKESNFGKGIIIGVLDTGITPGHPSFSDAGMSPPPPKWKGRCEINVTACNN  182

Query  1897  KLIGARNF--VSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLA  1724
             KLIG R F  V++        +D+ GHGTHTASTAAG FV +A V G+A+GTA G+AP A
Sbjct  183   KLIGVRTFNHVAKLIKGAEAAIDDFGHGTHTASTAAGAFVDHAEVLGNAEGTASGIAPYA  242

Query  1723  HLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSAS-FFEDSIAIGAFAAMEK  1547
             HL+IY+VC++  C ESDILAA+DAA++DGVDVLS+SLG   A  FF+  IAIG FAAM+K
Sbjct  243   HLAIYRVCSKV-CRESDILAALDAAVEDGVDVLSISLGSKRAKPFFDHGIAIGTFAAMQK  301

Query  1546  GIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENF  1367
             GIFVSCAAGN+GP   ++ N APW+LTVGAS I+R+I ATA LGNG + DGES FQ  +F
Sbjct  302   GIFVSCAAGNDGPLPGSVINGAPWILTVGASNINRSIAATAKLGNGQEFDGESIFQPSDF  361

Query  1366  PPTLLPLIYPG--SKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGA  1193
              PTLLPL Y G   K EDA  CG GSL+ +D +GKVVLC++GGGI ++ KG+ VK AGGA
Sbjct  362   SPTLLPLAYAGMNGKQEDA-FCGNGSLNDIDFRGKVVLCEKGGGIEKIAKGKEVKRAGGA  420

Query  1192  AMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTA  1013
             AMIL+N +  G+++  D HVLP T +SY+ GLK+K YI ST+ PTATI+FKGT IG   A
Sbjct  421   AMILMNDEKSGFSLNIDVHVLPTTHVSYDAGLKIKAYIYSTATPTATILFKGTIIGNSLA  480

Query  1012  PSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATP  833
             P V SFS RGPS  SPGILKPDI+GPG+NILAAWP   N N  +  +TFNI+SGTSM+ P
Sbjct  481   PVVTSFSGRGPSLPSPGILKPDIIGPGLNILAAWPFPLNNNTASK-STFNIMSGTSMSCP  539

Query  832   HLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPS  653
             HLSG+A LLKS+HP WSPAAIKSAI+T+AD  +     I+ E L PADVFATG G+VNPS
Sbjct  540   HLSGVAALLKSSHPHWSPAAIKSAIMTSADIISHERKHIVGETLQPADVFATGSGYVNPS  599

Query  652   RASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWL  473
             RA+DPGL+YD++ DDYIPYLCGL Y D E++ I  R ++CS+ +SI E +LNYPSF++ L
Sbjct  600   RANDPGLVYDIKPDDYIPYLCGLGYKDTEVEIIAGRTIKCSETSSIREGELNYPSFSVVL  659

Query  472   GKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSST  293
               +  T++RTVTNVGEANS Y V VS   GVDV V P+ L F+E NQ+ TY+++FS    
Sbjct  660   -DSPQTFTRTVTNVGEANSSYVVTVSAPDGVDVKVQPNKLYFSEANQKETYSVTFSRIEL  718

Query  292   PVD-IDFVQGAIAWVSQRHIVKSPIAIIF  209
               + + +VQG + WVS +H V+SPI+I F
Sbjct  719   DDETVKYVQGFLQWVSAKHTVRSPISISF  747



>gb|AES94150.2| subtilisin-like serine protease [Medicago truncatula]
Length=758

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/719 (57%), Positives = 524/719 (73%), Gaps = 17/719 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGE-RSRIVHSYRHVASGFAAKLSPEM  2165
             TYIVHV  P+       E    ++ S +  +  + + + R++ SY++V +GFA KL+PE 
Sbjct  48    TYIVHVEKPSLQ---SKESLDGWYNSLLPAATIKTQNQQRVIFSYQNVMNGFAVKLTPEE  104

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                + +K+  +S R + + +L+TTH+P+FLGL Q+ G W NS+ GKG+I+G+LDTGI+ +
Sbjct  105   AKALEEKEEVLSIRPENILSLHTTHTPSFLGLQQSQGLWINSNLGKGIIIGILDTGISLS  164

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVSEGssppppPVDEEGHGTHTA  1808
             HPSF+DE MP PPAKW G CEF G   CN KLIGARNFV++  +    P D+ GHGTHTA
Sbjct  165   HPSFSDEGMPSPPAKWNGHCEFTGERICNKKLIGARNFVTD--TNLSLPFDDVGHGTHTA  222

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdv  1628
             STAAG  V  A VFG+AKGTA GMAP AHL+IYKVC+  GC ES  LA MDAA++DGVDV
Sbjct  223   STAAGRLVQGANVFGNAKGTATGMAPDAHLAIYKVCSSSGCPESATLAGMDAAVEDGVDV  282

Query  1627  lslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTI  1448
             LS+SL G +  FFED IA+GAF+A +KGIFVSC+AGN GPDY T SNEAPW+LTVGAST 
Sbjct  283   LSISLNGPTNPFFEDVIALGAFSANQKGIFVSCSAGNFGPDYGTTSNEAPWILTVGASTT  342

Query  1447  DRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS---KDEDAALCGPGSLdkvdv  1277
             DR I+A A LGNG +  GES FQ + F  TLLPL+Y GS    D   A CGP S+  +DV
Sbjct  343   DRKIEAIAKLGNGEKYIGESVFQPKEFASTLLPLVYAGSVNISDNSIAFCGPISMKNIDV  402

Query  1276  kgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTH-VLPATELSYNDG  1100
             KGKVVLC+ GG +++  K Q VKDAGG+AMIL+N  + G+   +D    LPA  +SY+ G
Sbjct  403   KGKVVLCEEGGLVSQAAKAQAVKDAGGSAMILMNSKLQGFDPKSDVQDNLPAALVSYSAG  462

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
             L +KDYINSTS P ATI+F GT IG   AP VA FSSRGP+  SPGILKPDI+GPGVNIL
Sbjct  463   LSIKDYINSTSTPMATILFNGTVIGNPNAPQVAYFSSRGPNQESPGILKPDIIGPGVNIL  522

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAW V  + N       +NIISGTSM+ PHLSGIA LLK++HPDWSPAAIKSAI+TTA +
Sbjct  523   AAWHVSLDNNI----PPYNIISGTSMSCPHLSGIAALLKNSHPDWSPAAIKSAIMTTAYE  578

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              NL G  ILD+RL PAD+FATG GHVNPS+A+DPGL+YD++ +DY+PYLCGLNYTD+ + 
Sbjct  579   VNLQGKAILDQRLKPADLFATGAGHVNPSKANDPGLVYDIEPNDYVPYLCGLNYTDRHVG  638

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGV  380
              I+Q+KV+CS + SIP+AQLNYPSF+I LG TS  Y+RTVTNVG  N  Y V++   L V
Sbjct  639   IILQQKVKCSDIKSIPQAQLNYPSFSILLGSTSQFYTRTVTNVGPINMTYNVEIDVPLAV  698

Query  379   DVGVTPDTLVFTEVNQQLTYNISFSPSS--TPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             D+ + P  + FTE  Q++TY+++F+P +     D +  QG+I WVS ++ V+ PI++IF
Sbjct  699   DISIKPAQITFTEKKQKVTYSVAFTPENIVNRGDKEISQGSIKWVSGKYTVRIPISVIF  757



>ref|XP_002509660.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51047.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=751

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/723 (57%), Positives = 528/723 (73%), Gaps = 15/723 (2%)
 Frame = -1

Query  2368  SVASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGF  2189
             +V   +  +TYIV +  P  ++   S+D  S++ SF+  +    E+ R++HSYRHVA+GF
Sbjct  42    AVKEERNSETYIVLLKKPEGSVFTESKDLDSWYHSFLPVNAFSSEQPRLLHSYRHVATGF  101

Query  2188  AAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGV  2009
             AA+L  E V  M  K GF+SAR +R+  L+TTH+P+FLGL  N G W  S+ GKGVI+G+
Sbjct  102   AARLKAEDVKAMENKDGFVSARPRRMVPLHTTHTPSFLGLEHNLGLWNYSNDGKGVIIGL  161

Query  2008  LDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEE  1829
             +D+GITP+HPSF+D+ MPPPPAKWKGKC+ E T CNNKLIG RNF ++ ++      DE 
Sbjct  162   IDSGITPDHPSFSDQGMPPPPAKWKGKCDNE-TLCNNKLIGVRNFATDSNNTS----DEY  216

Query  1828  GHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVC-TEDGCAESdilaamda  1652
              HGTHTASTAAG+ V NA  FG A GTA+GMAPLAHL++YKV  +     +S+ILAAMDA
Sbjct  217   MHGTHTASTAAGSPVQNANFFGQANGTAIGMAPLAHLAMYKVSGSASEAGDSEILAAMDA  276

Query  1651  aiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWL  1472
             A++DGVDVLSLSLG GS  F++D IA+GA+AA+ KGIFVSC+AGN GPD  +LSNEAPW+
Sbjct  277   AVEDGVDVLSLSLGIGSHPFYDDVIALGAYAAIRKGIFVSCSAGNSGPDNSSLSNEAPWI  336

Query  1471  LTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGS  1295
             LTVGAST+DR I+AT +LGN A+L+GES FQ ++FP TLLPL+Y G+  +  +  C PGS
Sbjct  337   LTVGASTVDRAIRATVLLGNNAELNGESLFQPKDFPSTLLPLVYAGANGNASSGFCEPGS  396

Query  1294  LdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATEL  1115
             L  VD+KGKVVLC+ G     + KGQ VKD GGAAMI++N +  G+      HVLPA+ +
Sbjct  397   LKNVDIKGKVVLCE-GADFGTISKGQEVKDNGGAAMIVINDE--GFITTPRLHVLPASNV  453

Query  1114  SYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGP  935
             +Y  G  +K YINS+S P ATI+FKGT +G   AP VA FSSRGPS ASPGILKPDI+GP
Sbjct  454   NYITGSAIKAYINSSSSPMATILFKGTVVGVPDAPQVADFSSRGPSIASPGILKPDIIGP  513

Query  934   GVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAII  755
             GV ILAAWPV  +         F++ISGTSM+ PHLSGIA LLK AHPDWSPAAIKSAI+
Sbjct  514   GVRILAAWPVSVDNTTN----RFDMISGTSMSCPHLSGIAALLKHAHPDWSPAAIKSAIM  569

Query  754   TTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYT  575
             TTA+  NL G  I D+  V A VF  G GHVNPSRA+DPGLIYD+Q ++YIPYLCGL Y+
Sbjct  570   TTANLNNLGGKPISDQEFVLATVFDMGAGHVNPSRANDPGLIYDIQPEEYIPYLCGLGYS  629

Query  574   DQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVS  395
             D ++  IVQ  V+C+  +SIPE+QLNYPSF+I LG +  TY+RTVTNVG+  S YT K+ 
Sbjct  630   DNQVGLIVQGSVKCTNDSSIPESQLNYPSFSIKLGSSPKTYTRTVTNVGKPTSAYTPKIY  689

Query  394   PFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAI  215
                GVDV VTPD + F+EVN++ TY ++FS +       F QG + WV + + V SPIA+
Sbjct  690   GPQGVDVKVTPDIIHFSEVNEKATYTVTFSQNGK-AGGPFSQGYLTWVGEGYSVASPIAV  748

Query  214   IFQ  206
             IF+
Sbjct  749   IFE  751



>ref|XP_006358840.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=747

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/727 (57%), Positives = 527/727 (72%), Gaps = 21/727 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSE--DYRSYFRSF-------VSESGDEGERSRIVHSYRHVASG  2192
             +TYIVHV  P + I+  S   D  SY+ SF       +S  G+E E + +++SY +V  G
Sbjct  25    ETYIVHVESPESLISTQSSLTDLDSYYLSFLPKTTTAISSRGNE-EAATMIYSYHNVMKG  83

Query  2191  FAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVG  2012
             FAA+L+ E V EM KK GF+SA++QR+ +L TTH+P+FLGL QN G W++S+YGKGVI+G
Sbjct  84    FAARLTAEQVKEMEKKHGFVSAQKQRILSLDTTHTPSFLGLQQNMGIWKDSNYGKGVIIG  143

Query  2011  VLDTGITPNHPSFNDENMPPPPAKWKGKCEFEG-TACNNKLIGARNFVSEGssppppPVD  1835
             V+DTGI P+HPSF+D  MPPPPAKWKG CE      CNNKLIGAR++          P+D
Sbjct  144   VIDTGILPDHPSFSDVGMPPPPAKWKGVCESNFINKCNNKLIGARSY----KRGNGSPID  199

Query  1834  EEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDG-CAESdilaam  1658
               GHGTHTASTAAG FV  A V+G+A GTAVG+APLAH+++YKVC+ DG C++SDILAAM
Sbjct  200   GNGHGTHTASTAAGAFVKGANVYGNANGTAVGVAPLAHIAVYKVCSSDGGCSDSDILAAM  259

Query  1657  daaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAP  1478
             D+AIDDGVDVLS+SLGG   SF++D IA+GA++A  +GI VSC+AGN GP   ++ N AP
Sbjct  260   DSAIDDGVDVLSISLGGSPNSFYDDPIALGAYSATARGILVSCSAGNRGPLLASVGNAAP  319

Query  1477  WLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAA---LC  1307
             W+LTVGASTIDR +KAT  LGN  + +GESA+  +    T   L       +D +    C
Sbjct  320   WILTVGASTIDRKMKATVKLGNREEFEGESAYHPKISNSTFFTLFDAAKHAKDQSETPYC  379

Query  1306  GPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLP  1127
              PGSL+   ++GK+VLC  GGG++ V KGQ VKDAGG  MI++     G T  AD HVLP
Sbjct  380   KPGSLNDPVIRGKIVLCLAGGGVSSVAKGQVVKDAGGVGMIVIKTSQYGVTKSADAHVLP  439

Query  1126  ATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPD  947
             A ++S  DGL+++ Y NST    ATI F+GT IG K AP VA+FSSRGPS ASPGILKPD
Sbjct  440   ALDVSDADGLRIRAYTNSTINSVATITFQGTIIGDKNAPIVAAFSSRGPSRASPGILKPD  499

Query  946   ILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIK  767
             I+GPGVNILAAWP   + N     +TFNIISGTSM+ PHLSG+A LLKS+HPDWSPA IK
Sbjct  500   IIGPGVNILAAWPTSVDDNKNTK-STFNIISGTSMSCPHLSGVAALLKSSHPDWSPAVIK  558

Query  766   SAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCG  587
             SAI+TTAD  NL  + ILDERL+ AD+FA G GHVNPSRA+DPGL+YD   +DY+PY CG
Sbjct  559   SAIMTTADTLNLANSPILDERLLRADIFAMGAGHVNPSRANDPGLVYDTPFEDYVPYFCG  618

Query  586   LNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIW-LGKTSLTYSRTVTNVGEANSMY  410
             LNYT++E+ +++QR+V C +V SIPEAQLNYPSF+I+ LG T  TY+RTVTNVG+A S Y
Sbjct  619   LNYTNREVGKMLQRQVNCLKVKSIPEAQLNYPSFSIFRLGSTPQTYTRTVTNVGDATSSY  678

Query  409   TVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVK  230
              V+V+   GV V V P  L F+E+NQ+LTY ++FS ++   +   V G + W S RH V+
Sbjct  679   EVEVASPKGVVVEVKPTELNFSELNQKLTYQVTFSKTTNNSNFVIVGGFLKWTSNRHSVR  738

Query  229   SPIAIIF  209
             SPIAI+ 
Sbjct  739   SPIAIVL  745



>ref|XP_004512194.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=763

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/717 (55%), Positives = 511/717 (71%), Gaps = 27/717 (4%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
             TYIVHV  P    +   E+   ++ S +  S     + RI+ +Y+++  GFA KL+P   
Sbjct  67    TYIVHVKKPNYFQS--KENLHGWYHSLLPASTKTQNQKRIIFAYQNIVDGFAVKLTPNEA  124

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
               + +K+  +S R +++ +L+TTHSP+FLGL QN   W+NS+ GKG+I+G+LDTGI P H
Sbjct  125   KALEEKEEVVSTRPEKILSLHTTHSPSFLGLQQNQELWKNSNLGKGIIIGILDTGIFPFH  184

Query  1981  PSFNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             PS +D  M PP AKW G CEF G   CNNK+IGAR+F++   +    P D+ GHGTHTAS
Sbjct  185   PSSSDAGMSPP-AKWNGHCEFNGERICNNKIIGARSFIT--GTNLSLPFDDVGHGTHTAS  241

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAG  V  A VFG+A GTAVGMAP AHL+IYKVC+  GC ES I+A MD+         
Sbjct  242   TAAGRPVQGANVFGNANGTAVGMAPDAHLAIYKVCSIKGCTESSIIAGMDSLGGPS----  297

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
                       FFED IA+GAF+A++KGIFVSC+A N GP+Y TLSNEAPW+LTVGASTID
Sbjct  298   --------TPFFEDGIALGAFSAIQKGIFVSCSAANSGPEYGTLSNEAPWILTVGASTID  349

Query  1444  RTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG---SKDEDAALCGPGSLdkvdvk  1274
             R I+A A LGNG +  GES FQ ++F  TLLPL+Y G   + D+  A C P S+  VDVK
Sbjct  350   RKIEAIAKLGNGIEYLGESVFQPKDFESTLLPLVYAGAINTSDDSIAFCDPISMKNVDVK  409

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             GKVVLC++GG ++RV KGQ VKDAGG+AMIL+N + + +  + D HVLPA  +SY+ GL 
Sbjct  410   GKVVLCEQGGFVSRVAKGQAVKDAGGSAMILVNSEREAFNPITDVHVLPAVHVSYSSGLS  469

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             +KDYINSTS P ATI+F+GT IG   AP VASFSSRGPS +SPGILKPDI+GPG+NILA 
Sbjct  470   IKDYINSTSTPEATILFQGTVIGNPLAPQVASFSSRGPSKSSPGILKPDIIGPGMNILAG  529

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             W V  + +       FNI+SGTSM+ PHL GIA LLK++HPDWSPAAIKSAI+TTA+  N
Sbjct  530   WYVSLDNST----PPFNIVSGTSMSCPHLGGIAALLKNSHPDWSPAAIKSAIMTTANVVN  585

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             L GT ILD+R +PADVFATG GHVNP +A+DPGL+YD++ +DY+PYLCGLNYTD+++  I
Sbjct  586   LQGTAILDQRHLPADVFATGAGHVNPLKANDPGLVYDIEPNDYVPYLCGLNYTDRQVGVI  645

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDV  374
             +Q+KV+CS V SI +AQLNYPSF+I LG TS  Y+RT+TNVG  N+ Y+V++   L V +
Sbjct  646   LQQKVKCSDVKSISQAQLNYPSFSIRLGSTSQFYTRTLTNVGPVNTTYSVEIDVPLAVGM  705

Query  373   GVTPDTLVFTEVNQQLTYNISFSPSSTPVDID--FVQGAIAWVSQRHIVKSPIAIIF  209
              V+P  + FTEV Q++TY + F P       D    QG+I WVS+++ V  PIAI+F
Sbjct  706   SVSPAQITFTEVKQKVTYWVDFIPEDKKNRGDNMIAQGSIKWVSEKYSVSIPIAIVF  762



>ref|XP_006358841.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=745

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/738 (55%), Positives = 527/738 (71%), Gaps = 16/738 (2%)
 Frame = -1

Query  2395  VVCLTLVFHSVASAKYE-DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERS--R  2225
             ++C+ L   + A+ +     YIVH   P        +D  S++ SF+  +  +  R   R
Sbjct  14    LICVLLSCTTNATKQNNSQIYIVHCQFPDGERTAKYQDLESWYLSFLPTTTSDSSREAPR  73

Query  2224  IVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWR  2045
             +++SYR+V +GFAAKLS E + EM K +GF+SAR Q++  L+TTHS NFLGL QN GFW+
Sbjct  74    LIYSYRNVLTGFAAKLSQEDIKEMEKMEGFVSARPQQLLKLHTTHSVNFLGLQQNMGFWK  133

Query  2044  NSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARNFVS  1868
             +S+YGKGVI+GV+D+GI P+HPSF+D  MPP PAKWKG CE +  T CNNKLIGAR++  
Sbjct  134   DSNYGKGVIIGVIDSGIFPDHPSFSDVGMPPIPAKWKGVCESDFATKCNNKLIGARSY--  191

Query  1867  EGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDG  1688
                     P+D +GHGTHTAST AG FV  A V+G+A GTAVG+APLAH++IYKVC  D 
Sbjct  192   --QLANGSPIDNDGHGTHTASTTAGAFVKGANVYGNANGTAVGVAPLAHIAIYKVCNSDS  249

Query  1687  CAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGP  1508
             C+++DILAAMD+AIDDGVD+LS+SLGG    F+ DSIA GA+AA E+GI VSC+AGN GP
Sbjct  250   CSDTDILAAMDSAIDDGVDILSMSLGGSPVPFYADSIAFGAYAATERGILVSCSAGNSGP  309

Query  1507  DYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK  1328
                T +N APW+LTVGASTIDR IKAT  LGN  + +GESA++ +    T   L Y  +K
Sbjct  310   SIITAANTAPWILTVGASTIDRKIKATVTLGNTEEFEGESAYRPQISDSTFFTL-YDAAK  368

Query  1327  D----EDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDG  1160
                   +   C PGSL    +KGK+V+C   G ++ ++KGQ VKDAGG  MI++N    G
Sbjct  369   SIGDPSETPYCKPGSLTDPSIKGKIVIC-LPGVVSNIEKGQAVKDAGGVGMIVINPSQYG  427

Query  1159  YTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGP  980
              T  AD HVLPA  +S  DG K+ DY NS S PTATI  +GT IG K AP VA+FSSRGP
Sbjct  428   VTKSADAHVLPALVVSAADGTKILDYTNSISNPTATITIQGTIIGDKNAPIVAAFSSRGP  487

Query  979   SNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKS  800
             S  +PGILKPDI+GPGVNILAAWP   + N     +TFNIISGTSM+ PHLSG+A LLKS
Sbjct  488   SKPNPGILKPDIIGPGVNILAAWPTSVDDNKNTK-STFNIISGTSMSCPHLSGVAALLKS  546

Query  799   AHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDL  620
              HPDWSPAAIKSAI+TTA   NL+ + ILDE+L+PAD+FA G GHVNPSRA+DPGL+YD 
Sbjct  547   THPDWSPAAIKSAIMTTAYTLNLDNSPILDEKLLPADIFAIGAGHVNPSRANDPGLVYDT  606

Query  619   QSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIW-LGKTSLTYSRT  443
              S+DY+PYLCGL YT+ ++  +++R V C +V SIPEAQLNYPSF+I+ LG T  TY+RT
Sbjct  607   PSEDYLPYLCGLGYTNAQVGSLLRRTVNCLEVKSIPEAQLNYPSFSIFGLGSTPQTYTRT  666

Query  442   VTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGA  263
             VTNVG+  S Y V+++  +GV V V P  L F+E+NQ+LTY ++FS +++   +  V+G 
Sbjct  667   VTNVGDVASSYKVEIASLIGVSVEVVPTELNFSELNQKLTYQVTFSKTTSSSKVVVVEGF  726

Query  262   IAWVSQRHIVKSPIAIIF  209
             + W S RH V+SPIA++ 
Sbjct  727   LKWTSTRHSVRSPIAVVL  744



>ref|XP_004511628.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=763

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/727 (57%), Positives = 520/727 (72%), Gaps = 24/727 (3%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
             TYIVHV     A +  S D   ++ SF+ ++     +SR+V +YR+VASGFA KL+PE  
Sbjct  46    TYIVHVEKSEKAASLQSLDLHEWYHSFLPQTS---HKSRMVFTYRNVASGFAVKLTPEEA  102

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
               +++K+  +SAR +R  +L+TTH+P FLGL Q  G W + + GKGVI+G++DTGI P H
Sbjct  103   KSLQEKEEIVSARPERTLSLHTTHTPTFLGLKQGQGLWNDDNLGKGVIIGIIDTGIYPFH  162

Query  1981  PSFNDENMPPPPAKWKGKCEFEG-TACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             PSFNDE + PPPAKWKG CEF G   CNNKLIGAR+ +      PP   +   HGTHTA+
Sbjct  163   PSFNDEGISPPPAKWKGHCEFTGGRICNNKLIGARSLLKSAIQEPP--FETIFHGTHTAA  220

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDG---CAESdilaamdaaiddgv  1634
              AAG FV +A+VFG+AKG A GMAP AH+++YKVC  +    C ES ILAAMD AI+DGV
Sbjct  221   EAAGRFVEDASVFGNAKGVAAGMAPNAHIAMYKVCNSNEKFECPESAILAAMDIAIEDGV  280

Query  1633  dvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAS  1454
             DVLSLSLG GS  FFED IAIGAFAA + GIFVSC+A N GP Y TLSNEAPW+LTVGAS
Sbjct  281   DVLSLSLGLGSLPFFEDPIAIGAFAATQNGIFVSCSAANSGPGYSTLSNEAPWILTVGAS  340

Query  1453  TIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS---------KDEDAALCGP  1301
             TIDR I A+A LGNG + +GE+ FQ ++F   LLPL+Y GS         +  D +LC P
Sbjct  341   TIDRKIVASAKLGNGEEYEGETLFQPKDFSQQLLPLVYAGSYGNSNQSQTQTSDQSLCVP  400

Query  1300  GSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPAT  1121
             GSL  VD++GKVVLCD GGGI    KGQ V ++GG AMIL N +  G++  A   VLPA 
Sbjct  401   GSLKNVDLRGKVVLCDIGGGIPSDLKGQEVLNSGGVAMILANPERLGFSTFATATVLPAV  460

Query  1120  ELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDIL  941
             E+SY  GL +K YIN T+ PT+T++FKGT IG   APSV SFSSRGP+  SPGILKPDI+
Sbjct  461   EVSYAAGLSIKSYINLTNTPTSTLLFKGTVIGDSLAPSVVSFSSRGPNQESPGILKPDII  520

Query  940   GPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSA  761
             GPGVNILAAW +  +         +NI+SGTSM+ PHLSGIA LLKS+HPDWSPAAIKSA
Sbjct  521   GPGVNILAAWAISVDNKI----PPYNIVSGTSMSCPHLSGIAALLKSSHPDWSPAAIKSA  576

Query  760   IITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLN  581
             I+TTA   NL G  I+D+RL+PADVFATG GHVNP +A+DPGL+YD++ +DY+PYLCGL 
Sbjct  577   IMTTATTKNLAGLPIMDQRLLPADVFATGAGHVNPVKANDPGLVYDIKPEDYVPYLCGLG  636

Query  580   YTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVK  401
             Y+D+EI+ I+Q KV+CS V SI EA+LNYPSF+I LG  S  Y+RT+TNVG  NS Y V+
Sbjct  637   YSDKEIEVIIQWKVKCSDVKSIAEAELNYPSFSILLGSDSQFYTRTLTNVGPVNSTYRVE  696

Query  400   VSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPS--STPVDIDFVQGAIAWVSQRHIVKS  227
             +   L + + V P  + F+EVNQ+++Y + F P       +  F QG+I WVS +H V+ 
Sbjct  697   IEVPLSLGMSVNPSEITFSEVNQKVSYTVDFIPQIKENRGNHTFAQGSITWVSDKHAVRI  756

Query  226   PIAIIFQ  206
             PI++IF+
Sbjct  757   PISVIFK  763



>ref|XP_010058211.1| PREDICTED: subtilisin-like protease SDD1 [Eucalyptus grandis]
Length=763

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/723 (56%), Positives = 509/723 (70%), Gaps = 18/723 (2%)
 Frame = -1

Query  2338  YIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSR-IVHSYRHVASGFAAKLSPEMV  2162
             YI+ V  P        ED  +++RSF+  +     + R IVHSYRHV SGFAAKL+ E  
Sbjct  45    YIIQVRKPTDIHLATIEDLDTFYRSFLPATAASSNQERGIVHSYRHVLSGFAAKLTAEEA  104

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
               +R+K G ++ R ++  +L+TTHSP+FLGL+Q  G W++S++GKGVI+GVLDTG+ P+H
Sbjct  105   KAIREKDGVLAVRPEKALSLHTTHSPDFLGLHQGVGLWKDSNFGKGVIIGVLDTGVFPDH  164

Query  1981  PSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppP--VDEEGHGTHTA  1808
              SF+D+N+PPPPAKWKG+C+F+GT+CNNKLIGAR+F+S  ++        D EGHGTHT+
Sbjct  165   SSFSDKNVPPPPAKWKGRCDFDGTSCNNKLIGARSFISSSNTVAQADPPYDSEGHGTHTS  224

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdv  1628
             STAAG FV NA   G+A GTA G+APLAHL+IY+VC+  GC+E DILA +DAA +DGVDV
Sbjct  225   STAAGAFVRNANALGNANGTASGIAPLAHLAIYQVCSSLGCSEGDILAGLDAATEDGVDV  284

Query  1627  lslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTI  1448
             LSLSLGG S  F+ D IA GAFAA +KGI VSC+AGN GP   TLSNEAPW+LTVGAS+I
Sbjct  285   LSLSLGGNSQPFYSDLIATGAFAATQKGILVSCSAGNSGPSSGTLSNEAPWILTVGASSI  344

Query  1447  DRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvkg  1271
             DR+IKATA LGNG + DGE+ +Q  +F P  LPL+Y G K D  +A C  GSL       
Sbjct  345   DRSIKATARLGNGKEFDGETLYQPRDFDPVPLPLVYAGEKGDPSSAYCLTGSLGNRSGLR  404

Query  1270  kvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKV  1091
               V+     G  R DKGQ V+DAGG AMIL+N    GYT  AD HVLPA  +SY  G  +
Sbjct  405   GKVVVCDNDGTGRRDKGQEVQDAGGVAMILVNSIDGGYTTFADRHVLPAVHVSYAAGSDI  464

Query  1090  KDYINSTSWPTATIVFKGTFIGTKTA-PSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             K YI++ S P ATI+FKGT I  ++A P+V SFSSRGP+  SPGILKPDI+GPG+NILA 
Sbjct  465   KQYISTASAPKATILFKGTHINGRSADPAVTSFSSRGPNAQSPGILKPDIIGPGLNILAG  524

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             WP     +     A F ++SGTSM+ PHLSG+A LLKSAHPDWSPAAIKSAIITTA   N
Sbjct  525   WPFPLGNSTDKKRA-FAVLSGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIITTATTSN  583

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             L G  I+DE L PAD+FATG GHVNPS+A DPGLIYD    DYIPYLCGL+YTD EI++I
Sbjct  584   LKGQPIVDETLRPADIFATGAGHVNPSKAVDPGLIYDTAPQDYIPYLCGLDYTDSEIERI  643

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWL--GKTSLTYSRTVTNVGEANSMYTVKVSPFLGV  380
             V+  V+CS + SIP+ QLNYPS ++      T ++ +RTV NVG A S Y   + P  G+
Sbjct  644   VKENVKCSSIRSIPDYQLNYPSISVSFDGSATKVSVTRTVRNVGPAQSRYRSVIDPIKGL  703

Query  379   D-VGVTPDTLVFTEVNQQLTYNISFSPS-----STPVDIDFVQGAIAWVSQRHIVKSPIA  218
             D +GV P  LVFT+ NQ  +Y + F+ S     +TP    +  GA+ WVS +H V++P+ 
Sbjct  704   DLIGVQPRDLVFTKANQTASYRVDFTRSGKAKPATP----YAWGAVTWVSAKHSVRTPVV  759

Query  217   IIF  209
             + F
Sbjct  760   VRF  762



>gb|KDP25555.1| hypothetical protein JCGZ_20711 [Jatropha curcas]
Length=746

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/743 (56%), Positives = 532/743 (72%), Gaps = 23/743 (3%)
 Frame = -1

Query  2401  SVVVCLTLVFHSVASAKYED-----TYIVHVSPPAAAINGVSEDYRSYFRSFV---SESG  2246
             S+ +  T V  S + A  E+     TYIV +  P       S+D  S+++SF+   S S 
Sbjct  16    SIAISETPVRSSTSEATLEEESNLETYIVLLMKPEDVQFTESKDLDSWYQSFLPANSFSS  75

Query  2245  DEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLY  2066
             D+  + R++HSY HV +GFAAKL+ E    +  K+G + AR QR+  L+TTH+P+FLGL 
Sbjct  76    DQ-VQPRLIHSYHHVVTGFAAKLTAEEAKAIEIKEGVVLARPQRMLTLHTTHTPSFLGLQ  134

Query  2065  QNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLI  1889
             QN G W+ S+YGKGVI+GV+D+GIT +HPSF+ E MPPPP KWKGKCE +GT +CNNKLI
Sbjct  135   QNLGLWKQSNYGKGVIIGVVDSGITADHPSFSGEGMPPPPEKWKGKCELKGTLSCNNKLI  194

Query  1888  GARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIY  1709
             GARNF +         VD + HGTHTASTAAG+ V   + FG A GTAVGMAPL+HL++Y
Sbjct  195   GARNFATN----SNDLVDRDEHGTHTASTAAGSPVQGVSYFGQANGTAVGMAPLSHLAMY  250

Query  1708  KVCTEDGCA-ESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVS  1532
             KV   D  A ES++LAAMDAA++DGVDVLSLS+G  S  F++D +AI A+AA++KGIFVS
Sbjct  251   KVSGRDNKAGESELLAAMDAAVEDGVDVLSLSIGSDSHPFYDDVLAIAAYAAIQKGIFVS  310

Query  1531  CAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLL  1352
             C+AGNEGP   TLSNEAPWLLTVGAST+DR I+AT +LGN A+L+GES FQ ++F P LL
Sbjct  311   CSAGNEGPYSKTLSNEAPWLLTVGASTVDRAIRATVLLGNKAELNGESLFQPKSFLPKLL  370

Query  1351  PLIYPGSK-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLN  1175
             PL+Y G+  D  +A C  GSL  V+VKGK+VLC+  GG   V KGQ VKD GGAAMI++N
Sbjct  371   PLVYAGANGDARSASCDEGSLKNVNVKGKIVLCE--GGYETVSKGQEVKDNGGAAMIVMN  428

Query  1174  QDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASF  995
                +G+   AD HVLPA+ +SY  G  +K YIN+TS P ATI+FKGT  G   AP VASF
Sbjct  429   DQDEGFVTQADNHVLPASHVSYIAGSAIKAYINATSSPKATILFKGTVFGLPEAPQVASF  488

Query  994   SSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIA  815
             SSRGPS ASPGILKPDI+GPGV ILAAWP     +  N    F  +SGTSM+ PHLSG+A
Sbjct  489   SSRGPSTASPGILKPDIIGPGVRILAAWP----HSADNTTNRFEFLSGTSMSCPHLSGVA  544

Query  814   TLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPG  635
              LLKS HPDWSPAAIKSAI+TTA+ YNL G  I D    P+ +F  G GHVNP+ A +PG
Sbjct  545   ALLKSVHPDWSPAAIKSAIMTTANLYNLGGKPITDIWFFPSTLFDIGAGHVNPTAACNPG  604

Query  634   LIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLT  455
             LIYD+Q +DYIPYLCGL Y+D+ +  IV ++V+CS+ TSIPEAQLNYPSF+I LG    T
Sbjct  605   LIYDIQPEDYIPYLCGLGYSDKHVSVIVHKRVKCSKRTSIPEAQLNYPSFSIKLGSGPQT  664

Query  454   YSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDF  275
             Y RTVTNVG+ +S Y++++    GVD+ VTPD + F+EV Q+ TY+++F  +    +  +
Sbjct  665   YIRTVTNVGQPHSTYSLEIVTPNGVDIIVTPDKISFSEVKQKATYSVTFRKNGK-ANASY  723

Query  274   VQGAIAWVSQRHIVKSPIAIIFQ  206
              QG + WV + + VKSPIA+I +
Sbjct  724   AQGYLNWVGEGYRVKSPIAVIIE  746



>emb|CAA06413.1| P69E protein [Solanum lycopersicum]
Length=754

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/753 (55%), Positives = 540/753 (72%), Gaps = 26/753 (3%)
 Frame = -1

Query  2413  MAYISVVVCLTLVFHSVASAKYE---DTYIVHVSPPAAAINGVSE--DYRSYFRSF----  2261
             M ++ ++  L L+F S      +   + YIVHV  P + I+  S   D  SY+ SF    
Sbjct  1     MGFLKIL--LVLIFCSFPWPTIQSGLEIYIVHVESPESLISTQSSFTDLDSYYLSFLPET  58

Query  2260  ---VSESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTH  2090
                +S SG+E E + +++SY +V +GFAA+L+   V EM KK+GF+SA++QR+ +L TTH
Sbjct  59    TSAISSSGNE-EAATMIYSYHNVMTGFAARLTASHVKEMEKKRGFVSAQKQRILSLDTTH  117

Query  2089  SPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGT  1910
             +P+FLGL QN G W++S+YGKGVI+GVLDTGI P+HPSF+D  MPPPPAKWKG CE   T
Sbjct  118   TPSFLGLQQNMGVWKDSNYGKGVIIGVLDTGILPDHPSFSDVGMPPPPAKWKGVCESNFT  177

Query  1909  -ACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMA  1733
               CNNKLIGAR++          P+D +GHGTHTASTAAG FV  A V+G+A GTAVG+A
Sbjct  178   NKCNNKLIGARSY----HLGNGSPIDGDGHGTHTASTAAGAFVKGANVYGNANGTAVGVA  233

Query  1732  PLAHLSIYKVCTEDG-CAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAA  1556
             PLAH+++YKVC+ DG C++SDILAAMD+AIDDGVD+LS+S+GG   S ++D IA+GA++A
Sbjct  234   PLAHIAVYKVCSSDGGCSDSDILAAMDSAIDDGVDILSISIGGSPNSLYDDPIALGAYSA  293

Query  1555  MEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQV  1376
               +G+FVSC+AGN GP   ++ N APW+LTVGAST+DR IKAT  LGNG + +GESA++ 
Sbjct  294   TARGVFVSCSAGNRGPLLASVGNAAPWILTVGASTLDRKIKATVKLGNGEEFEGESAYRP  353

Query  1375  ENFPPTLLPLIYPGSKDEDAA---LCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKD  1205
             +    T   L       +D +    C PGSL    ++GK+VLC   GG++ VDKG+ VKD
Sbjct  354   QTSNSTFFTLFDAAKHAKDPSETPYCRPGSLTDPVIRGKIVLCLACGGVSSVDKGKVVKD  413

Query  1204  AGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIG  1025
             AGG  MI++N    G T  AD HVLPA ++S  DG +++ Y NS   P ATI F+GT IG
Sbjct  414   AGGVGMIVINPSQYGVTKSADAHVLPALDVSDADGTRIRAYTNSILNPVATITFQGTIIG  473

Query  1024  TKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTS  845
              + AP VA+FSSRGP+ ASPGILKPDI+GPGVNILAAWP   + N     +TFNIISGTS
Sbjct  474   DENAPIVAAFSSRGPNTASPGILKPDIIGPGVNILAAWPTSVDGNKNTK-STFNIISGTS  532

Query  844   MATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGH  665
             M+ PHLSG+A LLKS+HPDWSPA IKSAI+TTAD  NL  + ILDERL PAD++A G GH
Sbjct  533   MSCPHLSGVAALLKSSHPDWSPAVIKSAIMTTADTLNLASSPILDERLSPADIYAIGAGH  592

Query  664   VNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSF  485
             VNPSRA+DPGL+YD   +DY+PYLCGLNYT+ ++ ++++RKV CS+V SIPEAQLNYPSF
Sbjct  593   VNPSRANDPGLVYDTPFEDYLPYLCGLNYTNSQVGKLLKRKVNCSEVESIPEAQLNYPSF  652

Query  484   AI-WLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISF  308
              I  LG T  T++RTVTNVG+A S YTV+++   GV V V P  L+F+E+ Q+LTY ++F
Sbjct  653   CISRLGSTPQTFTRTVTNVGDAKSSYTVQIASPKGVVVKVKPRKLIFSELKQKLTYQVTF  712

Query  307   SPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             S  +        +G + W S ++ V+SPIA+ F
Sbjct  713   SKRTNSSKSGVFEGFLKWNSNKYSVRSPIAVEF  745



>gb|EYU39027.1| hypothetical protein MIMGU_mgv1a019149mg, partial [Erythranthe 
guttata]
Length=720

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/683 (61%), Positives = 503/683 (74%), Gaps = 17/683 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             +TYI+HV           +D  S++ SF+  S   G R RIV+SYR+V  GFAA+LS + 
Sbjct  9     ETYIIHVDVNFGFFARF-KDLESWYTSFLPTSISHGRR-RIVYSYRNVFKGFAARLSADE  66

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                M    GFISA  +R  + +TTHSPNFLGL QN GFW  S+YGKGVI+GVLD GI P+
Sbjct  67    AKAMENNPGFISAEPERKLDKHTTHSPNFLGLNQNMGFWEGSNYGKGVIIGVLDYGIFPS  126

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             HPSF+DE MPPPPAKWKGKC+F  TACNNK+IGAR F S        P+DE+GHGTHTAS
Sbjct  127   HPSFSDEGMPPPPAKWKGKCQFNQTACNNKIIGARYFDS----FDNSPLDEDGHGTHTAS  182

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAG+FV  A VFG+A GTA G+AP+AHL+IYKVC+   C ESDILA MDAAIDDGVD+L
Sbjct  183   TAAGSFVAGANVFGNANGTASGIAPMAHLAIYKVCSL-FCFESDILAGMDAAIDDGVDIL  241

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
             S+SLGG S  F+ DSIA+GAF+AMEKGI VSC+AGN GP  ++  NEAPW+LTVGASTID
Sbjct  242   SISLGGRSRDFYRDSIALGAFSAMEKGILVSCSAGNRGPFNFSTQNEAPWILTVGASTID  301

Query  1444  RTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS---KDEDAALCGPGSLdkvdvk  1274
             R I+ATA+LGN   +DGE+ FQ  +FP TLLPL+Y GS    D D   C P SL K++++
Sbjct  302   RKIRATALLGNNVSVDGETLFQPSDFPSTLLPLVYVGSLNTSDTDIQYCTPESLTKINLR  361

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             G +V+C+  G +  V KG+ VK AGGAAMIL+N  +      +D HVLPAT++ Y DGLK
Sbjct  362   GMIVVCE-SGLVTEVSKGEAVKTAGGAAMILVNHRLYANMTFSDAHVLPATDVGYADGLK  420

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             +K YINST+ P ATI+FKGT IG + AP VA+FSSRGP++ASPGILKPDI+GPGVNILAA
Sbjct  421   IKTYINSTTTPMATILFKGTIIGDERAPVVAAFSSRGPNSASPGILKPDIIGPGVNILAA  480

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             WP+    N        NIISGTSM+ PHLSG+A LLKS HPDWSPAAIKSAI+TTAD  N
Sbjct  481   WPISIENNTNTNATF-NIISGTSMSCPHLSGVAALLKSVHPDWSPAAIKSAIMTTADVVN  539

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             L    I DER VPA +FATG GHVNPSRASDPGLIYDL+S+DY+PYLCGLNYT++++  I
Sbjct  540   LAQNPIEDERFVPATIFATGSGHVNPSRASDPGLIYDLKSEDYVPYLCGLNYTNRQVGSI  599

Query  553   VQRKVECSQVTSIPEAQLNYPSFAI----WLGKTSLTYSRTVTNVGEANSMYTVKVSPFL  386
             +QR+V CS  + I EAQLNYPSF+I    W    S TY+R+VTNVG   S Y V++ P  
Sbjct  600   LQRRVNCSVESIIAEAQLNYPSFSISYDSW-QPISQTYTRSVTNVGVPVSSYVVEIVPPP  658

Query  385   GVDVGVTPDTLVFTEVNQQLTYN  317
             G+ V V P TL FTEVNQ L Y 
Sbjct  659   GIGVLVEPTTLDFTEVNQILQYQ  681



>ref|XP_006358144.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=729

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/743 (55%), Positives = 519/743 (70%), Gaps = 27/743 (4%)
 Frame = -1

Query  2416  NMAYISVVVCLTLVFHSVASAKYE--------DTYIVHVSPPAAAINGVSEDYRSYFRSF  2261
             ++ ++S+  C+ ++ HS  S   +        +TYIV +  P   +   S+D   + +SF
Sbjct  2     DLKFVSIFFCIVILLHSSKSTFADHFTNQNDLETYIVQLELPDDFVFSNSKDLYLWHQSF  61

Query  2260  VSESGDEGE-RSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSP  2084
             +  + +  +  SRI++SYRHV +GFAA LS + V  M K+ GF+SAR QRV  L+TTHSP
Sbjct  62    LPTTSENSDLSSRIIYSYRHVFNGFAAMLSSDEVKMMEKQPGFVSARPQRVLQLHTTHSP  121

Query  2083  NFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTAC  1904
             +FLGL+QN G W  S+ GKGVI+G+LD+GI P HPSFND  MPPPPAKWKGKCEF   AC
Sbjct  122   SFLGLHQNVGLWNASNSGKGVIIGLLDSGINPKHPSFNDYGMPPPPAKWKGKCEFNYKAC  181

Query  1903  NNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLA  1724
             NNKLIGARN V    SP    +D +GHGTHT+STAAGNFV  A   G+A GTAVG+AP A
Sbjct  182   NNKLIGARNLVKTAKSP----LDGDGHGTHTSSTAAGNFVVGANFLGNANGTAVGIAPGA  237

Query  1723  HLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKG  1544
             H+++Y+VC  DGC E  ILA  DAAI+DGVDV+S+S+G  +   +E+ +AIGA+ A+EKG
Sbjct  238   HVAMYRVCDTDGCPEVFILAGYDAAIEDGVDVISISIGAMAVPPYEEIMAIGAYRAIEKG  297

Query  1543  IFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFP  1364
             IFVSC+AGN GP   T+ N +PW+LTVGAS+ DR + A AVLGNGA+ +GESAFQ  N  
Sbjct  298   IFVSCSAGNSGPSSATVENGSPWILTVGASSTDRKLSAVAVLGNGAEYEGESAFQSTNIS  357

Query  1363  PTLLPLIYPGSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMI  1184
               LLPLI  G  +  A++   G +          LC   G ++ ++ GQ VK AGGAAMI
Sbjct  358   KKLLPLINGGDCESLASIDVRGKIV---------LCGAVGSLSGIEIGQEVKKAGGAAMI  408

Query  1183  LLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSV  1004
             L N++  GYT     HVLPAT +SY DGLK+ +YI STS P ATI FKGT IG K AP V
Sbjct  409   LKNEEEQGYTTFVTVHVLPATHVSYLDGLKIIEYIKSTSTPVATISFKGTRIGDKHAPVV  468

Query  1003  ASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLS  824
             ASFSSRGP   S GILKPDI+GPGVNILAAW         +  +TFNIISGTSM+ PHL+
Sbjct  469   ASFSSRGPYTISQGILKPDIIGPGVNILAAWIKPPAGVIPSATSTFNIISGTSMSCPHLA  528

Query  823   GIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRAS  644
             G+A LLKSAHPDWSPAAIKSAI+TTAD  NL    I DE+L PAD+   G GHVNPS+A+
Sbjct  529   GVAALLKSAHPDWSPAAIKSAIMTTADLVNLGNNPIQDEKLNPADLLTVGSGHVNPSKAN  588

Query  643   DPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKT  464
             +PGL+YD+Q  DY+PYLCGL YTDQ++  IV +KV C+  +SI EA+LNYPSF+I LG +
Sbjct  589   NPGLVYDIQPQDYVPYLCGLKYTDQQVSTIVNKKVHCT--SSIAEAELNYPSFSIDLGSS  646

Query  463   SLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVD  284
             + TY+RTVTNVGEANS YTV+V    GV + + P  L F+ +NQ+L+Y ++F  S++   
Sbjct  647   AQTYTRTVTNVGEANSTYTVEVIGVEGVVLSIKPSILKFSALNQKLSYEVTFKRSTS---  703

Query  283   IDFVQGAIAWVSQRHIVKSPIAI  215
              D  QG I W S ++ V+SPI+I
Sbjct  704   TDSSQGYINWSSGKYSVRSPISI  726



>ref|XP_008437722.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=764

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/763 (56%), Positives = 537/763 (70%), Gaps = 24/763 (3%)
 Frame = -1

Query  2434  AMKGTPNMAYISVVVCLTLVFHSVASAKYE----------DTYIVHVSPPAAAINGVSED  2285
             A+KG  N      +    L   S  +AK E           TYIVHV  P   + G S +
Sbjct  4     ALKGKKNGCSSFPLYFFLLNIESHVAAKVELPTTPLQSKLQTYIVHVEQPKIRLVGESSN  63

Query  2284  --YRSYFRSFVSESGDEG-ERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQR  2114
                 S++ SF+ +S +   E+ ++++SYR+V SGF+A+L+ E V  M KK GFISA  + 
Sbjct  64    DHIESWYMSFIPKSTETTVEQPQLLYSYRNVMSGFSARLTIEQVKAMEKKDGFISAMPET  123

Query  2113  VYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWK  1934
             + +L+TTH+P +LGL Q FG W+NS++GKGVIVGVLDTGI PNHPSFNDE M PPPAKWK
Sbjct  124   IMSLHTTHTPEYLGLNQQFGIWKNSNFGKGVIVGVLDTGIHPNHPSFNDEGMSPPPAKWK  183

Query  1933  GKCEFEGTACNNKLIGARNF-VSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSA  1757
             GKCEF  + CNNKLIGAR F +         P DE+GHGTHTASTAAG FV +A   G+A
Sbjct  184   GKCEFNSSLCNNKLIGARTFNLGNNFLMEESPNDEKGHGTHTASTAAGAFVEDAEALGNA  243

Query  1756  KGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSI  1577
             KG A G+APLAHL+IYKVC+   C  SD+ A +DAAIDDGVDVLS+SLG  S  FF+D+I
Sbjct  244   KGKAAGIAPLAHLAIYKVCSGKRCPSSDVFAGIDAAIDDGVDVLSISLGSRSVPFFKDNI  303

Query  1576  AIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLD  1397
             A+  F A++KGIFVS +AGN GP   TLSN+APW+LTVGASTI+R I A A LGNG Q +
Sbjct  304   AVATFGAIQKGIFVSSSAGNSGPLNSTLSNDAPWILTVGASTINRRIVAVAKLGNGEQYE  363

Query  1396  GESAFQVENFPPTLLPLIYPGSKDEDA-ALCGPGSLdkvdvkgkvVLCDRGGGIARVDKG  1220
             GES +Q  +FP   LPL+Y G+++    A CG GSL+ +DVKGKVV+C+  GG+ RV KG
Sbjct  364   GESLYQPNDFPSKFLPLVYAGNRENKTYAFCGEGSLENMDVKGKVVVCEGKGGVGRVAKG  423

Query  1219  QTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFK  1040
               VK+AGGAAMIL+NQ+ DG++ L++ HVLPAT +SY  G+ +K YINS+  PTA+I FK
Sbjct  424   LVVKNAGGAAMILINQEEDGFSTLSEAHVLPATHVSYKAGVLIKSYINSSQNPTASISFK  483

Query  1039  GTFIGTK---TAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNAT  869
             GT IG     +APS+ASFSSRGP   SPGILKPDI GPGVNILAAWP     N+ N  +T
Sbjct  484   GTVIGDGDDFSAPSMASFSSRGPCLPSPGILKPDITGPGVNILAAWPF-PLDNDTNTKST  542

Query  868   FNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPAD  689
             FN+ISGTSM+ PHLSGIA L+KS HP+WSPAAIKSAI+TTA+     G  I D+ L PA+
Sbjct  543   FNVISGTSMSCPHLSGIAALIKSVHPNWSPAAIKSAIMTTANIKTPQGEPITDQDLQPAN  602

Query  688   VFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPE  509
              FA G GHVNPS+A+DPGL+YD+Q DDYIPYLCGL Y D+E+  IV R V C  V SI E
Sbjct  603   FFAMGAGHVNPSKAADPGLVYDIQPDDYIPYLCGL-YKDEEVSIIVHRTVICGLVLSIRE  661

Query  508   AQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQ  329
               LNYPSF++ LG    T+ RTVTNVGEANS+YT  V   LGV + V P  L F+ VNQ 
Sbjct  662   GDLNYPSFSVALGGLQ-TFKRTVTNVGEANSVYTAIVEAPLGVSMTVMPRKLFFSRVNQT  720

Query  328   LTYNISFSPSS-TPVDIDFVQGAIAWV--SQRHIVKSPIAIIF  209
             +T+ ++F+      +  +F +G + WV  S++++V+SP+++ F
Sbjct  721   MTFTVTFNRIRWVKIVGEFGEGYLKWVSKSKKYVVRSPVSVKF  763



>gb|EYU28960.1| hypothetical protein MIMGU_mgv1a018215mg, partial [Erythranthe 
guttata]
Length=715

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/709 (57%), Positives = 504/709 (71%), Gaps = 16/709 (2%)
 Frame = -1

Query  2293  SEDYRSYFRSFVSE--------SGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKG  2138
             S+D  +++ SF+          + +  ++ RI++ YRHV SGFAAKLS   V EMRKKKG
Sbjct  9     SDDLDTFYDSFLPTNTNVTTIAASNSDDQPRILYRYRHVFSGFAAKLSAAHVDEMRKKKG  68

Query  2137  FISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENM  1958
             FISAR +R+ +L+TTHSPNFLGL QN G W+NSSYGKG+I+G++DTGITP+HPS ND+ +
Sbjct  69    FISARPERMMHLHTTHSPNFLGLNQNTGLWKNSSYGKGIIIGLVDTGITPDHPSLNDQGV  128

Query  1957  PPPPAKWKGKCEFEGT--ACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFV  1784
             PPPPAKWKGKCEF      CNNKLIGAR F         P +D+ GHGTHT+  AAGNFV
Sbjct  129   PPPPAKWKGKCEFTSPRWTCNNKLIGARYFYRSPPLFVQPLIDQIGHGTHTSGIAAGNFV  188

Query  1783  GNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslggg  1604
             G A  +G+A+GTA G APLAH++IY+ CT   C  S I AA+DAAI+DGVDVLS+SLGG 
Sbjct  189   GGADFYGNARGTASGTAPLAHVAIYQPCTGSHCGSSGIAAAIDAAIEDGVDVLSMSLGGA  248

Query  1603  SASFFEDSI-AIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKAT  1427
                 F D I AIG F AME+GI VSC+AGN+GP   TL NEAPW++TVGAST DR I   
Sbjct  249   LHLHFADDIMAIGTFRAMERGIVVSCSAGNDGPKNKTLYNEAPWIMTVGASTTDRKITVN  308

Query  1426  AVLGNGAQLDGESAFQVENFPPT-LLPLIYPGSKDEDAALCGPGSLdkvdvkgkvVLCDR  1250
             AVLGNG +L+GE+      FP    L L+YP S D   + C  G  +       VV    
Sbjct  309   AVLGNGEELEGETG---TGFPAIGKLDLVYPRSNDTGMSRCFDGHFNTDIKGKIVVCEGM  365

Query  1249  GGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINST  1070
                + RV +G TVK AGGAAMIL+N   DG T   + HVLPA +++Y D LK+K Y+NST
Sbjct  366   KYLVTRVQQGITVKGAGGAAMILINNKFDGDTTFEEPHVLPAMQITYADSLKLKAYLNST  425

Query  1069  SWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntn  890
             S PTAT+ FKGT IG   AP VA+FSSRGPS  SPGILKPDI+GPGVNIL++WP   + +
Sbjct  426   SNPTATMSFKGTVIGNNRAPVVATFSSRGPSVPSPGILKPDIIGPGVNILSSWPASVDNS  485

Query  889   ngngNA-TFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKIL  713
               +  + TFN+ISGTSM+ PHLSG+A LLKS HPDWSPAAIKSAI+TTAD  NL G  I 
Sbjct  486   KTDTKSPTFNMISGTSMSCPHLSGVAALLKSVHPDWSPAAIKSAIMTTADSVNLEGKPIE  545

Query  712   DERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVEC  533
             DE+L PA VFA G GHVNPSRA++PGL+YD+  DDYIPYLCGLNYT+QEI  IV RKV+C
Sbjct  546   DEQLQPASVFAIGSGHVNPSRANNPGLVYDIMPDDYIPYLCGLNYTNQEIGIIVGRKVDC  605

Query  532   SQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTL  353
             S+  SIPEAQLNYPSF+I  G T  TY+RT+TNVG+ANS Y V+++   GV V V P  L
Sbjct  606   SEEKSIPEAQLNYPSFSIIFGSTPQTYTRTLTNVGKANSSYVVEIASPDGVIVKVEPQKL  665

Query  352   VFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
             VF ++  + +Y+++F+ ++  V  +  QG I W +  + V+SPIA++FQ
Sbjct  666   VFPKLGDKSSYSVTFTRTNKGVMNNTTQGFIRWHTAEYSVRSPIAVVFQ  714



>ref|XP_009616445.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=727

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/713 (58%), Positives = 509/713 (71%), Gaps = 25/713 (4%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERS-RIVHSYRHVASGFAAKLSPE  2168
             DTYIV +      +   S+D   + +SF+  +    E S RI+HSYRHV +GFAA LS +
Sbjct  32    DTYIVLLEFRDDLVFSDSKDLYRWHQSFLPTTSTNSEHSSRIIHSYRHVFNGFAAVLSSD  91

Query  2167  MVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITP  1988
              V  + KK GF+SARRQ V  L+TTHSP+FLGL+QN G W  S+ GKGVI+GV+DTGITP
Sbjct  92    EVKMIEKKPGFVSARRQNVLQLHTTHSPDFLGLHQNVGLWNVSNSGKGVIIGVIDTGITP  151

Query  1987  NHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTA  1808
              HPSFND  MPPPP+KWKGKCEF  T CNNKLIGARNF          PVD++GHGTHT+
Sbjct  152   QHPSFNDNGMPPPPSKWKGKCEFNLTVCNNKLIGARNFAQNA----TSPVDDDGHGTHTS  207

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdv  1628
             STAAGNFV  A +  +AKGTA G+AP AH+++Y+VC    C ESDILA +DAAI+DGVDV
Sbjct  208   STAAGNFVEGANLLVNAKGTAAGIAPRAHVAMYRVCASK-CQESDILAGLDAAIEDGVDV  266

Query  1627  lslslgggSA-SFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAST  1451
             +S+SLG  ++ S ++D +AIG+++A+EKGIFVS +AGN GP   +++N APWLLTVGAST
Sbjct  267   ISISLGSLASMSLYDDVVAIGSYSAIEKGIFVSASAGNTGPVNGSVTNGAPWLLTVGAST  326

Query  1450  IDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvdvkg  1271
              DR I A AVLGNGA+  GES +Q  NF   LLPL+ P   +  + +   G +       
Sbjct  327   TDRKISAVAVLGNGAEYGGESVYQPSNFSQKLLPLVNPEYCEFLSTIDVKGKI-------  379

Query  1270  kvVLCDRGG-GIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
               VLC+R   G + V  GQ VKDAGGAAMIL+N +  GYT +AD HVLPAT +SY DG K
Sbjct  380   --VLCERSNTGYSAVQYGQNVKDAGGAAMILMNNEWRGYTTIADVHVLPATHVSYADGEK  437

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             + +Y+ ST+ P ATI FKGT IG K AP+VA FSSRGP   S GILKPDI+GPGVNILAA
Sbjct  438   ILNYMKSTTAPVATISFKGTRIGDKHAPAVADFSSRGP--FSFGILKPDIIGPGVNILAA  495

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             W   +     +  + FNI+SGTSMA PHL+G+A LLKS HPDWSPAAIKSAI+TTAD  N
Sbjct  496   WRT-SVGEITSATSIFNILSGTSMACPHLAGVAALLKSTHPDWSPAAIKSAIMTTADFVN  554

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             L    I DER  PA++ ATG GHVNPSRA+DPGLIYD+Q +DY+PYLCGLNYTDQ++  I
Sbjct  555   LGNDPIQDERFKPANLLATGSGHVNPSRANDPGLIYDIQPEDYVPYLCGLNYTDQQVSVI  614

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDV  374
             V+RKV C+  +SIPE++LN PSF+I L     TY+RTVTNVGEANS YTVKV    GV+V
Sbjct  615   VKRKVHCT--SSIPESELNNPSFSIPLKSGDQTYTRTVTNVGEANSTYTVKVFGLDGVEV  672

Query  373   GVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAI  215
              V P TL F+ +NQ+ +YN++  PS    D    QG I W S R+ V+SPI I
Sbjct  673   TVNPTTLKFSALNQKASYNVTVKPSPLIAD---SQGYITWSSDRYSVRSPIGI  722



>gb|KCW87517.1| hypothetical protein EUGRSUZ_B03965 [Eucalyptus grandis]
Length=743

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/721 (55%), Positives = 518/721 (72%), Gaps = 12/721 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYIVHV  P         D  + +RSF+ + +    +  R+VHSY+HV SGF AKL+ E 
Sbjct  26    TYIVHVRQPMDKHFATMGDLHTLYRSFLPATAAGSNQEQRMVHSYQHVLSGFTAKLTAEE  85

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                +++K G +  R ++  +L+TTH+P+FLGL++  G W++S++GKGVI+GVLDTGI P 
Sbjct  86    AEAIQEKDGVLYVRPEKALSLHTTHTPDFLGLHRGVGLWKDSNFGKGVIIGVLDTGIFPG  145

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             H SF+DE MPPPPAKWKG+C+F  TACN KLIGAR+FVS G++  P   D  GHG+HT+ 
Sbjct  146   HSSFSDEGMPPPPAKWKGRCDFNSTACNKKLIGARSFVSVGNTATP--YDGVGHGSHTSG  203

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAG FV NA+  G+A+GTAVGMAPLAHL++Y+VC   GC E D+LA MDAAI+DGVDVL
Sbjct  204   TAAGAFVRNASALGNARGTAVGMAPLAHLAMYQVCNPSGCLEGDVLAGMDAAIEDGVDVL  263

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
             SLSLGG S  F +DSIA+ +F+A +KGIFVSC+AGN GP  +TLSNEAPW+LTVGAS+ID
Sbjct  264   SLSLGGQSQRFSDDSIALSSFSATQKGIFVSCSAGNLGPSNFTLSNEAPWILTVGASSID  323

Query  1444  RTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG-SKDEDAALCGPGSLdkvdvkg-  1271
             R+IK T  LGNG + DGE+ +Q  +F P LLPL+YPG + D  AALC PGSL+       
Sbjct  324   RSIKTTVRLGNGQEFDGETLYQPHDFHPVLLPLVYPGVNGDGSAALCLPGSLESRSDLRG  383

Query  1270  kvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKV  1091
             KVV+CD G G   V KGQ VK+AGGAAMIL+N    GYT   + HVLPA  + Y  G ++
Sbjct  384   KVVVCDAGDGTGGVAKGQEVKNAGGAAMILVNNPTAGYTTSPELHVLPAVHVRYIAGREI  443

Query  1090  KDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAW  911
             K Y+++ S P ATI+FKGT IG   AP+V+ FSSRGP+  SPGILKPDI+GPGVNILAAW
Sbjct  444   KGYLSTASAPMATILFKGTHIGISVAPTVSFFSSRGPNYQSPGILKPDIIGPGVNILAAW  503

Query  910   PVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNL  731
                 + +    + TFNIISGTSM+ PHLSG+A LLKSAHPDWSPAAIKSAIITTA   N+
Sbjct  504   AFPLDYSIDRRH-TFNIISGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIITTAATLNM  562

Query  730   NGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIV  551
              G  I+D+ L PA++F TG G++NPS+A DPGLIYD+   DYIPYLCGLNYTD E++ IV
Sbjct  563   EGRPIVDQTLHPANIFTTGAGYINPSKAVDPGLIYDIAPQDYIPYLCGLNYTDYEVELIV  622

Query  550   QRKVECSQVTSIPEAQLNYPSFAI-WLGKTS-LTYSRTVTNVGEANSMYTVKVSPFLGVD  377
             ++ V+CS + SIP+ QLNYPS ++ + G  S ++ +RTV NVG A S Y   + P LG+D
Sbjct  623   KKVVKCSSIRSIPDYQLNYPSISLKFTGSVSKVSVTRTVRNVGPAKSRYRSVIDPILGLD  682

Query  376   -VGVTPDTLVFTEVNQQLTYNISFSP---SSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              + V P  L F  VNQ  ++ + F+     +    +   QGAI W+S +H V++P+A++F
Sbjct  683   SISVYPSDLEFANVNQTASFRVDFTRRVGRNATATLPLAQGAITWISAQHSVRTPVAVVF  742

Query  208   Q  206
             +
Sbjct  743   E  743



>ref|XP_006464862.1| PREDICTED: subtilisin-like protease SDD1-like [Citrus sinensis]
Length=744

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/722 (56%), Positives = 513/722 (71%), Gaps = 17/722 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSF----VSES-GDEGERSRIVHSYRHVASGFAAK  2180
              TYIV V  P        +D   ++ SF    VS+S  D+  +SRI++ Y++V SGFAA+
Sbjct  31    QTYIVRVQKPEQGTFSTEKDLERWYHSFLPATVSKSPADDHHQSRILYCYKNVMSGFAAR  90

Query  2179  LSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDT  2000
             L+ E V  M  KKGFISA  +     +TT+SP FLGL QN G W++S+ GKGVI+GV+D+
Sbjct  91    LTAEEVKAMETKKGFISAHVETYLGTHTTNSPKFLGLNQNSGLWKDSNLGKGVIIGVIDS  150

Query  1999  GITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHG  1820
             G+ P+HPSF+DE MPPPPAKWKGKCE EG  CNNK+IG RNF+S       P VD+ GHG
Sbjct  151   GVKPDHPSFSDEGMPPPPAKWKGKCELEGATCNNKVIGVRNFLSS---IGEPAVDDMGHG  207

Query  1819  THTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCT---EDGCAESdilaamdaa  1649
             THTASTAAGNFV  A  FG A GTAVGMAPLAHL+IYK      ++G  +S I AA++AA
Sbjct  208   THTASTAAGNFVSGANTFGLANGTAVGMAPLAHLAIYKTGNGKHQEGF-QSRIAAAIEAA  266

Query  1648  iddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLL  1469
             + DGVDV+S+S G    +F++D IA  AF A+  GIFVSCAAGN+GPD  + +N APW+L
Sbjct  267   VQDGVDVISISYGSPPLAFYDDPIASAAFTAVRNGIFVSCAAGNKGPDPSSSTNGAPWIL  326

Query  1468  TVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLd  1289
             TVGAST DR+I A+A LGN A  D E  F + NF    LPL+YPG ++  AA C PGSL+
Sbjct  327   TVGASTTDRSIVASAQLGNHATYDVEILFMLVNFTSMQLPLVYPGGRNSSAAFCLPGSLN  386

Query  1288  kvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSY  1109
              +DVKGKVV+C+R G + R +    VK+AGGAAMIL++   D Y+ + +THVLPA ++ Y
Sbjct  387   NIDVKGKVVVCERDGNMRRNETEYYVKEAGGAAMILISDKFDAYSAILETHVLPAVQVGY  446

Query  1108  NDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGV  929
               G  +K YINST  PT  I+ +      K+AP VAS S+RGP+  SPGILKPDI+GPGV
Sbjct  447   ATGESIKAYINSTPSPTVAILLRTG--NKKSAPEVASLSARGPNKVSPGILKPDIIGPGV  504

Query  928   NILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITT  749
             +ILAAWP  +  N     ATF I  GTSM+ PHLSGIA LLKS HPDWSPAAIKSAI+TT
Sbjct  505   SILAAWP-SSQENITKTKATFEIADGTSMSCPHLSGIAALLKSTHPDWSPAAIKSAIMTT  563

Query  748   ADQYNLNGTKILDE-RLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTD  572
             AD  NL G  I++   L+PAD+FA G GHVNPS+ +DPGLIYD+Q DDY+PYLCGLNYTD
Sbjct  564   ADIVNLEGKPIINNYNLLPADLFAVGAGHVNPSKTNDPGLIYDIQPDDYVPYLCGLNYTD  623

Query  571   QEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSP  392
             Q++Q IV   V+CS+V SI EA+LNYPSF+I LG +  TY+RT+TNVGEANS YT ++  
Sbjct  624   QQVQTIVDHDVQCSKVPSIAEAELNYPSFSIKLGSSPQTYNRTITNVGEANSSYTHQIVA  683

Query  391   FLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAII  212
               GV++ V P+ + FTE NQ++TY+I+F+  S      + QG ++WVS +H V+SPIA+ 
Sbjct  684   PEGVEISVQPNEISFTERNQKVTYSITFT-RSQKTSASYAQGYLSWVSTQHTVRSPIAVS  742

Query  211   FQ  206
             F+
Sbjct  743   FE  744



>gb|KHN34450.1| Subtilisin-like protease SDD1 [Glycine soja]
Length=688

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/682 (59%), Positives = 512/682 (75%), Gaps = 10/682 (1%)
 Frame = -1

Query  2236  ERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNF  2057
             E+ R+++SY +V SGFAA+L+ E +  + KK GFISAR +R+ +  TT++P FLGL +  
Sbjct  10    EQPRMIYSYLNVMSGFAARLTEEELIAVEKKDGFISARPERILHRQTTNTPQFLGLQKQT  69

Query  2056  GFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARN  1877
             G W+ S++GKG+I+GVLDTGITP HPSF+D  M PPP KWKG+CE   TACNNKLIG R 
Sbjct  70    GLWKESNFGKGIIIGVLDTGITPGHPSFSDAGMSPPPPKWKGRCEINVTACNNKLIGVRT  129

Query  1876  F--VSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKV  1703
             F  V++        +D+ GHGTHTASTAAG FV +A V G+A+GTA G+AP AHL+IY+V
Sbjct  130   FNHVAKLIKGAEAAIDDFGHGTHTASTAAGAFVDHAEVLGNAEGTASGIAPYAHLAIYRV  189

Query  1702  CTEDGCAESdilaamdaaiddgvdvlslslgggSAS-FFEDSIAIGAFAAMEKGIFVSCA  1526
             C++  C ESDILAA+DAA++DGVDVLS+SLG   A  FF+  IAIG FAAM+KGIFVSCA
Sbjct  190   CSKV-CRESDILAALDAAVEDGVDVLSISLGSKRAKPFFDHGIAIGTFAAMQKGIFVSCA  248

Query  1525  AGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPL  1346
             AGN+GP   ++ N APW+LTVGAS I+R+I ATA LGNG + DGES FQ  +F PTLLPL
Sbjct  249   AGNDGPLPGSVINGAPWILTVGASNINRSIAATAKLGNGQEFDGESIFQPSDFSPTLLPL  308

Query  1345  IYPG--SKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQ  1172
              Y G   K EDA  CG GSL+ +D +GKVVLC++GGGI ++ KG+ VK AGGAAMIL+N 
Sbjct  309   AYAGMNGKQEDA-FCGNGSLNDIDFRGKVVLCEKGGGIEKIAKGKEVKRAGGAAMILMND  367

Query  1171  DIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFS  992
             +  G+++  D HVLP T +SY+ GLK+K YI ST+ PTATI+FKGT IG   AP V SFS
Sbjct  368   EKSGFSLNIDVHVLPTTHVSYDAGLKIKAYIYSTATPTATILFKGTIIGNSLAPVVTSFS  427

Query  991   SRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIAT  812
              RGPS  SPGILKPDI+GPG+NILAAWP   N N  +  +TFNI+SGTSM+ PHLSG+A 
Sbjct  428   GRGPSLPSPGILKPDIIGPGLNILAAWPFPLNNNTASK-STFNIMSGTSMSCPHLSGVAA  486

Query  811   LLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGL  632
             LLKS+HP WSPAAIKSAI+T+AD  +     I+ E L PADVFATG G+VNPSRA+DPGL
Sbjct  487   LLKSSHPHWSPAAIKSAIMTSADIISHERKHIVGETLQPADVFATGSGYVNPSRANDPGL  546

Query  631   IYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTY  452
             +YD++ DDYIPYLCGL Y D E++ I  R ++CS+ +SI E +LNYPSF++ L  +  T+
Sbjct  547   VYDIKPDDYIPYLCGLGYKDTEVEIIAGRTIKCSETSSIREGELNYPSFSVVL-DSPQTF  605

Query  451   SRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVD-IDF  275
             +RTVTNVGEANS Y V VS   GVDV V P+ L F+E NQ+ TY+++FS      + + +
Sbjct  606   TRTVTNVGEANSSYVVTVSAPDGVDVKVQPNKLYFSEANQKETYSVTFSRIELDDETVKY  665

Query  274   VQGAIAWVSQRHIVKSPIAIIF  209
             VQG + WVS +H V+SPI+I F
Sbjct  666   VQGFLQWVSAKHTVRSPISISF  687



>ref|XP_006427879.1| hypothetical protein CICLE_v10027438mg, partial [Citrus clementina]
 gb|ESR41119.1| hypothetical protein CICLE_v10027438mg, partial [Citrus clementina]
Length=731

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/722 (56%), Positives = 512/722 (71%), Gaps = 17/722 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSF----VSES-GDEGERSRIVHSYRHVASGFAAK  2180
              TYIV V  P        +D   ++ SF    VS+S  D+  +SRI++ Y++V SGFAA+
Sbjct  18    QTYIVRVQKPEQGTFSTEKDLERWYHSFLPATVSKSPADDHHQSRILYCYKNVMSGFAAR  77

Query  2179  LSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDT  2000
             L+ E V  M  KKGFISA  +     +TT+SP FLGL QN G W++S+ GKGVI+GV+D+
Sbjct  78    LTAEEVKAMETKKGFISAHVETYLGTHTTNSPKFLGLNQNSGLWKDSNLGKGVIIGVIDS  137

Query  1999  GITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHG  1820
             G+ P+HPSF+DE MPPPPAKWKGKCE EG  CNNK+IG RNF+S       P VD+ GHG
Sbjct  138   GVKPDHPSFSDEGMPPPPAKWKGKCELEGATCNNKVIGVRNFLSS---IGEPAVDDMGHG  194

Query  1819  THTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCT---EDGCAESdilaamdaa  1649
             THTASTAAGNFV  A  FG A GTAVGMAPLAHL+IYK      ++G  +S I AA++AA
Sbjct  195   THTASTAAGNFVSGANTFGLANGTAVGMAPLAHLAIYKTGNGKHQEGF-QSRIAAAIEAA  253

Query  1648  iddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLL  1469
             + DGVDV+ +S G    +F++D IA  AF A+  GIFVSCAAGN+GPD  + +N APW+L
Sbjct  254   VQDGVDVIWISYGSPPLAFYDDPIASAAFTAVRNGIFVSCAAGNKGPDPSSSTNGAPWIL  313

Query  1468  TVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLd  1289
             TVGAST DR+I A+A LGN A  D E  F + NF    LPL+YPG ++  AA C PGSL+
Sbjct  314   TVGASTTDRSIVASAQLGNHATYDVEILFMLVNFTSMQLPLVYPGGRNSSAAFCLPGSLN  373

Query  1288  kvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSY  1109
              +DVKGKVV+C+R G + R +    VK+AGGAAMIL++   D Y+ + +THVLPA ++ Y
Sbjct  374   NIDVKGKVVVCERDGNMRRNETEYYVKEAGGAAMILISDKFDAYSAILETHVLPAVQVGY  433

Query  1108  NDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGV  929
               G  +K YINST  PT  I+ +      K+AP VAS S+RGP+  SPGILKPDI+GPGV
Sbjct  434   ATGESIKAYINSTPSPTVAILLRTG--NKKSAPEVASLSARGPNKVSPGILKPDIIGPGV  491

Query  928   NILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITT  749
             +ILAAWP  +  N     ATF I  GTSM+ PHLSGIA LLKS HPDWSPAAIKSAI+TT
Sbjct  492   SILAAWP-SSQENITKTKATFEIADGTSMSCPHLSGIAALLKSTHPDWSPAAIKSAIMTT  550

Query  748   ADQYNLNGTKILDE-RLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTD  572
             AD  NL G  I++   L+PAD+FA G GHVNPS+ +DPGLIYD+Q DDY+PYLCGLNYTD
Sbjct  551   ADIVNLEGKPIINNYNLLPADLFAVGAGHVNPSKTNDPGLIYDIQPDDYVPYLCGLNYTD  610

Query  571   QEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSP  392
             Q++Q IV   V+CS+V SI EA+LNYPSF+I LG +  TY+RT+TNVGEANS YT ++  
Sbjct  611   QQVQTIVDHDVQCSKVPSIAEAELNYPSFSIKLGSSPQTYNRTITNVGEANSSYTHQIVA  670

Query  391   FLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAII  212
               GV++ V P+ + FTE NQ++TY+I+F+  S      + QG ++WVS +H V+SPIA+ 
Sbjct  671   PEGVEISVQPNEISFTERNQKVTYSITFT-RSQKTSASYAQGYLSWVSTQHTVRSPIAVS  729

Query  211   FQ  206
             F+
Sbjct  730   FE  731



>ref|XP_010046741.1| PREDICTED: subtilisin-like protease SDD1 [Eucalyptus grandis]
Length=761

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/721 (55%), Positives = 518/721 (72%), Gaps = 12/721 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYIVHV  P         D  + +RSF+ + +    +  R+VHSY+HV SGF AKL+ E 
Sbjct  44    TYIVHVRQPMDKHFATMGDLHTLYRSFLPATAAGSNQEQRMVHSYQHVLSGFTAKLTAEE  103

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                +++K G +  R ++  +L+TTH+P+FLGL++  G W++S++GKGVI+GVLDTGI P 
Sbjct  104   AEAIQEKDGVLYVRPEKALSLHTTHTPDFLGLHRGVGLWKDSNFGKGVIIGVLDTGIFPG  163

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             H SF+DE MPPPPAKWKG+C+F  TACN KLIGAR+FVS G++  P   D  GHG+HT+ 
Sbjct  164   HSSFSDEGMPPPPAKWKGRCDFNSTACNKKLIGARSFVSVGNTATP--YDGVGHGSHTSG  221

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAG FV NA+  G+A+GTAVGMAPLAHL++Y+VC   GC E D+LA MDAAI+DGVDVL
Sbjct  222   TAAGAFVRNASALGNARGTAVGMAPLAHLAMYQVCNPSGCLEGDVLAGMDAAIEDGVDVL  281

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
             SLSLGG S  F +DSIA+ +F+A +KGIFVSC+AGN GP  +TLSNEAPW+LTVGAS+ID
Sbjct  282   SLSLGGQSQRFSDDSIALSSFSATQKGIFVSCSAGNLGPSNFTLSNEAPWILTVGASSID  341

Query  1444  RTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG-SKDEDAALCGPGSLdkvdvkg-  1271
             R+IK T  LGNG + DGE+ +Q  +F P LLPL+YPG + D  AALC PGSL+       
Sbjct  342   RSIKTTVRLGNGQEFDGETLYQPHDFHPVLLPLVYPGVNGDGSAALCLPGSLESRSDLRG  401

Query  1270  kvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKV  1091
             KVV+CD G G   V KGQ VK+AGGAAMIL+N    GYT   + HVLPA  + Y  G ++
Sbjct  402   KVVVCDAGDGTGGVAKGQEVKNAGGAAMILVNNPTAGYTTSPELHVLPAVHVRYIAGREI  461

Query  1090  KDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAW  911
             K Y+++ S P ATI+FKGT IG   AP+V+ FSSRGP+  SPGILKPDI+GPGVNILAAW
Sbjct  462   KGYLSTASAPMATILFKGTHIGISVAPTVSFFSSRGPNYQSPGILKPDIIGPGVNILAAW  521

Query  910   PVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNL  731
                 + +    + TFNIISGTSM+ PHLSG+A LLKSAHPDWSPAAIKSAIITTA   N+
Sbjct  522   AFPLDYSIDRRH-TFNIISGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIITTAATLNM  580

Query  730   NGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIV  551
              G  I+D+ L PA++F TG G++NPS+A DPGLIYD+   DYIPYLCGLNYTD E++ IV
Sbjct  581   EGRPIVDQTLHPANIFTTGAGYINPSKAVDPGLIYDIAPQDYIPYLCGLNYTDYEVELIV  640

Query  550   QRKVECSQVTSIPEAQLNYPSFAI-WLGKTS-LTYSRTVTNVGEANSMYTVKVSPFLGVD  377
             ++ V+CS + SIP+ QLNYPS ++ + G  S ++ +RTV NVG A S Y   + P LG+D
Sbjct  641   KKVVKCSSIRSIPDYQLNYPSISLKFTGSVSKVSVTRTVRNVGPAKSRYRSVIDPILGLD  700

Query  376   -VGVTPDTLVFTEVNQQLTYNISFSP---SSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              + V P  L F  VNQ  ++ + F+     +    +   QGAI W+S +H V++P+A++F
Sbjct  701   SISVYPSDLEFANVNQTASFRVDFTRRVGRNATATLPLAQGAITWISAQHSVRTPVAVVF  760

Query  208   Q  206
             +
Sbjct  761   E  761



>ref|XP_010034346.1| PREDICTED: subtilisin-like protease SDD1 [Eucalyptus grandis]
Length=757

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/719 (56%), Positives = 508/719 (71%), Gaps = 12/719 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYI+ V  P        ED  S +RSF+ + +    +  R+VHSY+H  SGFAAKL+ E 
Sbjct  44    TYIIQVRKPTDKHFATVEDLDSLYRSFLPTTAASSKQEQRMVHSYQHALSGFAAKLTAEE  103

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                +++K G +    + V +L+TT +P+FLGL+Q  GFW++S++GKGVI+G+LD+G+ P 
Sbjct  104   AKAVQEKDGVLQVHPEEVLSLHTTRTPDFLGLHQGVGFWKDSNFGKGVIIGLLDSGVFPE  163

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSE-GssppppPVDEEGHGTHTA  1808
             HPSFNDE +PPPPAKWKG+C+F GT+CNNKLIGAR+F++   ++   PP D+ GHGTHT+
Sbjct  164   HPSFNDEGVPPPPAKWKGRCDFNGTSCNNKLIGARSFINPINATQAVPPYDDTGHGTHTS  223

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdv  1628
             STAAG FV +A+  G+AKGTAVGMAPLAHL++YKVC +DGC  S ILA  DAAI+DGVDV
Sbjct  224   STAAGAFVRDASALGNAKGTAVGMAPLAHLAMYKVCVDDGCPASSILAGFDAAIEDGVDV  283

Query  1627  lslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTI  1448
             LS+SLGG S  FF+D IA GAFAA +KGIFVSC+AGN GP   +LSNEAPW+LTVGAS+I
Sbjct  284   LSVSLGGNSKPFFKDWIAQGAFAATQKGIFVSCSAGNSGPYNTSLSNEAPWILTVGASSI  343

Query  1447  DRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvdvkgk  1268
             DR+I+ATA LGNG + DGE+ +Q  NF P LLPLIYP   D+    C  GSL        
Sbjct  344   DRSIEATARLGNGLEFDGETLYQPHNFHPALLPLIYP-EIDDRIQDCAKGSLRFRSDIRG  402

Query  1267  vVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVK  1088
              V+    G    V  GQ VKD GG AMIL+N   DGYT LAD HVLPA E+SY  G ++K
Sbjct  403   KVVVCDLGSTEPVVAGQEVKDRGGVAMILVNGLTDGYTTLADAHVLPAVEVSYVAGREIK  462

Query  1087  DYINSTSWPTATIVFKGTFIGTKT-APSVASFSSRGPSNASPGILKPDILGPGVNILAAW  911
              Y N+ S P ATI+FKGT I  ++ AP+VASFSSRGP+  SPGILKPDI+GPG+NILA W
Sbjct  463   RYFNTASTPMATILFKGTHIIRRSVAPAVASFSSRGPNRQSPGILKPDIIGPGLNILAGW  522

Query  910   PVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNL  731
             P   + +       FN+ISGTSM+ PHLSG+A LLKS HP+WSP AIKSAI+TTA  +N+
Sbjct  523   PFPLDNSTNL----FNVISGTSMSCPHLSGVAALLKSTHPNWSPEAIKSAIMTTATTFNM  578

Query  730   NGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIV  551
              G  I+DE L PAD+FATG GH+NPS+A DPGL+YD    DYIPYLCGL   + +I+ IV
Sbjct  579   EGRPIVDETLHPADIFATGAGHINPSKAVDPGLVYDDGPQDYIPYLCGLISNESQIEVIV  638

Query  550   QRKVECSQVTSIPEAQLNYPSFAIWLGK--TSLTYSRTVTNVGEANSMYTVKVSPFLG-V  380
             ++KV CS + SIP+ QLNYPS  +      T+++ +RTV NVG A S Y   V P  G V
Sbjct  639   KKKVNCSSIGSIPDYQLNYPSITVSFKPSVTNVSVTRTVKNVGPAKSRYQSVVDPIKGPV  698

Query  379   DVGVTPDTLVFTEVNQQLTYNISFSPS-STPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
              +GV P  LVFTE NQ  +Y + F+    +     + QGAI WVS RH V++PIAI+F+
Sbjct  699   SIGVYPRELVFTEANQTASYRVDFTREVDSKAPSPYAQGAITWVSARHSVRTPIAIVFE  757



>ref|XP_009411516.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=750

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/721 (57%), Positives = 515/721 (71%), Gaps = 15/721 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
             TYIVHV PP +A  G S D   ++RSF++    E    +++H+Y +VASGFAA+L+ + +
Sbjct  33    TYIVHVQPPESAAPGTSSDRVVWYRSFLATVTSE---LQMIHAYTNVASGFAARLTEQEL  89

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
             + M    GF+ A   R+Y L TTH+P+FLGL+ + G W  SSYGKGVIVG+LDTG+ P+H
Sbjct  90    AAMSLIPGFVRAYPDRMYRLQTTHTPDFLGLHMHQGLWNLSSYGKGVIVGLLDTGVFPDH  149

Query  1981  PSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPV------DEEGHG  1820
             PSF+   MPPPPAKW G+C+F  ++CNNKLIGAR F++   +            D+ GHG
Sbjct  150   PSFSGLGMPPPPAKWTGRCDFNASSCNNKLIGARTFLAGAKAARGEAFASDPPNDDVGHG  209

Query  1819  THTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaidd  1640
             THT+STAAG  V  A V G+AKG AVGMAPLAHL++YKVC + GC  SDILA MDAA+ D
Sbjct  210   THTSSTAAGAAVPGAQVLGNAKGVAVGMAPLAHLAMYKVCADFGCFSSDILAGMDAAVSD  269

Query  1639  gvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVG  1460
             GVDVLSLSLGG S  F++DSIA+GA+AA+E G+FVSCAAGN GP+  TLSNEAPW+LTV 
Sbjct  270   GVDVLSLSLGGASLPFYDDSIALGAYAAIENGVFVSCAAGNGGPESSTLSNEAPWILTVA  329

Query  1459  ASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG-SKDEDAALCGPGSLdkv  1283
             AST+DR I+ T  LGNG   DGES +Q  +FPPTL PL+Y G S + D   CG GS D  
Sbjct  330   ASTMDRNIRVTVTLGNGLSFDGESLYQPSSFPPTLYPLVYAGASGNPDTVFCGIGSFDGF  389

Query  1282  dvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYND  1103
             DVKGK+VLC+RGGGI R+DKG  V+ AGG  MIL+NQ  DGY+ LAD HVLPA+ +S+  
Sbjct  390   DVKGKIVLCERGGGIGRIDKGTAVQSAGGIGMILMNQAADGYSTLADAHVLPASHVSFAA  449

Query  1102  GLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNI  923
             G ++K YINS + PTA ++FKGT +GT  AP++ SFSSRGPS ASPGILKPDI GPGVN+
Sbjct  450   GEQIKAYINSLASPTAALLFKGTILGTSPAPAITSFSSRGPSQASPGILKPDITGPGVNV  509

Query  922   LAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTAD  743
             LAAWP     +N  G  TF+IISGTSMATPHLSGIA L+K  HPDWSPAAIKSA++TTA 
Sbjct  510   LAAWPFPVGPSNYTG-VTFDIISGTSMATPHLSGIAALIKGVHPDWSPAAIKSAMMTTAS  568

Query  742   QYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEI  563
               + +G  I++E+LVPAD+FATG GHVNP +AS+PGL+YDL +DDYI YLCGL YT  E+
Sbjct  569   VQDHSGNPIVNEQLVPADLFATGAGHVNPVKASNPGLVYDLTADDYIGYLCGLGYTSTEV  628

Query  562   QQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYS---RTVTNVGEANSMYTVKVSP  392
               I ++ + C  V+SIPE  LNYPS ++ LG   +TY+   RTV NVGEA   Y  +V  
Sbjct  629   SVIARKPILCPTVSSIPEKDLNYPSISVSLGG-KVTYTVVKRTVKNVGEAAVTYWAEVGA  687

Query  391   FLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAII  212
               G  V V P  L FT VN++  + + F  +     +   QG + WVS +H V+SPI+I 
Sbjct  688   PNGTYVRVYPRALSFTYVNEEKQFFVVFKMTGGCGCVGAAQGYLKWVSVKHEVRSPISIT  747

Query  211   F  209
             +
Sbjct  748   Y  748



>ref|XP_004244717.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=744

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/742 (55%), Positives = 528/742 (71%), Gaps = 18/742 (2%)
 Frame = -1

Query  2407  YISVVVCLTLVFHSVASAKYEDTYIVHVSPPAAAINGVSE--DYRSYFRSFVS---ESGD  2243
             + S++ C +   HS+ S    +TYIV V  P + I+      D  S+++SF+    E+  
Sbjct  8     FFSILACFSC--HSMQSDL--ETYIVQVESPESQISTQPSRMDLESWYKSFMPKTIETAS  63

Query  2242  EGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQ  2063
               E+ ++++SY +V  GFAA+LS + V EM KK GFI A  QR+ +L+TTHSP+FL L Q
Sbjct  64    SDEKPQLIYSYHNVIIGFAARLSAKQVKEMEKKPGFIFAWPQRILSLHTTHSPSFLELQQ  123

Query  2062  NFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTA-CNNKLIG  1886
             N G W + +YG+GVI+G+ DTGITP+HPSF+DE MPPPPAKWKGKC+   T  CNNKLIG
Sbjct  124   NVGLWSDDNYGEGVIIGLFDTGITPDHPSFSDEGMPPPPAKWKGKCDSNFTGKCNNKLIG  183

Query  1885  ARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYK  1706
             A+ +          P DE GHGTHT+STAAGNFV  A V+G+AKGTAVG+APLAHL++YK
Sbjct  184   AKTY----PLNSESPKDEAGHGTHTSSTAAGNFVKGANVYGNAKGTAVGIAPLAHLAMYK  239

Query  1705  VCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCA  1526
             VC  D C+ES ILA MD AIDDGVD++SLSLGG S  F+ D IA+GA++A ++GI VSC+
Sbjct  240   VCDND-CSESAILAGMDEAIDDGVDIMSLSLGGSSRPFYYDVIALGAYSAAKRGILVSCS  298

Query  1525  AGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPL  1346
             AGN GP + TLSNEAPW+LTVGASTIDR +KAT +LG+    +GES F  +    +  PL
Sbjct  299   AGNGGPSHSTLSNEAPWILTVGASTIDRELKATVMLGDQKLFEGESVFSPKVPDSSFYPL  358

Query  1345  IYP--GSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQ  1172
             I P   +    +  C PG+L     KGK+V+C  GG ++ + KGQ VKDAGG  MIL++ 
Sbjct  359   IDPSLNATHIGSRFCEPGTLSDPKFKGKIVVCMAGGYVSTIGKGQVVKDAGGVGMILVSI  418

Query  1171  DIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFS  992
                G++  AD HVLPA  +++NDG+++  YINSTS PTA I+F GT IG K AP VA+FS
Sbjct  419   PEYGFSKFADPHVLPALYITFNDGMEILQYINSTSEPTARIMFHGTIIGDKEAPVVAAFS  478

Query  991   SRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIAT  812
             SRGPS ASPGILKPDI+GPG NILAAW    +      +A FNII GTSM+ PHLSG+A 
Sbjct  479   SRGPSYASPGILKPDIIGPGNNILAAWHTSVDYEKHTKSA-FNIIQGTSMSCPHLSGVAA  537

Query  811   LLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGL  632
             LLKS+H +WSP+AIKSAI+TTA+  NL    ILDERL+PAD+FA G GHVNP RA+DPGL
Sbjct  538   LLKSSHRNWSPSAIKSAIMTTANTLNLANVPILDERLLPADIFAIGAGHVNPLRANDPGL  597

Query  631   IYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTY  452
             IYD+  +DY+PYLCGLNYT+Q++  IV+ KV+C++V  IPEAQLNYPSF+I LG  S TY
Sbjct  598   IYDISIEDYLPYLCGLNYTNQQVGSIVKHKVDCNKVKHIPEAQLNYPSFSITLGDISQTY  657

Query  451   SRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFV  272
             +RTVTNVGEA S YTV++     V V V P TL F++++Q+L Y ++F+           
Sbjct  658   TRTVTNVGEAKSSYTVEIDSPPRVTVIVKPSTLKFSQLDQKLKYQVTFTRRDDSTSSGIA  717

Query  271   QGAIAWVSQRHIVKSPIAIIFQ  206
             QG + W S+++ V+SPIA++ Q
Sbjct  718   QGFLKWSSKKYSVRSPIAVVLQ  739



>ref|XP_010041553.1| PREDICTED: subtilisin-like protease SDD1 [Eucalyptus grandis]
 gb|KCW44274.1| hypothetical protein EUGRSUZ_L02292 [Eucalyptus grandis]
Length=729

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/720 (55%), Positives = 508/720 (71%), Gaps = 10/720 (1%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYI+ V  P        ED  S +RSF+ + +    +  R+VHSY+H  SGFAAKL+ E 
Sbjct  12    TYIIQVRKPTDKHFATVEDLDSLYRSFLPTTAASSNQEQRMVHSYQHAISGFAAKLTAEE  71

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                +++K G +    + V +L+TT +P+FLGL+Q  G W++S++GKG+I+G+LD+G+ P+
Sbjct  72    AKAVQEKDGVLQVHPEEVLSLHTTRTPDFLGLHQGVGLWKDSNFGKGMIIGLLDSGVFPD  131

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSE-GssppppPVDEEGHGTHTA  1808
             HPSFNDE +PPPPAKWKG+C+F GT+CNNKLIGAR+F++   ++   PP D+ GHGTHT+
Sbjct  132   HPSFNDEGVPPPPAKWKGRCDFNGTSCNNKLIGARSFINPINATQAVPPYDDTGHGTHTS  191

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdv  1628
             S AAG FV +A+  G+AKGTAVGMAPLAHL++YKVC +D C  S ILA  DAAI+DGVDV
Sbjct  192   SIAAGAFVRDASALGNAKGTAVGMAPLAHLAMYKVCVDDACPASSILAGFDAAIEDGVDV  251

Query  1627  lslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTI  1448
             LS+SLGG    FF D IA GAFAA +KGIFVSC+AGN GP   TLSNEAPW+LTVGAS+I
Sbjct  252   LSVSLGGNPKPFFNDWIAQGAFAATQKGIFVSCSAGNLGPYNTTLSNEAPWILTVGASSI  311

Query  1447  DRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvdvkgk  1268
             DR+I+ATA LGNG + DGE+ +Q  NF P L+PLIYP   D+    CG GSL        
Sbjct  312   DRSIEATARLGNGLEFDGETLYQPHNFQPALVPLIYP-EIDDGIQDCGEGSLRFRSDIRG  370

Query  1267  vVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVK  1088
              V+    G    V  GQ VKD GG AMIL+N+  DGYT L   HVLPA E+SY  G ++K
Sbjct  371   KVVVCDLGSTEPVAAGQEVKDRGGVAMILVNRPTDGYTTLVYAHVLPAVEVSYVAGREIK  430

Query  1087  DYINSTSWPTATIVFKGTFIGTKT-APSVASFSSRGPSNASPGILKPDILGPGVNILAAW  911
              Y N+ S P ATI+FKGT I  ++ AP+VASFSSRGP+  SPGILKPDI+GPG+NILA W
Sbjct  431   RYFNTASTPVATILFKGTHIIRRSIAPAVASFSSRGPNRQSPGILKPDIIGPGLNILAGW  490

Query  910   PVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNL  731
             P   + +    +A FN+ISGTSM+ PHLSG+A LLKSAHP+WSPAAIKSAI+TTA   N+
Sbjct  491   PFPLDNSTNLKHA-FNVISGTSMSCPHLSGVAALLKSAHPNWSPAAIKSAIMTTATTINM  549

Query  730   NGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIV  551
              G  I+DE L PAD+FATG GH+NPS+A DPGL+YD    DYIPYLCGL   + +I+ IV
Sbjct  550   EGRPIVDETLHPADIFATGAGHINPSKAVDPGLVYDDGPQDYIPYLCGLISNESQIEVIV  609

Query  550   QRKVECSQVTSIPEAQLNYPSFAIWLGKTSLT---YSRTVTNVGEANSMYTVKVSPFLG-  383
             ++KV CS + SIP+ QLNYPS  +   K S+T    +RTV NVG A S Y   V P  G 
Sbjct  610   KKKVNCSSIGSIPDYQLNYPSITVSFHKPSVTNVSVTRTVKNVGPAKSRYQSVVDPIKGP  669

Query  382   VDVGVTPDTLVFTEVNQQLTYNISFSPS-STPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
             V +GV P  LVFTE NQ  +Y + F+    +     +VQGAI WVS RH V++P+A++F+
Sbjct  670   VSIGVYPRELVFTEANQTASYRVDFTREVDSKAPSPYVQGAITWVSARHSVRTPVAVVFK  729



>ref|XP_004245675.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=748

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/726 (56%), Positives = 524/726 (72%), Gaps = 20/726 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSE--DYRSYFRSF-------VSESGDEGERSRIVHSYRHVASG  2192
             +TYIVHV  P + I   S   D  SY+ SF       +S SG+E E + +++SY +V +G
Sbjct  25    ETYIVHVESPESLITAQSSLMDLDSYYLSFLPKTTTAISSSGNE-EAATMIYSYHNVMTG  83

Query  2191  FAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVG  2012
             FAA+L+ E V EM KK GF+SA++QR+ +L+TTH+P+FLGL QN G W++S++G+GVI+G
Sbjct  84    FAARLTAEQVKEMEKKHGFVSAQKQRILSLHTTHTPSFLGLQQNMGLWKDSNFGEGVIIG  143

Query  2011  VLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppPVD  1835
             VLDTGI P+HPSF+D  MPPPPAKWKG CE   T  CNNKLIGAR++          P+D
Sbjct  144   VLDTGILPDHPSFSDVGMPPPPAKWKGVCEPNFTNKCNNKLIGARSY----KLGNGSPID  199

Query  1834  EEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamd  1655
             ++GHGTHTASTAAG FV  A V+ +A GTAVG+APLAH++IYKVC   GC++SDILAAMD
Sbjct  200   DDGHGTHTASTAAGAFVKGANVYENANGTAVGVAPLAHIAIYKVCNSVGCSDSDILAAMD  259

Query  1654  aaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPW  1475
             +AIDDGVD+LS+S+GG     +++SIA+GA++A ++GI VSC+AGN GP   ++ N APW
Sbjct  260   SAIDDGVDILSISIGGSLRPLYDESIALGAYSATQRGILVSCSAGNNGPSPASVDNSAPW  319

Query  1474  LLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAA---LCG  1304
             +LTVGAST+DR IKATA LGNG + +GESA++ +    T   L       +D +    C 
Sbjct  320   ILTVGASTLDRKIKATAKLGNGEEFEGESAYRPKISNSTFFTLFDAAKNAKDPSETPYCR  379

Query  1303  PGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPA  1124
              GSL    ++GK+VLC   GG+A VDKGQ VKDAGG  MI++N    G T  AD HVLPA
Sbjct  380   RGSLTDPAIRGKIVLCLAFGGVANVDKGQAVKDAGGVGMIVINPSQYGVTKSADAHVLPA  439

Query  1123  TELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDI  944
               +S  DG K++ Y NS S P ATI  +GT IG K AP VA+FSSRGPS  +PGILKPDI
Sbjct  440   LVVSAADGSKIRAYTNSISNPVATITIQGTVIGDKNAPIVAAFSSRGPSKPNPGILKPDI  499

Query  943   LGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKS  764
             +GPGVNILAAWP   + N     +TFNIISGTSM+ PHLSG+A LLK  HPDWSPA IKS
Sbjct  500   IGPGVNILAAWPTSVDDNKDTK-STFNIISGTSMSCPHLSGVAALLKRTHPDWSPAVIKS  558

Query  763   AIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGL  584
             A++TTAD  NL  + ILD+RL PAD++A G GHVNPSRA+DPGL+YD   +DY+ YLCGL
Sbjct  559   AMMTTADTLNLASSPILDQRLRPADIYAIGAGHVNPSRANDPGLVYDTPFEDYVAYLCGL  618

Query  583   NYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAI-WLGKTSLTYSRTVTNVGEANSMYT  407
             NYT+ ++ +++QRKV C +V SIPEAQLNYPSF+I  LG T  TY+RTVTNVG+A S Y 
Sbjct  619   NYTNPQVSKLLQRKVNCWEVESIPEAQLNYPSFSISGLGSTPQTYTRTVTNVGDAESSYK  678

Query  406   VKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKS  227
             V+++   GV V V P  L F+E+NQ+LTY ++FS + +    + V+G + W S  + V+S
Sbjct  679   VEIASPKGVVVEVEPSELNFSELNQKLTYQVTFSKTISSSQPEVVEGFLKWNSNTYSVRS  738

Query  226   PIAIIF  209
             PIA++ 
Sbjct  739   PIAVVL  744



>emb|CAB67119.1| subtilisin-like protease [Solanum lycopersicum]
Length=743

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/739 (55%), Positives = 521/739 (71%), Gaps = 20/739 (3%)
 Frame = -1

Query  2395  VVCLTLVFHSVASAKYE-DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERS--R  2225
             ++C+  +F + A+ +     YIVH   P+       +D  S++ SF+  +  +  R   R
Sbjct  14    LICVLFLFSTNATEQNNSQIYIVHCEFPSGERTSKYQDLESWYLSFLPATTSDSSREAPR  73

Query  2224  IVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWR  2045
             +++SYR+V +GFAAKLS E + EM K +GF+SAR QR+  L+TTHS +FLGL QN GFW+
Sbjct  74    LIYSYRNVLTGFAAKLSQEDIKEMEKMEGFVSARPQRLLKLHTTHSVDFLGLQQNMGFWK  133

Query  2044  NSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARNF-V  1871
             +S+YGKGVI+GV+D+G+ P+HPSF+D  MPP PAKWKG CE +  T CNNKLIGAR++ +
Sbjct  134   DSNYGKGVIIGVIDSGVFPDHPSFSDVGMPPIPAKWKGVCESDFATKCNNKLIGARSYQI  193

Query  1870  SEGssppppPVDEEGHGTHTASTAAGNFV-GNAAVFGSAKGTAVGMAPLAHLSIYKVCTE  1694
             + GS      +D +GHGTHTA T AG FV G     G+A GTAVG+APLAH++IYKVC  
Sbjct  194   ANGSP-----IDNDGHGTHTAGTTAGAFVEGANGSSGNANGTAVGVAPLAHIAIYKVCNS  248

Query  1693  DGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNE  1514
             + C++SDILAAMD+AI+ GVD+LS+SLGG    F+EDSIA GA+AA E+GI VSC+AGN 
Sbjct  249   NSCSDSDILAAMDSAIEYGVDILSMSLGGSPVPFYEDSIAFGAYAATERGILVSCSAGNS  308

Query  1513  GPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG  1334
             GP Y T SN APW+LTVGASTIDR IKAT  LGN  + +GESA++ +    T   L Y  
Sbjct  309   GPSYITASNTAPWILTVGASTIDRKIKATVTLGNTEEFEGESAYRPQISDSTYFTL-YDA  367

Query  1333  SK---DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDID  1163
             +K   D     C            K+ +C + G ++ ++K Q VKDAGG  MI++N  I 
Sbjct  368   AKSIGDPSEPYCTRS--LTDPAIKKIAIC-QAGDVSNIEKRQAVKDAGGVGMIVINHHIY  424

Query  1162  GYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRG  983
             G T  AD HVLP   +S  DG K+ DY NS S P ATI  +GT IG K AP VA+FSSRG
Sbjct  425   GVTKSADAHVLPGLVVSAADGSKILDYTNSISNPIATITIQGTIIGDKNAPIVAAFSSRG  484

Query  982   PSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLK  803
             PS  +PGILKPDI+GPGVNILAAWP   + N     +TFNIISGTSM+ PHLSGIA LLK
Sbjct  485   PSKPNPGILKPDIIGPGVNILAAWPTSVDDNKDTK-STFNIISGTSMSCPHLSGIAALLK  543

Query  802   SAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYD  623
             S HPDWSPAAIKSAI+TTA   NL+ + ILDERL+PAD+FA G GHVNPS A+DPGL+YD
Sbjct  544   STHPDWSPAAIKSAIMTTAYTLNLDSSPILDERLLPADIFAIGAGHVNPSSANDPGLVYD  603

Query  622   LQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIW-LGKTSLTYSR  446
               S+DY PYLCGL YT+ ++  +++R V C +V SIPEAQLNYPSF+I+ LG T  TY+R
Sbjct  604   TPSEDYFPYLCGLGYTNAQVSSLLRRTVNCLEVNSIPEAQLNYPSFSIYGLGSTPQTYTR  663

Query  445   TVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQG  266
             TVTNVG+A S Y VK++  +GV V V P  L F+E+NQ+LTY ++FS +++  ++  V+G
Sbjct  664   TVTNVGDATSSYKVKIASLIGVAVEVVPTELNFSELNQKLTYQVTFSKTTSSSEVVVVEG  723

Query  265   AIAWVSQRHIVKSPIAIIF  209
              + W S RH V+SPIA++ 
Sbjct  724   FLKWTSTRHSVRSPIAVVL  742



>ref|XP_008381959.1| PREDICTED: subtilisin-like protease SDD1 [Malus domestica]
Length=1289

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/729 (58%), Positives = 529/729 (73%), Gaps = 19/729 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAING--VSEDYRSYFRSFVSES---GDEGERSRIVHSYRHVASGFAAK  2180
              TYIV V  P +       +ED   +++SF+ ES    ++    R+VHSYR++A+GFAAK
Sbjct  561   QTYIVWVEKPVSQKFSPQSNEDLGXWYQSFLPESIASSNQQMNQRMVHSYRNIATGFAAK  620

Query  2179  LSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDT  2000
             L+PE V EM  K+GF+SAR QR+  L TTH+P+FLGL+Q  G W  ++YGKGVI+G+LDT
Sbjct  621   LTPEEVREMETKEGFVSARPQRILPLQTTHTPDFLGLHQGSGLWEAATYGKGVIIGLLDT  680

Query  1999  GITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNF--VSEGssppppPVDEEG  1826
             GI P+HPSFNDE MPPPPAKWKGKCEF  T CNNKLIGARNF  V +G      P D  G
Sbjct  681   GIVPDHPSFNDEGMPPPPAKWKGKCEFNETLCNNKLIGARNFIGVGKGQPKRRFPFDIAG  740

Query  1825  HGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaai  1646
             HG+HT+STAAG FV  A+V+G A GTA GMAP AHL++YKVC   GCA++DI AA+D AI
Sbjct  741   HGSHTSSTAAGRFVEGASVYGQANGTAAGMAPYAHLAMYKVCEGFGCADADIFAALDVAI  800

Query  1645  ddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLT  1466
             DDGVDVLSLSLGG S  F++D IAIGAFAA++KGIF SCA GN GP   TLSN+APW+LT
Sbjct  801   DDGVDVLSLSLGGPSLPFYDDVIAIGAFAAIQKGIFFSCAGGNSGPWNRTLSNDAPWILT  860

Query  1465  VGASTIDRTIKATAVLGNGAQ--LDGESAFQVENFPPT-LLPLIYPGSKDEDAALCGPGS  1295
             VGAST DR + +   +G+  Q   DG+S  Q E+F  T LLPL+  GS    ++ C  GS
Sbjct  861   VGASTTDRILTSGLQIGDEKQYHFDGKSLSQPEDFDXTVLLPLVDAGSFGNQSSFCKAGS  920

Query  1294  LdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATEL  1115
             L   +V+GK+VLC+ GGG+  + KG+ VK AGGAAMIL+N++IDG++ LA+ HVLPAT +
Sbjct  921   L--KNVEGKIVLCETGGGVTNIXKGEEVKRAGGAAMILMNKEIDGFSTLAEAHVLPATHV  978

Query  1114  SYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGP  935
             SY  GL++K YI+STS P  TI+F GT IG   AP VASFSSRGP+ ASPGILKPD++GP
Sbjct  979   SYAAGLQIKLYISSTSTPKGTILFNGTVIGDALAPKVASFSSRGPNIASPGILKPDVIGP  1038

Query  934   GVNILAAWPVgnntnng-ngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAI  758
             GV+ILAAWP   +     N  A FNIISGTSMA PHLSGIA LLKS HPDWSPAAIKSAI
Sbjct  1039  GVSILAAWPYNVDNVTHPNPKALFNIISGTSMACPHLSGIAALLKSTHPDWSPAAIKSAI  1098

Query  757   ITTADQYNLNGTKILDER-LVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLN  581
             +TTAD  NL G+ I+DE  L PADVFA G GHVNPS+A+DPGLI+DL+ +DYIPYLCGLN
Sbjct  1099  MTTADVLNLLGSPIVDESGLKPADVFAIGAGHVNPSKANDPGLIFDLKPEDYIPYLCGLN  1158

Query  580   YTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLT---YSRTVTNVGEANSMY  410
             Y D  I+ I Q+ V+CSQV +IPEAQLNYPSFAI +G        Y+RTV NVG A S Y
Sbjct  1159  YNDTVIKIITQQAVKCSQVGAIPEAQLNYPSFAITIGPNQTRTQYYTRTVRNVGPATSTY  1218

Query  409   TVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSP--SSTPVDIDFVQGAIAWVSQRHI  236
              +++     + + V P  L FTEVNQ++TY++ F+    +    + F QG + W S +H 
Sbjct  1219  NLELLVPHEMGMSVNPQVLTFTEVNQEITYHVEFNAHDGAGKDGVPFGQGYLRWFSDKHN  1278

Query  235   VKSPIAIIF  209
             V +PIA++F
Sbjct  1279  VTTPIAVLF  1287


 Score =   301 bits (770),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 158/309 (51%), Positives = 194/309 (63%), Gaps = 43/309 (14%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSE---SGDEGERSRIVHSYRHVASGFAAKLS  2174
              TYIV V  P +       D  S+++SF+ E   S ++   SRIVH+YR V +GFAAKL+
Sbjct  2     QTYIVFVEKPVSQKFSDQLDLESWYQSFLPETAQSSNQETSSRIVHAYRKVVTGFAAKLT  61

Query  2173  PEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGI  1994
             PE V  M+ K+GF+SAR +R+  L TTHSP+FLGL+Q FG W+ ++YG+GVI+G+LDTGI
Sbjct  62    PEEVKAMKNKEGFVSAREERILPLQTTHSPDFLGLHQGFGLWKQTNYGEGVIIGLLDTGI  121

Query  1993  TPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFV-SEGssppppPVDEEGHGT  1817
              P+HPSF DE + PPPAKWKGKCEF GT CNNKLIGARNF+  E       P D  GHGT
Sbjct  122   GPDHPSFXDEXVSPPPAKWKGKCEFNGTVCNNKLIGARNFIGXEEGHITGTPFDNHGHGT  181

Query  1816  HTASTAAGNFVGNAAVFGSAK-GTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaidd  1640
             HT+STAAGNFV  A+VFG A  G  V    L   S+                        
Sbjct  182   HTSSTAAGNFVQGASVFGEANDGVDVLSLSLGGESL------------------------  217

Query  1639  gvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVG  1460
                            F+ D  AIGAFAA++KGIF SCAAGN GP Y +LSNEAPW+LTVG
Sbjct  218   --------------XFYNDVJAIGAFAAIQKGIFFSCAAGNXGPSYESLSNEAPWILTVG  263

Query  1459  ASTIDRTIK  1433
             AST DR ++
Sbjct  264   ASTTDRILR  272


 Score =   290 bits (742),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 146/247 (59%), Positives = 181/247 (73%), Gaps = 4/247 (2%)
 Frame = -1

Query  1036  TFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngng-NATFNI  860
             T IG   AP VA FSSRGPS ASPGILKPDI+GPGV+ILAAWP   +        ATFNI
Sbjct  283   TVIGDALAPKVAFFSSRGPSIASPGILKPDIIGPGVDILAAWPESVDNATLPNPKATFNI  342

Query  859   ISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFA  680
             ISGTSMATPHLSGI  LLK +HPDWSPA IKSAI+TTA+  NL G+ I+D++L PAD+F 
Sbjct  343   ISGTSMATPHLSGIGALLKKSHPDWSPAXIKSAIMTTANVLNLAGSXIVDQQLQPADIFT  402

Query  679   TGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQL  500
              G GHVNP+ A+DPGLI+D++ +DYIPYLCGL + + +I+ I QR V CSQ  +IPEAQL
Sbjct  403   LGAGHVNPAXANDPGLIFDIKPEDYIPYLCGLYHNETQIKMITQRXVNCSQAGAIPEAQL  462

Query  499   NYPSFAIWLGKT---SLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQ  329
             NYPSFAI +G     S  Y+RTV NVG  +S Y++ +     + + V P  L FT+VNQ+
Sbjct  463   NYPSFAITIGSNETQSQYYTRTVRNVGPXSSTYSLDLLVPHKMGMSVNPQVLTFTKVNQE  522

Query  328   LTYNISF  308
             +TY++ F
Sbjct  523   ITYHVEF  529



>gb|KCW51739.1| hypothetical protein EUGRSUZ_J01198, partial [Eucalyptus grandis]
Length=719

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/719 (56%), Positives = 512/719 (71%), Gaps = 11/719 (2%)
 Frame = -1

Query  2368  SVASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFV-SESGDEGERSRIVHSYRHVASG  2192
             +VA  +   TYI+ V  P        ED  S +RSF+ + +    +  R+VHSY+HV SG
Sbjct  2     AVADTRSSSTYIIQVRKPTDKHFANVEDIDSLYRSFLPTTAASSNQEQRMVHSYQHVLSG  61

Query  2191  FAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVG  2012
             FAAKL+ E    +++K G +    + V +L+TTH+P+FLGL+Q  G W++S++GKGVI+G
Sbjct  62    FAAKLTAEEAKVVQEKDGVLQVHPEEVLSLHTTHTPDFLGLHQGVGLWKDSNFGKGVIIG  121

Query  2011  VLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSE-GssppppPVD  1835
             +LD+G+ P+HPSFNDE +PPPPAKWKG+C+F GT+CNNKLIGAR+F++   ++   PP D
Sbjct  122   LLDSGVFPDHPSFNDEGVPPPPAKWKGRCDFNGTSCNNKLIGARSFINPINATQAVPPYD  181

Query  1834  EEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamd  1655
             + GHGTHT+STAAG FV +A+  G+AKGTAVG+APLAHL++YKVC + GC  S ILA  D
Sbjct  182   DTGHGTHTSSTAAGAFVRDASALGNAKGTAVGLAPLAHLAMYKVCADGGCPASSILAGFD  241

Query  1654  aaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPW  1475
             AAI+DGVDVLS+SLGG     F+D IAIGA AA +KGI VSC+ GN GP + TLSNEAPW
Sbjct  242   AAIEDGVDVLSVSLGGKKPPLFQDWIAIGALAATQKGILVSCSGGNTGPKHRTLSNEAPW  301

Query  1474  LLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKD-EDAALCGPG  1298
             +LTVGAS+IDR+IKATA LGNG + DGE+ +Q  +F PT LPLIYP   D  D   C  G
Sbjct  302   ILTVGASSIDRSIKATARLGNGLEFDGETLYQPHDFHPTQLPLIYPEVFDGRDVQDCHYG  361

Query  1297  SLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATE  1118
             SL ++ V+GKVVLCD    I  V  GQ VKD GGAAMIL+N   DGYT ++D HVLPA  
Sbjct  362   SLARLSVRGKVVLCDIKW-IDPVGAGQEVKDNGGAAMILVNGPADGYTTISDAHVLPAIA  420

Query  1117  LSYNDGLKVKDYINSTSWPTATIVFKGT-FIGTKTAPSVASFSSRGPSNASPGILKPDIL  941
             L+Y  G ++K Y+N+T  PTATI+FKGT  IG   AP+VASFSSRGP+  SPGILKPDI+
Sbjct  421   LNYAAGREIKRYLNTTPAPTATILFKGTHIIGRSPAPAVASFSSRGPNRLSPGILKPDII  480

Query  940   GPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSA  761
             GPG+NILA WP   + +    +A FN+ISGTSMA PH+SG+A LLKSAHPDWSP AIKSA
Sbjct  481   GPGLNILAGWPYPLDNSTDMKHA-FNVISGTSMACPHISGVAALLKSAHPDWSPVAIKSA  539

Query  760   IITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLN  581
             I+TTA   N+ G  I+DE L PAD+FATG GH+NPS+A DPGL+YD    DYIPYLCGL 
Sbjct  540   IMTTAATSNMEGRPIVDETLHPADIFATGAGHINPSKAVDPGLVYDDGPQDYIPYLCGLI  599

Query  580   YTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLT---YSRTVTNVGEANSMY  410
               + +I+ IV++KV CS + SIP+ QLNYPS  +   K S+T    +RTV NVG A S Y
Sbjct  600   SNESQIEVIVKKKVNCSSIGSIPDYQLNYPSITVSFHKPSVTNVSVTRTVKNVGPAKSRY  659

Query  409   TVKVSPFLG-VDVGVTPDTLVFTEVNQQLTYNISFSPS-STPVDIDFVQGAIAWVSQRH  239
                V P  G V +GV P  LVFTE NQ  +Y + F+    +     + QGAI WVS RH
Sbjct  660   QSVVDPIKGPVSIGVYPRELVFTEANQTASYRVDFTREVDSKAPSPYAQGAITWVSARH  718



>ref|XP_004245678.1| PREDICTED: subtilisin-like protease SDD1 [Solanum lycopersicum]
 emb|CAA06412.1| P69C protein [Solanum lycopersicum]
Length=754

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/727 (56%), Positives = 521/727 (72%), Gaps = 21/727 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSE--DYRSYFRSF-------VSESGDEGERSRIVHSYRHVASG  2192
             +TYIVHV  P + I   S   D  SY+ SF       +S SG+E E + I++SY +V +G
Sbjct  25    ETYIVHVESPESLITTQSSFMDLESYYLSFLPETMSAISSSGNE-EAASIIYSYHNVMTG  83

Query  2191  FAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVG  2012
             FAA+L+ E V EM KK GF+SA++QR+ +L+TTH+P+FLGL QN G W++S+YGKGVI+G
Sbjct  84    FAARLTAEQVKEMEKKHGFVSAQKQRILSLHTTHTPSFLGLQQNKGVWKDSNYGKGVIIG  143

Query  2011  VLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppPVD  1835
             VLDTGI P+HPSF+D  MP PPAKWKG C+   T  CNNKLIGAR++          P+D
Sbjct  144   VLDTGIIPDHPSFSDVGMPSPPAKWKGVCKSNFTNKCNNKLIGARSY----ELGNASPID  199

Query  1834  EEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDG-CAESdilaam  1658
              +GHGTHTASTAAG FV  A V G+A GTAVG+APLAH++IYKVC  DG C  SDILAAM
Sbjct  200   NDGHGTHTASTAAGAFVKGANVHGNANGTAVGVAPLAHIAIYKVCGFDGKCPGSDILAAM  259

Query  1657  daaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAP  1478
             DAAIDDGVD+LS+SLGG  +  ++++IA+GA++  ++GI VSC+AGN GP   ++ N AP
Sbjct  260   DAAIDDGVDILSISLGGSLSPLYDETIALGAYSTTQRGILVSCSAGNSGPSPASVDNSAP  319

Query  1477  WLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAA---LC  1307
             W+LTVGAST+DR IKAT  LGNG + +GESA+  +    T   L       +D +    C
Sbjct  320   WILTVGASTLDRKIKATVKLGNGEEFEGESAYHPKTSNATFFTLFDAAKNAKDPSETPYC  379

Query  1306  GPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLP  1127
               GSL    ++GK+VLC   GG+A VDKGQ VKDAGG  MI++N    G T  AD HVLP
Sbjct  380   RRGSLTDPAIRGKIVLCLAFGGVANVDKGQAVKDAGGVGMIVINPSQYGVTKSADAHVLP  439

Query  1126  ATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPD  947
             A  +S  DG K++ Y NS   P ATI F+GT IG K AP VA+FSSRGP+ AS GILKPD
Sbjct  440   ALVVSAADGTKIRAYTNSILNPVATITFQGTIIGDKNAPIVAAFSSRGPNTASRGILKPD  499

Query  946   ILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIK  767
             I+GPGVNILAAWP   + N     +TFNIISGTSM+ PHLSG+A LLKS+HPDWSPA IK
Sbjct  500   IIGPGVNILAAWPTSVDGNKNTK-STFNIISGTSMSCPHLSGVAALLKSSHPDWSPAVIK  558

Query  766   SAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCG  587
             SAI+TTAD  NL  + ILDERL PAD++A G GHVNPSRA+DPGL+YD   +DY+PYLCG
Sbjct  559   SAIMTTADTLNLASSPILDERLSPADIYAIGAGHVNPSRANDPGLVYDTPFEDYLPYLCG  618

Query  586   LNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAI-WLGKTSLTYSRTVTNVGEANSMY  410
             LNYT+ ++ ++++RKV CS+V SIPEAQLNYPSF I  LG T  T++RTVTNVG+A S Y
Sbjct  619   LNYTNSQVGKLLKRKVNCSEVESIPEAQLNYPSFCISRLGSTPQTFTRTVTNVGDAKSSY  678

Query  409   TVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVK  230
             TV+++   GV V V P  L+F+E+ Q+LTY ++FS  +        +G + W S ++ V+
Sbjct  679   TVQIASPKGVVVKVKPRKLIFSELKQKLTYQVTFSKRTNSSKSGVFEGFLKWNSNKYSVR  738

Query  229   SPIAIIF  209
             SPIA+ F
Sbjct  739   SPIAVEF  745



>ref|XP_009382355.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=743

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/721 (56%), Positives = 506/721 (70%), Gaps = 17/721 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
             TYIVHV PP +A  G S D  S++RSFV+    E    ++VH Y +V SGFAA+L+   +
Sbjct  28    TYIVHVQPPESAALGASSDRESWYRSFVATVSSE---VQMVHMYTNVISGFAARLTELEL  84

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
               M    GF+ A   R+Y L TTH+P FLGL  + G W  S+YGKG+I+GVLDTG+ P+H
Sbjct  85    EAMSVMPGFVRAYPDRMYRLQTTHTPAFLGLLMHQGLWNASNYGKGIIIGVLDTGVFPDH  144

Query  1981  PSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPV------DEEGHG  1820
             PSF+   MPPPPAKW+G+C+F  ++CNNKLIGAR+F+S   +     V      D++GHG
Sbjct  145   PSFSGLGMPPPPAKWRGRCDFNASSCNNKLIGARSFISGAMAMKGKAVASDSPIDDDGHG  204

Query  1819  THTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaidd  1640
             THT STAAG  V  A V G+AKG A+GMAPLAH+++YKVC E  CA SDILA MDAA+ D
Sbjct  205   THTTSTAAGAAVPGADVLGNAKGMAIGMAPLAHVAMYKVCGEIDCASSDILAGMDAAVAD  264

Query  1639  gvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVG  1460
             GVDVLSLSLGG S  F ED+IA+GAF A+EKG+FVSCAAGN GP   TLSNEAPW+LTV 
Sbjct  265   GVDVLSLSLGGPSLPFDEDTIAVGAFGAIEKGVFVSCAAGNSGPVSSTLSNEAPWILTVA  324

Query  1459  ASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDA-ALCGPGSLdkv  1283
             AST+DR I+ T +LGNG   DGES FQ  +FPP L PL+Y G+    A ALC  GS D  
Sbjct  325   ASTMDRNIRVTVMLGNGLSFDGESLFQPNSFPPALYPLVYAGANGSPATALCANGSFDGF  384

Query  1282  dvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYND  1103
             DVKGK+VLCDRGGGIAR++KG TV  AGG  MIL NQ  DGY+ LAD HVLPA+ + +  
Sbjct  385   DVKGKIVLCDRGGGIARLEKGATVLSAGGIGMILANQATDGYSTLADAHVLPASHVGFAA  444

Query  1102  GLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNI  923
             G ++K YINS+S PTA  +FKGT +GT  AP++ SFSSRGPS ASPGILKPDI GPGV++
Sbjct  445   GDQIKAYINSSSNPTAAFLFKGTILGTSPAPAITSFSSRGPSLASPGILKPDITGPGVSV  504

Query  922   LAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTAD  743
             LAAWP      +     TFN+ISGTSM+TPHLSGIA L+KSA PDWSPAAIKSAI+TTA 
Sbjct  505   LAAWPFRVGPPSNYTGTTFNVISGTSMSTPHLSGIAALIKSARPDWSPAAIKSAIMTTAS  564

Query  742   QYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEI  563
               + +G  I++E+L+PAD+FA G GHVNP +A +PGL+YDL +DDYI YLCGL Y ++++
Sbjct  565   VVDHSGKPIVNEQLLPADLFAIGAGHVNPVKAGNPGLVYDLSADDYIAYLCGLGYANKQV  624

Query  562   QQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYS---RTVTNVGEANSMYTVKVSP  392
               I +R ++CS V+SIPE  LNYPS ++ LG  + TY+   R V NVG A S Y  +V  
Sbjct  625   SVIARRTIDCSAVSSIPEKDLNYPSISVTLGGNT-TYAVVERRVKNVGNAASTYWAEVGA  683

Query  391   FLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAII  212
               G  V V P  L F  VNQ+  + ++F            QG + WVS  H V+SPI+I 
Sbjct  684   PYGTYVRVHPPVLSFNYVNQEKRFFVAF---KMVGGGGGSQGYLKWVSVNHEVRSPISIT  740

Query  211   F  209
             +
Sbjct  741   Y  741



>gb|KCW72066.1| hypothetical protein EUGRSUZ_E00511, partial [Eucalyptus grandis]
Length=685

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/682 (57%), Positives = 491/682 (72%), Gaps = 17/682 (2%)
 Frame = -1

Query  2224  IVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWR  2045
             IVHSYRHV SGFAAKL+ E    +R+K G ++ R ++  +L+TTHSP+FLGL+Q  G W+
Sbjct  9     IVHSYRHVLSGFAAKLTAEEAKAIREKDGVLAVRPEKALSLHTTHSPDFLGLHQGVGLWK  68

Query  2044  NSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSE  1865
             +S++GKGVI+GVLDTG+ P+H SF+D+N+PPPPAKWKG+C+F+GT+CNNKLIGAR+F+S 
Sbjct  69    DSNFGKGVIIGVLDTGVFPDHSSFSDKNVPPPPAKWKGRCDFDGTSCNNKLIGARSFISS  128

Query  1864  GssppppP--VDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTED  1691
              ++        D EGHGTHT+STAAG FV NA   G+A GTA G+APLAHL+IY+VC+  
Sbjct  129   SNTVAQADPPYDSEGHGTHTSSTAAGAFVRNANALGNANGTASGIAPLAHLAIYQVCSSL  188

Query  1690  GCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEG  1511
             GC+E DILA +DAA +DGVDVLSLSLGG S  F+ D IA GAFAA +KGI VSC+AGN G
Sbjct  189   GCSEGDILAGLDAATEDGVDVLSLSLGGNSQPFYSDLIATGAFAATQKGILVSCSAGNSG  248

Query  1510  PDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS  1331
             P   TLSNEAPW+LTVGAS+IDR+IKATA LGNG + DGE+ +Q  +F P  LPL+Y G 
Sbjct  249   PSSGTLSNEAPWILTVGASSIDRSIKATARLGNGKEFDGETLYQPRDFDPVPLPLVYAGE  308

Query  1330  K-DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYT  1154
             K D  +A C  GSL         V+     G  R DKGQ V+DAGG AMIL+N    GYT
Sbjct  309   KGDPSSAYCLTGSLGNRSGLRGKVVVCDNDGTGRRDKGQEVQDAGGVAMILVNSIDGGYT  368

Query  1153  ILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTA-PSVASFSSRGPS  977
               AD HVLPA  +SY  G  +K YI++ S P ATI+FKGT I  ++A P+V SFSSRGP+
Sbjct  369   TFADRHVLPAVHVSYAAGSDIKQYISTASAPKATILFKGTHINGRSADPAVTSFSSRGPN  428

Query  976   NASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSA  797
               SPGILKPDI+GPG+NILA WP     +     A F ++SGTSM+ PHLSG+A LLKSA
Sbjct  429   AQSPGILKPDIIGPGLNILAGWPFPLGNSTDKKRA-FAVLSGTSMSCPHLSGVAALLKSA  487

Query  796   HPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQ  617
             HPDWSPAAIKSAIITTA   NL G  I+DE L PAD+FATG GHVNPS+A DPGLIYD  
Sbjct  488   HPDWSPAAIKSAIITTATTSNLKGQPIVDETLRPADIFATGAGHVNPSKAVDPGLIYDTA  547

Query  616   SDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWL--GKTSLTYSRT  443
               DYIPYLCGL+YTD EI++IV+  V+CS + SIP+ QLNYPS ++      T ++ +RT
Sbjct  548   PQDYIPYLCGLDYTDSEIERIVKENVKCSSIRSIPDYQLNYPSISVSFDGSATKVSVTRT  607

Query  442   VTNVGEANSMYTVKVSPFLGVD-VGVTPDTLVFTEVNQQLTYNISFSPS-----STPVDI  281
             V NVG A S Y   + P  G+D +GV P  LVFT+ NQ  +Y + F+ S     +TP   
Sbjct  608   VRNVGPAQSRYRSVIDPIKGLDLIGVQPRDLVFTKANQTASYRVDFTRSGKAKPATP---  664

Query  280   DFVQGAIAWVSQRHIVKSPIAI  215
              +  GA+ WVS +H V++P+ +
Sbjct  665   -YAWGAVTWVSAKHSVRTPVVV  685



>gb|EPS72026.1| serine protease, partial [Genlisea aurea]
Length=708

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/710 (58%), Positives = 509/710 (72%), Gaps = 15/710 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGER-SRIVHSYRHVASGFAAKLSPEM  2165
             TYIVHV P        ++D  S++ SF+ ES    E  SRI++ YRH+ SGFAA+L+PE 
Sbjct  7     TYIVHVEPCVE-----TQDLESWYDSFIPESNPSTESGSRIIYRYRHIFSGFAARLTPEE  61

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             V  M  KKGFISA  +RV  L+TTH+P+FLGL +N GFW  SSYG+GV++G+LDTGI  +
Sbjct  62    VKVMEGKKGFISAAEERVLQLHTTHTPSFLGLGRNLGFWNESSYGEGVVIGLLDTGINAD  121

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             HPSF+DE +PPPP KWKG+CE  G  CN KLIGAR F   GS     P DE+GHGTHT+S
Sbjct  122   HPSFSDEGVPPPPKKWKGRCELGGGVCNRKLIGARAF-GVGSGLTNTPADEQGHGTHTSS  180

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAGNFV  A   GSA GT++G+AP AH+++Y+VC  DGC ESDI A +DAAIDDGVD+L
Sbjct  181   TAAGNFVPGANFLGSANGTSIGIAPRAHIAMYRVCFTDGCQESDIAAGLDAAIDDGVDIL  240

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
             S+SLGG SA +  D IAIG+F A+EKGIFVSC+AGN GP   +LSNEAPW+LTVGAST D
Sbjct  241   SISLGGNSAVYDVDPIAIGSFRAVEKGIFVSCSAGNSGPTTQSLSNEAPWILTVGASTTD  300

Query  1444  RTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLd-kvdvkgk  1268
             R + ATAVLG+G +L GES FQ ++     LPLI P S     + CGP  L    +V+GK
Sbjct  301   RKLVATAVLGSGVELVGESGFQTDS--TADLPLINP-STSGGFSFCGPDDLGPTSNVEGK  357

Query  1267  vVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVK  1088
             +V+C  GG I  VDKG+ V+ AGG  MIL+N +I  YT+    HV+PAT +SY D LK++
Sbjct  358   IVICQVGGNIQSVDKGEYVRQAGGKGMILVNSEIAAYTLFDYAHVIPATHVSYEDSLKIE  417

Query  1087  DYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWP  908
              Y+NSTS PTA IVF+GT +G K AP +A FSSRGP   SPGILKPDI+GPGVNILA W 
Sbjct  418   GYLNSTSNPTARIVFEGTKMGDKFAPFLAFFSSRGPGKQSPGILKPDIIGPGVNILAGWH  477

Query  907   VgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLN  728
               +   + N    +NIISGTSM+ PHL+G+  LLKSAHPDWSPAAIKSAI+TTADQ NL 
Sbjct  478   -ESVRKDTNTTPFYNIISGTSMSCPHLAGVVALLKSAHPDWSPAAIKSAIMTTADQLNLG  536

Query  727   GTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQ  548
             G  ILDER +P   F+ G GHVNPS+ASDPGL+YDL ++DY+PYLCGLNYT   IQ+IVQ
Sbjct  537   GDPILDERHLPPPPFSVGSGHVNPSKASDPGLVYDLSTEDYVPYLCGLNYTADAIQKIVQ  596

Query  547   RKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGV  368
             R+V C+   +I EA+LNYPSF + +G    TYSRTVTNVGE  + YTV++    GV V V
Sbjct  597   RRVSCAN--AISEAELNYPSFTVAVGSAPATYSRTVTNVGEGKASYTVEIGAPDGVSVVV  654

Query  367   TPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGA-IAWVSQRHIVKSPI  221
             TP+TL F E+ Q+L Y+++FS S             I+W S ++ V+SPI
Sbjct  655   TPETLDFMEIGQKLNYSVTFSSSGGSSGGAGYSQGFISWNSGKYSVRSPI  704



>ref|XP_002509667.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF51054.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=753

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/773 (54%), Positives = 534/773 (69%), Gaps = 30/773 (4%)
 Frame = -1

Query  2515  ICNAVFVYIYLTRSSCF*SSNH--QICIIAMKGTPNMAYISVVVCLTLVFHSVASAKYED  2342
             I   + + I+LT +S F SS    Q  + ++    N+  +S +                +
Sbjct  8     IFQTILLMIFLTLASMFSSSRAVIQTTVRSLTSDANVNKMSTL----------------E  51

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEMV  2162
              YI+ +  P   +    E   S++RSF+ E+     +SR++HSYRHV +GFAAKL+ E V
Sbjct  52    IYIILLEKPQGKVFRDFEHLESWYRSFLPENTFRSNKSRLLHSYRHVVTGFAAKLTAEEV  111

Query  2161  SEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNH  1982
             + M  K+GF++A    +  L+TTH+P+FLGL QN GFW  S+YGKGVI+G++D+GITP+H
Sbjct  112   NSMEYKEGFVTALPGSLVRLHTTHTPSFLGLQQNLGFWNYSNYGKGVIIGLVDSGITPDH  171

Query  1981  PSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAST  1802
             PSF+ E MP PPA+WKGKCE+  T CNNK+IGARNF  +         DE  HGTHTAS 
Sbjct  172   PSFSSEGMPLPPARWKGKCEYNETLCNNKIIGARNFNMDSKDTS----DEYNHGTHTASI  227

Query  1801  AAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvls  1622
             AAG+ V     FG A GTA G+APLAHL++YK+  E   +E  ILAA+DAAIDDGVDVLS
Sbjct  228   AAGSPVQGVNFFGQANGTASGVAPLAHLAMYKISNEATTSE--ILAAIDAAIDDGVDVLS  285

Query  1621  lslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDR  1442
             LS+G  S  F++D IAI A+AA+ KGIFVS +AGNEG D   LSNEAPW+LTVGAST+DR
Sbjct  286   LSIGIDSHPFYDDVIAIAAYAAIRKGIFVSSSAGNEGKDKGPLSNEAPWMLTVGASTVDR  345

Query  1441  TIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSK-DEDAALCGPGSLdkvdvkgkv  1265
             TI+AT +LGN  +L+GES FQ ++FP T+LPL+Y G   +  +A C PGSL  VDV+GK+
Sbjct  346   TIRATVLLGNNTELNGESLFQPKDFPSTMLPLVYAGENGNALSASCMPGSLKNVDVRGKI  405

Query  1264  VLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKD  1085
             VLC+RG     + KG+ VK  GG AMI++N   DG+ I AD HVLPA+ +S   GL +K 
Sbjct  406   VLCERGSAHDMIFKGEVVKRNGGVAMIVMNGQSDGFIISADLHVLPASHVSCMAGLAIKA  465

Query  1084  YINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPV  905
             YINSTS P  TI+F+GT  G   AP VA FSSRGPS ASPGILKPDI+GPGVNILAAWPV
Sbjct  466   YINSTSSPIGTILFEGTVTGLPEAPQVAEFSSRGPSKASPGILKPDIIGPGVNILAAWPV  525

Query  904   gnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNG  725
                         FN+ SGTSM+ PHLSGIA LLKSAHPDWSPAAIKSAI+TTA+ +NL+G
Sbjct  526   SEEEAPNR----FNMKSGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTTANVFNLDG  581

Query  724   TKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQR  545
               I D++ VPA  F  G GHVNPSRA++PGLIYD+Q DDY+PYLCGL Y+++++  I QR
Sbjct  582   KPITDQQFVPATYFDIGAGHVNPSRANEPGLIYDIQPDDYLPYLCGLGYSNKQVGVITQR  641

Query  544   KVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVT  365
             +V CS+  S+PEAQLNYPSF++ LG +  T +RTVTNVG+ NS Y ++     GVDV VT
Sbjct  642   RVNCSKNLSMPEAQLNYPSFSVKLGSSPQTCARTVTNVGKPNSSYILETFAPRGVDVKVT  701

Query  364   PDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
             P+ + FT +NQ+ TY I+FS       + F QG + WV+  + V+SPI +I Q
Sbjct  702   PNKITFTGLNQKATYTIAFSKMGN-TSVSFAQGYLNWVADGYSVRSPITVISQ  753



>ref|XP_006468883.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=747

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/723 (57%), Positives = 514/723 (71%), Gaps = 24/723 (3%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV-----SESGDEGERSRIVHSYRHVASGFAAKL  2177
             TY+V+V  P         D  S++ SF+     S S D+  +SR+VH YRHV SGFAA+L
Sbjct  36    TYMVYVQKPRHGNFSKEIDLESWYHSFLPATFSSNSIDDDRQSRMVHCYRHVISGFAARL  95

Query  2176  SPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTG  1997
             + E V  M  K GFISAR +    L+TTH+PNFLGL+QN GFW++S+ GKGVI+GVLD+G
Sbjct  96    TAEEVKAMETKNGFISARVENTLQLHTTHTPNFLGLHQNSGFWKDSNLGKGVIIGVLDSG  155

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVSEGssppppPVDEEGHG  1820
             ITP HPSF+D++MPPPPAKW+GKCEF G A CNNK+IGARNF +       PP+D+ GHG
Sbjct  156   ITPTHPSFSDKDMPPPPAKWRGKCEFAGGAGCNNKIIGARNFYN----LSLPPIDDGGHG  211

Query  1819  THTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTE--DGCAESdilaamdaai  1646
             THT+STAAG FV  A   G A GTAVGMAPLAHL++YK C +  D C ES + AA+DAAI
Sbjct  212   THTSSTAAGTFVNGANRLGEANGTAVGMAPLAHLAMYKTCDDYADNCPESSVSAALDAAI  271

Query  1645  ddgvdvlslslgg---gSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPW  1475
             +DGVDVLSLS+G        F  ++IAI  F A++KGIFVS +AGN GP  +++ N+APW
Sbjct  272   EDGVDVLSLSIGLGPHQHKEFHANAIAIATFKAVKKGIFVSISAGNWGPRTFSVVNDAPW  331

Query  1474  LLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAAL-CGPG  1298
             +LTVGAST DR I  +  LGN    DGES  Q  + P   LPL+YP +K+  A   C P 
Sbjct  332   MLTVGASTTDRGIVTSVQLGNQKTYDGESLLQGTDTPFEQLPLVYPVTKNASATTNCPPE  391

Query  1297  SLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATE  1118
             +L  +DVKGKVVLC        VD  Q V DAGGAAMIL+N ++ G +I+A + VLP   
Sbjct  392   TLKSIDVKGKVVLCQ-----LSVDP-QDVLDAGGAAMILMNNELIGDSIVAGSTVLPHVR  445

Query  1117  LSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILG  938
             +SY  G  +K YINSTS PTA +V KGT IG KTAP VA+FSSRGPS  SPGILKPDI+G
Sbjct  446   VSYTVGESIKAYINSTSSPTAALVVKGTVIGRKTAPEVAAFSSRGPSTVSPGILKPDIIG  505

Query  937   PGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAI  758
             PGVNI+AAW +       N   TF+IISGTSM+ PHLSGIA LLKSAHPDWSPAAIKSAI
Sbjct  506   PGVNIIAAW-LTAVEPITNTEYTFDIISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAI  564

Query  757   ITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNY  578
             +TTAD  NL G  ILD   +PAD+FA G GHVNPS+A+DPGLIYD+Q DDYIPYLCGLNY
Sbjct  565   MTTADTVNLEGKPILDRNHLPADLFAVGAGHVNPSKANDPGLIYDIQPDDYIPYLCGLNY  624

Query  577   TDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKV  398
             TDQ++Q IV   V+CS+V+SI EA+LNYPSF+I LG +  TY+RTVTNVG ANS YT ++
Sbjct  625   TDQQVQGIVGGDVQCSKVSSIAEAELNYPSFSIRLGSSPQTYNRTVTNVGPANSSYTSQI  684

Query  397   SPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIA  218
                 GV++ V P+ + FTE NQ++ Y+++F+ +         Q  ++W+  ++ VKSPIA
Sbjct  685   VAPEGVEITVQPNKISFTEKNQKVAYSVTFTRTKN-TGASSAQANLSWIFGQYTVKSPIA  743

Query  217   IIF  209
             I F
Sbjct  744   ISF  746



>ref|XP_011081245.1| PREDICTED: subtilisin-like protease SDD1 [Sesamum indicum]
Length=668

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/678 (58%), Positives = 487/678 (72%), Gaps = 15/678 (2%)
 Frame = -1

Query  2224  IVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWR  2045
             ++ SYR V  GFAA+LSP+ V +M KK+GF+ AR   + +L+TTHSP+FLGL QN GFW+
Sbjct  1     MIFSYREVFIGFAARLSPDEVKDMEKKEGFVYARPDEMLSLHTTHSPSFLGLNQNTGFWK  60

Query  2044  NSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSE  1865
              S+YG+GVI+GVLDTGI P HPSF+D  MP PPAKWKG+CE     CNNK+IGAR FV  
Sbjct  61    ESNYGRGVIIGVLDTGIFPQHPSFSDVGMPRPPAKWKGRCERNTITCNNKIIGARYFVQS  120

Query  1864  GssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGC  1685
                         GHGTH A TAAGNFV  A +FG A GTA G+AP AHL+IYKVC +  C
Sbjct  121   DD-------QNAGHGTHCAGTAAGNFVRGANIFGLANGTAAGIAPYAHLAIYKVC-DVTC  172

Query  1684  AESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPD  1505
               S ILA +DAA+ DGVDVLS+SL     +F +D  A+GAF AMEKG+FVSC+AGN GP 
Sbjct  173   PTSSILAGIDAAVADGVDVLSISLSSAGNNFAQDLTAVGAFGAMEKGVFVSCSAGNRGPF  232

Query  1504  YYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS--  1331
              YTLSN APW+LTVGAST DR  +ATAVLG+     G SAFQ  NFP T+LPL+Y G+  
Sbjct  233   SYTLSNPAPWVLTVGASTTDRKTRATAVLGDSQLFHGVSAFQPNNFPTTMLPLLYAGTLN  292

Query  1330  -KDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYT  1154
               D  A  C   SL+ +D++GK+VLCD GG +  V+KGQ ++ AGGAAMIL+N +    T
Sbjct  293   PSDPMARFCSRSSLNSMDLRGKIVLCDIGG-VTAVEKGQAIRSAGGAAMILVNDESYANT  351

Query  1153  ILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSN  974
             ILAD HVLPAT +S+ DGL++K YINS   P ATI F GT +G   AP VA+FSSRGP++
Sbjct  352   ILADPHVLPATHVSHADGLRIKAYINSARAPVATIRFSGTLLGDNRAPVVAAFSSRGPNS  411

Query  973   ASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAH  794
              SPGILKPDILGPGV+IL  W +    N       FN++SGTSMA PHLSG+A LLKSAH
Sbjct  412   LSPGILKPDILGPGVDILGPWNIALENNPNTNF-RFNMVSGTSMACPHLSGVAALLKSAH  470

Query  793   PDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQS  614
             P+WSPAAIKSAI+TTAD  N  G  I DER +PA +FATG GHVNPSRA+DPGL+YD+Q 
Sbjct  471   PNWSPAAIKSAIMTTADVVNHAGGAIQDERFLPAGIFATGSGHVNPSRANDPGLVYDIQP  530

Query  613   DDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLT--YSRTV  440
              DYIPYLCGLNYT+ ++  IV R+V C + + IPEAQLNYPSFA+    +S T  Y+RTV
Sbjct  531   QDYIPYLCGLNYTNSQVSSIVGRRVNCLEESHIPEAQLNYPSFALTFAPSSTTQVYTRTV  590

Query  439   TNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAI  260
             TNVG+  S Y V++ P  G+DV V P TL FT VNQQ+ Y ++FS  ++ ++   V+G +
Sbjct  591   TNVGDPISSYNVEIFPPSGIDVRVFPTTLNFTRVNQQMHYLVTFSRLTSTLNGVVVRGFL  650

Query  259   AWVSQRHIVKSPIAIIFQ  206
              W S +H V+SPIA+I Q
Sbjct  651   RWTSSKHSVRSPIAVILQ  668



>gb|KDP25553.1| hypothetical protein JCGZ_20709 [Jatropha curcas]
Length=743

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/716 (58%), Positives = 524/716 (73%), Gaps = 15/716 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             +TYIV +  P   +   S+D  S+++SF+ +      + R+VHSY  V +GFAAKL+ E 
Sbjct  40    ETYIVFLEKPEGMMFTDSKDLDSWYQSFLPDDTLSSNKPRLVHSYHQVVTGFAAKLTAEE  99

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             V E+ KK+GF+SAR +R+   +TTH+P+FLGL QN GFW  S+YGKGVIVG++D+GITP+
Sbjct  100   VKEIEKKEGFVSARPRRMVPFHTTHTPSFLGLQQNTGFWNYSNYGKGVIVGLIDSGITPD  159

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppPVDEEGHGTHTA  1808
             HPSF+ E MPPPPAKWKGKCE  GT +CNNKLIG RNF ++ ++      DE  HGTHTA
Sbjct  160   HPSFSGEGMPPPPAKWKGKCELNGTYSCNNKLIGVRNFATDSNNTD----DEYQHGTHTA  215

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCA-ESdilaamdaaiddgvd  1631
             STAAG+ V  A  FG A GTA+GMAPLAHL++YKV      A +S+ILAAMDAA++D VD
Sbjct  216   STAAGSPVQGANYFGQANGTAIGMAPLAHLAMYKVSGRASAAGDSEILAAMDAAVEDNVD  275

Query  1630  vlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAST  1451
             VLSLSLG GS  F++D IA+GA+AA++KGIF+SC+AGN GP+  +LSNEAPW+LTVGAST
Sbjct  276   VLSLSLGIGSHPFYDDVIALGAYAAIQKGIFISCSAGNSGPENSSLSNEAPWILTVGAST  335

Query  1450  IDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKD-EDAALCGPGSLdkvdvk  1274
             +DR I+AT  LGN A+L+GES FQ  +FP TLLPL+Y G+     +A C PGSL  VDVK
Sbjct  336   VDRAIRATVFLGNNAELNGESLFQPADFPSTLLPLVYAGANGMASSASCEPGSLKNVDVK  395

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             GK+VLC+  GG     KGQ VKD GG AMI++N + DG+   AD +VLPA+ +S+ DGL 
Sbjct  396   GKIVLCE--GGYDATYKGQEVKDNGGVAMIVMNDEYDGFVTDADLNVLPASRVSFMDGLA  453

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             +K YI STS P ATI+FKGT  G   AP +A FSSRGPS ASPGILKPDI+GPGV ILAA
Sbjct  454   IKAYIYSTSSPNATILFKGTVTGLPNAPQLAEFSSRGPSLASPGILKPDIIGPGVRILAA  513

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             WPV  + +       F +ISGTSM+ PHLSGIA LLKSAHPDWSPAAIKSAI+TT +  +
Sbjct  514   WPVSVDNSINR----FAMISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAIMTTDNLVD  569

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             L G  I DE+     VF  G GHVNPSRA+DPGLIYD+Q +DYIPYLCGL Y+ +++  I
Sbjct  570   LGGKPISDEQFGTTTVFDIGAGHVNPSRANDPGLIYDIQPNDYIPYLCGLGYSAKQVGLI  629

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDV  374
             VQ  V CS  +SI EAQLNYPSF+I LG T  TY+RTVTNVG+ NS YT+++    GV+V
Sbjct  630   VQHTVTCSNDSSILEAQLNYPSFSIKLGSTPQTYTRTVTNVGQPNSTYTLEILAPEGVNV  689

Query  373   GVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
              VTP T+ F+ VNQ+ TY+++FS           QG + WV+  + V+SP+A+IF+
Sbjct  690   KVTPITINFSGVNQKATYSVTFSRDEYASGA--TQGYLNWVADGYSVRSPVAVIFE  743



>ref|NP_001234257.1| subtilisin-like endoprotease precursor [Solanum lycopersicum]
 emb|CAA64566.1| subtilisin-like endoprotease [Solanum lycopersicum]
 emb|CAA76724.1| P69A protein [Solanum lycopersicum]
Length=745

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/731 (55%), Positives = 516/731 (71%), Gaps = 31/731 (4%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSE--DYRSYFRSF-------VSESGDEGERSRIVHSYRHVASG  2192
             +TY+VHV  P + I+  S   D  SY+ SF       +S SG+E E + +++SY +V +G
Sbjct  25    ETYLVHVESPESLISTQSSLTDLDSYYLSFLPKTTTAISSSGNE-EAATMIYSYHNVMTG  83

Query  2191  FAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVG  2012
             FAA+L+ E V EM K  GF+SA++QR  +L TTH+ +FLGL QN G W++S+YGKGVI+G
Sbjct  84    FAARLTAEQVKEMEKIHGFVSAQKQRTLSLDTTHTSSFLGLQQNMGVWKDSNYGKGVIIG  143

Query  2011  VLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppPVD  1835
             V+DTGI P+HPSF+D  MPPPPAKWKG CE   T  CNNKLIGAR++          P+D
Sbjct  144   VIDTGILPDHPSFSDVGMPPPPAKWKGVCESNFTNKCNNKLIGARSY----QLGHGSPID  199

Query  1834  EEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamd  1655
             ++GHGTHTASTAAG FV  A VFG+A GTA G+AP AH+++YKVC  DGCA++D+LAAMD
Sbjct  200   DDGHGTHTASTAAGAFVNGANVFGNANGTAAGVAPFAHIAVYKVCNSDGCADTDVLAAMD  259

Query  1654  aaidd-gvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAP  1478
             AAIDD    +     GGGS+ F+ + IA+GA++A E+GI VSC+AGN GP   ++ NEAP
Sbjct  260   AAIDDGVDILSISLGGGGSSDFYSNPIALGAYSATERGILVSCSAGNNGPSTGSVGNEAP  319

Query  1477  WLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDED---AALC  1307
             W+LTVGAST DR +KAT  LGN  + +GESA++ +    T   L   G    D      C
Sbjct  320   WILTVGASTQDRKLKATVKLGNREEFEGESAYRPKISNSTFFALFDAGKNASDEFETPYC  379

Query  1306  GPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLP  1127
               GSL    ++GK+V+C  GGG+ RVDKGQ VKDAGG  MI++NQ   G T  AD HV+P
Sbjct  380   RSGSLTDPVIRGKIVICLAGGGVPRVDKGQAVKDAGGVGMIIINQQRSGVTKSADAHVIP  439

Query  1126  ATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPD  947
             A ++S  DG K+  Y+NSTS P ATI F+GT IG K AP VA+FSSRGPS AS GILKPD
Sbjct  440   ALDISDADGTKILAYMNSTSNPVATITFQGTIIGDKNAPIVAAFSSRGPSGASIGILKPD  499

Query  946   ILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIK  767
             I+GPGVNILAAWP   + N     +TFNIISGTSM+ PHLSG+  LLKS HPDWSPAAIK
Sbjct  500   IIGPGVNILAAWPTSVDDNKNTK-STFNIISGTSMSCPHLSGVRALLKSTHPDWSPAAIK  558

Query  766   SAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCG  587
             SA++TTAD  NL  + ILDERL+PAD++A G GHVNPSRA+DPGL+YD   +DY+PYLCG
Sbjct  559   SAMMTTADTLNLANSPILDERLLPADIYAIGAGHVNPSRANDPGLVYDTPFEDYVPYLCG  618

Query  586   LNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIW-LGKTSLTYSRTVTNVGEANSMY  410
             LNYT++++  ++QRKV CS+V SI EAQLNYPSF+I+ LG T  TY+RTVTNVG+A S Y
Sbjct  619   LNYTNRQVGNLLQRKVNCSEVKSILEAQLNYPSFSIYDLGSTPQTYTRTVTNVGDAKSSY  678

Query  409   TVKV-SPFLGVDVGVTPDTLVFT---EVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQR  242
              V+V SP         P  L        +Q+LTY ++FS ++   + + ++G + W S R
Sbjct  679   KVEVASP------EALPSKLTLRANFSSDQKLTYQVTFSKTANSSNTEVIEGFLKWTSNR  732

Query  241   HIVKSPIAIIF  209
             H V+SPIA++ 
Sbjct  733   HSVRSPIALLL  743



>ref|XP_006358906.1| PREDICTED: subtilisin-like protease SDD1-like [Solanum tuberosum]
Length=646

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/648 (61%), Positives = 504/648 (78%), Gaps = 6/648 (1%)
 Frame = -1

Query  2155  MRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPS  1976
             M  K GF+ AR +++  L+TTH+PNFLGLY+N GFW+ S+YGKGVI+GVLDTGI P HPS
Sbjct  1     MEMKDGFVYARVEKILALHTTHTPNFLGLYRNVGFWQESNYGKGVIIGVLDTGINPGHPS  60

Query  1975  FNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVSEGssppppPVDEEGHGTHTASTA  1799
             F+D+NMPP P KWKGKCEF G   CN KLIGARNFV        PP +E GHGT T+S A
Sbjct  61    FSDKNMPPSPEKWKGKCEFIGNVTCNKKLIGARNFVR---GSTDPPFEEGGHGTLTSSVA  117

Query  1798  AGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlsl  1619
             AGNFV +A VFG+A GTA GMAPLAH+++YKVC++ GC++ D LAA+DAAIDDGVDVLSL
Sbjct  118   AGNFVDDANVFGNANGTAAGMAPLAHIAMYKVCSDSGCSDVDTLAAIDAAIDDGVDVLSL  177

Query  1618  slgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRT  1439
             S+GG +A F++D +AIGAFAA++KGIF+S +AGN+GP   TLSN APW+LTVGAST DR 
Sbjct  178   SIGGYTAPFYDDGMAIGAFAAIQKGIFMSASAGNDGPLSATLSNVAPWILTVGASTHDRK  237

Query  1438  IKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvdvkgkvVL  1259
             I AT VLGNG + DGES F   +   T  PL+YPG  ++++A+C  GSL+  +VKGK+V+
Sbjct  238   IVATVVLGNGQEYDGESIFNPSDCH-TFFPLVYPGLLNQESAVCKSGSLNNANVKGKIVV  296

Query  1258  CDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYI  1079
             CD+GGG+ R++KG+TV+DAGG AM+L+N +IDG   LA   VLP T + Y+ G  +K Y+
Sbjct  297   CDKGGGVTRLEKGKTVRDAGGVAMVLVNLEIDGDGTLAYVDVLPTTNVGYSTGEMIKAYV  356

Query  1078  NSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgn  899
             NSTS P A I+FKGT IG K+APSV+SFSSRGPS ASPGILKPDI+GPGVNILAA  V  
Sbjct  357   NSTSTPLAGILFKGTSIGFKSAPSVSSFSSRGPSLASPGILKPDIIGPGVNILAATHVSA  416

Query  898   ntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTK  719
                 G    TFNI+SGTS++ PHLSGI  L+KSAHPDWSPAAIKSAI+TTADQ+NL G  
Sbjct  417   ENKIGTYL-TFNIVSGTSISCPHLSGIVALVKSAHPDWSPAAIKSAIMTTADQFNLEGQP  475

Query  718   ILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKV  539
             ILD+R +PAD+FATG GHVNPS+A+DPGLIYD+Q  +YI YLCGL YTD++I  IVQ+ +
Sbjct  476   ILDQRNLPADIFATGAGHVNPSKANDPGLIYDIQPHNYIMYLCGLGYTDKQIGLIVQQTI  535

Query  538   ECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPD  359
             +CS  ++I EA+LNYPSF+I LG+ S  Y+RTVTNVG+A+S Y V +    GV + V P 
Sbjct  536   KCSLQSTILEAELNYPSFSIILGQQSQNYTRTVTNVGDASSTYVVNIIQIRGVHIVVEPT  595

Query  358   TLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAI  215
             TL FT+VNQQ TY++SF+   + +   FVQG I+W+S +++V+SPI++
Sbjct  596   TLAFTKVNQQATYSVSFTQIGSSITGHFVQGTISWMSNKYVVRSPISV  643



>ref|XP_010058417.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=1255

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/717 (57%), Positives = 519/717 (72%), Gaps = 11/717 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYI+ V  P       SED  + +RSF+ + +    +  R+VHSYRHV SGFAAKL+ E 
Sbjct  544   TYIIQVRKPTDKHFATSEDLDALYRSFLPTTATSSNQEQRMVHSYRHVVSGFAAKLTAEE  603

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
               ++R + G +  R +RV +L+TT +P FLGL Q  G W++S++GKGVI+GVLD+GI+P 
Sbjct  604   AKDIRNRDGVLYVRPERVLSLHTTRTPEFLGLRQEVGLWKDSNFGKGVIIGVLDSGISPQ  663

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             H SF+ E +PPPPAKWKGKC F  T+CNNKLIGAR+F   G  PP    D+ GHGTHTAS
Sbjct  664   HSSFSGEGLPPPPAKWKGKCIFNDTSCNNKLIGARSFAYGGIYPP---TDDVGHGTHTAS  720

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAG FV NA+  G+AKGTA G+APLAHL+IY+VC   GC E+DILA +DAAI+DGVDV+
Sbjct  721   TAAGAFVKNASALGNAKGTAAGIAPLAHLAIYQVCGISGCLEADILAGLDAAIEDGVDVI  780

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTID  1445
             SLS+GG S  FF+D+IA G+FAA++KGIFVS +AGN GP  Y+LSNEAPWLL VGASTID
Sbjct  781   SLSVGGDSYPFFQDAIATGSFAAIQKGIFVSSSAGNMGPYNYSLSNEAPWLLNVGASTID  840

Query  1444  RTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDA-ALCGPGSLdkvdvkg-  1271
             R IKATA LGNG + DGE+ +Q ++F  TLLPL+ P    E++ A C PGSL        
Sbjct  841   RRIKATARLGNGKEFDGETVYQPQDFDSTLLPLVDPARNGENSSAFCFPGSLKDRSDLKG  900

Query  1270  kvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKV  1091
             KVV+C  G G+ARVDKGQ VKDAGGAAMIL+N  ++G T LAD HVLPA  + Y+ G ++
Sbjct  901   KVVVCSVGSGVARVDKGQEVKDAGGAAMILVNSPLEGATTLADKHVLPAVHVGYDAGREI  960

Query  1090  KDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAW  911
             K Y+++TS P ATI+ KGT IG+  AP VASFSSRGP+  S GILKPDI+GPGVNILAAW
Sbjct  961   KSYLSTTSAPKATILLKGTDIGSSVAPVVASFSSRGPNYQSQGILKPDIIGPGVNILAAW  1020

Query  910   PVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNL  731
             PV  + +  + + +FN+ISGTSM+ PHLSG+A LLKSAHPDWSPAAIKSAIITTA   + 
Sbjct  1021  PVSLDNSTDDKH-SFNVISGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIITTASTSDT  1079

Query  730   NGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIV  551
              G  ILD+ L PA++F TG GHVNPS+A DPGLIYD++  DYIPYLCGLNYTD EI+ IV
Sbjct  1080  KGQPILDQSLNPANIFTTGAGHVNPSKAVDPGLIYDIEPQDYIPYLCGLNYTDSEIELIV  1139

Query  550   QRKVECSQVTSIPEAQLNYPSFAIWLGK--TSLTYSRTVTNVGEANSMYTVKVSPFLGVD  377
             + K+ CS    IP+ QLNYPS ++      T    +R V NVG ANS Y V   P  G++
Sbjct  1140  KEKITCSSTGRIPDYQLNYPSISLSFESSVTKFNVTRRVRNVGPANSSYKVVTDPITGLN  1199

Query  376   -VGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              +GV P  L FT+VN+  ++++ F+ + T       QGAI WVS +H V+ P+A++F
Sbjct  1200  SIGVYPSNLEFTKVNETASFSVDFTRNKTATP-PLAQGAITWVSAKHSVRIPVAVVF  1255


 Score =   203 bits (517),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 123/275 (45%), Positives = 160/275 (58%), Gaps = 37/275 (13%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYI+ V  P       SED  + +RS + + +    +  R+VHSYRHV SGFAAKL+ E 
Sbjct  44    TYIIQVRKPTDKHFATSEDLDALYRSCLPTTATSSNQEQRMVHSYRHVVSGFAAKLTAEE  103

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                +R + G +  R +RV +L+TT +P FLGL Q  G W++S++GKGVI+GVLD+GI P 
Sbjct  104   AKAIRNRDGVLYVRPERVLSLHTTRTPEFLGLRQEVGLWKDSNFGKGVIIGVLDSGIYPQ  163

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTAS  1805
             H SF+ E +PPP AKWKGKC F    CNNKLIGAR+ V         P D+ GHGTH AS
Sbjct  164   HSSFSGEGLPPPQAKWKGKCVFNDAYCNNKLIGARSIV---YGEFEQPFDDVGHGTHAAS  220

Query  1804  TAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvl  1625
             TAAG FV NA+                 L+ +    EDG                  DV+
Sbjct  221   TAAGAFVKNASA----------------LAGFDAAIEDGV-----------------DVI  247

Query  1624  slslgggSASFFEDSIAIGAFAAMEKGIFVSCAAG  1520
             SLS+GG S+ FF+D+IA G+FAA++KG  V  A G
Sbjct  248   SLSVGGDSSPFFDDAIAKGSFAAIQKGQEVKDAGG  282


 Score =   181 bits (459),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 120/180 (67%), Gaps = 10/180 (6%)
 Frame = -1

Query  775  AIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPY  596
            AIKSAIITTA   N  G  ILD+ L PA++F TG GHVNPS+A DPGLIYD++  DYIPY
Sbjct  341  AIKSAIITTASTSNTEGQPILDQSLNPANIFTTGAGHVNPSKAVDPGLIYDIEPKDYIPY  400

Query  595  LCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTY--SRTVTNVGEA  422
            LCGLNYTD EI+ IV+ KV CS   SIP+ QLNYPS ++    T   +  +R V NVG A
Sbjct  401  LCGLNYTDSEIELIVKEKVTCSSTGSIPDYQLNYPSISLNFDSTVTKFNVTRKVRNVGSA  460

Query  421  NSMYTVKVSPFLGVD-VGVTPDTLVFTEVNQQLTYNISFSPSST---PVDIDFVQGAIAW  254
            NS Y V + P  G++ +GV P  L FT+VN+  ++++ F+ + T   PV     QGAI W
Sbjct  461  NSSYRVVIDPITGLNSIGVYPSNLEFTKVNETASFSVDFTRNKTATPPV----AQGAITW  516


 Score = 92.4 bits (228),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = -1

Query  1246  GGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTS  1067
             G  A + KGQ VKDAGGAAMIL+N  ++G T LAD HVLPA  + Y+ G ++K Y+N+TS
Sbjct  266   GSFAAIQKGQEVKDAGGAAMILVNSPLEGATTLADKHVLPAVHVGYDVGREIKSYLNTTS  325

Query  1066  WPTATIVFKGTFIGTKTAPSVASFSSRGPSNASP  965
              P ATI+FKG  IGT    ++ + +S   +   P
Sbjct  326   APNATILFKGADIGTAIKSAIITTASTSNTEGQP  359



>ref|XP_004245674.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 emb|CAB67120.1| subtilisin-like protease [Solanum lycopersicum]
Length=746

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/739 (55%), Positives = 524/739 (71%), Gaps = 17/739 (2%)
 Frame = -1

Query  2395  VVCLTLVFHSVASAKYE-DTYIVHVSPPAAAINGVSEDYRSYFRSFV--SESGDEGERSR  2225
             ++C+   F + A+ +     YIVH   P+       +D  S++ SF+  + S    E  R
Sbjct  14    LICVLFSFTTHAAEQNNSQIYIVHCEFPSGERTAEYQDLESWYLSFLPTTTSVSSREAPR  73

Query  2224  IVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWR  2045
             +++SYR+V +GFAAKLS E + EM KK+GF+SAR Q+  +L+TTHS NFLGL QN GFW+
Sbjct  74    LIYSYRNVLTGFAAKLSEEDIKEMEKKEGFVSARPQQFVSLHTTHSVNFLGLQQNMGFWK  133

Query  2044  NSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARNFVS  1868
             +S+YGKGVI+GVLDTGI P+HPSF+D  MP PPAKWKG CE      CN KLIGAR++  
Sbjct  134   DSNYGKGVIIGVLDTGILPDHPSFSDVGMPTPPAKWKGVCESNFMNKCNKKLIGARSY--  191

Query  1867  EGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDG  1688
                     P+D  GHGTHTASTAAG FV  A V+G+A GTAVG+APLAH++IYKVC  DG
Sbjct  192   --QLGNGSPIDGNGHGTHTASTAAGAFVKGANVYGNANGTAVGVAPLAHIAIYKVCGSDG  249

Query  1687  -CAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEG  1511
              C++SDILAAMD+AIDDGVD++S+SLGGG   F  D+IA+GA++A E+GI VS +AGN G
Sbjct  250   KCSDSDILAAMDSAIDDGVDIISMSLGGGPVPFHSDNIALGAYSATERGILVSASAGNSG  309

Query  1510  PDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS  1331
             P   T  N APW+LTVGAST DR IK T  LGN  + +GE++++ +        L Y  S
Sbjct  310   PSLITAGNTAPWILTVGASTTDRKIKVTVTLGNTEEFEGEASYRPQISDSKFFTL-YDAS  368

Query  1330  KDE----DAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDID  1163
             K +        C PGSL    +KGK+V+C   G +++V KGQ VKDAGG  MI +N   D
Sbjct  369   KGKGDPSKTPYCKPGSLTDPAIKGKIVIC-YPGVVSKVVKGQAVKDAGGVGMIAINLPED  427

Query  1162  GYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRG  983
             G T  AD HVLPA E+S  DG+++  Y NS S PTA I F+GT IG + AP VASFSSRG
Sbjct  428   GVTKSADAHVLPALEVSAADGIRILTYTNSISNPTAKITFQGTIIGDENAPIVASFSSRG  487

Query  982   PSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLK  803
             P+  SPGILKPDI+GPGVNILAAWP   + N     +TFNIISGTSM+ PHLSG+A LLK
Sbjct  488   PNKPSPGILKPDIIGPGVNILAAWPTSVDDNKKTK-STFNIISGTSMSCPHLSGVAALLK  546

Query  802   SAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYD  623
             S HPDWSPAAIKSAI+TTA   NL  + ILDERL+PAD+FA G GHVNPS A+DPGL+YD
Sbjct  547   STHPDWSPAAIKSAIMTTAYTLNLASSPILDERLLPADIFAIGAGHVNPSSANDPGLVYD  606

Query  622   LQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIW-LGKTSLTYSR  446
               S+DY PYLCGL YT+ ++ +++QRKV C +V SIPEA+LNYPSF+I+ LG T  TY+R
Sbjct  607   TPSEDYFPYLCGLRYTNAQVSKLLQRKVNCLEVKSIPEAELNYPSFSIFGLGSTPQTYTR  666

Query  445   TVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQG  266
             TVTNVG+  S Y V+++  +GV + V P  L F+++NQ+LTY ++FS +++  ++  V+G
Sbjct  667   TVTNVGDVASSYKVEIASPIGVAIEVVPTELNFSKLNQKLTYQVTFSKTTSSSEVVVVEG  726

Query  265   AIAWVSQRHIVKSPIAIIF  209
              + W S RH V+SPIA++ 
Sbjct  727   FLKWTSTRHSVRSPIAVVL  745



>gb|KDP25556.1| hypothetical protein JCGZ_20712 [Jatropha curcas]
Length=744

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/716 (56%), Positives = 517/716 (72%), Gaps = 14/716 (2%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             +TYIV +  P       S+   S+++SF+       ++ R++HSY HV +GFAAKL+ E 
Sbjct  40    ETYIVLLLKPEGVDFTESKYLESWYQSFMPADTFSSDQPRLIHSYHHVVTGFAAKLTAEA  99

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                + +K+  + AR QR+  L+TTH+P+FLGL QN G W+ S+YGKGVI+GV+D+GIT +
Sbjct  100   AKAIERKEEVVLARPQRMVTLHTTHTPSFLGLQQNLGLWKQSNYGKGVIIGVVDSGITAD  159

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIGARNFVSEGssppppPVDEEGHGTHTA  1808
             HPSF+ E MPPPPAKWKGKCE  G  +CNNKLIGARNF +         VD   HGTHTA
Sbjct  160   HPSFSGEGMPPPPAKWKGKCELNGKLSCNNKLIGARNFDTN----SNDLVDRAEHGTHTA  215

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVC-TEDGCAESdilaamdaaiddgvd  1631
             STAAG+ V   + FG A GTAVG+APLAHL++YK+   +D   ES++LAAMDAA++D VD
Sbjct  216   STAAGSPVQGVSYFGQANGTAVGVAPLAHLAMYKISGRDDMTGESELLAAMDAAVEDSVD  275

Query  1630  vlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAST  1451
             VLSLS G GS  F++D IAI A+AA  KGIFVS +AGNEGP+Y TLSNEAPWLLTVGAST
Sbjct  276   VLSLSCGNGSRLFYDDVIAIAAYAATRKGIFVSVSAGNEGPNYRTLSNEAPWLLTVGAST  335

Query  1450  IDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDE-DAALCGPGSLdkvdvk  1274
             +DR I+ T +LGN  +L+GES FQ ++F P LL L+Y G+  +  +A C  GSL  V+VK
Sbjct  336   VDRAIRVTVLLGNNEELNGESLFQPKSFRPKLLRLVYAGANGKTSSASCEKGSLKNVNVK  395

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             GK+VLC+  GG   + KGQ VKD GGAAMI++N + +G+ I    HVLPA+ +SY  G  
Sbjct  396   GKIVLCE--GGSDTIPKGQEVKDNGGAAMIVMNHENEGFDITPVYHVLPASHVSYAAGSA  453

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             +K YINST  P ATI+FKGT +G + AP VA FSSRGPS ASPGILKPDI+GPGV ILAA
Sbjct  454   IKAYINSTPSPKATILFKGTVVGLQEAPQVAWFSSRGPSIASPGILKPDIIGPGVRILAA  513

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             WP     +  N    F ++SGTSMA PHLSGIA LLKS HPDWSPAAIKSAI+TTA+ YN
Sbjct  514   WP----HSADNTTNRFEMLSGTSMACPHLSGIAALLKSVHPDWSPAAIKSAIMTTANLYN  569

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
               G  I +++  P+ +F  G GHVNPSRA++PGLIYD+Q  DYIPYLCGL Y+D+ ++ I
Sbjct  570   FGGQPITNDQFFPSTLFDVGAGHVNPSRANNPGLIYDIQPKDYIPYLCGLGYSDKHVRII  629

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDV  374
             VQ+KV+CS+ T IPEAQLNYPSF+I LG +   Y+RTVTNVG  +S+Y +++    GVD+
Sbjct  630   VQKKVKCSKRTRIPEAQLNYPSFSIVLGSSPQRYTRTVTNVGPPHSVYFLEIVAPNGVDI  689

Query  373   GVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
              VTP  ++F++VNQ+ TY+++F  +    +  + QG + WV + +IV+SPIAI  +
Sbjct  690   MVTPHKIIFSKVNQKATYSVTFRKNGKG-NGSYAQGYLNWVGEGYIVRSPIAIQLK  744



>ref|XP_010051224.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=747

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/754 (54%), Positives = 533/754 (71%), Gaps = 18/754 (2%)
 Frame = -1

Query  2452  HQICIIAMKGTPNMAYISVVVCLTLVFHSVASAKYED--TYIVHVSPPAAAINGVSEDYR  2279
             H +C+I +         S+  CL     S   ++  D  TYIVHV+PP        +D  
Sbjct  5     HLLCLIVLLS-------SLQFCLANGQSSPTRSQTSDLQTYIVHVTPPDGQRLSELKDLE  57

Query  2278  SYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNL  2102
             S++ SF+ ++S       R+++SY++V +GFAA+L+P+ V+ M+ K GF++A  +++Y+L
Sbjct  58    SWYYSFLPTDSTTSRNERRLLYSYQNVMTGFAARLTPDEVATMQDKPGFVAAHPEQIYSL  117

Query  2101  YTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCE  1922
              TTHSP FLGL  N G   +S+ GKG+I+G++DTG+TP+H SF+ + MPPPPAKWKG+C+
Sbjct  118   QTTHSPQFLGLPLNQGSSNSSTMGKGIIIGIMDTGVTPDHTSFSGDGMPPPPAKWKGRCD  177

Query  1921  FEGTACNNKLIGARNFVSEGssppppP-VDEEGHGTHTASTAAGNFVGNAAVFGSAKGTA  1745
             F+ + CNNKLIGA+ F S        P +D++GHGTHTASTAAG  V  A     A+GTA
Sbjct  178   FKPSQCNNKLIGAKTFDSSAKKNVTMPPIDDDGHGTHTASTAAGASVQQANTLRMAEGTA  237

Query  1744  VGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGA  1565
             VGMAP AHL+IYKVC+ D C   DILA +DAA+ DGVDV+S+SLGGGSA F+ D IA+  
Sbjct  238   VGMAPYAHLAIYKVCSTD-CFLGDILAGLDAALADGVDVISISLGGGSAPFYMDGIAVAT  296

Query  1564  FAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESA  1385
             FAA+++G+FVSC+AGN GP   +LSNEAPW+LTVGASTIDR I +   LGNG + +GE+ 
Sbjct  297   FAAVQRGVFVSCSAGNSGPFSESLSNEAPWILTVGASTIDRNIVSNVKLGNGEEYEGETI  356

Query  1384  FQVENFPPTLLPLIYPG-SKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVK  1208
             +Q  +FP TLLPL+YPG    E +  C PG L    V+GK+VLC+RG  + R  +   VK
Sbjct  357   YQ-PSFPSTLLPLVYPGIDGTEGSIYCVPGQLKSSQVEGKIVLCERGF-VGRYFQAIEVK  414

Query  1207  DAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFI  1028
              AGGA MI++NQ+IDG++ LAD +VLPA+ +SY  G K+K YIN+T  PTATI+FKGT  
Sbjct  415   RAGGAGMIMMNQEIDGFSTLADAYVLPASHVSYFAGNKIKAYINATRTPTATIMFKGTVF  474

Query  1027  GTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGT  848
             G  TAP++ SFSSRGPS  SPGILKPDI+GPGVNILAAWP     +       FNIISGT
Sbjct  475   GNPTAPALTSFSSRGPSLISPGILKPDIIGPGVNILAAWPFPIRNDTKAKYY-FNIISGT  533

Query  847   SMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGG  668
             SM+ PHLSGIA L+K  HPDWSPAAIKSAI+TTA Q N+    ILDERL PADVFA G G
Sbjct  534   SMSCPHLSGIAALIKGIHPDWSPAAIKSAIMTTAKQLNVKQNPILDERLQPADVFAIGAG  593

Query  667   HVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPS  488
             HV+P +A DPG IYD+  DDYIPYLCGL YTD+++  IV + V+CS V+SIPE +LNYPS
Sbjct  594   HVDPEKAIDPGFIYDMHPDDYIPYLCGLGYTDKQVATIVHKPVKCSGVSSIPEGELNYPS  653

Query  487   FAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISF  308
             F++ LG    T++RTVTNVG   S Y V V P  GV V V P+ L F+++NQ+ TY+I+ 
Sbjct  654   FSVNLGPPQ-TFTRTVTNVGTDYSPYVVTVVPPQGVHVTVKPNKLTFSKLNQKATYSITL  712

Query  307   SPSSTPVDI-DFVQGAIAWVSQRHIVKSPIAIIF  209
             S +++  D+  F QG + W S+++ V+SPI++ F
Sbjct  713   SRANSTQDVAKFTQGFLRWDSKKYSVRSPISVKF  746



>ref|XP_006446036.1| hypothetical protein CICLE_v10018202mg [Citrus clementina]
 gb|ESR59276.1| hypothetical protein CICLE_v10018202mg [Citrus clementina]
Length=745

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/721 (55%), Positives = 508/721 (70%), Gaps = 26/721 (4%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESG-------DEGERSRIVHSYRHVASGFAA  2183
             TYI++V  P         D  S++RSF+ E+        D  + SR+++ Y++V SGFAA
Sbjct  42    TYIIYVQKPEQG------DLDSWYRSFLPEATISNSSDHDRNQSSRMLYFYKNVISGFAA  95

Query  2182  KLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLD  2003
             +L+ E V  M  KKGFISAR +   +L+TTH+PNFLGL+++ GFW++S++GKGVI+GVLD
Sbjct  96    RLTAEEVKAMETKKGFISARVENTLHLHTTHTPNFLGLHRSSGFWKDSNFGKGVIIGVLD  155

Query  2002  TGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGH  1823
             TGITP HPSFNDE MPPPPAKW+GKCE  G  CNNKLIG RNF           +D  GH
Sbjct  156   TGITPGHPSFNDEGMPPPPAKWRGKCELVGATCNNKLIGVRNFFC---GKDGSAIDYTGH  212

Query  1822  GTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDG-CAESdilaamdaai  1646
             GTHTASTAAGNFV  A +FG A GTAVGMAPLAHL++YKVC  +  C ES ++A +DAAI
Sbjct  213   GTHTASTAAGNFVHGANIFGQANGTAVGMAPLAHLAVYKVCNPNVYCPESAVIAGIDAAI  272

Query  1645  ddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLT  1466
             +DGVDVLSLS G G + F+++ IA   F A+ +GIFVS AAGN GP++YTL N+APW+LT
Sbjct  273   EDGVDVLSLSFGLGLSQFYDNGIAKATFEAIRRGIFVSIAAGNSGPNHYTLVNDAPWMLT  332

Query  1465  VGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAA-LCGPGSLd  1289
             VGASTIDR I  +  LGN    DGE+ +Q  + P   LPL+YP +++      C P +L 
Sbjct  333   VGASTIDRGITISVRLGNQETYDGEALWQWTDIPSKRLPLVYPDARNHSTTTFCSPETLK  392

Query  1288  kvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSY  1109
              VDVKGKVVLC RG        G  V +AGGAAMIL+N ++ G + L   + LP   +S+
Sbjct  393   SVDVKGKVVLCQRGA------SGDDVLNAGGAAMILMNDELFGDSTLIQRNSLPNVRVSH  446

Query  1108  NDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGV  929
                  +K YINSTS PTA +V KGT IG  +AP V +FS RGPS  SPGILKPDI+GPG+
Sbjct  447   AVSESIKAYINSTSSPTAALVMKGTVIGAGSAPQVVAFSGRGPSRISPGILKPDIIGPGL  506

Query  928   NILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITT  749
             NI+AAW    +        TF+I+SGTSMA PHLSG+A LLKSAHP+WS AAIKSA++TT
Sbjct  507   NIIAAWKTTVDPLANRVY-TFDIVSGTSMACPHLSGVAALLKSAHPNWSHAAIKSAMMTT  565

Query  748   ADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQ  569
             AD  NL G  ILD   +PAD++A G G VNPS+A+DPGL+YD+Q DDYIPYLCGLNYTD+
Sbjct  566   ADTVNLEGKPILDCTRLPADLYAVGAGQVNPSKANDPGLVYDIQPDDYIPYLCGLNYTDE  625

Query  568   EIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPF  389
             ++Q IV R+V+C++V+SIPEA+LNYPSF+I LG +  TY RTVTNVG+A S YT ++   
Sbjct  626   QVQSIVDREVQCAKVSSIPEAELNYPSFSIKLGYSPQTYHRTVTNVGKAKSFYTRQIVAP  685

Query  388   LGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              GV++ V P  + F   NQ++TY+++F+ +    +    Q  ++WVS ++ VKSPIAI F
Sbjct  686   EGVEITVQPHNISFAAKNQKVTYSVTFTRTGN-TNASSAQAYLSWVSDKYTVKSPIAISF  744

Query  208   Q  206
             +
Sbjct  745   E  745



>gb|KCW51741.1| hypothetical protein EUGRSUZ_J01200, partial [Eucalyptus grandis]
Length=703

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/702 (56%), Positives = 502/702 (72%), Gaps = 9/702 (1%)
 Frame = -1

Query  2290  EDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQR  2114
             E   S +RSF+ + +    +  R+VHSY+H  SGFAAKL+ E    +++K G +    + 
Sbjct  4     EILDSLYRSFLPTTAASSNQEQRMVHSYQHAISGFAAKLTAEEAKAVQEKDGVLQVHPEE  63

Query  2113  VYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWK  1934
             V +L+TT +P+FLGL+Q  G W++S++GKG+I+G+LD+G+ P+HPSFNDE +PPPPAKWK
Sbjct  64    VLSLHTTRTPDFLGLHQGVGLWKDSNFGKGMIIGLLDSGVFPDHPSFNDEGVPPPPAKWK  123

Query  1933  GKCEFEGTACNNKLIGARNFVSE-GssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSA  1757
             G+C+F GT+CNNKLIGAR+F++   ++   PP D+ GHGTHT+S AAG FV +A+  G+A
Sbjct  124   GRCDFNGTSCNNKLIGARSFINPINATQAVPPYDDTGHGTHTSSIAAGAFVRDASALGNA  183

Query  1756  KGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSI  1577
             KGTAVGMAPLAHL++YKVC +D C  S ILA  DAAI+DGVDVLS+SLGG S  FF+D I
Sbjct  184   KGTAVGMAPLAHLAMYKVCVDDACPASSILAGFDAAIEDGVDVLSVSLGGNSKPFFKDWI  243

Query  1576  AIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLD  1397
             A GAFAA +KGIFVSC+AGN GP   +LSNEAPW+LTVGAS+IDR+I+ATA LGNG + D
Sbjct  244   AQGAFAATQKGIFVSCSAGNSGPYNTSLSNEAPWILTVGASSIDRSIEATARLGNGLEFD  303

Query  1396  GESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQ  1217
             GE+ +Q  NF P LLPLIYP   D+    C  GSL         V+    G    V  GQ
Sbjct  304   GETLYQPHNFHPALLPLIYP-EIDDRIQDCAKGSLRFRSDIRGKVVVCDLGSTEPVVAGQ  362

Query  1216  TVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKG  1037
              VKD GG AMIL+N   DGYT LAD HVLPA E+SY  G ++K Y N+ S P ATI+FKG
Sbjct  363   EVKDRGGVAMILVNGLTDGYTTLADAHVLPAVEVSYVAGREIKRYFNTASTPMATILFKG  422

Query  1036  TFIGTKT-APSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNI  860
             T I  ++ AP+VASFSSRGP+  SPGILKPDI+GPG+NILA WP   + +    +A FN+
Sbjct  423   THIIRRSVAPAVASFSSRGPNRQSPGILKPDIIGPGLNILAGWPFPLDNSTNLKHA-FNV  481

Query  859   ISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFA  680
             ISGTSM+ PHLSG+A LLKSAHP+WSPAAIKSAI+TTA   N+ G  I+DE L PAD+FA
Sbjct  482   ISGTSMSCPHLSGVAALLKSAHPNWSPAAIKSAIMTTATTINMEGRPIVDETLHPADIFA  541

Query  679   TGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQL  500
             TG GH+NPS+A DPGL+YD    DYIPYLCGL   + +I+ IV++KV CS + SIP+ QL
Sbjct  542   TGAGHINPSKAVDPGLVYDDGPQDYIPYLCGLISNESQIEVIVKKKVNCSSIGSIPDYQL  601

Query  499   NYPSFAIWLGK--TSLTYSRTVTNVGEANSMYTVKVSPFLG-VDVGVTPDTLVFTEVNQQ  329
             NYPS  +      T+++ +RTV NVG A S Y   V P  G V +GV P  LVFTE NQ 
Sbjct  602   NYPSITVSFKPSVTNVSVTRTVKNVGPAKSRYQSVVDPIKGPVSIGVYPRELVFTEANQT  661

Query  328   LTYNISFSPS-STPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
              +Y + F+    +     + QGAI WVS RH V++PIAI+F+
Sbjct  662   ASYRVDFTREVDSKAPSPYAQGAITWVSARHSVRTPIAIVFE  703



>emb|CDP10008.1| unnamed protein product [Coffea canephora]
Length=1406

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/747 (53%), Positives = 512/747 (69%), Gaps = 48/747 (6%)
 Frame = -1

Query  2395  VVCLTLVFHSVASAKYE--DTYIVHVSPPAAAINGVS-------EDYRSYFRSF---VSE  2252
             + C+  +F  + + +    +TYIVHV  P +     +       ED  S++ SF   V+ 
Sbjct  687   IYCIAQIFVQLITCEQSNLETYIVHVELPESGTQLSTTNSSIPNEDLDSWYNSFLPTVTA  746

Query  2251  SGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLG  2072
             S ++G R  I++ Y +V  GFAAKLS E V  M K  GF+SAR Q+V +L+TTH+PNFLG
Sbjct  747   SSNDGPR--IIYPYHNVFKGFAAKLSAEDVKAMEKMPGFVSARPQKVLSLHTTHTPNFLG  804

Query  2071  LYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKL  1892
             L+ N GFW+ S+YGKGVI+GVLD+GITP+HPSF DE MPPPPAKWKGKCEF  + CNNKL
Sbjct  805   LHPNSGFWKASNYGKGVIIGVLDSGITPDHPSFGDEGMPPPPAKWKGKCEFNTSVCNNKL  864

Query  1891  IGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSI  1712
             IGAR F   G       +D  GHGTHTASTAAG++V  A VFG+A GTAVG+APLAHL+I
Sbjct  865   IGAR-FFRHGDGSS---IDGIGHGTHTASTAAGSYVEGANVFGNANGTAVGIAPLAHLAI  920

Query  1711  YKVCTEDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVS  1532
             YKVCT   C+E                            F+ D+IA+GA+ A EKGIFVS
Sbjct  921   YKVCTTSSCSERSSE-----------------------PFYADNIALGAYRATEKGIFVS  957

Query  1531  CAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLL  1352
             C+AGN+GP   TLSNEAPW+LTVGAST DR I+AT VLGN  +L+GE+  Q ++FP T  
Sbjct  958   CSAGNDGPSSSTLSNEAPWILTVGASTTDRKIRATVVLGNKEKLEGETLHQPKDFPSTQF  1017

Query  1351  PLIYPGSKDEDA---ALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMIL  1181
              + +PG+   D      C    L++  +KGK+ +CD G  I  +DK + VK AGG  MI+
Sbjct  1018  RIFFPGANQSDPNADRFCTTALLNQTGIKGKIAVCDIGE-IPLLDKEKNVKAAGGVGMII  1076

Query  1180  LNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVA  1001
             +N +  GYT   D + LPAT+++Y D LK+  Y+N+   P A I FKGT IG   AP+VA
Sbjct  1077  INPEEFGYTTSVDAYSLPATQVTYADRLKLIKYVNTARSPKAAISFKGTMIGDNHAPAVA  1136

Query  1000  SFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSG  821
              FSSRGPS AS GILKPDI+GPGVNILAAW   +  NN N  + FN+ISGTSMA PHLSG
Sbjct  1137  YFSSRGPSQASIGILKPDIIGPGVNILAAWH-RSVENNPNTKSNFNVISGTSMACPHLSG  1195

Query  820   IATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASD  641
             +A LLKSAHP+WSPAAIKSA+ITT D  NL    I D+R +PAD+FATG GHVNP+ AS+
Sbjct  1196  VAALLKSAHPNWSPAAIKSAMITTTDLVNLAKKPIEDQRQLPADIFATGAGHVNPASASN  1255

Query  640   PGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTS  461
             PGLIYD++  DYIPYLCGLNYTD+++  I+QRKV+CS++++IPE QLNYPSF++ +    
Sbjct  1256  PGLIYDIEPKDYIPYLCGLNYTDKQVGLILQRKVKCSEISNIPEGQLNYPSFSVVVRLAV  1315

Query  460   LTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDI  281
               Y+RTVTNVGEA+S+Y V++    GV+V V P  L FT+VNQ+L Y ++FSPS +  +I
Sbjct  1316  QKYTRTVTNVGEASSVYHVQIVAPAGVNVRVNPTMLSFTKVNQKLAYEVTFSPSGSANNI  1375

Query  280   DFVQGAIAWVS--QRHIVKSPIAIIFQ  206
                QG++ W S   ++ V+SPIA IFQ
Sbjct  1376  AVSQGSLTWHSSNSKYSVRSPIAAIFQ  1402


 Score =   545 bits (1405),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 278/466 (60%), Positives = 352/466 (76%), Gaps = 5/466 (1%)
 Frame = -1

Query  1594  FFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLG  1415
             F+ D+IA+GA++AMEKGIFVSC+AGN+GP   TLSNEAPW+LTVGASTIDR I+ATAVLG
Sbjct  212   FYADNIALGAYSAMEKGIFVSCSAGNDGPTSSTLSNEAPWILTVGASTIDRKIRATAVLG  271

Query  1414  NGAQLDGESAFQVENFPPTLLPLIYPGSKDED---AALCGPGSLdkvdvkgkvVLCDRGG  1244
             N  +L+GE+ +Q ++FP TL P+ YPG+   D      C P  L+K  +KGK+ +C+ G 
Sbjct  272   NKEELEGETLYQPKDFPSTLFPIYYPGANQSDFNADRFCTPALLNKTGIKGKIAVCEVGA  331

Query  1243  GIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSW  1064
               A +DKG+ VK AGG  MI++N    GYT  AD HVLPAT L+Y D LK+ +YI +TS 
Sbjct  332   N-AMLDKGKNVKAAGGVGMIIVNPQQYGYTPRADAHVLPATHLNYADRLKLIEYIKTTSS  390

Query  1063  PTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnng  884
             P A I FKGT IG   AP+VA FSSRGPS AS GILKPDI+GPGVNILAAW   +  NN 
Sbjct  391   PMAAISFKGTIIGDGHAPAVAYFSSRGPSQASIGILKPDIIGPGVNILAAW-YRSVENNT  449

Query  883   ngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDER  704
             N  + FN+ISGTSM+ PHLSG+A LLKSAHPDWSPAAIKSA++TT D  NL    I D+R
Sbjct  450   NTKSNFNVISGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAMMTTTDLVNLAKNPIEDQR  509

Query  703   LVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQV  524
              +PA++F +G GHVNP+RAS+PGLIYD++  DYIPYLCGLNYT++E+  ++QRKV CS++
Sbjct  510   QLPANIFDSGAGHVNPARASNPGLIYDIEPKDYIPYLCGLNYTNREVALVLQRKVNCSEI  569

Query  523   TSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFT  344
              SIPEAQLNYPSFAI +      Y+RTVTNVGEANS+Y+V++    GV+V V P TL FT
Sbjct  570   PSIPEAQLNYPSFAIVVRSAVQKYTRTVTNVGEANSVYSVQIVAPAGVNVTVNPTTLSFT  629

Query  343   EVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIFQ  206
             +VNQ+LTY ++FSPS    +I   QG++ W+S ++ V+SPIA IF+
Sbjct  630   KVNQKLTYEVTFSPSRLASNITVSQGSLTWISSKNAVRSPIAAIFR  675


 Score =   198 bits (504),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 130/195 (67%), Gaps = 16/195 (8%)
 Frame = -1

Query  2413  MAYISVVVCLTLVFHSVASAKYE-------DTYIVHVSPP-------AAAINGVSEDYRS  2276
             +  I  + C  L FHS+A +  +       +TYIVHV  P        A+ +  +ED   
Sbjct  3     LVQILTLFC-ALSFHSLAISALDFQEQSNLETYIVHVEFPESDTQLSTASSSIPNEDLDG  61

Query  2275  YFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLY  2099
             ++ SF+ + +    +  R+++ Y +V  GFAAKLS E +  M KK GF+SAR Q+V  L+
Sbjct  62    WYNSFLPTVTASSNDAPRMIYPYHNVFKGFAAKLSAEDIKAMEKKPGFLSARPQKVLLLH  121

Query  2098  TTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEF  1919
             TTH+PNFLGL+QN GFW  S+YGKGVI+GVLDTGITP+HPSF DE MPPPPAKWKG+CEF
Sbjct  122   TTHTPNFLGLHQNMGFWNESNYGKGVIIGVLDTGITPDHPSFGDEGMPPPPAKWKGRCEF  181

Query  1918  EGTACNNKLIGARNF  1874
               + CNNKLIGAR F
Sbjct  182   NTSVCNNKLIGARFF  196



>emb|CDO99977.1| unnamed protein product [Coffea canephora]
Length=733

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/761 (55%), Positives = 522/761 (69%), Gaps = 60/761 (8%)
 Frame = -1

Query  2413  MAYISVVVCLTLV-FHSVASAKYED------TYIVHVSPP------AAAINGVSEDYRSY  2273
             M  + +++ L ++ F S+A+    +      TYIVHV  P      +A+ +  ++D  ++
Sbjct  1     MGSMQILILLFVISFLSIAAKGLHEQESTVQTYIVHVELPTDTQLSSASASPNNDDLENW  60

Query  2272  FRSFV---SESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNL  2102
             ++SF+   + S    E  R+++SY +V  GFAAKLS E V EM KK GF+SA  Q + +L
Sbjct  61    YKSFLPTTTISSSSNEAPRMLYSYHNVFRGFAAKLSAEDVKEMEKKPGFLSASPQEMLSL  120

Query  2101  YTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCE  1922
             +TTH+P+FLGL+   GFW++S+YG GVI+GV+DTGI P+HPSF+DE MPPPPAKWKGKCE
Sbjct  121   HTTHTPSFLGLHPGMGFWKDSNYGNGVIIGVMDTGIRPDHPSFSDEGMPPPPAKWKGKCE  180

Query  1921  FEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAV  1742
             F  +ACNNKLIGARNF  E        +DE GHGTHTASTAAGNFV  A V  +A GTA 
Sbjct  181   FNSSACNNKLIGARNFNQE---FSDSALDEVGHGTHTASTAAGNFVQGANVLRNANGTAA  237

Query  1741  GMAPLAHLSIYKVC--------TEDGCAESdilaamdaaiddgvdvlslslgggSASFFE  1586
             G+APLAHL++YKVC          + C ES ILAAMDAAI DGVD+LSLSLGG S  F+ 
Sbjct  238   GIAPLAHLAMYKVCIIVCQGVVCLNICPESAILAAMDAAIHDGVDILSLSLGGSSKPFYT  297

Query  1585  DSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGA  1406
             DS+A+GA+ AMEKGI VSC+AGN GP   +L NEAPW+LTVGASTIDR I ATA+LGN  
Sbjct  298   DSVALGAYTAMEKGILVSCSAGNGGPFNQSLENEAPWILTVGASTIDRKIVATALLGNKE  357

Query  1405  QLDGESAFQVENFPPTLLPLIYPGSKDED--AALCGPGSLdkvdvkgkvVLCDRGGGIAR  1232
             + DGES +  ++F  T  PL Y G    D  +A C   +L+   V+GK+V+CD G GI+ 
Sbjct  358   EFDGESLYNPKHFLSTPFPLYYAGWNASDILSAYCFSSALNSSKVQGKIVVCDYGVGISD  417

Query  1231  VDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTAT  1052
             V KG+ VK AGG  MI++N    GYT  AD HVLPAT L  ND                 
Sbjct  418   VQKGENVKAAGGVGMIIINGQNQGYTTFADAHVLPATHL--ND-----------------  458

Query  1051  IVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNA  872
                         AP VASFSSRGPS ASPGILKPDI+GPGVNILAAWP  +  NN N  +
Sbjct  459   -----------HAPVVASFSSRGPSMASPGILKPDIIGPGVNILAAWP-QSVENNTNTKS  506

Query  871   TFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPA  692
             TFN++SGTSM+ PHLSG+A LLKSAHPDWSPAAIKSAI+TTAD  NL    I DERL+PA
Sbjct  507   TFNMLSGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIMTTADLVNLAKNPIEDERLLPA  566

Query  691   DVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIP  512
             ++FA G GHVNPSRA++PGLIYD++  DY+PYLCGLNYT + +  I+QR+V C++ +SIP
Sbjct  567   NIFAIGSGHVNPSRANNPGLIYDIEPKDYVPYLCGLNYTRRGLLYILQRRVNCTEESSIP  626

Query  511   EAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQ  332
             EAQLNYPSF+I  G     Y+RTVTNVGEA S+YTVKV P  GV+V V P TL F+EV Q
Sbjct  627   EAQLNYPSFSIQFGSPIQRYTRTVTNVGEAKSVYTVKVVPPEGVEVIVKPKTLRFSEVKQ  686

Query  331   QLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
             +LTY + FS   T  +    QG+I W S +  V+SPIA I 
Sbjct  687   KLTYQVIFSQLPTAANNTASQGSITWASAKVSVRSPIAAII  727



>gb|KCW51742.1| hypothetical protein EUGRSUZ_J01202, partial [Eucalyptus grandis]
Length=715

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/708 (56%), Positives = 498/708 (70%), Gaps = 12/708 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYI+ V  P        ED  S +RSF+ + +    +  R+VHSY+H  SGFAAKL+ E 
Sbjct  12    TYIIQVRKPTDKHFATVEDLDSLYRSFLPTTAASSKQEQRMVHSYQHALSGFAAKLTAEE  71

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                +++K G +    + V +L+TT +P+FLGL+Q  GFW++S++GKGVI+G+LD+G+ P 
Sbjct  72    AKAVQEKDGVLQVHPEEVLSLHTTRTPDFLGLHQGVGFWKDSNFGKGVIIGLLDSGVFPE  131

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSE-GssppppPVDEEGHGTHTA  1808
             HPSFNDE +PPPPAKWKG+C+F GT+CNNKLIGAR+F++   ++   PP D+ GHGTHT+
Sbjct  132   HPSFNDEGVPPPPAKWKGRCDFNGTSCNNKLIGARSFINPINATQAVPPYDDTGHGTHTS  191

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdv  1628
             STAAG FV +A+  G+AKGTAVGMAPLAHL++YKVC +DGC  S ILA  DAAI+DGVDV
Sbjct  192   STAAGAFVRDASALGNAKGTAVGMAPLAHLAMYKVCVDDGCPASSILAGFDAAIEDGVDV  251

Query  1627  lslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTI  1448
             LS+SLGG S  FF+D IA GAFAA +KGIFVSC+AGN GP   +LSNEAPW+LTVGAS+I
Sbjct  252   LSVSLGGNSKPFFKDWIAQGAFAATQKGIFVSCSAGNSGPYNTSLSNEAPWILTVGASSI  311

Query  1447  DRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvdvkgk  1268
             DR+I+ATA LGNG + DGE+ +Q  NF P LLPLIYP   D+    C  GSL        
Sbjct  312   DRSIEATARLGNGLEFDGETLYQPHNFHPALLPLIYP-EIDDRIQDCAKGSLRFRSDIRG  370

Query  1267  vVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVK  1088
              V+    G    V  GQ VKD GG AMIL+N   DGYT LAD HVLPA E+SY  G ++K
Sbjct  371   KVVVCDLGSTEPVVAGQEVKDRGGVAMILVNGLTDGYTTLADAHVLPAVEVSYVAGREIK  430

Query  1087  DYINSTSWPTATIVFKGTFIGTKT-APSVASFSSRGPSNASPGILKPDILGPGVNILAAW  911
              Y N+ S P ATI+FKGT I  ++ AP+VASFSSRGP+  SPGILKPDI+GPG+NILA W
Sbjct  431   RYFNTASTPMATILFKGTHIIRRSVAPAVASFSSRGPNRQSPGILKPDIIGPGLNILAGW  490

Query  910   PVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNL  731
             P   + +       FN+ISGTSM+ PHLSG+A LLKS HP+WSP AIKSAI+TTA  +N+
Sbjct  491   PFPLDNSTNL----FNVISGTSMSCPHLSGVAALLKSTHPNWSPEAIKSAIMTTATTFNM  546

Query  730   NGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIV  551
              G  I+DE L PAD+FATG GH+NPS+A DPGL+YD    DYIPYLCGL   + +I+ IV
Sbjct  547   EGRPIVDETLHPADIFATGAGHINPSKAVDPGLVYDDGPQDYIPYLCGLISNESQIEVIV  606

Query  550   QRKVECSQVTSIPEAQLNYPSFAIWLGK--TSLTYSRTVTNVGEANSMYTVKVSPFLG-V  380
             ++KV CS + SIP+ QLNYPS  +      T+++ +RTV NVG A S Y   V P  G V
Sbjct  607   KKKVNCSSIGSIPDYQLNYPSITVSFKPSVTNVSVTRTVKNVGPAKSRYQSVVDPIKGPV  666

Query  379   DVGVTPDTLVFTEVNQQLTYNISFSPS-STPVDIDFVQGAIAWVSQRH  239
              +GV P  LVFTE NQ  +Y + F+    +     + QGAI WVS RH
Sbjct  667   SIGVYPRELVFTEANQTASYRVDFTREVDSKAPSPYAQGAITWVSARH  714



>ref|XP_006493680.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
 gb|KDO64849.1| hypothetical protein CISIN_1g045720mg [Citrus sinensis]
Length=745

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/721 (55%), Positives = 508/721 (70%), Gaps = 26/721 (4%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFVSESG-------DEGERSRIVHSYRHVASGFAA  2183
             TYI++V  P         D  S++RSF+ E+        D  + SR+++ Y++V SGFAA
Sbjct  42    TYIIYVQKPEQG------DLDSWYRSFLPEATISNSSDHDRNQSSRMLYFYKNVISGFAA  95

Query  2182  KLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLD  2003
             +L+ E V  M  KKGFISAR +   +L+TTH+PNFLGL+++ GFW++S++GKGVI+GVLD
Sbjct  96    RLTAEEVKAMETKKGFISARVENTLHLHTTHTPNFLGLHRSSGFWKDSNFGKGVIIGVLD  155

Query  2002  TGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGH  1823
             TGITP HPSFNDE MPPPPAKW+GKCE  G  CNNKLIG RNF           +D  GH
Sbjct  156   TGITPGHPSFNDEGMPPPPAKWRGKCELVGATCNNKLIGVRNFFC---GKDGSAIDYTGH  212

Query  1822  GTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTED-GCAESdilaamdaai  1646
             GTHTASTAAGNFV  A +FG A GTAVGMAPLAHL++YKVC  +  C ES ++A +DAAI
Sbjct  213   GTHTASTAAGNFVHGANIFGQANGTAVGMAPLAHLAVYKVCNPNVYCPESAVIAGIDAAI  272

Query  1645  ddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLT  1466
             +DGVDVLSLS G G + F+++ IA   F A+ +GIFVS AAGN GP++YTL N+APW+LT
Sbjct  273   EDGVDVLSLSFGLGLSQFYDNGIAKATFEAIRRGIFVSIAAGNSGPNHYTLVNDAPWMLT  332

Query  1465  VGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAA-LCGPGSLd  1289
             VGASTIDR I  +  LGN    DGE+ +Q  + P   LPL+YP +++      C P +L 
Sbjct  333   VGASTIDRGITISVRLGNQETYDGEALWQWTDIPSKRLPLVYPDARNHSTTTFCSPETLK  392

Query  1288  kvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSY  1109
              VDVKGKVVLC RG        G  V +AGGAAMIL+N ++ G + L   + LP   +S+
Sbjct  393   SVDVKGKVVLCQRGA------SGDDVLNAGGAAMILMNDELFGDSTLIQRNSLPNVRVSH  446

Query  1108  NDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGV  929
                  +K YINSTS PTA +V KGT IG  +AP V +FS RGPS  SPGILKPDI+GPG+
Sbjct  447   AVSESIKAYINSTSSPTAALVMKGTVIGGGSAPQVVAFSGRGPSRISPGILKPDIIGPGL  506

Query  928   NILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITT  749
             NI+AAW    +        TF+I+SGTSMA PHLSG+A LLKSAHP+WS AAIKSA++TT
Sbjct  507   NIIAAWKTTVDPLANRVY-TFDIVSGTSMACPHLSGVAALLKSAHPNWSHAAIKSAMMTT  565

Query  748   ADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQ  569
             AD  NL G  ILD   +PAD++A G G VNPS+A+DPGL+YD+Q DDYIPYLCGLNYTD+
Sbjct  566   ADTVNLEGKPILDCTRLPADLYAVGAGQVNPSKANDPGLVYDIQPDDYIPYLCGLNYTDE  625

Query  568   EIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPF  389
             ++Q IV R+V+C++V+SIPEA+LNYPSF+I LG +  TY RTVTNVG+A S YT ++   
Sbjct  626   QVQSIVDREVQCAKVSSIPEAELNYPSFSIKLGYSPQTYHRTVTNVGKAKSFYTRQMVAP  685

Query  388   LGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAIIF  209
              GV++ V P  + F   NQ++TY+++F+ +    +    Q  ++WVS ++ VKSPIAI F
Sbjct  686   EGVEITVQPHNISFAAKNQKVTYSVTFTRTGN-TNASSAQAYLSWVSDKYTVKSPIAISF  744

Query  208   Q  206
             +
Sbjct  745   E  745



>ref|XP_002275381.2| PREDICTED: subtilisin-like protease SDD1 [Vitis vinifera]
Length=1076

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/716 (56%), Positives = 521/716 (73%), Gaps = 13/716 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYIVH+  P   +   SE+   +++SF+ +      ++ R+V+SYR+V +GFAA+L+ E 
Sbjct  370   TYIVHLKEPEGGVFAESENLEGWYKSFLPARIASSKQQERMVYSYRNVLTGFAARLTEEE  429

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
               EM  K+GF+SAR +++Y+L+TTHSP+FLGL++  G W+ S+ GKGVI+GV+D+GI P+
Sbjct  430   AKEMEAKEGFVSARPEKIYHLHTTHSPSFLGLHKRSGLWKGSNLGKGVIIGVMDSGILPS  489

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVSEGssppppPVDEEGHGTHTA  1808
             HPSF DE MPPPPAKW G CEF  +  C+NK+IGARNF  E  S   PP DE GHG+HTA
Sbjct  490   HPSFGDEGMPPPPAKWTGLCEFNKSGGCSNKVIGARNF--ESGSKGMPPFDEGGHGSHTA  547

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdv  1628
             S AAGNFV +A V G+AKGTA G+AP AHL+IYK+CT++GCA +DILAA DAAI DGVDV
Sbjct  548   SIAAGNFVKHANVLGNAKGTAAGVAPGAHLAIYKICTDEGCAGADILAAFDAAIADGVDV  607

Query  1627  lslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTI  1448
             LS+S+G  S  F++D+IA+GAFAA+ KGI VSC+AGN GP   ++ N APW+LTVGASTI
Sbjct  608   LSVSVGQKSTPFYDDAIAVGAFAAIRKGILVSCSAGNYGPTSASVGNAAPWILTVGASTI  667

Query  1447  DRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvdvkgk  1268
             DR+I+A+  LGNG + DGES FQ  ++PP   PL+Y          C  G+++  DV+GK
Sbjct  668   DRSIRASVKLGNGEKFDGESLFQPSDYPPEFFPLVY------SPYFCSAGTVNVADVEGK  721

Query  1267  vVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVK  1088
             VVLCD  G  +  DKG+ VK AGG AMI+ N D+ G T +A  HVLPA+ +SY+ GL +K
Sbjct  722   VVLCDSDGKTSITDKGRVVKQAGGVAMIVANSDLAGSTTIALEHVLPASHVSYSAGLSIK  781

Query  1087  DYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWP  908
              YI+STS PTA+I F+GT IG  +AP V  FS+RGPS A+PGILKPDI+GPG+NILAAWP
Sbjct  782   AYISSTSHPTASIAFEGTIIGEPSAPEVIFFSARGPSLATPGILKPDIIGPGMNILAAWP  841

Query  907   VgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLN  728
                + N+ +   TFN++SGTSM+ PHLSG+A L+KS+HPDWSPAAIKSAI+TTAD  NL 
Sbjct  842   TPLHNNSPSKL-TFNLLSGTSMSCPHLSGVAALIKSSHPDWSPAAIKSAIMTTADILNLK  900

Query  727   GTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQ  548
              + ILD+   PA +FA G GHVNP RA+DPGLIYD+Q DDYIPYLCGL Y D ++  I  
Sbjct  901   DSPILDQTEHPASIFAIGAGHVNPLRANDPGLIYDIQPDDYIPYLCGLGYNDTQVGLITL  960

Query  547   RKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGV  368
             R V CS+ +SIPEAQLNYPSF+I L   +  + RTVTNVG+  S YTV ++   GVDV V
Sbjct  961   RTVRCSEESSIPEAQLNYPSFSIALRSKARRFQRTVTNVGKPTSSYTVHIAAPPGVDVTV  1020

Query  367   TPDTLVFTEVNQQLTYNISFSPSSTPVDI--DFVQGAIAWVSQRHIVKSPIAIIFQ  206
              P  L FT+ NQ+ TY ++F  SS+ V     + QG + WVS  H  +SPIA+ F+
Sbjct  1021  KPHKLHFTKRNQKKTYTVTFKRSSSGVITGEQYAQGFLKWVSATHSARSPIAVKFE  1076


 Score =   198 bits (503),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 123/167 (74%), Gaps = 2/167 (1%)
 Frame = -1

Query  802  SAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYD  623
            S HP+WSPAAIKSAI+TTAD+ N     I+D+   PAD+FA G GHVNPSRA+DPGLIYD
Sbjct  171  STHPEWSPAAIKSAIMTTADEVNHENKPIMDQTHQPADIFAVGAGHVNPSRANDPGLIYD  230

Query  622  LQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLT--YS  449
            +Q +DYI YLCGL Y+D ++  +V R+V CS+ ++IPEAQLNYPS +I LG ++ T  ++
Sbjct  231  IQPEDYIHYLCGLGYSDSQVGIVVNRRVNCSEESTIPEAQLNYPSSSIALGSSTTTQEFT  290

Query  448  RTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISF  308
            RT TNVG  +S Y +++    GV+V V PD L FT +NQ+ TY + F
Sbjct  291  RTATNVGAVDSTYIIEIFAPPGVNVSVKPDKLDFTRLNQKKTYAVMF  337


 Score = 87.4 bits (215),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 68/149 (46%), Gaps = 44/149 (30%)
 Frame = -1

Query  1960  MPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAAGNFVG  1781
             MPPPPAKWKGKC F GT CNNK+I A NFV        PP ++  HGT  AS AAGNFV 
Sbjct  1     MPPPPAKWKGKCAFNGTICNNKIISATNFVES-----LPPTEDFIHGTPVASIAAGNFVE  55

Query  1780  NAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlslslgggS  1601
             +A  F                       EDG                   +        S
Sbjct  56    DAGDF-----------------------EDGV----------------DVLSISLAADHS  76

Query  1600  ASFFEDSIAIGAFAAMEKGIFVSCAAGNE  1514
               F+ D I IGAFAA  KGIFVS  AGNE
Sbjct  77    DPFYVDEITIGAFAATRKGIFVSTPAGNE  105


 Score = 77.0 bits (188),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -1

Query  1252  RGGGIARVDKGQTVKDAGGAAMILLNQDIDGY-TILADTHVLPATELSYNDGLKVKDYIN  1076
             R G       G  VK+AGG A+IL N    G+ T   +  +LPAT LSY+ GLK+K YIN
Sbjct  93    RKGIFVSTPAGNEVKNAGGVAIILPNNKYRGFSTSEINADILPATHLSYSSGLKIKAYIN  152

Query  1075  STSWPTATIVFKGTFIGTKTAP  1010
             ST+ PTATI FKGT IG  T P
Sbjct  153   STTKPTATIEFKGTIIGISTHP  174



>ref|XP_006358145.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=647

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/656 (61%), Positives = 485/656 (74%), Gaps = 19/656 (3%)
 Frame = -1

Query  2179  LSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDT  2000
             LS + V EM  K GF+SAR QRV  L TTH+P+FLGL+QN G W  S+ GKGVI+G+LD+
Sbjct  2     LSSDEVKEMELKPGFVSARPQRVLELDTTHTPSFLGLHQNVGLWNASNSGKGVIIGLLDS  61

Query  1999  GITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHG  1820
             GITP HPSFND  MPPPPAKWKGKCEF   ACNNKLIGARNFV+        P+D EGHG
Sbjct  62    GITPKHPSFNDNGMPPPPAKWKGKCEFNSNACNNKLIGARNFVT----TSTSPLDVEGHG  117

Query  1819  THTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaidd  1640
             THT+STAAGNFV  A + G+A GTAVG+AP AHL++Y+VC +  C ES ILA +DAAI+D
Sbjct  118   THTSSTAAGNFVDGANLLGNANGTAVGIAPRAHLAMYRVCDDGVCQESYILAGLDAAIED  177

Query  1639  gvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVG  1460
             GVDVLS+SLGG    F++D++AIGA++A++KGIFVSC+AGN+GP   TL N APW+LTV 
Sbjct  178   GVDVLSISLGGMPVPFYDDALAIGAYSAIQKGIFVSCSAGNKGPAVGTLKNGAPWILTVA  237

Query  1459  ASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvd  1280
             A+T DR I+A AVLGNGA+  GESA+Q  NF    LPL+       +A  C   SL  +D
Sbjct  238   ATTTDRKIRAVAVLGNGAKYVGESAYQPTNFSGKWLPLV-------NANDCE--SLFTID  288

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
             VKGK+VLCD  G ++R++KG+ VK+AGGAAMIL+ +   GYT +AD HVLPAT++SY +G
Sbjct  289   VKGKIVLCDTSGDLSRIEKGEAVKNAGGAAMILVTEKKRGYTTIADVHVLPATQVSYFNG  348

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
             LK+ +Y+ STS P ATI FKGT  G K  P+VASFSSRGP + SPGILKPDI GPGVNIL
Sbjct  349   LKIINYMKSTSSPVATISFKGTEFGNKHVPTVASFSSRGPFSPSPGILKPDISGPGVNIL  408

Query  919   AAWPVgn-ntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTAD  743
             AAWP           ++TFNIISGTSMA PHL+G+A LLKSAHPDWSPAAIKSAI+TTAD
Sbjct  409   AAWPTSVGEMIISATSSTFNIISGTSMACPHLAGVAALLKSAHPDWSPAAIKSAIMTTAD  468

Query  742   QYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEI  563
               NL    I DERL PA++F  G G+VNPSRASDPGLIYD+  +DY+PYLCGL YTDQ++
Sbjct  469   IINLKKHPIEDERLNPANLFTIGSGNVNPSRASDPGLIYDIHPEDYVPYLCGLKYTDQQV  528

Query  562   QQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLG  383
               IV+RKV C+  +SI EA+LNYPSF+I     + TY+RTVTNVGEANS YTV+V    G
Sbjct  529   SSIVRRKVHCT--SSIAEAELNYPSFSISSKSGAQTYTRTVTNVGEANSTYTVEVCGLNG  586

Query  382   VDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAI  215
             V V V P TL F+ +NQ+ +YN++             QG I W S R+ V+SPI I
Sbjct  587   VKVAVNPITLKFSALNQKASYNVTVKHLK---HRSHSQGYITWSSGRYSVRSPIQI  639



>ref|XP_006469111.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=744

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/723 (56%), Positives = 509/723 (70%), Gaps = 24/723 (3%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV-----SESGDEGERSRIVHSYRHVASGFAAKL  2177
             TYIV+V  P         D  S++ SF+     S S D+  +SR+VH YRHV SGFAA+L
Sbjct  33    TYIVYVQEPKHGNFSKEIDLESWYHSFLPASISSNSIDDDHQSRMVHCYRHVISGFAARL  92

Query  2176  SPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTG  1997
             + E V  M  K GFISA  +    L+TTH+P FLGL+QN GFW++S++GKGVI+GV+D+G
Sbjct  93    TAEEVKVMETKSGFISAHVENTLQLHTTHTPRFLGLHQNSGFWKDSNFGKGVIIGVVDSG  152

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVSEGssppppPVDEEGHG  1820
             I P HPSF D++MPPPPAKW+GKCEF G A CNNK+IGARNF+++      PP D EGHG
Sbjct  153   IGPTHPSFGDKDMPPPPAKWRGKCEFAGGAGCNNKIIGARNFLNK----SEPPTDNEGHG  208

Query  1819  THTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTE--DGCAESdilaamdaai  1646
             THT+STAAG FV  A + G A GTAVGMAPLAHL++YK C +    C ES + AA+DAAI
Sbjct  209   THTSSTAAGTFVNGANILGQANGTAVGMAPLAHLAMYKACDDYNGTCPESSVSAALDAAI  268

Query  1645  ddgvdvlslslgg---gSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPW  1475
             +DGVDVLSLS+G        F  ++IAI AF A++KGIFVS +AGN GP  +++ N+APW
Sbjct  269   EDGVDVLSLSIGLGPYQHKEFHANAIAIAAFKAVKKGIFVSISAGNWGPKPFSVVNDAPW  328

Query  1474  LLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAAL-CGPG  1298
             +LTVGAST DR+I  +  LGN    DGES  Q  + P   LPL+YP +K+  A   C P 
Sbjct  329   MLTVGASTTDRSIVTSVQLGNQETYDGESLLQWTDIPSEQLPLVYPVTKNASATTNCSPE  388

Query  1297  SLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATE  1118
             +L  +DVKGKVVLC     +  V+  Q V DAGGAAMIL+N ++ G +I+    VLP   
Sbjct  389   TLKSIDVKGKVVLC-----LLSVNP-QDVLDAGGAAMILMNNELIGDSIVVARSVLPNVR  442

Query  1117  LSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILG  938
             +SY  G  +K YINSTS PTA +V KGT IG K+AP++ +FSSRGPS  SPGILKPD++G
Sbjct  443   VSYMVGESIKAYINSTSSPTAALVVKGTVIGEKSAPAIVAFSSRGPSTVSPGILKPDVVG  502

Query  937   PGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAI  758
             PGVNI+AAW              F+IISGTSM+ PHLSGIA LLKSAHPDWSPAAIKSAI
Sbjct  503   PGVNIIAAWRTAVEPITNTEY-IFDIISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAI  561

Query  757   ITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNY  578
             +TTAD  NL G  ILD   +PAD FA G GHVNPS+A+DPGLIYD+Q DDYIPYLCGLNY
Sbjct  562   MTTADTINLEGKPILDRNHLPADPFAVGAGHVNPSKANDPGLIYDIQPDDYIPYLCGLNY  621

Query  577   TDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKV  398
             TDQ++Q IV   V+CS+V+SI EA LNYPSF+I LG +  TY+RTVTNVG AN  YT ++
Sbjct  622   TDQQVQGIVGGDVQCSKVSSIAEAGLNYPSFSIRLGSSPQTYNRTVTNVGPANLSYTSQI  681

Query  397   SPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIA  218
                 GV + + PD + FTE NQ++ Y+++F+ +    +  F Q  ++W+S R+ VKSPIA
Sbjct  682   VAPEGVGITIQPDKISFTEKNQKVAYSVTFTRTKN-TNTSFTQANLSWISGRYAVKSPIA  740

Query  217   IIF  209
             I F
Sbjct  741   ISF  743



>ref|XP_009586892.1| PREDICTED: subtilisin-like protease SDD1 [Nicotiana tomentosiformis]
Length=742

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/747 (54%), Positives = 525/747 (70%), Gaps = 18/747 (2%)
 Frame = -1

Query  2413  MAYISVVV-CLTLVFHSVASAKYEDTYIVHVSPPAAAINGVSE--DYRSYFRSFV----S  2255
             M ++ +++ C+   F   +     +TYIV V PP + I+  S   D  SY+ SF+    S
Sbjct  1     MGFLKILLFCIFCSFPLPSFQSDLETYIVQVEPPESQISTQSSSMDLESYYHSFLPKTTS  60

Query  2254  ESGDEGERSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFL  2075
              S  E E  R+++SY +V  GFAA+L+   V EM KK+GF SAR  R+ +L TTH+P+FL
Sbjct  61    ISSSENEEPRMIYSYHNVMKGFAARLTAAQVKEMEKKQGFFSARPHRILSLQTTHTPSFL  120

Query  2074  GLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNN  1898
             GL QN G W++S+YGKGVI+GVLDTGI P+HPSF+D  MPPPPAKWKG CE    T CNN
Sbjct  121   GLQQNMGLWKDSNYGKGVIIGVLDTGIFPDHPSFSDVGMPPPPAKWKGFCESNFTTKCNN  180

Query  1897  KLIGARNF-VSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAH  1721
             K+IG R+F  +EGS      +D++GHGTHTASTAAG FV  A  FG+A GTAVG+APLAH
Sbjct  181   KIIGLRSFRFAEGSP-----IDDDGHGTHTASTAAGAFVKGANFFGNANGTAVGVAPLAH  235

Query  1720  LSIYKVCTEDGCAESdilaamdaaiddgvdvlslslg-ggSASFFEDSIAIGAFAAMEKG  1544
             ++IYKVC+   C+++D LAAMDAAIDDGVD++S SLG   +  F +D IA+GA++A E+G
Sbjct  236   IAIYKVCSFATCSDTDFLAAMDAAIDDGVDIISASLGGFSNGPFHDDPIALGAYSATERG  295

Query  1543  IFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFP  1364
             I VSC+AGN   D  +++N APW+LTVGAST DR +KAT  LGN  + +GESA + +   
Sbjct  296   ILVSCSAGNRQFDN-SVANSAPWILTVGASTHDRKLKATVKLGNKEEFEGESADEKKTSN  354

Query  1363  PTLLPLIYPG--SKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAA  1190
              T + L   G  + D+DA  C   +L    +KGK+VLC +        +G++VK+AGG  
Sbjct  355   STFIALYDAGKNASDQDAPFCRSWALTDPAIKGKIVLCRKDCCSLTSSQGESVKNAGGVG  414

Query  1189  MILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAP  1010
             MIL+N   DG T  A  HVLPA ++S+ +G K+K YINSTS P A I F+GT IG K AP
Sbjct  415   MILINNPEDGVTKSATAHVLPALDVSHEEGEKIKAYINSTSNPIAAITFQGTVIGDKNAP  474

Query  1009  SVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPH  830
              VASFS+RGPS A+PGILKPDI+GPGVN+LAAWP   N  N N  + FNI+SGTSM+  H
Sbjct  475   IVASFSTRGPSRANPGILKPDIIGPGVNVLAAWPTTVNIPNKNTKSAFNILSGTSMSCAH  534

Query  829   LSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSR  650
             L+GIA LLKSAHP+WS +AIKSAI+TTAD  NL    ILDE L PA++FATG GHVNPSR
Sbjct  535   LTGIAALLKSAHPNWSSSAIKSAIMTTADTLNLAKNPILDETLNPANIFATGAGHVNPSR  594

Query  649   ASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLG  470
             A+DPGL+YD   +DY+PYLCGLNY+++E+  ++QRKV C +V SIPEAQLNYPSF+I L 
Sbjct  595   ATDPGLVYDTPFEDYLPYLCGLNYSNREVGNLLQRKVNCLEVKSIPEAQLNYPSFSIRLR  654

Query  469   KTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTP  290
              T  TY+R VTNVG+A S Y V++    GV V V P  L F+ +NQ+LTY ++FS ++  
Sbjct  655   STPQTYTRNVTNVGDAKSSYKVEIVQPKGVAVKVKPSKLNFSMLNQRLTYQVTFSKTTNS  714

Query  289   VDIDFVQGAIAWVSQRHIVKSPIAIIF  209
                + VQG + W S RH V+SPIA++ 
Sbjct  715   SGNEVVQGFLKWTSNRHSVRSPIAVVL  741



>ref|XP_010058207.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=1262

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/728 (56%), Positives = 512/728 (70%), Gaps = 32/728 (4%)
 Frame = -1

Query  2341  TYIVHVSPPA----AAINGVSEDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKL  2177
             TYIV V  PA    AA  G   D  +++RS + + +    +  R+V SYR+V SGFAAKL
Sbjct  550   TYIVQVRKPADQDFAATPG---DLDAFYRSLLPATAASSNQEHRMVRSYRNVLSGFAAKL  606

Query  2176  SPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTG  1997
             + E    +R+K G +  R +   +L+TTH+P+FLGL+Q  G W++S++GKGVI+GVLDTG
Sbjct  607   TTEEAEAIREKDGVLYVRPEEALSLHTTHTPDFLGLHQGVGLWKDSNFGKGVIIGVLDTG  666

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGT  1817
             I P+H SF+DE +PPPPAKWKG C+F G +CNNKLIGAR++            D  GHGT
Sbjct  667   IFPDHISFSDEGVPPPPAKWKGGCDFNGKSCNNKLIGARSYTGPPD-------DHVGHGT  719

Query  1816  HTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddg  1637
             HT+STAAG FV  A+  G+A GTAVGMAPLAHL+IYKVC   GC ESDILA  DAAI+DG
Sbjct  720   HTSSTAAGAFVRRASALGNANGTAVGMAPLAHLAIYKVCEVFGCLESDILAGFDAAIEDG  779

Query  1636  vdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGA  1457
             VDVLSLSLGG S  F++D IA GAFAA +KGIFVSC+AGN GP   TLSNEAPW+LTVGA
Sbjct  780   VDVLSLSLGGISRPFYDDVIAKGAFAATQKGIFVSCSAGNSGPSNSTLSNEAPWILTVGA  839

Query  1456  STIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG-SKDEDAALCGPGSLdkvd  1280
             S+IDRTI A+  LG+  + DGE+ +Q  +FP  LLPL++ G + D  +A C PGSL    
Sbjct  840   SSIDRTITASVQLGSRQEFDGETLYQPHDFPQKLLPLVHAGKTGDPSSASCLPGSLQGRS  899

Query  1279  vkg-kvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYND  1103
                 KVV+CD G G  RV+KGQ VKDAGGAAMIL+N   +GYT LAD HVLPA  +SY  
Sbjct  900   DLQGKVVVCDVGDGKGRVEKGQEVKDAGGAAMILVNGPTEGYTTLADAHVLPAVHVSYVA  959

Query  1102  GLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNI  923
             G  +K Y+     PTATI+FKGT IGT  AP+V+ FSSRGP+  SPGILKPDI+GPGVNI
Sbjct  960   GAAIKSYLRKARAPTATILFKGTHIGTSAAPAVSFFSSRGPNIESPGILKPDIIGPGVNI  1019

Query  922   LAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTAD  743
             LA+WP   + +    +A FN+ISGTSMA PHLSG+A LLKS HPDWSP AIKSAI+TTA 
Sbjct  1020  LASWPFPLDKSTSKTDA-FNVISGTSMACPHLSGVAALLKSVHPDWSPGAIKSAIVTTAA  1078

Query  742   QYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEI  563
               N+    I+D+ L PAD+FATG GHVNPS+A DPGLIYD+   DY+PY CGLNYTD EI
Sbjct  1079  TSNMKHQPIIDQTLHPADIFATGAGHVNPSKAVDPGLIYDIGLQDYVPYFCGLNYTDSEI  1138

Query  562   QQIVQRKVECSQVTSIPEAQLNYPSFAIWLGK--TSLTYSRTVTNVGEANSMYTVKVSPF  389
             + IVQ+KV CS + SIP+ QLNYPS ++  G   T ++ +RTV NVG A S Y   + P 
Sbjct  1139  EMIVQKKVTCSSIKSIPDYQLNYPSISLMFGGSVTKVSVTRTVRNVGPAKSHYWSVIEPI  1198

Query  388   LGVD-VGVTPDTLVFTEVNQQLTYNISFS-------PSSTPVDIDFVQGAIAWVSQRHIV  233
              G+D + V P  L FTE NQ  +Y + F+        ++TP    F QGAI WVS R+ V
Sbjct  1199  KGLDSIDVHPRDLEFTEANQTASYRVDFTRGVDRKAAATTP----FAQGAITWVSARYSV  1254

Query  232   KSPIAIIF  209
             ++P+A++F
Sbjct  1255  RTPVAVVF  1262


 Score =   218 bits (555),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYI+ V  P        ED  + +RSF+ + +    +  R+VHSYR+V SGFAAKL+ E 
Sbjct  45    TYIIQVQKPKDKDLTTLEDLDTLYRSFLPTAAASSNQEQRMVHSYRNVLSGFAAKLTAEE  104

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
                +R+K   +  R ++  +L+TTH+PNFLGL+Q  G W +S+YGKG+I+GVLDTGI P+
Sbjct  105   AKAIREKDRVLHVRPEKALSLHTTHTPNFLGLHQGVGLWNDSNYGKGMIIGVLDTGIFPD  164

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppP--VDEEGHGTHT  1811
             HPSF+DE MPPPPAKWKG+C+F GT+CNNKLIGAR+F S  ++        D EGHGTHT
Sbjct  165   HPSFSDEGMPPPPAKWKGRCDFNGTSCNNKLIGARSFTSSSTTHAQAVPPYDGEGHGTHT  224

Query  1810  ASTAAGNFVGNAAVF  1766
             +STAAG FV +A+  
Sbjct  225   SSTAAGAFVRDASAL  239


 Score =   185 bits (469),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 126/186 (68%), Gaps = 14/186 (8%)
 Frame = -1

Query  787  WSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDD  608
            WSPAAIKSAI+TTA   NL    I+D+ L PAD+FATG GHVNPS+A DPGLIYD+   D
Sbjct  349  WSPAAIKSAILTTATTSNLERRPIVDQTLHPADIFATGAGHVNPSKAVDPGLIYDVGPQD  408

Query  607  YIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKT--SLTYSRTVTN  434
            YI YLCGL YTD EI+ IVQ  V CS + SIP+ QLNYPS ++    +  +++ +RTV N
Sbjct  409  YIAYLCGLGYTDSEIETIVQETVTCSSIPSIPDYQLNYPSISVRFEGSVNTVSVTRTVRN  468

Query  433  VGEANSMYTVK-VSPFLGVD-VGVTPDTLVFTEVNQQLTYNISFSPS------STPVDID  278
            VG A S Y +  + P +G+D +GV+P  L FTEVNQ ++Y + F+ S      +TP    
Sbjct  469  VGPAKSRYILSLIDPIMGLDSIGVSPGDLEFTEVNQTVSYTVDFTRSVDWNTTATP----  524

Query  277  FVQGAI  260
            F QGAI
Sbjct  525  FAQGAI  530


 Score = 94.0 bits (232),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -1

Query  1261  LCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDY  1082
             +CD G G  RV KGQ VK+AGGAAMIL+N  I+GYT L D HVLPA  +SY  G+ +KDY
Sbjct  272   VCDIGDGRGRVAKGQEVKNAGGAAMILVNGPIEGYTTLVDAHVLPAVHVSYVAGMAIKDY  331

Query  1081  INSTSWPTATIVFKGTF  1031
             +++   P  TI+FKGT 
Sbjct  332   LSTAQAPAGTILFKGTL  348



>ref|XP_006446947.1| hypothetical protein CICLE_v10014389mg [Citrus clementina]
 gb|ESR60187.1| hypothetical protein CICLE_v10014389mg [Citrus clementina]
Length=744

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/723 (56%), Positives = 507/723 (70%), Gaps = 24/723 (3%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV-----SESGDEGERSRIVHSYRHVASGFAAKL  2177
             TY+V+V  P         D  S++ SF+     S S D+  +SR+VH YRHV SGFAA+L
Sbjct  33    TYMVYVQKPKHGNFSKEIDLESWYHSFLPATISSNSTDDDRQSRMVHCYRHVISGFAARL  92

Query  2176  SPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTG  1997
             + E V  M  K GFISA  +    L+TTH+PNFLGL+QN GFW++S+ GKGVI+GVLD+G
Sbjct  93    TAEEVKAMETKNGFISAHVENTLRLHTTHTPNFLGLHQNSGFWKDSNLGKGVIIGVLDSG  152

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVSEGssppppPVDEEGHG  1820
             ITP HPSF+D++MPPPPAKW+GKCEF G A CNNK+IGARNF +       PP+D+ GHG
Sbjct  153   ITPTHPSFSDKDMPPPPAKWRGKCEFAGGAGCNNKIIGARNFYN----LSLPPIDDGGHG  208

Query  1819  THTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTE--DGCAESdilaamdaai  1646
             THT+STAAG FV  A   G A GTAVGMAPLAHL++YK C +  D C ES + AA+DAAI
Sbjct  209   THTSSTAAGTFVNGANRLGEANGTAVGMAPLAHLAMYKACDDYADKCPESSVSAALDAAI  268

Query  1645  ddgvdvlslslgg---gSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPW  1475
             +DGVDVLSLS+G        F  ++IAI  F A++KGIF+S +AGN GP  +++ N+APW
Sbjct  269   EDGVDVLSLSIGLGPDQHKEFHANAIAIATFKAVKKGIFISISAGNWGPKPFSVVNDAPW  328

Query  1474  LLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAAL-CGPG  1298
             +LTVGAST DR+I  +  LGN    DGES  Q    P   LPL+YP +K+  A   C P 
Sbjct  329   MLTVGASTTDRSIVTSVQLGNQETYDGESLLQGTGIPSEQLPLVYPVTKNASATTNCPPE  388

Query  1297  SLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATE  1118
             +L  +DVKGKVVLC            Q V DAGGAAMIL+N ++ G +I+A + VLP   
Sbjct  389   TLKSIDVKGKVVLCQLSA------DPQDVLDAGGAAMILMNNELIGDSIVAGSTVLPHAR  442

Query  1117  LSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILG  938
             +SY  G  +K YINSTS PTA +V KGT IG K+AP++ +FSSRGPS  SPGILKPD++G
Sbjct  443   VSYTVGESIKAYINSTSSPTAALVVKGTVIGEKSAPAIVAFSSRGPSTVSPGILKPDVVG  502

Query  937   PGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAI  758
             PGVNI+AAW              F+IISGTSM+ PHLSGIA LLKSAHPDWSPAAIKSAI
Sbjct  503   PGVNIIAAWRTAVEPITNTEY-IFDIISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAI  561

Query  757   ITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNY  578
             +TTAD  NL G  ILD   +PAD+FA G GHVNPS+A+DPGLIYD+Q +DYIPYLCGLNY
Sbjct  562   MTTADTINLEGKPILDRNHLPADLFAVGAGHVNPSKANDPGLIYDIQPNDYIPYLCGLNY  621

Query  577   TDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKV  398
             TDQ++Q IV   V+CS+V SI EA+LNYPSF+I LG    TY+RTVTNVG ANS YT ++
Sbjct  622   TDQQVQGIVGGDVQCSKVQSIAEAELNYPSFSIRLGSARQTYNRTVTNVGPANSSYTSQI  681

Query  397   SPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIA  218
                 GV++ + P  + FT  NQ++TY+++F+ +   +     Q  ++W+  ++IVKSPIA
Sbjct  682   VAPEGVEITIQPSKISFTGKNQKVTYSVTFTRTKN-IGASSAQANLSWIFGQYIVKSPIA  740

Query  217   IIF  209
             I F
Sbjct  741   ISF  743



>ref|XP_006446945.1| hypothetical protein CICLE_v10017946mg [Citrus clementina]
 gb|ESR60185.1| hypothetical protein CICLE_v10017946mg [Citrus clementina]
Length=744

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/723 (56%), Positives = 510/723 (71%), Gaps = 24/723 (3%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV-----SESGDEGERSRIVHSYRHVASGFAAKL  2177
             TYIV+V  P         D  S++ SF+     S S D+  +SR+VH YRHV SGFAA+L
Sbjct  33    TYIVYVQEPKHGNFSKEIDLESWYHSFLPATISSNSIDDDHQSRMVHYYRHVISGFAARL  92

Query  2176  SPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTG  1997
             + E V  M  K GFISA  +    L+TTH+P FLGL+QN GFW++S++GKGVI+GV+D+G
Sbjct  93    TAEEVKVMETKSGFISAHVENTLQLHTTHTPRFLGLHQNSGFWKDSNFGKGVIIGVVDSG  152

Query  1996  ITPNHPSFNDENMPPPPAKWKGKCEFEGTA-CNNKLIGARNFVSEGssppppPVDEEGHG  1820
             I P HPSF D++MPPPPAKW+GKCEF G A CNNK+IGARNF+++      PP D EGHG
Sbjct  153   IGPTHPSFGDKDMPPPPAKWRGKCEFAGGAGCNNKIIGARNFLNK----SEPPTDNEGHG  208

Query  1819  THTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTE--DGCAESdilaamdaai  1646
             THT+STAAG FV  A + G A GTAVGMAPLAHL++YK C +    C ES + AA+DAAI
Sbjct  209   THTSSTAAGTFVNGANILGQANGTAVGMAPLAHLAMYKACDDYNGTCPESSVSAALDAAI  268

Query  1645  ddgvdvlslslgg---gSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPW  1475
             +DGVDVLSLS+G        F  ++IAI AF A++KGIFVS +AGN GP  +++ N+APW
Sbjct  269   EDGVDVLSLSIGLGPYQHKEFHANAIAIAAFKAVKKGIFVSISAGNWGPKPFSVVNDAPW  328

Query  1474  LLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAAL-CGPG  1298
             +LTVGAST DR+I  +  LGN    DGES  Q  + P   LPL+YP +K+  A   C P 
Sbjct  329   MLTVGASTTDRSIVTSVQLGNQETYDGESLLQWTDIPSEQLPLVYPVTKNASATTNCSPE  388

Query  1297  SLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATE  1118
             +L  +DVKGKVVLC     +  V+  Q V DAGGAAMIL+N ++ G +I+    VL    
Sbjct  389   TLKSIDVKGKVVLC-----LLSVNP-QDVLDAGGAAMILMNNELIGDSIVVARSVLRNVR  442

Query  1117  LSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILG  938
             +SY  G  +K YINSTS PTA +V KGT IG K+AP++ +FSSRGPS  SPGILKPD++G
Sbjct  443   VSYMVGESIKAYINSTSSPTAALVVKGTVIGEKSAPAIVAFSSRGPSTVSPGILKPDVVG  502

Query  937   PGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAI  758
             PGVNI+AAW              F+IISGTSM+ PHLSGIA LLKSAHPDWSPAAIKSAI
Sbjct  503   PGVNIIAAWRTAVEPITNTEY-IFDIISGTSMSCPHLSGIAALLKSAHPDWSPAAIKSAI  561

Query  757   ITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNY  578
             +TTAD  NL G  ILD   +PAD FA G GHVNPS+A+DPGLIYD+Q DDYIPYLCGLNY
Sbjct  562   MTTADTVNLEGKPILDRNHLPADPFAVGAGHVNPSKANDPGLIYDIQPDDYIPYLCGLNY  621

Query  577   TDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKV  398
             TDQ++Q IV   V+CS+++SI EA+LNYPSF+I LG +  TY+RTVTNVG AN  YT ++
Sbjct  622   TDQQVQGIVGGDVQCSKMSSIAEAELNYPSFSIRLGSSPQTYNRTVTNVGPANLSYTSQI  681

Query  397   SPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIA  218
                 GV++ + PD + FTE NQ++ Y+++F+ +    +  F Q  ++W+S R+ VKSPIA
Sbjct  682   VAPEGVEITIQPDKISFTEKNQKVAYSVTFTRTKN-TNTSFTQANLSWISGRYAVKSPIA  740

Query  217   IIF  209
             I F
Sbjct  741   ISF  743



>gb|EYU29357.1| hypothetical protein MIMGU_mgv1a021077mg [Erythranthe guttata]
Length=719

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/726 (57%), Positives = 515/726 (71%), Gaps = 25/726 (3%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFV--------SESGDEGERSRIVHSYRHVASGF  2189
             D YIVHV         +S+D  +++ SF+        + +    ++ RI++ YRHV SGF
Sbjct  5     DVYIVHVDHAQ-----ISDDLETFYDSFLPTNTNLAAASTNSTTDQPRILYRYRHVISGF  59

Query  2188  AAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGV  2009
             AAKLS   V  MR  KGF+SAR +R+ +L+TTHSPNFLGL QN G W+NSSYGKG+I+G+
Sbjct  60    AAKLSAADVEVMRHMKGFVSARPERMLHLHTTHSPNFLGLNQNTGLWKNSSYGKGIIIGM  119

Query  2008  LDTGITPNHPSFNDENMPPPPAKWKGKCEF--EGTACNNKLIGARNFVSEGssppppPVD  1835
             +D+GI P+HPS  D  MPPPPAKWKGKC+F     ACNNKLIGAR F    S   PP +D
Sbjct  120   VDSGILPDHPSLADRGMPPPPAKWKGKCDFISRKWACNNKLIGARYFY-HNSGTEPPLID  178

Query  1834  EEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamd  1655
             + GHGTHT+  AAGNFV  A  FG+A GTA G+AP AH+++Y+ C    C ES++ AAMD
Sbjct  179   QIGHGTHTSGIAAGNFVEGAGFFGNAGGTASGIAPFAHVAMYQPCKYHNCTESNVAAAMD  238

Query  1654  aaiddgvdvlslslgggSASFFEDSI-AIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAP  1478
             AAI+DGVDVLS+SLGG     F D I AIGAF A+EKGI VSC+AGN+GP   +LSNEAP
Sbjct  239   AAIEDGVDVLSMSLGGAYLHRFPDDIMAIGAFRAIEKGIVVSCSAGNDGPKSKSLSNEAP  298

Query  1477  WLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPT-LLPLIYPGSKDEDAALCGP  1301
             W++TVGASTIDR I ATA+LGNG +L+GE+      FP    L L+YP S     + C  
Sbjct  299   WIMTVGASTIDRKIVATAMLGNGEELEGETG---TGFPSIGKLHLVYPRSFYTRVSSCV-  354

Query  1300  GSLdkvdvkgkvVLCDRGGGIA-RVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPA  1124
                   DV+GK+VLCD G  I+ RV++G+TVK AGGAAMIL+N   DG T   D HVLPA
Sbjct  355   -YRFNTDVRGKIVLCDSGDHISNRVEQGRTVKKAGGAAMILINYKSDGDTTFDDPHVLPA  413

Query  1123  TELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDI  944
              ++ Y DGLK+K Y+NSTS PTAT+ FKGT IG+  AP V +FSSRGP+  SPGILKPDI
Sbjct  414   MQIGYVDGLKLKAYVNSTSNPTATMSFKGTVIGSGRAPVVPAFSSRGPNKVSPGILKPDI  473

Query  943   LGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKS  764
             +GPGVNILAAWPV          +TFNI+ GTSM+ PHLSG+A LLKSAHPDWSPAAIKS
Sbjct  474   IGPGVNILAAWPVSVENKTNIK-STFNILYGTSMSCPHLSGVAALLKSAHPDWSPAAIKS  532

Query  763   AIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGL  584
             AI+TTAD  NL G  I +E L PA VFA G GHVNPSRA+DPGL+YD+  DDYIPYLCGL
Sbjct  533   AIMTTADHLNLKGNPIENEHLKPASVFAVGSGHVNPSRANDPGLVYDILPDDYIPYLCGL  592

Query  583   NYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTV  404
             NYT+QE+  IV+ KV+CS+  SIPEAQLNYPSF+I  G T  TY+RT+TNVG+ANS Y V
Sbjct  593   NYTNQEVGIIVKCKVDCSKKKSIPEAQLNYPSFSIIFGSTPQTYTRTLTNVGKANSSYDV  652

Query  403   KVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSP  224
             ++    GV+V V P  LVF ++  + +Y+++F+ ++        QG I W +  H V+SP
Sbjct  653   EIVSSHGVNVKVEPHKLVFPKLGDKSSYSVTFTRTTKEAMNSTTQGFIRWYTADHSVRSP  712

Query  223   IAIIFQ  206
             I ++F+
Sbjct  713   IIVVFK  718



>ref|XP_010317342.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=642

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/655 (59%), Positives = 479/655 (73%), Gaps = 18/655 (3%)
 Frame = -1

Query  2179  LSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDT  2000
             LS + V  M  + GF+SAR QRV  L+TTHSP+FLGL+QN G W  S+ GKGVI+G+LD+
Sbjct  2     LSSDEVKMMETQPGFVSARPQRVLQLHTTHSPSFLGLHQNVGLWNASNSGKGVIIGLLDS  61

Query  1999  GITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHG  1820
             GI PNHPSFND  MPPPPAKWKGKCEF   ACNNKLIGARN V         P+D +GHG
Sbjct  62    GINPNHPSFNDHGMPPPPAKWKGKCEFNYKACNNKLIGARNLVK----TAESPLDGDGHG  117

Query  1819  THTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaidd  1640
             THT+ST AGNFVG A + G+A GTAVG+AP AH+++Y+VC +DGC E  ILA  DAAI+D
Sbjct  118   THTSSTGAGNFVGGANLLGNANGTAVGIAPRAHVAMYRVCDKDGCPEVFILAGFDAAIED  177

Query  1639  gvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVG  1460
             GVDV+S S+G  +   + +++AIGA+ A+EKGIFV+C+AGN GP   T+ N +PW+LTVG
Sbjct  178   GVDVISASVGATALPPYAETMAIGAYRAIEKGIFVTCSAGNSGPFSSTVENGSPWILTVG  237

Query  1459  ASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvd  1280
             AS+ DR I A AVLGNG++ +GESAFQ  N    LLPLI       D   C   SL  +D
Sbjct  238   ASSTDRKISAVAVLGNGSEYEGESAFQSTNMSRKLLPLI-------DGGDCE--SLAIID  288

Query  1279  vkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDG  1100
             V+GK+VLC   G ++ ++KG+ VK AGGAAMIL N++  GYT  A  HVLPAT +SY DG
Sbjct  289   VRGKIVLCAAVGSLSGIEKGEEVKKAGGAAMILKNEEEQGYTTFATIHVLPATHVSYLDG  348

Query  1099  LKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNIL  920
             LK+ +YI STS P ATI FKGT IG K AP VASFSSRGP   S GILKPDI+GPGVNIL
Sbjct  349   LKIINYITSTSTPVATISFKGTRIGDKHAPVVASFSSRGPYTVSQGILKPDIIGPGVNIL  408

Query  919   AAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQ  740
             AAW         +  +TFNIISGTSM+ PHL+G+A LLKSAHPDWSPAAIKSAI+TTAD 
Sbjct  409   AAWIKPPAGVIPSATSTFNIISGTSMSCPHLAGVAALLKSAHPDWSPAAIKSAIMTTADL  468

Query  739   YNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQ  560
              NL    I DE+L PAD+ + G GHVNPS+A+DPGL+YD+Q  DY+PYLCGLNYTDQ++ 
Sbjct  469   VNLGNNPIQDEKLNPADLLSIGSGHVNPSKANDPGLVYDIQPQDYVPYLCGLNYTDQQVS  528

Query  559   QIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGV  380
              IV +KV C+   SI EA+LNYPSF+I LG ++ TY+RTVTNVGEANS YTV+V    GV
Sbjct  529   SIVNKKVHCT--LSIAEAELNYPSFSIDLGSSAQTYTRTVTNVGEANSTYTVEVIGVEGV  586

Query  379   DVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAI  215
              + + P  L F+ +NQ+L+Y ++F  S++    D  QG I W S ++ V+SPI+I
Sbjct  587   ALSIKPSILKFSALNQKLSYEVTFKRSTS---TDSSQGYIKWSSAKYSVRSPISI  638



>gb|EYU29361.1| hypothetical protein MIMGU_mgv1a026567mg [Erythranthe guttata]
Length=725

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/737 (55%), Positives = 522/737 (71%), Gaps = 21/737 (3%)
 Frame = -1

Query  2407  YISVVVCLTLVFHSVASAKYEDTYIVHVSPPAAAINGVSEDYRSYFRSFVSESGDEG--E  2234
             +   ++C+ L  +    A+  D YIVHV P  A  + +   Y S+  +  +   D    +
Sbjct  5     FFLALICI-LNLNQFLKAENLDVYIVHVDP--AQSDNLETFYDSFLPTNTNLEADSAVID  61

Query  2233  RSRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFG  2054
             + RI+H YR+V SGFAAKLS   V  MR+KKGF+SAR +R+  L+TTHSP+FLGL QN G
Sbjct  62    QPRILHRYRNVFSGFAAKLSAAEVEAMRQKKGFVSARPERMLPLHTTHSPSFLGLSQNTG  121

Query  2053  FWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFE-GTACNNKLIGARN  1877
              W NS+YGKGVI+GVLDTGITP HPSF+DE MPPPPA+WKGKC+     +CNNKLIGAR 
Sbjct  122   LWENSNYGKGVIIGVLDTGITPEHPSFSDEGMPPPPARWKGKCQLRVRGSCNNKLIGARY  181

Query  1876  FVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCT  1697
             +  +       P+D +GHGTHTA TAAGNFVG AA+FG+A GTA G+AP AH++IY+ C 
Sbjct  182   YFGK------SPIDVDGHGTHTAGTAAGNFVGGAALFGNANGTAAGIAPHAHVAIYQACQ  235

Query  1696  EDGCAESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGN  1517
              +GC ES I AAMDAAIDDGVDVLS+SLGGG A +  D IAIGA+ AM++GI VSC+AGN
Sbjct  236   PEGCPESAIAAAMDAAIDDGVDVLSMSLGGGFAPYPNDVIAIGAYRAMQRGIVVSCSAGN  295

Query  1516  EGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYP  1337
             EGPD  TL+N+APW++TVGAST DR I  TA LGNG ++ GE+A    +       L++P
Sbjct  296   EGPDSETLTNQAPWIMTVGASTTDRKILVTASLGNGEKIHGETAKGFHSIKKK--KLVHP  353

Query  1336  GSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGY  1157
              S       C        DV+GK+V+CD GG  +R +K + VK AGGAA+IL+N ++ G 
Sbjct  354   RSNLTGTTYCDT-DFGIDDVRGKIVMCDGGGAKSRTEKAEAVKSAGGAAIILVNDELAGD  412

Query  1156  TILADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPS  977
             T +   + LPA ++ Y DGLK++ Y+NSTS P ATI FKGT +G   AP VA FSSRGP+
Sbjct  413   TTMVGVYPLPAIQIGYTDGLKIQAYLNSTSKPKATIAFKGTVLGDNRAPVVAPFSSRGPN  472

Query  976   NASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSA  797
              ASPGILKPDI+GPG NILAAWP     N+   N TF +ISGTSM+ PHLSG+A LLKSA
Sbjct  473   IASPGILKPDIIGPGFNILAAWP-----NSIFPNTTFYMISGTSMSCPHLSGVAALLKSA  527

Query  796   HPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQ  617
             HPDWSPA IKSAI+TTAD  N  G  I ++++ PA++FA G GHVNP++A+DPGL+YD+ 
Sbjct  528   HPDWSPAVIKSAIMTTADFTNRAGNPIENDKMQPAELFAIGSGHVNPTQANDPGLVYDIS  587

Query  616   SDDYIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVT  437
              DDYIPYLCG+N+TD+E+  +VQR V+CS V SI ++QLNYPSF+I LG T  +Y+RTVT
Sbjct  588   PDDYIPYLCGMNFTDKEVSVVVQRNVDCSDVNSIIDSQLNYPSFSIILGSTPQSYTRTVT  647

Query  436   NVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTP-VDIDFVQGAI  260
             NVG+AN+ + V++    GV V V P+ L F E+ Q+L+YN++F+ S+         +G I
Sbjct  648   NVGKANASFDVEIVSPDGVIVRVEPERLWFWELGQKLSYNVTFTRSAADGATKKNGEGFI  707

Query  259   AWVSQRHIVKSPIAIIF  209
              W S  H V+SPI+++F
Sbjct  708   KWNSADHSVRSPISVVF  724



>gb|KCW81559.1| hypothetical protein EUGRSUZ_C02917, partial [Eucalyptus grandis]
Length=706

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/705 (56%), Positives = 511/705 (72%), Gaps = 9/705 (1%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYIVHV+PP        +D  S++ SF+ ++S       R+++SY++V +GFAA+L+P+ 
Sbjct  6     TYIVHVTPPDGQRLSELKDLESWYYSFLPTDSTTSRNERRLLYSYQNVMTGFAARLTPDE  65

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             V+ M+ K GF++A  +++Y+L TTHSP FLGL  N G   +S+ GKG+I+G++DTG+TP+
Sbjct  66    VATMQDKPGFVAAHPEQIYSLQTTHSPQFLGLPLNQGSSNSSTMGKGIIIGIMDTGVTPD  125

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppP-VDEEGHGTHTA  1808
             H SF+ + MPPPPAKWKG+C+F+ + CNNKLIGA+ F S        P +D++GHGTHTA
Sbjct  126   HTSFSGDGMPPPPAKWKGRCDFKPSQCNNKLIGAKTFDSSAKKNVTMPPIDDDGHGTHTA  185

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdv  1628
             STAAG  V  A     A+GTAVGMAP AHL+IYKVC+ D C   DILA +DAA+ DGVDV
Sbjct  186   STAAGASVQQANTLRMAEGTAVGMAPYAHLAIYKVCSTD-CFLGDILAGLDAALADGVDV  244

Query  1627  lslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTI  1448
             +S+SLGGGSA F+ D IA+  FAA+++G+FVSC+AGN GP   +LSNEAPW+LTVGASTI
Sbjct  245   ISISLGGGSAPFYMDGIAVATFAAVQRGVFVSCSAGNSGPFSESLSNEAPWILTVGASTI  304

Query  1447  DRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG-SKDEDAALCGPGSLdkvdvkg  1271
             DR I +   LGNG + +GE+ +Q  +FP TLLPL+YPG    E +  C PG L    V+G
Sbjct  305   DRNIVSNVKLGNGEEYEGETIYQ-PSFPSTLLPLVYPGIDGTEGSIYCVPGQLKSSQVEG  363

Query  1270  kvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKV  1091
             K+VLC+RG  + R  +   VK AGGA MI++NQ+IDG++ LAD +VLPA+ +SY  G K+
Sbjct  364   KIVLCERGF-VGRYFQAIEVKRAGGAGMIMMNQEIDGFSTLADAYVLPASHVSYFAGNKI  422

Query  1090  KDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAW  911
             K YIN+T  PTATI+FKGT  G  TAP++ SFSSRGPS  SPGILKPDI+GPGVNILAAW
Sbjct  423   KAYINATRTPTATIMFKGTVFGNPTAPALTSFSSRGPSLISPGILKPDIIGPGVNILAAW  482

Query  910   PVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNL  731
             P     +       FNIISGTSM+ PHLSGIA L+K  HPDWSPAAIKSAI+TTA Q N+
Sbjct  483   PFPIRNDTKAKYY-FNIISGTSMSCPHLSGIAALIKGIHPDWSPAAIKSAIMTTAKQLNV  541

Query  730   NGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIV  551
                 ILDERL PADVFA G GHV+P +A DPG IYD+  DDYIPYLCGL YTD+++  IV
Sbjct  542   KQNPILDERLQPADVFAIGAGHVDPEKAIDPGFIYDMHPDDYIPYLCGLGYTDKQVATIV  601

Query  550   QRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVG  371
              + V+CS V+SIPE +LNYPSF++ LG    T++RTVTNVG   S Y V V P  GV V 
Sbjct  602   HKPVKCSGVSSIPEGELNYPSFSVNLGPPQ-TFTRTVTNVGTDYSPYVVTVVPPQGVHVT  660

Query  370   VTPDTLVFTEVNQQLTYNISFSPSSTPVDI-DFVQGAIAWVSQRH  239
             V P+ L F+++NQ+ TY+I+ S +++  D+  F QG + W S+++
Sbjct  661   VKPNKLTFSKLNQKATYSITLSRANSTQDVAKFTQGFLRWDSKKY  705



>ref|XP_010051225.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=761

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/716 (55%), Positives = 514/716 (72%), Gaps = 8/716 (1%)
 Frame = -1

Query  2344  DTYIVHVSPPAAAINGVSEDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPE  2168
              TYIVHV+PP        +D  S++ SF+ ++S       R+++SY++V +GFAA+L+P+
Sbjct  49    QTYIVHVTPPDGQRLSELKDLESWYYSFLPTDSTTSRNERRLLYSYQNVMTGFAARLTPD  108

Query  2167  MVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITP  1988
              V+ M+ K GF++A  +++Y+L TTHSP FLGL  + G   +S+ GKG+I+G++DTG+TP
Sbjct  109   EVATMQDKPGFVAAHPEQIYSLQTTHSPQFLGLPLSQGSSNSSTMGKGIIIGIMDTGVTP  168

Query  1987  NHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppP-VDEEGHGTHT  1811
             +HPSF+ + MPPPPAKWKG+C+F+ + CNNKLIGA+ F S        P  D+ GHGTHT
Sbjct  169   DHPSFSGDGMPPPPAKWKGRCDFKPSQCNNKLIGAKTFDSSAKKNVTMPPTDDVGHGTHT  228

Query  1810  ASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvd  1631
             ASTAAG  V  A     A+GTA GMAP AHL+IYKVC    C   DILA +DAA+ DGVD
Sbjct  229   ASTAAGASVQQANTLRMAEGTAGGMAPYAHLAIYKVCFTTSCFLGDILAGLDAALADGVD  288

Query  1630  vlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGAST  1451
             V+S+S+GGGSA F+ D IA+  FAA+++GIFVSC+AGN GP   +LSNEAPW+LTVGAST
Sbjct  289   VISISIGGGSAPFYMDGIAVATFAAVQRGIFVSCSAGNSGPFSESLSNEAPWILTVGAST  348

Query  1450  IDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG-SKDEDAALCGPGSLdkvdvk  1274
             IDR I + A LGNG + +GE+ +Q  +FP TLLPL+YPG    E +  C PG L    V+
Sbjct  349   IDRNIVSNAKLGNGEEYEGETIYQ-PSFPSTLLPLVYPGIDGTEGSVYCVPGQLKSSQVE  407

Query  1273  gkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLK  1094
             GK+VLC+RG  + R  +   VK AGGA MI++NQ+IDG++ LAD + LPA+ +SY  G K
Sbjct  408   GKIVLCERGF-VGRYFQAIEVKRAGGAGMIMMNQEIDGFSTLADAYDLPASHVSYFAGNK  466

Query  1093  VKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAA  914
             +K YIN+T  PTATI+FKGT  G  TAP++ SFSSRGPS  SPGILKPDI+GPGVNILAA
Sbjct  467   IKAYINATRTPTATIMFKGTVFGNPTAPALTSFSSRGPSLISPGILKPDIIGPGVNILAA  526

Query  913   WPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYN  734
             WP     +       FNIISGTSM+ PHLSGIA L+K  HPDWSPA IKSAI+TTA Q N
Sbjct  527   WPFPIRNDTKAKYY-FNIISGTSMSCPHLSGIAALIKGIHPDWSPATIKSAIMTTAKQLN  585

Query  733   LNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQI  554
             +    ILDERL PADVFA G GHV+P++A DPG IYD+  +DYIPYLCGL YTD+++  I
Sbjct  586   VKQNPILDERLQPADVFAIGAGHVDPAKAIDPGFIYDMHPNDYIPYLCGLGYTDKQVATI  645

Query  553   VQRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDV  374
               + V+CS V+SIPE +LNYPSF++ LG    T++RTVTNVG   S Y V V P  GV V
Sbjct  646   AHKPVKCSGVSSIPEGELNYPSFSVNLGPPQ-TFTRTVTNVGTDYSPYVVTVVPPQGVHV  704

Query  373   GVTPDTLVFTEVNQQLTYNISFSPSSTPVDI-DFVQGAIAWVSQRHIVKSPIAIIF  209
              V P+ L F+++NQ+ TY+I+ S +++  D+  F QG + W S+++ V+SPI++ F
Sbjct  705   TVKPNKLNFSKLNQKATYSITLSRANSTQDVAKFTQGFLRWDSKKYSVRSPISVKF  760



>ref|XP_008811118.1| PREDICTED: subtilisin-like protease SDD1 [Phoenix dactylifera]
Length=732

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/733 (55%), Positives = 517/733 (71%), Gaps = 21/733 (3%)
 Frame = -1

Query  2353  KYEDTYIVHVSPPAAAINGVSEDYRSYFRSFV---SESGDEGERSRIVHSYRHVASGFAA  2183
             K   TYIVHV PP + +     D +S++RSF+   S SGD+G  SR+++SY ++ASGFAA
Sbjct  4     KNLQTYIVHVHPPESTVFASDGDRKSWYRSFLPTTSASGDDG--SRMIYSYENLASGFAA  61

Query  2182  KLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLD  2003
             +L+ E V +M KK GFISA   R+  L TT +P+FLGL      W   ++G+GV++GVLD
Sbjct  62    RLTKEEVKDMEKKDGFISANPDRLLQLLTTRTPSFLGLQPQPKAWVRKNHGEGVVIGVLD  121

Query  2002  TGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVS-----EGssppppP-  1841
             TG+ P+HPSF+ E M PPPAKWKG+CEF+ + CNNKLIGAR F+S     EG+   P   
Sbjct  122   TGVVPSHPSFSGEGMAPPPAKWKGRCEFQASECNNKLIGARAFLSGAMAMEGAGAVPMSP  181

Query  1840  VDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaa  1661
             +D+ GHGTH A TAAG  V NA+V G A GTAVGMAP AHL+IYKVCT  GCA SD+LA 
Sbjct  182   LDDNGHGTHIAGTAAGAAVKNASVLGQAGGTAVGMAPKAHLAIYKVCTGKGCAVSDVLAG  241

Query  1660  mdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEA  1481
              D A+ DGVDV+S+SLG     FF+D +A+G F AMEKG+FVSCAAGN+GP   TLSN+A
Sbjct  242   YDTAVADGVDVISISLGHHGVPFFQDEVAVGTFRAMEKGVFVSCAAGNDGPGSSTLSNDA  301

Query  1480  PWLLTVGASTIDRTIKATAVLGNG-AQLDGESAFQVENFPPTLLPLI-YPGSKDEDAALC  1307
             PW+LTVGASTIDR I+AT  LGNG A + GES +Q ++FP T LPL+      +  AA C
Sbjct  302   PWMLTVGASTIDRNIRATVKLGNGTAPIVGESLYQPKDFPSTPLPLVDAGAGGESGAAFC  361

Query  1306  GPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLP  1127
             G GSL+ +DVKGKVVLC+RG GI +V KG+ VK AGGAAMIL+N     ++ L + HVLP
Sbjct  362   GNGSLNGLDVKGKVVLCERGAGIIQVAKGEVVKAAGGAAMILMNDKPSEFSTLVEAHVLP  421

Query  1126  ATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPD  947
             A+ ++Y DGLK++ YI S+S PTATI+F+GT +GT  AP++ASFSSRGPS  S GILKPD
Sbjct  422   ASHVTYADGLKIRAYIASSSKPTATILFQGTIVGTSPAPAMASFSSRGPSTVSRGILKPD  481

Query  946   ILGPGVNILAAWP--VgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAA  773
             I GPGV+I+AAW   +G  +  G+    FN+ SGTSM+TPHLSGI  L+K  HPDWSPAA
Sbjct  482   ITGPGVSIIAAWASAIGPPSAAGSTGPFFNVKSGTSMSTPHLSGIVALIKRKHPDWSPAA  541

Query  772   IKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYL  593
             IKSAI+TTA  ++ +  +I+DE L+PAD FA G GHVNP RA DPGL+YDL ++DYI YL
Sbjct  542   IKSAIMTTASVFSQSRKRIVDETLLPADFFAMGAGHVNPVRAVDPGLVYDLHANDYISYL  601

Query  592   CGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWLGKT--SLTYSRTVTNVG-EA  422
             CGLNYT +++  +V R  +CS+  SI    LNYPS ++ LG    ++T  RTV NVG  A
Sbjct  602   CGLNYTSKQVGLVVGRPTDCSKAGSIAGKDLNYPSISVSLGTKGGNVTVKRTVRNVGLAA  661

Query  421   NSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQR  242
             NS+Y  KV     V V V P  L F  +NQ+L++ ++   SS P +    +G ++WV   
Sbjct  662   NSVYRAKVEVPKHVSVCVEPKMLAFHRLNQELSFTVTI--SSGPQESGVAEGQLSWVGGG  719

Query  241   H-IVKSPIAIIFQ  206
             H +V+SPI+I  +
Sbjct  720   HYVVRSPISITHE  732



>ref|XP_010942947.1| PREDICTED: subtilisin-like protease SDD1 [Elaeis guineensis]
Length=761

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/736 (55%), Positives = 510/736 (69%), Gaps = 29/736 (4%)
 Frame = -1

Query  2359  SAKYEDTYIVHVSPPAAAIN-----GVSEDYRSYFRSFVSESGDEGERSRIVHSYRHVAS  2195
             S +   TYIVHV P  A+ +      + E Y+S+  S +  SG+   +SR+++SY  V S
Sbjct  31    SFEKHKTYIVHVHPKLASSSPEKPRELEEWYKSFLPSAMLSSGEF--KSRLIYSYSSVIS  88

Query  2194  GFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNF--GFWRNSSYGKGV  2021
             GFAA+L+ E +++++KK GF+ A   R+  L TTH+P FLGL  N+  GFW++S++GKGV
Sbjct  89    GFAARLTDEELADVKKKAGFVHAYPDRLVRLQTTHTPQFLGLQHNYTTGFWKDSNFGKGV  148

Query  2020  IVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVS--------E  1865
             IVGVLDTG+ P+HPSF+DE MPPPP KWKG CEF  ++CNNKLIGA+ F           
Sbjct  149   IVGVLDTGVLPSHPSFDDEGMPPPPEKWKGSCEFTASSCNNKLIGAKRFAKGASAMHGFY  208

Query  1864  GssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGC  1685
             G      P D++GHGTHTA+TAAG FV NA V G A GTAVGMAP AHL++YKVC  +GC
Sbjct  209   GGMKQDEPFDDDGHGTHTAATAAGMFVDNADVLGQAAGTAVGMAPYAHLAVYKVCNSEGC  268

Query  1684  AESdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPD  1505
               SDILA +D+A++DGVDVLSLS+ GGS  F++D IAIG+F A+E GIFVSCAAGN GP 
Sbjct  269   TTSDILAGLDSAVEDGVDVLSLSISGGSYPFYDDGIAIGSFRAIENGIFVSCAAGNSGPF  328

Query  1504  YYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG-SK  1328
               TLSNEAPW+LTVGA T+DR+I++   LGNG Q  GE+ +Q  N    L PL+YPG   
Sbjct  329   ASTLSNEAPWILTVGAGTMDRSIRSVVELGNGDQFVGEALYQSNNVIANL-PLVYPGFLA  387

Query  1327  DEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTIL  1148
                AA C   SL  VDVKGKVVLCD G  I RV KG+ VK AGGAAMIL N +  G+T L
Sbjct  388   GSQAATCKNESLASVDVKGKVVLCDTGE-ITRVAKGENVKSAGGAAMILANSEAAGFTTL  446

Query  1147  ADTHVLPATELSYNDGLKVKDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNAS  968
             +D HVLPA+ +SY DGLK+K YI S S PT +I F+GT +GT  AP V  FSSRGP+ A 
Sbjct  447   SDIHVLPASHVSYADGLKIKSYIKSASNPTTSIAFEGTVLGTSPAPMVGYFSSRGPNQAD  506

Query  967   PGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPD  788
             P ILKPDI+GPGVN+LAAWP    T+     A+FNIISGTSMATPHLSGIA LLKSAHPD
Sbjct  507   PNILKPDIIGPGVNVLAAWPFPVGTSGAA--ASFNIISGTSMATPHLSGIAALLKSAHPD  564

Query  787   WSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDD  608
             WSPAAIKSAI+TTAD+   +G  I D+ +  AD +A G GHVNP++A++PGL+YD+ SDD
Sbjct  565   WSPAAIKSAIMTTADRTANDGKLIRDQSMEVADFYAVGSGHVNPTKANEPGLVYDMDSDD  624

Query  607   YIPYLCGLNYTDQEIQQIVQRKVECSQVTSIPEAQLNYPSFAIWL---GKTSLTYSRTVT  437
             YI YLCGL YTD+E+  IV   +ECS + SI  A+LNYPSF ++L    +  +  +RTVT
Sbjct  625   YIAYLCGLQYTDEEVSIIVGHAIECSGIESISGAELNYPSFVVFLSAENEYKMKVTRTVT  684

Query  436   NVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIA  257
             NVG   S Y V V+P  GV V V P  L F+EVN++  Y ++FS        +  +G + 
Sbjct  685   NVGAPGSEYAVNVTPPSGVLVTVEPKKLSFSEVNEKAQYTVTFSGKGKGEGTE--RGFLT  742

Query  256   WVS--QRHIVKSPIAI  215
             WVS  Q   V  PI +
Sbjct  743   WVSSAQNTSVTGPITV  758



>gb|EYU39028.1| hypothetical protein MIMGU_mgv1a002635mg [Erythranthe guttata]
Length=651

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/660 (61%), Positives = 487/660 (74%), Gaps = 19/660 (3%)
 Frame = -1

Query  2155  MRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPS  1976
             M    GFISA  +R  +++TTHSPNFLGL QN GFW+ S+YGKGVI+GVLD+GI P+HPS
Sbjct  1     MESNPGFISAEPERKLDMHTTHSPNFLGLNQNMGFWQGSNYGKGVIIGVLDSGIFPSHPS  60

Query  1975  FNDENMPPPPAKWKGKCEFEGTACNNKLIGAR--NFVSEGssppppPVDEEGHGTHTAST  1802
             F+DE MPPPPAKWKGKCEF  T CNNK+IGAR  NF          P+D+ GHGTHTAST
Sbjct  61    FSDEGMPPPPAKWKGKCEFNPTVCNNKIIGARYLNFFD------GSPLDDGGHGTHTAST  114

Query  1801  AAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvls  1622
             AAG+FV +A VFG+A GTA G+APLAHL+IYKVC+   C ES+ILAAMDAAI+DGVD+LS
Sbjct  115   AAGSFVASANVFGNANGTASGIAPLAHLAIYKVCSSI-CLESNILAAMDAAIEDGVDILS  173

Query  1621  lslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDR  1442
             LSLGG S  F+ DSIA+GAF+AM+KGI VSC+AGN GP  +++ NEAPW+LTVGASTIDR
Sbjct  174   LSLGGPSRDFYLDSIALGAFSAMKKGILVSCSAGNSGPFNFSMENEAPWILTVGASTIDR  233

Query  1441  TIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGS---KDEDAALCGPGSLdkvdvkg  1271
              I+ATA+LGN   +DGE+ FQ  +FP TL PL+Y GS    D     C   SL+K D++G
Sbjct  234   KIRATALLGNNISVDGETLFQPSDFPSTLFPLVYAGSLNTSDPHIQYCTRASLNKTDLRG  293

Query  1270  kvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKV  1091
              +V+C+ G G   V KG  VK+AGGAAMIL+N  +     L+  HVLP T + Y DGLK+
Sbjct  294   MIVVCEMGLGDG-VSKGVEVKNAGGAAMILVNHWLYANMTLSYAHVLPTTHVGYVDGLKI  352

Query  1090  KDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAW  911
             K YINST+ P A I+FKGT IG   AP VA+FSSRGP+ ASPGILKPDI+GPGVNILAAW
Sbjct  353   KTYINSTTTPMAAILFKGTIIGDDRAPVVAAFSSRGPNIASPGILKPDIIGPGVNILAAW  412

Query  910   PVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNL  731
             PV    N        NIISGTSM+ PHLSG+A LLKSAHPDWSPAAIKSAI+TTAD  NL
Sbjct  413   PVSIENNTNTNATF-NIISGTSMSCPHLSGVAALLKSAHPDWSPAAIKSAIMTTADVVNL  471

Query  730   NGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIV  551
                 I DER VPA +FATG GHVNPSRA+DPGLIYDL+S+DY PYLCGLNYT+ ++  I+
Sbjct  472   AQNPIEDERFVPAALFATGSGHVNPSRANDPGLIYDLKSEDYFPYLCGLNYTNLQVSIIM  531

Query  550   QRKVECSQVTSIPEAQLNYPSFAIWLG---KTSLTYSRTVTNVGEANSMYTVKVSPFLGV  380
             Q+KV+CS    I EAQLNYPSFAI  G     + TY+RTVTNVGE  S Y V++ P  G+
Sbjct  532   QKKVDCSVEARISEAQLNYPSFAITFGPLQPITQTYTRTVTNVGEPVSSYVVEIVPPPGI  591

Query  379   DVGVTPDTLVFTEVNQQLTYNISFSP-SSTPVDIDFVQGAIAWVS-QRHIVKSPIAIIFQ  206
              V V P +L FTE N  L Y ++F+   ST  +  ++QG + W S  ++ V++PIA+I +
Sbjct  592   GVVVEPTSLDFTEANPILQYQVTFTRLGSTTNNAGYIQGYLKWNSGAKYSVRTPIAVILR  651



>gb|KCW81560.1| hypothetical protein EUGRSUZ_C02918, partial [Eucalyptus grandis]
Length=707

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/705 (55%), Positives = 506/705 (72%), Gaps = 8/705 (1%)
 Frame = -1

Query  2341  TYIVHVSPPAAAINGVSEDYRSYFRSFV-SESGDEGERSRIVHSYRHVASGFAAKLSPEM  2165
             TYIVHV+PP        +D  S++ SF+ ++S       R+++SY++V +GFAA+L+P+ 
Sbjct  6     TYIVHVTPPDGQRLSELKDLESWYYSFLPTDSTTSRNERRLLYSYQNVMTGFAARLTPDE  65

Query  2164  VSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPN  1985
             V+ M+ K GF++A  +++Y+L TTHSP FLGL  + G   +S+ GKG+I+G++DTG+TP+
Sbjct  66    VATMQDKPGFVAAHPEQIYSLQTTHSPQFLGLPLSQGSSNSSTMGKGIIIGIMDTGVTPD  125

Query  1984  HPSFNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppP-VDEEGHGTHTA  1808
             HPSF+ + MPPPPAKWKG+C+F+ + CNNKLIGA+ F S        P  D+ GHGTHTA
Sbjct  126   HPSFSGDGMPPPPAKWKGRCDFKPSQCNNKLIGAKTFDSSAKKNVTMPPTDDVGHGTHTA  185

Query  1807  STAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdv  1628
             STAAG  V  A     A+GTA GMAP AHL+IYKVC    C   DILA +DAA+ DGVDV
Sbjct  186   STAAGASVQQANTLRMAEGTAGGMAPYAHLAIYKVCFTTSCFLGDILAGLDAALADGVDV  245

Query  1627  lslslgggSASFFEDSIAIGAFAAMEKGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTI  1448
             +S+S+GGGSA F+ D IA+  FAA+++GIFVSC+AGN GP   +LSNEAPW+LTVGASTI
Sbjct  246   ISISIGGGSAPFYMDGIAVATFAAVQRGIFVSCSAGNSGPFSESLSNEAPWILTVGASTI  305

Query  1447  DRTIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPG-SKDEDAALCGPGSLdkvdvkg  1271
             DR I + A LGNG + +GE+ +Q  +FP TLLPL+YPG    E +  C PG L    V+G
Sbjct  306   DRNIVSNAKLGNGEEYEGETIYQ-PSFPSTLLPLVYPGIDGTEGSVYCVPGQLKSSQVEG  364

Query  1270  kvVLCDRGGGIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKV  1091
             K+VLC+RG  + R  +   VK AGGA MI++NQ+IDG++ LAD + LPA+ +SY  G K+
Sbjct  365   KIVLCERGF-VGRYFQAIEVKRAGGAGMIMMNQEIDGFSTLADAYDLPASHVSYFAGNKI  423

Query  1090  KDYINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAW  911
             K YIN+T  PTATI+FKGT  G  TAP++ SFSSRGPS  SPGILKPDI+GPGVNILAAW
Sbjct  424   KAYINATRTPTATIMFKGTVFGNPTAPALTSFSSRGPSLISPGILKPDIIGPGVNILAAW  483

Query  910   PVgnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNL  731
             P     +       FNIISGTSM+ PHLSGIA L+K  HPDWSPA IKSAI+TTA Q N+
Sbjct  484   PFPIRNDTKAKYY-FNIISGTSMSCPHLSGIAALIKGIHPDWSPATIKSAIMTTAKQLNV  542

Query  730   NGTKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIV  551
                 ILDERL PADVFA G GHV+P++A DPG IYD+  +DYIPYLCGL YTD+++  I 
Sbjct  543   KQNPILDERLQPADVFAIGAGHVDPAKAIDPGFIYDMHPNDYIPYLCGLGYTDKQVATIA  602

Query  550   QRKVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVG  371
              + V+CS V+SIPE +LNYPSF++ LG    T++RTVTNVG   S Y V V P  GV V 
Sbjct  603   HKPVKCSGVSSIPEGELNYPSFSVNLGPPQ-TFTRTVTNVGTDYSPYVVTVVPPQGVHVT  661

Query  370   VTPDTLVFTEVNQQLTYNISFSPSSTPVDI-DFVQGAIAWVSQRH  239
             V P+ L F+++NQ+ TY+I+ S +++  D+  F QG + W S+++
Sbjct  662   VKPNKLNFSKLNQKATYSITLSRANSTQDVAKFTQGFLRWDSKKY  706



>ref|XP_009775744.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=633

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/650 (59%), Positives = 471/650 (72%), Gaps = 25/650 (4%)
 Frame = -1

Query  2155  MRKKKGFISARRQRVYNLYTTHSPNFLGLYQNFGFWRNSSYGKGVIVGVLDTGITPNHPS  1976
             M KK GF+SARRQ+V  L+TTHSP+FLGL+QN G W  S+ GKGVI+GV+DTGITP HPS
Sbjct  1     MEKKPGFVSARRQQVLQLHTTHSPDFLGLHQNVGLWNASNSGKGVIIGVIDTGITPQHPS  60

Query  1975  FNDENMPPPPAKWKGKCEFEGTACNNKLIGARNFVSEGssppppPVDEEGHGTHTASTAA  1796
             FND  MPPPPAKWKGKCEF  T CNNKLIGARN     +SP     D++GHGTHT+STAA
Sbjct  61    FNDNGMPPPPAKWKGKCEFNLTVCNNKLIGARNLAQNATSPE----DDDGHGTHTSSTAA  116

Query  1795  GNFVGNAAVFGSAKGTAVGMAPLAHLSIYKVCTEDGCAESdilaamdaaiddgvdvlsls  1616
             GNFV  A + G A GTA G+AP AH+ +Y+VC    C ESDILA +DAAI+DGVDV+S+S
Sbjct  117   GNFVEGANLLGKANGTAAGIAPRAHVVMYRVCASK-CQESDILAGLDAAIEDGVDVISIS  175

Query  1615  lgggSA-SFFEDSIAIGAFAAMEKGIFVSCAAGNEGP-DYYTLSNEAPWLLTVGASTIDR  1442
             LG  ++ S ++D +AIG+++A+EKGIFVS +AGN GP D   ++N APWLLTVGAST DR
Sbjct  176   LGSLASMSLYDDVVAIGSYSAIEKGIFVSASAGNTGPVDDSXVTNAAPWLLTVGASTTDR  235

Query  1441  TIKATAVLGNGAQLDGESAFQVENFPPTLLPLIYPGSKDEDAALCGPGSLdkvdvkgkvV  1262
              I A AVLGNGA+ +GES +Q  NF   LLPL+ P   +  + +   G +          
Sbjct  236   KISAVAVLGNGAEYEGESVYQPSNFSQKLLPLVNPEYCEFLSTIDVKGKIV---------  286

Query  1261  LCDRGG-GIARVDKGQTVKDAGGAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKD  1085
             LC+R   G   V  GQ VKDAGGAAMIL+N +  GYT +AD HVLPAT +SY DG K+ +
Sbjct  287   LCERSNTGYPAVQYGQNVKDAGGAAMILMNNEWRGYTTIADVHVLPATHISYADGQKILN  346

Query  1084  YINSTSWPTATIVFKGTFIGTKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPV  905
             Y+ ST+ P ATI FKGT IG K AP+VA FSSRGP   S GI+KPDI+GPGVNILAAW  
Sbjct  347   YMKSTTAPVATISFKGTRIGDKHAPAVADFSSRGP--FSIGIVKPDIIGPGVNILAAWRT  404

Query  904   gnntnngngNATFNIISGTSMATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNG  725
                       +TFNI+SGTSMA PHL+G+A LLKSAHPDWSPAAIKSAI+TTAD  NL  
Sbjct  405   SVGEITSAT-STFNILSGTSMACPHLAGVAALLKSAHPDWSPAAIKSAIMTTADFVNLGN  463

Query  724   TKILDERLVPADVFATGGGHVNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQR  545
               I DER   A++ ATG GHV+PSRA+DPGLIYD+Q +DY+PYLCGLNYTDQ++  IV+R
Sbjct  464   DPIQDERFKTANLLATGSGHVDPSRANDPGLIYDIQPEDYVPYLCGLNYTDQQVSAIVKR  523

Query  544   KVECSQVTSIPEAQLNYPSFAIWLGKTSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVT  365
             K+ C+  +SIPE++LNYPSF+I L   + TY+RTVTNVGEANS YTVKV    GV+V V 
Sbjct  524   KIHCT--SSIPESELNYPSFSIPLKSGAQTYTRTVTNVGEANSTYTVKVFGLDGVEVTVN  581

Query  364   PDTLVFTEVNQQLTYNISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAI  215
             P  L F+ +NQ+ +YN++  PS    D    QG I W S R+ V+SPI I
Sbjct  582   PTILKFSALNQKASYNVTVKPSPLIAD---SQGYITWSSDRYSVRSPIGI  628



>gb|EYU37178.1| hypothetical protein MIMGU_mgv1a001832mg [Erythranthe guttata]
Length=753

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/754 (53%), Positives = 509/754 (68%), Gaps = 45/754 (6%)
 Frame = -1

Query  2386  LTLVFHSVASAKYE-DTYIVHVSPPAAAINGVS--EDYRSYFRSFVSESGDEGER-----  2231
                 FHS +S+     TYIVHV  P    +G S   +  +++ SF+  S +         
Sbjct  11    FIFTFHSASSSNTSYQTYIVHVDLPPTEEDGFSGQSNLETWYHSFLPPSSEAATSDSDNH  70

Query  2230  ----SRIVHSYRHVASGFAAKLSPEMVSEMRKKKGFISARRQRVYNLYTTHSPNFLGLYQ  2063
                 SRIVH YR+V +GFAAKLSPE V EM KK GF+ AR  + Y L+TTHSPNFLGL+Q
Sbjct  71    YTPSSRIVHMYRNVITGFAAKLSPEEVKEMEKKPGFMHARPHKKYQLHTTHSPNFLGLHQ  130

Query  2062  NFGFWRNSSYGKGVIVGVLDTGITPNHPSFNDENMPPPPAKWKGKCEFEGT-ACNNKLIG  1886
               G W  S+YG GVI+GV+DTGITP HPSFND+ MPPPP KWKGKCE  GT +CNNKLIG
Sbjct  131   GVGAWPASNYGNGVIIGVIDTGITPGHPSFNDQGMPPPPPKWKGKCELSGTLSCNNKLIG  190

Query  1885  ARNFVSEGssppppPVDEEGHGTHTASTAAGNFVGNAAVFGSAKGTAVGMAPLAHLSIYK  1706
             ARNF S     P PP+D  GHGTHTASTAAGNFV  A VFG A GTA G+APLAHL+IYK
Sbjct  191   ARNFAS---YFPGPPIDNFGHGTHTASTAAGNFVSGANVFGQANGTASGIAPLAHLAIYK  247

Query  1705  VCTEDGCAE--------SdilaamdaaiddgvdvlslslgggSASFFEDSIAIGAFAAME  1550
             V + +   +        + + AA++  +D     L+      ++ F ED +AIGAF+A++
Sbjct  248   VGSHENGTDVLFDSDLLAGMDAAIEDGVDVLSLSLAGDSVSHTSPFHEDVVAIGAFSAVK  307

Query  1549  KGIFVSCAAGNEGPDYYTLSNEAPWLLTVGASTIDRTIKATAVLGNGAQLDGESAFQVE-  1373
             +GIFV+C+AGN+GP + +L N APW+LTVGAST DR IKATA+LGNG   +GES +Q E 
Sbjct  308   RGIFVTCSAGNDGPSHSSLYNTAPWILTVGASTTDRKIKATALLGNGEAYEGESFYQPEE  367

Query  1372  --NFPPTLLPLIYPGSKDEDAALCGPGSLdkvdvkgkvVLCDRGGGIARVDKGQTVKDAG  1199
               +    LLPL+Y        ALCG   L ++ VKGKVVLC+    I   + GQ VKDAG
Sbjct  368   GGSSSEELLPLVY-------GALCGSELLGEIGVKGKVVLCE----IGTFNNGQDVKDAG  416

Query  1198  GAAMILLNQDIDGYTILADTHVLPATELSYNDGLKVKDYIN--STSWPTATIVFKGTFIG  1025
             GAAMI +N + D Y      HVLPAT ++Y   LK+K YI   ++S PT+ I+F GT IG
Sbjct  417   GAAMIGINDETDDYYTEPIPHVLPATLVNYEAALKIKAYIEDANSSTPTSAILFGGTVIG  476

Query  1024  TKTAPSVASFSSRGPSNASPGILKPDILGPGVNILAAWPVgnntnngngNATFNIISGTS  845
              KTAP V  FSSRGP+  SPGI+KPDI+GPG NILAAWPV  + N     AT+N++SGTS
Sbjct  477   DKTAPMVTPFSSRGPNLVSPGIIKPDIIGPGANILAAWPVSIDNNIKEKTATYNMVSGTS  536

Query  844   MATPHLSGIATLLKSAHPDWSPAAIKSAIITTADQYNLNGTKILDERLVPADVFATGGGH  665
             M+ PHLSG+A L+KSAHPDWSPA +KSAI+T++ Q NL    ILD+R  PADVFA G GH
Sbjct  537   MSCPHLSGVAALVKSAHPDWSPAMVKSAIMTSSTQTNLGNIPILDQRHQPADVFAVGAGH  596

Query  664   VNPSRASDPGLIYDLQSDDYIPYLCGLNYTDQEIQQIVQRKVEC---SQVTSIPEAQLNY  494
             VNP  A +PGL+YD+ + DYI YLC L YT++++  IV RK++C   S+ + +PEAQLNY
Sbjct  597   VNPPAALNPGLVYDISARDYISYLCFL-YTERQVAAIVNRKIDCSSKSEYSGVPEAQLNY  655

Query  493   PSFAIWLGK-TSLTYSRTVTNVGEANSMYTVKVSPFLGVDVGVTPDTLVFTEVNQQLTYN  317
             PSF++ LG+     YSRTVTNVGEA S Y  K+  F GV + V P  L FTEV QQLTY 
Sbjct  656   PSFSVVLGQDIGYAYSRTVTNVGEAESTYYAKIECFPGVSIFVEPTVLSFTEVKQQLTYE  715

Query  316   ISFSPSSTPVDIDFVQGAIAWVSQRHIVKSPIAI  215
             + FS +    +  +VQG+I+WVS +H+V+ P+++
Sbjct  716   VYFSRTEFTTNGSYVQGSISWVSTKHVVRIPVSV  749



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8539532906259