BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15848_g1_i2 len=1540 path=[3521:0-22 @47@!:23-1333 3501:1334-1353
3078:1354-1539]

Length=1540
                                                                      Score     E

ref|XP_010242235.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    276   2e-82   
ref|XP_010242234.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    276   1e-81   
ref|XP_006473473.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    272   4e-81   
ref|NP_192176.1|  indeterminate-domain 12 protein                       269   1e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008220893.1|  PREDICTED: zinc finger protein NUTCRACKER-like     271   3e-80   
ref|XP_007201015.1|  hypothetical protein PRUPE_ppa005468mg             268   9e-80   
ref|XP_010245572.1|  PREDICTED: zinc finger protein MAGPIE-like         268   9e-80   
ref|XP_004291889.1|  PREDICTED: zinc finger protein MAGPIE-like         269   1e-79   
ref|XP_009612371.1|  PREDICTED: zinc finger protein JACKDAW-like        269   1e-79   
ref|XP_009805010.1|  PREDICTED: zinc finger protein JACKDAW-like ...    267   1e-79   
ref|XP_011074522.1|  PREDICTED: zinc finger protein NUTCRACKER-like     269   2e-79   
gb|KHG04949.1|  Zinc finger MAGPIE -like protein                        269   2e-79   
ref|XP_009805007.1|  PREDICTED: zinc finger protein MAGPIE-like i...    268   4e-79   
ref|NP_001280800.1|  zinc finger protein NUTCRACKER-like                268   6e-79   
ref|XP_009338257.1|  PREDICTED: zinc finger protein JACKDAW-like        265   7e-79   
ref|XP_004146819.1|  PREDICTED: zinc finger protein MAGPIE-like         268   8e-79   
ref|XP_010038657.1|  PREDICTED: zinc finger protein JACKDAW-like        266   8e-79   
ref|XP_008358430.1|  PREDICTED: zinc finger protein JACKDAW-like        265   8e-79   
ref|XP_008465570.1|  PREDICTED: zinc finger protein NUTCRACKER-like     268   8e-79   
ref|XP_009778699.1|  PREDICTED: zinc finger protein JACKDAW-like        266   9e-79   
ref|XP_007017487.1|  C2H2-like zinc finger protein                      266   9e-79   
ref|XP_006342212.1|  PREDICTED: zinc finger protein MAGPIE-like         260   1e-78   
ref|XP_002510356.1|  nucleic acid binding protein, putative             266   1e-78   Ricinus communis
ref|XP_007225628.1|  hypothetical protein PRUPE_ppa003844mg             268   1e-78   
ref|XP_004290634.1|  PREDICTED: zinc finger protein NUTCRACKER-like     265   1e-78   
ref|XP_010262086.1|  PREDICTED: zinc finger protein NUTCRACKER is...    266   1e-78   
ref|XP_008673471.1|  PREDICTED: zinc finger protein NUTCRACKER-like     263   1e-78   
ref|XP_009612196.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    266   1e-78   
ref|XP_008235356.1|  PREDICTED: zinc finger protein MAGPIE              265   2e-78   
ref|XP_011043608.1|  PREDICTED: zinc finger protein NUTCRACKER-like     265   2e-78   
emb|CBI21907.3|  unnamed protein product                                263   2e-78   
ref|XP_006361805.1|  PREDICTED: zinc finger protein JACKDAW-like        263   3e-78   
ref|XP_010689779.1|  PREDICTED: zinc finger protein MAGPIE              266   3e-78   
ref|XP_007050479.1|  Indeterminate(ID)-domain 12                        263   3e-78   
ref|XP_006372765.1|  zinc finger family protein                         265   3e-78   
gb|ADL36647.1|  C2H2L domain class transcription factor                 265   3e-78   
ref|XP_004495164.1|  PREDICTED: zinc finger protein MAGPIE-like         261   3e-78   
ref|XP_008385294.1|  PREDICTED: zinc finger protein JACKDAW-like        265   3e-78   
ref|XP_008359126.1|  PREDICTED: zinc finger protein JACKDAW-like        265   4e-78   
ref|XP_011083713.1|  PREDICTED: zinc finger protein NUTCRACKER-like     266   4e-78   
ref|XP_002872826.1|  atidd12-domain 12                                  262   4e-78   
ref|XP_010664668.1|  PREDICTED: zinc finger protein JACKDAW-like ...    265   4e-78   
ref|XP_006396480.1|  hypothetical protein EUTSA_v10028701mg             262   4e-78   
ref|XP_004138788.1|  PREDICTED: zinc finger protein MAGPIE-like         263   5e-78   
ref|XP_004170825.1|  PREDICTED: zinc finger protein MAGPIE-like         262   5e-78   
gb|KHG28179.1|  Zinc finger MAGPIE -like protein                        264   5e-78   
ref|XP_008455947.1|  PREDICTED: zinc finger protein MAGPIE-like         262   5e-78   
ref|XP_009364602.1|  PREDICTED: zinc finger protein NUTCRACKER-like     266   5e-78   
ref|XP_010262085.1|  PREDICTED: zinc finger protein NUTCRACKER is...    266   6e-78   
gb|KDO84481.1|  hypothetical protein CISIN_1g026210mg                   256   6e-78   
ref|XP_009350365.1|  PREDICTED: zinc finger protein MAGPIE-like         263   7e-78   
ref|XP_006443977.1|  hypothetical protein CICLE_v10019959mg             263   8e-78   
ref|XP_004238241.1|  PREDICTED: zinc finger protein NUTCRACKER-like     264   8e-78   
ref|XP_008225411.1|  PREDICTED: zinc finger protein JACKDAW             264   8e-78   
ref|XP_004971461.1|  PREDICTED: zinc finger protein NUTCRACKER-like     260   8e-78   
ref|XP_003523580.1|  PREDICTED: zinc finger protein MAGPIE-like         263   9e-78   
ref|XP_008386413.1|  PREDICTED: zinc finger protein MAGPIE-like         263   9e-78   
ref|XP_008368735.1|  PREDICTED: zinc finger protein MAGPIE-like         263   9e-78   
ref|XP_009370754.1|  PREDICTED: zinc finger protein MAGPIE-like         263   9e-78   
gb|KDO49571.1|  hypothetical protein CISIN_1g048287mg                   259   1e-77   
gb|EPS58012.1|  hypothetical protein M569_16805                         257   1e-77   
emb|CDP03675.1|  unnamed protein product                                263   1e-77   
ref|XP_006380280.1|  hypothetical protein POPTR_0007s01380g             263   1e-77   
ref|XP_010097054.1|  Zinc finger protein MAGPIE                         265   2e-77   
ref|XP_010932829.1|  PREDICTED: zinc finger protein MAGPIE-like         260   2e-77   
ref|XP_009335059.1|  PREDICTED: zinc finger protein JACKDAW-like        263   2e-77   
emb|CBI19670.3|  unnamed protein product                                263   2e-77   
ref|XP_003590506.1|  Zinc finger protein                                263   2e-77   
ref|XP_002281605.1|  PREDICTED: zinc finger protein JACKDAW-like ...    263   2e-77   Vitis vinifera
ref|XP_008452730.1|  PREDICTED: zinc finger protein MAGPIE-like         255   2e-77   
ref|XP_008649012.1|  PREDICTED: LOC542697 isoform X5                    264   3e-77   
ref|XP_003527695.1|  PREDICTED: zinc finger protein MAGPIE-like         262   3e-77   
ref|XP_006856069.1|  hypothetical protein AMTR_s00059p00106830          263   3e-77   
emb|CDX91304.1|  BnaC02g27150D                                          260   3e-77   
ref|XP_007149800.1|  hypothetical protein PHAVU_005G099800g             261   3e-77   
ref|XP_004141426.1|  PREDICTED: zinc finger protein NUTCRACKER-like     260   3e-77   
ref|XP_006480617.1|  PREDICTED: zinc finger protein JACKDAW-like        262   3e-77   
ref|XP_007043706.1|  C2H2 and C2HC zinc fingers superfamily protein     261   3e-77   
ref|XP_002275400.3|  PREDICTED: zinc finger protein MAGPIE              261   4e-77   Vitis vinifera
ref|XP_006434957.1|  hypothetical protein CICLE_v10001017mg             261   4e-77   
gb|KDP38479.1|  hypothetical protein JCGZ_04404                         262   4e-77   
ref|XP_006428811.1|  hypothetical protein CICLE_v10011592mg             262   4e-77   
ref|XP_006365738.1|  PREDICTED: zinc finger protein JACKDAW-like        263   5e-77   
ref|XP_006597191.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    261   5e-77   
ref|XP_006339068.1|  PREDICTED: zinc finger protein JACKDAW-like        262   5e-77   
ref|XP_004295016.1|  PREDICTED: zinc finger protein NUTCRACKER-like     262   5e-77   
ref|XP_004171470.1|  PREDICTED: zinc finger protein NUTCRACKER-like     262   5e-77   
ref|XP_007136579.1|  hypothetical protein PHAVU_009G056800g             259   5e-77   
ref|XP_004173254.1|  PREDICTED: zinc finger protein NUTCRACKER-like     259   5e-77   
ref|XP_006838942.1|  hypothetical protein AMTR_s00002p00270520          262   5e-77   
gb|KGN55339.1|  hypothetical protein Csa_4G646130                       259   5e-77   
ref|XP_003541898.2|  PREDICTED: zinc finger protein MAGPIE-like         261   5e-77   
gb|EYU46525.1|  hypothetical protein MIMGU_mgv1a017919mg                259   5e-77   
ref|XP_003590574.1|  Zinc finger protein-like protein                   263   5e-77   
ref|XP_004241270.1|  PREDICTED: zinc finger protein JACKDAW             263   6e-77   
ref|XP_011082585.1|  PREDICTED: zinc finger protein MAGPIE-like         259   6e-77   
ref|XP_010099839.1|  Zinc finger protein MAGPIE                         263   6e-77   
ref|XP_010032012.1|  PREDICTED: zinc finger protein JACKDAW             261   7e-77   
ref|XP_009789501.1|  PREDICTED: zinc finger protein JACKDAW-like        262   7e-77   
ref|XP_008350745.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    254   7e-77   
gb|KGN44789.1|  hypothetical protein Csa_7G387730                       261   7e-77   
gb|KDP44082.1|  hypothetical protein JCGZ_05549                         261   7e-77   
ref|XP_006469076.1|  PREDICTED: zinc finger protein MAGPIE-like         261   8e-77   
ref|XP_009620251.1|  PREDICTED: zinc finger protein JACKDAW-like        262   8e-77   
ref|XP_006446712.1|  hypothetical protein CICLE_v10015043mg             261   9e-77   
ref|XP_004154868.1|  PREDICTED: zinc finger protein MAGPIE-like         261   9e-77   
ref|XP_011047708.1|  PREDICTED: zinc finger protein NUTCRACKER-like     261   9e-77   
ref|XP_009144549.1|  PREDICTED: zinc finger protein MAGPIE              258   9e-77   
emb|CDP21823.1|  unnamed protein product                                252   1e-76   
gb|KHN00558.1|  Zinc finger protein MAGPIE-like protein                 261   1e-76   
ref|XP_010904556.1|  PREDICTED: zinc finger protein NUTCRACKER-like     264   1e-76   
ref|XP_009406262.1|  PREDICTED: zinc finger protein NUTCRACKER-like     259   1e-76   
ref|XP_006287797.1|  hypothetical protein CARUB_v10001008mg             259   1e-76   
ref|XP_010552209.1|  PREDICTED: zinc finger protein NUTCRACKER-like     261   1e-76   
ref|XP_009793158.1|  PREDICTED: zinc finger protein NUTCRACKER-like     261   1e-76   
ref|XP_010534894.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    259   1e-76   
ref|XP_010679126.1|  PREDICTED: zinc finger protein NUTCRACKER          261   1e-76   
ref|XP_004146996.1|  PREDICTED: zinc finger protein NUTCRACKER-like     261   1e-76   
ref|XP_004249492.1|  PREDICTED: zinc finger protein JACKDAW             261   1e-76   
ref|XP_010547496.1|  PREDICTED: zinc finger protein MAGPIE-like i...    261   1e-76   
ref|XP_010521474.1|  PREDICTED: zinc finger protein MAGPIE-like         260   1e-76   
gb|KHG05632.1|  Zinc finger MAGPIE -like protein                        261   1e-76   
ref|XP_010087102.1|  Zinc finger protein MAGPIE                         259   1e-76   
gb|KDP31793.1|  hypothetical protein JCGZ_12254                         261   1e-76   
ref|XP_011025733.1|  PREDICTED: zinc finger protein NUTCRACKER-like     262   1e-76   
ref|XP_011100239.1|  PREDICTED: zinc finger protein NUTCRACKER          260   1e-76   
ref|XP_009365587.1|  PREDICTED: zinc finger protein NUTCRACKER-like     262   1e-76   
emb|CDP06730.1|  unnamed protein product                                262   2e-76   
ref|XP_004304416.1|  PREDICTED: zinc finger protein MAGPIE-like         260   2e-76   
ref|XP_003518037.1|  PREDICTED: zinc finger protein JACKDAW-like        261   2e-76   
ref|XP_009781290.1|  PREDICTED: zinc finger protein JACKDAW-like ...    260   2e-76   
ref|XP_002302090.2|  hypothetical protein POPTR_0002s04880g             260   2e-76   Populus trichocarpa [western balsam poplar]
ref|XP_010547497.1|  PREDICTED: zinc finger protein MAGPIE-like i...    261   2e-76   
gb|EAY72878.1|  hypothetical protein OsI_00752                          260   2e-76   Oryza sativa Indica Group [Indian rice]
ref|XP_011026098.1|  PREDICTED: zinc finger protein NUTCRACKER-like     260   2e-76   
emb|CDP02817.1|  unnamed protein product                                261   2e-76   
gb|KDP24073.1|  hypothetical protein JCGZ_25730                         259   2e-76   
ref|XP_007204325.1|  hypothetical protein PRUPE_ppa004299mg             261   2e-76   
ref|XP_002894488.1|  predicted protein                                  259   2e-76   
gb|ADL36648.1|  C2H2L domain class transcription factor                 261   2e-76   
emb|CDX97281.1|  BnaA02g20720D                                          257   2e-76   
ref|NP_001042288.1|  Os01g0195000                                       260   3e-76   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010043069.1|  PREDICTED: zinc finger protein MAGPIE              259   3e-76   
ref|XP_004246670.1|  PREDICTED: zinc finger protein JACKDAW isofo...    259   3e-76   
ref|XP_011012272.1|  PREDICTED: zinc finger protein NUTCRACKER-like     260   3e-76   
ref|XP_007132765.1|  hypothetical protein PHAVU_011G123200g             259   3e-76   
ref|XP_011048567.1|  PREDICTED: zinc finger protein JACKDAW-like        260   3e-76   
emb|CDP08272.1|  unnamed protein product                                260   3e-76   
gb|KHN22265.1|  Zinc finger protein MAGPIE                              259   3e-76   
ref|XP_008813524.1|  PREDICTED: zinc finger protein MAGPIE-like         258   3e-76   
ref|XP_008648994.1|  PREDICTED: LOC542697 isoform X4                    261   3e-76   
ref|XP_010999961.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    261   3e-76   
ref|XP_010244313.1|  PREDICTED: zinc finger protein NUTCRACKER-like     260   3e-76   
ref|XP_006380751.1|  hypothetical protein POPTR_0007s12520g             261   3e-76   
ref|XP_010088951.1|  Zinc finger protein MAGPIE                         260   3e-76   
ref|XP_010046700.1|  PREDICTED: zinc finger protein JACKDAW-like        260   4e-76   
ref|XP_006381470.1|  hypothetical protein POPTR_0006s13130g             260   4e-76   
ref|XP_009598165.1|  PREDICTED: zinc finger protein JACKDAW-like ...    259   4e-76   
ref|XP_010260340.1|  PREDICTED: zinc finger protein MAGPIE-like         259   4e-76   
tpg|DAA48715.1|  TPA: hypothetical protein ZEAMMB73_834941              263   4e-76   
ref|XP_010540892.1|  PREDICTED: zinc finger protein NUTCRACKER-like     259   4e-76   
ref|XP_007012298.1|  Indeterminate(ID)-domain 7, putative               261   4e-76   
ref|XP_011089888.1|  PREDICTED: zinc finger protein JACKDAW             259   4e-76   
ref|XP_004487192.1|  PREDICTED: zinc finger protein MAGPIE-like         258   4e-76   
ref|XP_009596422.1|  PREDICTED: zinc finger protein NUTCRACKER-like     259   4e-76   
ref|XP_002876042.1|  ATIDD2-DOMAIN 2                                    258   4e-76   
gb|KHF99746.1|  Zinc finger MAGPIE -like protein                        258   5e-76   
ref|XP_009805009.1|  PREDICTED: zinc finger protein MAGPIE-like i...    259   5e-76   
ref|XP_007156918.1|  hypothetical protein PHAVU_002G028100g             260   5e-76   
ref|XP_008440687.1|  PREDICTED: zinc finger protein NUTCRACKER-like     259   5e-76   
ref|XP_006351575.1|  PREDICTED: zinc finger protein NUTCRACKER-like     258   5e-76   
ref|XP_008338682.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    260   5e-76   
ref|XP_011072643.1|  PREDICTED: zinc finger protein NUTCRACKER-like     254   5e-76   
ref|XP_008338685.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    259   5e-76   
ref|XP_010106246.1|  hypothetical protein L484_005111                   259   5e-76   
ref|XP_010534893.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    259   5e-76   
ref|XP_009396147.1|  PREDICTED: zinc finger protein MAGPIE-like         261   5e-76   
ref|XP_006643871.1|  PREDICTED: zinc finger protein NUTCRACKER-like     259   5e-76   
ref|XP_010475014.1|  PREDICTED: zinc finger protein MAGPIE-like i...    259   6e-76   
ref|XP_010917616.1|  PREDICTED: zinc finger protein MAGPIE-like         256   6e-76   
gb|EYU42150.1|  hypothetical protein MIMGU_mgv1a006193mg                258   6e-76   
ref|XP_007156028.1|  hypothetical protein PHAVU_003G252400g             259   6e-76   
emb|CBI25044.3|  unnamed protein product                                256   6e-76   
ref|XP_009762294.1|  PREDICTED: zinc finger protein JACKDAW-like ...    259   6e-76   
ref|XP_010669389.1|  PREDICTED: zinc finger protein NUTCRACKER-like     261   7e-76   
ref|NP_171880.1|  zinc finger protein MAGPIE                            259   7e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004143503.1|  PREDICTED: uncharacterized protein LOC101217597    259   7e-76   
ref|XP_002306797.2|  zinc finger family protein                         258   7e-76   Populus trichocarpa [western balsam poplar]
ref|XP_006418198.1|  hypothetical protein EUTSA_v10009734mg             259   7e-76   
ref|XP_010919168.1|  PREDICTED: zinc finger protein MAGPIE-like         258   7e-76   
ref|XP_004245090.1|  PREDICTED: zinc finger protein NUTCRACKER          258   8e-76   
ref|XP_006307283.1|  hypothetical protein CARUB_v10008897mg             259   8e-76   
ref|XP_010503736.1|  PREDICTED: zinc finger protein MAGPIE-like i...    257   8e-76   
ref|XP_002527396.1|  nucleic acid binding protein, putative             260   9e-76   Ricinus communis
ref|XP_006291095.1|  hypothetical protein CARUB_v10017209mg             258   9e-76   
gb|AFY26885.1|  zinc finger protein                                     259   9e-76   
ref|XP_003540171.1|  PREDICTED: zinc finger protein JACKDAW-like        259   9e-76   
ref|XP_004501031.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    256   1e-75   
ref|XP_010503737.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    256   1e-75   
ref|XP_008673585.1|  PREDICTED: zinc finger protein NUTCRACKER-like     258   1e-75   
emb|CBI32713.3|  unnamed protein product                                258   1e-75   
ref|XP_002462813.1|  hypothetical protein SORBIDRAFT_02g032400          259   1e-75   Sorghum bicolor [broomcorn]
gb|ABR17388.1|  unknown                                                 263   1e-75   Picea sitchensis
ref|XP_009420841.1|  PREDICTED: zinc finger protein NUTCRACKER-like     259   1e-75   
ref|XP_010653553.1|  PREDICTED: zinc finger protein JACKDAW             258   1e-75   
gb|KFK34317.1|  hypothetical protein AALP_AA5G129400                    257   1e-75   
ref|XP_004235590.1|  PREDICTED: zinc finger protein NUTCRACKER-like     259   1e-75   
ref|XP_002892182.1|  hypothetical protein ARALYDRAFT_470357             259   1e-75   
ref|XP_010558174.1|  PREDICTED: zinc finger protein NUTCRACKER          258   1e-75   
ref|XP_009803272.1|  PREDICTED: putative uncharacterized protein ...    259   1e-75   
ref|XP_004300616.1|  PREDICTED: uncharacterized protein LOC101300627    259   1e-75   
ref|XP_006383231.1|  hypothetical protein POPTR_0005s12710g             258   1e-75   
ref|XP_007144666.1|  hypothetical protein PHAVU_007G174900g             257   1e-75   
gb|KHN11278.1|  Zinc finger protein MAGPIE                              259   1e-75   
ref|XP_009762293.1|  PREDICTED: zinc finger protein JACKDAW-like ...    259   1e-75   
gb|KHN36136.1|  Zinc finger protein MAGPIE                              256   1e-75   
ref|XP_008798275.1|  PREDICTED: zinc finger protein NUTCRACKER-like     257   2e-75   
gb|KHN30052.1|  Zinc finger protein MAGPIE                              258   2e-75   
ref|XP_002320649.2|  hypothetical protein POPTR_0014s17900g             259   2e-75   Populus trichocarpa [western balsam poplar]
ref|XP_009612199.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    258   2e-75   
ref|XP_004172936.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    258   2e-75   
ref|XP_003539541.2|  PREDICTED: zinc finger protein MAGPIE-like         258   2e-75   
ref|XP_009590472.1|  PREDICTED: zinc finger protein NUTCRACKER-like     259   2e-75   
ref|XP_008649017.1|  PREDICTED: LOC542697 isoform X1                    259   2e-75   
ref|XP_002865381.1|  zinc finger family protein                         257   2e-75   
gb|KHN44500.1|  Zinc finger protein MAGPIE                              258   2e-75   
ref|XP_003565455.1|  PREDICTED: zinc finger protein MAGPIE              257   2e-75   
dbj|BAD10885.1|  zinc finger protein                                    258   2e-75   Malus domestica [apple tree]
ref|XP_001760619.1|  predicted protein                                  249   2e-75   
gb|KFK28353.1|  hypothetical protein AALP_AA8G504900                    258   2e-75   
ref|NP_001241804.1|  INDETERMINATE-related protein 1                    259   2e-75   
ref|NP_190639.1|  indeterminate-domain 2 protein                        256   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009587634.1|  PREDICTED: zinc finger protein MAGPIE              257   2e-75   
ref|NP_001105282.1|  LOC542198                                          258   2e-75   Zea mays [maize]
gb|KDP21398.1|  hypothetical protein JCGZ_21869                         256   2e-75   
gb|KFK42728.1|  hypothetical protein AALP_AA1G032000                    258   2e-75   
ref|XP_010426610.1|  PREDICTED: zinc finger protein MAGPIE-like i...    256   2e-75   
gb|KHG24773.1|  Zinc finger MAGPIE -like protein                        259   2e-75   
ref|NP_001105683.1|  LOC542697                                          259   2e-75   Zea mays [maize]
ref|XP_006342974.1|  PREDICTED: zinc finger protein MAGPIE-like i...    259   2e-75   
gb|AAG50836.1|AC073944_3  zinc finger protein, putative                 256   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008798233.1|  PREDICTED: zinc finger protein MAGPIE              256   2e-75   
gb|KHG14531.1|  Zinc finger MAGPIE -like protein                        258   2e-75   
ref|XP_010279249.1|  PREDICTED: zinc finger protein NUTCRACKER-like     257   2e-75   
ref|XP_009409481.1|  PREDICTED: zinc finger protein NUTCRACKER-like     256   2e-75   
ref|XP_009612448.1|  PREDICTED: zinc finger protein JACKDAW-like        257   2e-75   
ref|XP_009771226.1|  PREDICTED: zinc finger protein JACKDAW-like        257   2e-75   
ref|XP_009393052.1|  PREDICTED: zinc finger protein MAGPIE-like         253   2e-75   
ref|XP_010558265.1|  PREDICTED: zinc finger protein JACKDAW-like ...    258   2e-75   
ref|XP_008444696.1|  PREDICTED: zinc finger protein MAGPIE-like         256   3e-75   
gb|KCW68263.1|  hypothetical protein EUGRSUZ_F01910                     249   3e-75   
ref|XP_010910693.1|  PREDICTED: zinc finger protein NUTCRACKER-like     257   3e-75   
ref|XP_009106906.1|  PREDICTED: zinc finger protein MAGPIE isofor...    256   3e-75   
ref|XP_010482570.1|  PREDICTED: zinc finger protein MAGPIE              258   3e-75   
ref|XP_003547992.1|  PREDICTED: zinc finger protein NUTCRACKER-like     258   3e-75   
ref|XP_009394220.1|  PREDICTED: zinc finger protein MAGPIE-like         259   3e-75   
emb|CDP07541.1|  unnamed protein product                                258   3e-75   
ref|XP_010426611.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    255   3e-75   
ref|XP_011089318.1|  PREDICTED: zinc finger protein JACKDAW             258   3e-75   
ref|XP_011094681.1|  PREDICTED: zinc finger protein JACKDAW-like        259   3e-75   
ref|XP_011079920.1|  PREDICTED: zinc finger protein MAGPIE              255   3e-75   
ref|XP_004243388.1|  PREDICTED: zinc finger protein MAGPIE              257   3e-75   
ref|XP_003566276.1|  PREDICTED: zinc finger protein NUTCRACKER-like     254   3e-75   
emb|CBI35959.3|  unnamed protein product                                249   3e-75   
ref|NP_175907.2|  indeterminate(ID)-domain 7 protein                    256   3e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010457401.1|  PREDICTED: zinc finger protein MAGPIE-like         258   3e-75   
ref|XP_003520199.1|  PREDICTED: zinc finger protein NUTCRACKER-like     256   3e-75   
gb|EEC74689.1|  hypothetical protein OsI_10388                          258   3e-75   Oryza sativa Indica Group [Indian rice]
ref|XP_010556851.1|  PREDICTED: zinc finger protein NUTCRACKER          256   4e-75   
emb|CBI17550.3|  unnamed protein product                                257   4e-75   
gb|EYU18854.1|  hypothetical protein MIMGU_mgv1a008806mg                253   4e-75   
ref|XP_004303130.1|  PREDICTED: zinc finger protein MAGPIE-like         257   4e-75   
ref|XP_010061336.1|  PREDICTED: zinc finger protein MAGPIE-like         249   4e-75   
ref|XP_009765644.1|  PREDICTED: zinc finger protein MAGPIE-like         256   4e-75   
emb|CDX89862.1|  BnaA10g02200D                                          256   4e-75   
ref|XP_004486834.1|  PREDICTED: zinc finger protein JACKDAW-like ...    255   4e-75   
gb|ABF94468.1|  Zinc finger, C2H2 type family protein, expressed        258   4e-75   Oryza sativa Japonica Group [Japonica rice]
emb|CDY18188.1|  BnaC05g02110D                                          256   4e-75   
ref|XP_006853846.1|  hypothetical protein AMTR_s00036p00077430          255   4e-75   
ref|XP_006349768.1|  PREDICTED: zinc finger protein MAGPIE-like         257   4e-75   
ref|XP_004149169.1|  PREDICTED: uncharacterized protein LOC101215476    254   4e-75   
ref|XP_003536915.1|  PREDICTED: zinc finger protein NUTCRACKER-like     256   4e-75   
ref|XP_004247200.1|  PREDICTED: zinc finger protein NUTCRACKER          257   4e-75   
ref|XP_004152782.1|  PREDICTED: zinc finger protein NUTCRACKER-like     256   4e-75   
gb|KHN03825.1|  Zinc finger protein MAGPIE                              256   4e-75   
ref|XP_010646129.1|  PREDICTED: zinc finger protein NUTCRACKER          256   4e-75   
gb|AAM14021.1|  putative zinc finger protein                            256   4e-75   
ref|XP_002444605.1|  hypothetical protein SORBIDRAFT_07g024550          258   4e-75   
ref|XP_006855509.1|  hypothetical protein AMTR_s00057p00204520          256   5e-75   
gb|EYU34438.1|  hypothetical protein MIMGU_mgv1a003700mg                259   5e-75   
gb|EYU45130.1|  hypothetical protein MIMGU_mgv1a005657mg                256   5e-75   
ref|XP_009119357.1|  PREDICTED: zinc finger protein MAGPIE-like         256   5e-75   
ref|XP_008453721.1|  PREDICTED: zinc finger protein MAGPIE-like         254   5e-75   
ref|XP_007162739.1|  hypothetical protein PHAVU_001G176200g             257   5e-75   
ref|XP_004236896.1|  PREDICTED: zinc finger protein JACKDAW-like ...    258   5e-75   
ref|XP_011081679.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    257   5e-75   
ref|XP_011081677.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    257   6e-75   
gb|KFK31661.1|  hypothetical protein AALP_AA6G142300                    255   6e-75   
ref|XP_003517239.1|  PREDICTED: zinc finger protein MAGPIE-like         257   6e-75   
ref|XP_009603158.1|  PREDICTED: zinc finger protein JACKDAW-like        256   6e-75   
ref|XP_004232386.1|  PREDICTED: zinc finger protein NUTCRACKER is...    257   6e-75   
ref|XP_009106907.1|  PREDICTED: zinc finger protein MAGPIE isofor...    255   6e-75   
ref|XP_003533006.2|  PREDICTED: zinc finger protein MAGPIE-like         257   6e-75   
ref|XP_010029827.1|  PREDICTED: zinc finger protein NUTCRACKER-like     257   7e-75   
ref|XP_004230217.1|  PREDICTED: zinc finger protein JACKDAW-like        254   7e-75   
ref|XP_006392689.1|  hypothetical protein EUTSA_v10011450mg             256   7e-75   
ref|XP_010556771.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    253   7e-75   
ref|XP_008246406.1|  PREDICTED: zinc finger protein NUTCRACKER-like     257   7e-75   
ref|XP_009389837.1|  PREDICTED: zinc finger protein MAGPIE-like         253   8e-75   
ref|XP_011032636.1|  PREDICTED: zinc finger protein MAGPIE-like i...    255   8e-75   
ref|XP_008655812.1|  PREDICTED: zinc finger protein NUTCRACKER-like     254   8e-75   
ref|XP_008804317.1|  PREDICTED: zinc finger protein NUTCRACKER-like     258   8e-75   
ref|XP_010501294.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    257   9e-75   
ref|XP_009386431.1|  PREDICTED: zinc finger protein NUTCRACKER-like     258   9e-75   
ref|XP_010501300.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    256   9e-75   
gb|KCW56793.1|  hypothetical protein EUGRSUZ_I02463                     256   9e-75   
ref|XP_002865050.1|  hypothetical protein ARALYDRAFT_496927             256   1e-74   
ref|XP_010264716.1|  PREDICTED: zinc finger protein JACKDAW             257   1e-74   
ref|XP_002520944.1|  nucleic acid binding protein, putative             255   1e-74   
ref|XP_010501286.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    256   1e-74   
gb|EPS62199.1|  zinc finger family protein                              251   1e-74   
ref|NP_001042553.1|  Os01g0242200                                       253   1e-74   
ref|XP_011032635.1|  PREDICTED: zinc finger protein MAGPIE-like i...    255   1e-74   
emb|CDM83220.1|  unnamed protein product                                255   1e-74   
ref|XP_007217101.1|  hypothetical protein PRUPE_ppa004346m2g            251   1e-74   
gb|KDO73212.1|  hypothetical protein CISIN_1g011146mg                   254   1e-74   
ref|XP_003529728.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    256   1e-74   
ref|XP_009786203.1|  PREDICTED: zinc finger protein NUTCRACKER-like     256   1e-74   
ref|XP_004968516.1|  PREDICTED: zinc finger protein MAGPIE-like         255   1e-74   
ref|XP_004164789.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    253   1e-74   
ref|XP_008783278.1|  PREDICTED: zinc finger protein MAGPIE-like         254   1e-74   
ref|NP_001146099.1|  uncharacterized protein LOC100279631               257   1e-74   
ref|XP_010999966.1|  PREDICTED: zinc finger protein MAGPIE-like i...    256   1e-74   
ref|XP_008229114.1|  PREDICTED: zinc finger protein NUTCRACKER-like     254   1e-74   
ref|XP_009110534.1|  PREDICTED: zinc finger protein MAGPIE-like         255   1e-74   
ref|XP_002322870.2|  zinc finger family protein                         253   1e-74   
ref|XP_010999964.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    256   1e-74   
ref|XP_004974170.1|  PREDICTED: zinc finger protein MAGPIE-like i...    256   1e-74   
ref|XP_003629476.1|  Zinc finger protein                                256   1e-74   
ref|XP_008648978.1|  PREDICTED: LOC542697 isoform X2                    260   2e-74   
ref|XP_010501280.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    256   2e-74   
ref|XP_006344640.1|  PREDICTED: zinc finger protein JACKDAW-like        253   2e-74   
emb|CDY10404.1|  BnaCnng03050D                                          256   2e-74   
ref|XP_010501262.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    256   2e-74   
ref|XP_010999962.1|  PREDICTED: zinc finger protein MAGPIE-like i...    256   2e-74   
ref|XP_008649023.1|  PREDICTED: LOC542697 isoform X6                    256   2e-74   
ref|XP_007150513.1|  hypothetical protein PHAVU_005G158600g             255   2e-74   
ref|XP_010462352.1|  PREDICTED: zinc finger protein MAGPIE-like i...    254   2e-74   
ref|XP_007207366.1|  hypothetical protein PRUPE_ppa004548mg             255   2e-74   
ref|XP_010655209.1|  PREDICTED: zinc finger protein NUTCRACKER is...    254   2e-74   
ref|XP_009122729.1|  PREDICTED: zinc finger protein JACKDAW isofo...    256   2e-74   
ref|XP_010999960.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    256   2e-74   
ref|XP_007221346.1|  hypothetical protein PRUPE_ppa023209mg             254   2e-74   
ref|XP_010462351.1|  PREDICTED: zinc finger protein MAGPIE-like i...    254   2e-74   
ref|XP_006355018.1|  PREDICTED: zinc finger protein JACKDAW-like ...    256   2e-74   
ref|XP_009395398.1|  PREDICTED: zinc finger protein NUTCRACKER-like     256   2e-74   
ref|NP_001175975.1|  Os09g0555700                                       256   2e-74   
ref|XP_003540944.2|  PREDICTED: zinc finger protein MAGPIE-like         254   2e-74   
ref|XP_006307340.1|  hypothetical protein CARUB_v10008958mg             255   2e-74   
ref|XP_006355017.1|  PREDICTED: zinc finger protein JACKDAW-like ...    256   2e-74   
ref|XP_003553472.1|  PREDICTED: zinc finger protein MAGPIE              254   2e-74   
ref|XP_009122730.1|  PREDICTED: zinc finger protein JACKDAW isofo...    255   2e-74   
gb|EYU33109.1|  hypothetical protein MIMGU_mgv1a017741mg                254   2e-74   
dbj|BAJ94059.1|  predicted protein                                      254   2e-74   
tpg|DAA62601.1|  TPA: INDETERMINATE protein 7                           255   2e-74   
ref|XP_004173051.1|  PREDICTED: zinc finger protein NUTCRACKER-like     253   2e-74   
emb|CDO97906.1|  unnamed protein product                                256   3e-74   
gb|EYU21367.1|  hypothetical protein MIMGU_mgv1a003883mg                256   3e-74   
ref|XP_006403134.1|  hypothetical protein EUTSA_v10003218mg             253   3e-74   
ref|XP_010680830.1|  PREDICTED: zinc finger protein NUTCRACKER-like     256   3e-74   
ref|XP_011040764.1|  PREDICTED: zinc finger protein NUTCRACKER-like     255   3e-74   
ref|XP_009781292.1|  PREDICTED: zinc finger protein JACKDAW-like ...    254   3e-74   
emb|CDY44344.1|  BnaC02g03330D                                          255   3e-74   
ref|XP_004496222.1|  PREDICTED: zinc finger protein JACKDAW-like ...    255   3e-74   
ref|XP_006280348.1|  hypothetical protein CARUB_v10026275mg             254   3e-74   
ref|XP_006340149.1|  PREDICTED: zinc finger protein JACKDAW-like        255   3e-74   
emb|CDM82512.1|  unnamed protein product                                254   3e-74   
ref|XP_009356670.1|  PREDICTED: zinc finger protein NUTCRACKER-like     255   3e-74   
gb|ABU45196.1|  unknown                                                 255   3e-74   
ref|XP_010904891.1|  PREDICTED: zinc finger protein NUTCRACKER-like     253   3e-74   
gb|KHN39309.1|  Zinc finger protein MAGPIE                              254   3e-74   
ref|XP_010270754.1|  PREDICTED: zinc finger protein NUTCRACKER-like     257   4e-74   
gb|EEC70289.1|  hypothetical protein OsI_01118                          254   4e-74   
ref|XP_002457187.1|  hypothetical protein SORBIDRAFT_03g002960          254   4e-74   
ref|XP_011025113.1|  PREDICTED: zinc finger protein NUTCRACKER-like     256   4e-74   
ref|XP_010325994.1|  PREDICTED: zinc finger protein JACKDAW isofo...    253   4e-74   
ref|NP_199229.1|  zinc finger protein NUTCRACKER                        253   4e-74   
ref|XP_003543476.1|  PREDICTED: zinc finger protein JACKDAW-like        254   4e-74   
ref|XP_006424606.1|  hypothetical protein CICLE_v10028294mg             254   4e-74   
gb|ACU23180.1|  unknown                                                 254   4e-74   
ref|XP_002271958.2|  PREDICTED: zinc finger protein NUTCRACKER          254   4e-74   
gb|AES88616.2|  C2H2 and C2HC zinc finger protein, putative             254   4e-74   
ref|XP_007207116.1|  hypothetical protein PRUPE_ppa018226mg             255   4e-74   
ref|XP_009598166.1|  PREDICTED: zinc finger protein JACKDAW-like ...    254   4e-74   
gb|EEE54212.1|  hypothetical protein OsJ_01066                          254   4e-74   
gb|KHG03503.1|  Zinc finger MAGPIE -like protein                        256   4e-74   
ref|XP_011004624.1|  PREDICTED: zinc finger protein JACKDAW-like        254   4e-74   
ref|XP_010684114.1|  PREDICTED: zinc finger protein JACKDAW             255   5e-74   
gb|ABR18333.1|  unknown                                                 257   5e-74   
gb|ABU45210.1|  unknown                                                 255   5e-74   
ref|XP_006363144.1|  PREDICTED: zinc finger protein MAGPIE-like         255   5e-74   
ref|XP_006291100.1|  hypothetical protein CARUB_v10017213mg             253   5e-74   
gb|EMT13592.1|  Zinc finger protein MAGPIE                              252   5e-74   
ref|XP_010905076.1|  PREDICTED: zinc finger protein NUTCRACKER-like     255   5e-74   
ref|XP_004302410.1|  PREDICTED: uncharacterized protein LOC101315251    255   5e-74   
emb|CDM81605.1|  unnamed protein product                                254   5e-74   
ref|XP_009130730.1|  PREDICTED: zinc finger protein JACKDAW-like        254   5e-74   
emb|CDY11241.1|  BnaA03g00770D                                          254   6e-74   
ref|XP_009376645.1|  PREDICTED: zinc finger protein NUTCRACKER-like     254   6e-74   
ref|XP_007162467.1|  hypothetical protein PHAVU_001G154800g             253   6e-74   
ref|XP_011099580.1|  PREDICTED: zinc finger protein NUTCRACKER-like     254   6e-74   
gb|KHN07785.1|  Zinc finger protein NUTCRACKER                          253   6e-74   
ref|XP_003526253.2|  PREDICTED: zinc finger protein NUTCRACKER-like     253   6e-74   
ref|XP_009628988.1|  PREDICTED: zinc finger protein NUTCRACKER-like     252   6e-74   
ref|XP_004137968.1|  PREDICTED: zinc finger protein MAGPIE-like         254   6e-74   
ref|XP_006379801.1|  hypothetical protein POPTR_0008s14180g             257   6e-74   
ref|XP_010480027.1|  PREDICTED: zinc finger protein MAGPIE-like         253   6e-74   
ref|XP_006853370.1|  hypothetical protein AMTR_s00032p00120910          256   6e-74   
gb|KDP29101.1|  hypothetical protein JCGZ_16490                         254   6e-74   
ref|XP_007030962.1|  C2H2 and C2HC zinc fingers superfamily prote...    255   7e-74   
ref|XP_010935373.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    255   7e-74   
ref|XP_008811073.1|  PREDICTED: zinc finger protein MAGPIE-like         256   7e-74   
ref|XP_004957598.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    254   7e-74   
tpg|DAA52688.1|  TPA: hypothetical protein ZEAMMB73_797413              249   7e-74   
ref|XP_010430007.1|  PREDICTED: zinc finger protein NUTCRACKER-like     251   7e-74   
ref|XP_010465254.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    254   7e-74   
ref|XP_010465251.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    254   7e-74   
emb|CDY24490.1|  BnaC05g34640D                                          252   7e-74   
ref|XP_010916031.1|  PREDICTED: zinc finger protein NUTCRACKER-like     252   7e-74   
ref|XP_009118688.1|  PREDICTED: zinc finger protein MAGPIE-like         253   8e-74   
ref|XP_006379805.1|  hypothetical protein POPTR_0008s14190g             254   8e-74   
ref|XP_010935369.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    256   8e-74   
ref|XP_010422558.1|  PREDICTED: zinc finger protein MAGPIE-like         251   9e-74   
ref|XP_007027297.1|  C2H2-like zinc finger protein, putative            253   9e-74   
ref|XP_008782073.1|  PREDICTED: zinc finger protein NUTCRACKER-like     252   9e-74   
ref|XP_002519549.1|  nucleic acid binding protein, putative             254   9e-74   
gb|AES67848.2|  C2H2-type zinc finger protein                           253   9e-74   
ref|XP_008369754.1|  PREDICTED: zinc finger protein JACKDAW-like        253   1e-73   
ref|XP_009416535.1|  PREDICTED: zinc finger protein MAGPIE              251   1e-73   
ref|XP_010444745.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    254   1e-73   
ref|NP_201474.1|  C2H2-like zinc finger protein                         253   1e-73   
ref|XP_010931612.1|  PREDICTED: zinc finger protein NUTCRACKER-like     254   1e-73   
ref|XP_010501118.1|  PREDICTED: zinc finger protein MAGPIE-like i...    253   1e-73   
emb|CDY51742.1|  BnaA01g37250D                                          253   1e-73   
ref|XP_007161022.1|  hypothetical protein PHAVU_001G036500g             250   1e-73   
emb|CBI16293.3|  unnamed protein product                                253   1e-73   
dbj|BAB08375.1|  unnamed protein product                                251   1e-73   
ref|XP_010444746.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    254   1e-73   
dbj|BAJ87690.1|  predicted protein                                      255   1e-73   
gb|EEE54841.1|  hypothetical protein OsJ_02296                          252   1e-73   
gb|AGO81841.1|  indterminate-like protein                               244   1e-73   
ref|XP_010501117.1|  PREDICTED: zinc finger protein MAGPIE-like i...    252   1e-73   
emb|CDX80854.1|  BnaC03g01080D                                          253   1e-73   
emb|CDY22307.1|  BnaA06g36290D                                          252   1e-73   
ref|XP_011025044.1|  PREDICTED: zinc finger protein MAGPIE-like         256   1e-73   
ref|XP_009342741.1|  PREDICTED: zinc finger protein JACKDAW-like        254   1e-73   
ref|XP_002468334.1|  hypothetical protein SORBIDRAFT_01g043960          254   1e-73   
gb|KHG10356.1|  Zinc finger NUTCRACKER -like protein                    256   1e-73   
gb|KEH39925.1|  C2H2-type zinc finger protein                           252   1e-73   
ref|XP_010464989.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    253   1e-73   
ref|XP_010444747.1|  PREDICTED: zinc finger protein JACKDAW-like ...    253   1e-73   
ref|XP_006404010.1|  hypothetical protein EUTSA_v10010353mg             252   1e-73   
ref|XP_010484596.1|  PREDICTED: zinc finger protein JACKDAW-like        253   1e-73   
dbj|BAJ90343.1|  predicted protein                                      255   1e-73   
ref|XP_010464997.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    253   1e-73   
emb|CDX77936.1|  BnaA09g31310D                                          251   1e-73   
ref|XP_009784070.1|  PREDICTED: zinc finger protein MAGPIE-like         251   1e-73   
ref|XP_009337719.1|  PREDICTED: zinc finger protein NUTCRACKER-like     254   1e-73   
ref|XP_009117441.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    253   1e-73   
ref|XP_008800868.1|  PREDICTED: zinc finger protein NUTCRACKER-like     253   2e-73   
ref|NP_001105281.1|  INDETERMINATE-related protein 10                   255   2e-73   
ref|XP_009115732.1|  PREDICTED: zinc finger protein JACKDAW             251   2e-73   
gb|ABU45176.1|  unknown                                                 253   2e-73   
ref|XP_010452174.1|  PREDICTED: zinc finger protein JACKDAW-like        253   2e-73   
gb|ABD28501.1|  Zinc finger, C2H2-type                                  252   2e-73   
ref|XP_010423754.1|  PREDICTED: zinc finger protein JACKDAW-like        253   2e-73   
ref|XP_006660959.1|  PREDICTED: zinc finger protein MAGPIE-like         253   2e-73   
ref|XP_010253625.1|  PREDICTED: zinc finger protein JACKDAW-like        254   2e-73   
ref|XP_008228284.1|  PREDICTED: zinc finger protein NUTCRACKER          255   2e-73   
ref|XP_004974171.1|  PREDICTED: zinc finger protein MAGPIE-like i...    253   2e-73   
ref|XP_009626387.1|  PREDICTED: zinc finger protein NUTCRACKER-like     253   2e-73   
ref|XP_009101734.1|  PREDICTED: zinc finger protein NUTCRACKER          251   2e-73   
ref|NP_001030951.1|  zinc finger protein MAGPIE                         253   2e-73   
ref|XP_008797147.1|  PREDICTED: zinc finger protein NUTCRACKER-like     253   2e-73   
ref|XP_009421477.1|  PREDICTED: zinc finger protein NUTCRACKER-like     250   2e-73   
ref|XP_010487159.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    253   2e-73   
ref|XP_010487157.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    253   2e-73   
ref|XP_004291048.1|  PREDICTED: zinc finger protein NUTCRACKER-like     253   2e-73   
gb|ACL52429.1|  unknown                                                 255   2e-73   
gb|AES67460.2|  C2H2-type zinc finger protein                           250   2e-73   
ref|XP_010940267.1|  PREDICTED: zinc finger protein NUTCRACKER-like     255   2e-73   
ref|XP_009593681.1|  PREDICTED: zinc finger protein NUTCRACKER-like     253   2e-73   
ref|XP_009117428.1|  PREDICTED: zinc finger protein NUTCRACKER-li...    253   2e-73   
dbj|BAF00785.1|  hypothetical protein                                   252   2e-73   
gb|KHG06591.1|  Zinc finger MAGPIE -like protein                        252   2e-73   
emb|CAN79105.1|  hypothetical protein VITISV_006257                     253   3e-73   
ref|XP_007015429.1|  Nucleic acid binding protein, putative isofo...    253   3e-73   
ref|XP_006425718.1|  hypothetical protein CICLE_v10025390mg             253   3e-73   
ref|XP_008442674.1|  PREDICTED: zinc finger protein JACKDAW             252   3e-73   
ref|XP_011023656.1|  PREDICTED: zinc finger protein NUTCRACKER-like     253   3e-73   



>ref|XP_010242235.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X2 [Nelumbo 
nucifera]
Length=488

 Score =   276 bits (705),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 148/318 (47%), Positives = 199/318 (63%), Gaps = 12/318 (4%)
 Frame = -1

Query  1330  RQMTTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKG  1151
             R  T  L  ++S     QT   K+KR+ PG PD + EVIALSP++L+ TNR+VC++C KG
Sbjct  34    RAETGTLYPQQSFASPNQTQVVKKKRNLPGNPDPDAEVIALSPRTLMATNRFVCEICNKG  93

Query  1150  FQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHF  971
             FQR+QNLQLHRRGHNLPWKLKQR  +EV +++VYVCPE +C  H PS+ALGDL+GIKKHF
Sbjct  94    FQRDQNLQLHRRGHNLPWKLKQRTSKEV-RKKVYVCPEPSCVHHDPSRALGDLTGIKKHF  152

Query  970   CRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA-  794
             CRKHG + +KC+KC+K YAVQ DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A 
Sbjct  153   CRKHGEKKWKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDAL  212

Query  793   SQaltvtapsaspppqpptpSMAVLSPTLSLHSIQSFELPEDRVMGGANYKERTQAP---  623
             ++     A +       P+ S   L P  + H +Q+F L  ++     ++ +R++ P   
Sbjct  213   AEESARAANTLLSTQPGPSTSHINLQPQFNSHDLQAFSLKREQQQQQLHFNQRSEVPPWL  272

Query  622   ---SSSFGLVIGDNGEEDFSSVFRLSLRSGNEEEATPACAAIMERpvplllstpppVYHA  452
                S   G   G    +  SS+F   L    ++E +    +  +       +   P YH 
Sbjct  273   ACSSVVLGAGPGPPPIDLSSSIFSTRL----DQEFSRTQPSTHQENFNSSPTPSLPPYHP  328

Query  451   SNPPVLSATALLQKAAEM  398
                P +SATALLQKAA+M
Sbjct  329   LASPHMSATALLQKAAQM  346



>ref|XP_010242234.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X1 [Nelumbo 
nucifera]
Length=541

 Score =   276 bits (705),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/318 (47%), Positives = 199/318 (63%), Gaps = 12/318 (4%)
 Frame = -1

Query  1330  RQMTTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKG  1151
             R  T  L  ++S     QT   K+KR+ PG PD + EVIALSP++L+ TNR+VC++C KG
Sbjct  34    RAETGTLYPQQSFASPNQTQVVKKKRNLPGNPDPDAEVIALSPRTLMATNRFVCEICNKG  93

Query  1150  FQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHF  971
             FQR+QNLQLHRRGHNLPWKLKQR  +EV +++VYVCPE +C  H PS+ALGDL+GIKKHF
Sbjct  94    FQRDQNLQLHRRGHNLPWKLKQRTSKEV-RKKVYVCPEPSCVHHDPSRALGDLTGIKKHF  152

Query  970   CRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA-  794
             CRKHG + +KC+KC+K YAVQ DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A 
Sbjct  153   CRKHGEKKWKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDAL  212

Query  793   SQaltvtapsaspppqpptpSMAVLSPTLSLHSIQSFELPEDRVMGGANYKERTQAP---  623
             ++     A +       P+ S   L P  + H +Q+F L  ++     ++ +R++ P   
Sbjct  213   AEESARAANTLLSTQPGPSTSHINLQPQFNSHDLQAFSLKREQQQQQLHFNQRSEVPPWL  272

Query  622   ---SSSFGLVIGDNGEEDFSSVFRLSLRSGNEEEATPACAAIMERpvplllstpppVYHA  452
                S   G   G    +  SS+F   L    ++E +    +  +       +   P YH 
Sbjct  273   ACSSVVLGAGPGPPPIDLSSSIFSTRL----DQEFSRTQPSTHQENFNSSPTPSLPPYHP  328

Query  451   SNPPVLSATALLQKAAEM  398
                P +SATALLQKAA+M
Sbjct  329   LASPHMSATALLQKAAQM  346



>ref|XP_006473473.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X1 [Citrus 
sinensis]
 ref|XP_006473474.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X2 [Citrus 
sinensis]
Length=476

 Score =   272 bits (696),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 171/394 (43%), Positives = 228/394 (58%), Gaps = 39/394 (10%)
 Frame = -1

Query  1279  QTVKP--KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHN  1106
             Q + P  K+KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHN
Sbjct  29    QVIPPTQKKKRNLPGMPDPDSEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHN  88

Query  1105  LPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCN  926
             LPWKLKQR  +EV +++VYVCPE+TC  H+P++ALGDL+GIKKHF RKHG + +KCE+C+
Sbjct  89    LPWKLKQRNSKEV-RKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCS  147

Query  925   KMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYASQaltvtapsaspppq  746
             K YAVQ DWKAHMKTCGTR+Y CDCG +F+R+DSFI H+  C A    +    + +    
Sbjct  148   KKYAVQSDWKAHMKTCGTREYKCDCGTIFSRRDSFITHRAFCDALAEESARTRTPAIEGN  207

Query  745   pptp-------------SMAVLSPTLSLHSIQSFELPEDRVMGGANYKERTQAPSSS---  614
             P                S  V+SP L   SIQS E+P D  +  +  +     PS+S   
Sbjct  208   PNAKTVVSSPPPPPLTPSTGVVSPGL---SIQSSEVPADNPLIHSPPRPVATTPSASTCT  264

Query  613   ---FGLVIGDN---------GEEDFSSVFRLSLRSGNEEEATPACAAIMERpvplllstp  470
                F  V   +         G   FS+   +S         + + +  +          P
Sbjct  265   STVFASVFSSSAISQPTQATGPSSFSNQISVSSTGIEPTSLSLSPSLYLSSNNLFSKPEP  324

Query  469   ppVYHASNP-PVLSATALLQKAAEMgssfssggsfFAGYGLTMPATPA---QWGMHanap  302
               +++A +P P +SATALLQKAA++G+S SS      G GLTM ++ A   Q   ++ + 
Sbjct  325   SHIHYAPSPQPAMSATALLQKAAQIGASSSSPSLLR-GLGLTMSSSSADNQQENTNSASA  383

Query  301   elalelalrpasaaatafAGSVFSSHRQTLDFLG  200
                L L L      A     S+F S   TLD LG
Sbjct  384   AAGLGLGLNSGFTDAMMDPSSLFGSKPTTLDLLG  417



>ref|NP_192176.1| indeterminate-domain 12 protein [Arabidopsis thaliana]
 sp|O22759.2|IDD12_ARATH RecName: Full=Protein indeterminate-domain 12 [Arabidopsis thaliana]
 gb|AAC78253.1| putative zinc finger protein [Arabidopsis thaliana]
 emb|CAB77752.1| putative zinc finger protein [Arabidopsis thaliana]
 dbj|BAH30510.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82212.1| indeterminate-domain 12 protein [Arabidopsis thaliana]
Length=402

 Score =   269 bits (687),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = -1

Query  1279  QTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLP  1100
             +T KPK+KR  PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLP
Sbjct  48    ETHKPKKKRGLPGNPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLP  107

Query  1099  WKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKM  920
             WKLKQ+  +E  K++VYVCPET C+ HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K 
Sbjct  108   WKLKQKNTKEQQKKKVYVCPETNCAHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKF  167

Query  919   YAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             YAVQ DWKAH K CGTRDY CDCG LF+RKD+FI H+  C A
Sbjct  168   YAVQSDWKAHTKICGTRDYRCDCGTLFSRKDTFITHRAFCDA  209



>ref|XP_008220893.1| PREDICTED: zinc finger protein NUTCRACKER-like [Prunus mume]
Length=516

 Score =   271 bits (693),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 162/347 (47%), Positives = 206/347 (59%), Gaps = 44/347 (13%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD E EVIALSP +LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  39    KKKRNLPGMPDPEAEVIALSPTTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  98

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPET+C  H+P++ALGDL+GIKKHFCRKHG + +KCE+C+K YAVQ 
Sbjct  99    RTTKEV-RKRVYVCPETSCVHHNPTRALGDLTGIKKHFCRKHGEKKWKCERCSKKYAVQS  157

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA-----------------------  794
             DWKAHMKTCGTR+Y CDCG LF+R+DSFI H+  C A                       
Sbjct  158   DWKAHMKTCGTREYRCDCGTLFSRRDSFITHRAFCDALAEESAKAQTLAIDGSDGNQNLN  217

Query  793   --SQaltvtapsaspppqpptpSMAVLSPTLSLHSIQSFELPEDRVMGGANYKERTQAPS  620
               S         ASPPP P TPS  V+SP LS+ S  SF         G++      APS
Sbjct  218   NHSPNPNAKGVVASPPPPPLTPSNTVVSPALSIQSSGSFSFQTGNCNNGSSVFASIFAPS  277

Query  619   SSFGLVIGDNGEEDFSSVFRLSLRSGNEEEAT--PACAAIMERpvplllstpppVY----  458
             ++  L+         SS        G  + +T  P  ++I E     L ++         
Sbjct  278   TASALISQPPQTSSPSSFSNQVSTLGRPDGSTTIPTVSSINEPTSLSLSTSLYLSSNGSS  337

Query  457   -----------HASNPPVLSATALLQKAAEMgssfssggsfFAGYGL  350
                        H + P V+SATALLQKAA+MG++ S+      G+GL
Sbjct  338   LFPTPEPQDHRHYAQPAVMSATALLQKAAQMGAAASNASLLR-GFGL  383



>ref|XP_007201015.1| hypothetical protein PRUPE_ppa005468mg [Prunus persica]
 gb|EMJ02214.1| hypothetical protein PRUPE_ppa005468mg [Prunus persica]
Length=460

 Score =   268 bits (685),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = -1

Query  1321  TTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQR  1142
             T + P +   Q  + T K K+KRS PG PD + EVIALSPK+LL TNR+VC++C KGFQR
Sbjct  32    TNISPHQSDHQHQQPTNKIKKKRSLPGNPDPDAEVIALSPKTLLATNRFVCEICNKGFQR  91

Query  1141  EQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRK  962
             +QNLQLHRRGHNLPWKLKQR  ++ +++R YVCPE +C  HHPS+ALGDL+GIKKHFCRK
Sbjct  92    DQNLQLHRRGHNLPWKLKQRNNKDQIRKRAYVCPEPSCVHHHPSRALGDLTGIKKHFCRK  151

Query  961   HGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             HG + +KC+KC+K+YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  152   HGEKKWKCDKCSKIYAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  207



>ref|XP_010245572.1| PREDICTED: zinc finger protein MAGPIE-like [Nelumbo nucifera]
Length=455

 Score =   268 bits (685),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 156/331 (47%), Positives = 191/331 (58%), Gaps = 43/331 (13%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  28    KKKRNLPGNPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLRQ  87

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E  K+RVYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  88    RTSKEP-KKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  146

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVC--YASQaltvtapsaspppqpptpS  731
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C   A +   VTA            S
Sbjct  147   DWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCEALAEETARVTAAYKMNNANAGNIS  206

Query  730   MAVLSPTLSLHSIQSFE-----LPE-----DRVMGG----------------ANYKERTQ  629
                +  +L  + +Q F      +P      D+   G                 N  E  Q
Sbjct  207   YPFMGTSLRSNMVQHFSSVFKPIPSSNGAMDQTRPGLSLWMDQESQTNQAMSNNLTELHQ  266

Query  628   APSSSFGLVIGD------NGEEDFSSVFRLSLRSGNEEE---ATPACAAIME----Rpvp  488
               SSS G V  D      + +   +  F   L S N  E    TP    + E    R   
Sbjct  267   MGSSSIGTVYADPFSNPPHTDYQVNWAFGNKLSSTNAGELTSTTPPLTNLKEVGSPRLAS  326

Query  487   lllstpppVYHASNPP-VLSATALLQKAAEM  398
                      YH   PP ++SATALLQKAAE+
Sbjct  327   APSLYSTQHYHHQLPPAIMSATALLQKAAEI  357



>ref|XP_004291889.1| PREDICTED: zinc finger protein MAGPIE-like [Fragaria vesca subsp. 
vesca]
Length=510

 Score =   269 bits (688),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 147/183 (80%), Gaps = 1/183 (1%)
 Frame = -1

Query  1342  MEDPRQMTTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDV  1163
             M+D    ++++    SA+ S      K+KR+ PGMPD + EVIALSPK+L+ TNR+VC++
Sbjct  1     MDDLDNSSSLVDSTASAEASFSEPPAKKKRNLPGMPDPDAEVIALSPKTLMATNRFVCEI  60

Query  1162  CGKGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGI  983
             C KGFQR+QNLQLHRRGHNLPWKL+QR   EV K+RVYVCPET+C  H+P++ALGDL+GI
Sbjct  61    CNKGFQRDQNLQLHRRGHNLPWKLRQRTTTEV-KKRVYVCPETSCVHHNPARALGDLTGI  119

Query  982   KKHFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRV  803
             KKHFCRKHG + +KCE+C+K YAVQ DWKAHMKTCGTR+Y CDCG LFAR+DSFI H+  
Sbjct  120   KKHFCRKHGEKKWKCERCSKKYAVQSDWKAHMKTCGTREYKCDCGTLFARRDSFITHRAF  179

Query  802   CYA  794
             C A
Sbjct  180   CDA  182



>ref|XP_009612371.1| PREDICTED: zinc finger protein JACKDAW-like [Nicotiana tomentosiformis]
Length=492

 Score =   269 bits (687),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 153/342 (45%), Positives = 199/342 (58%), Gaps = 31/342 (9%)
 Frame = -1

Query  1333  PRQMTTVLPGEESAQLSEQTVKP---KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDV  1163
             P  +  VLP  E          P   KR+R+ PG PD + EVIALSPKSL+ TNR++C++
Sbjct  10    PSSVKAVLPHHELQTNPNPKPNPASSKRRRNLPGTPDPDAEVIALSPKSLMATNRFLCEI  69

Query  1162  CGKGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGI  983
             C KGFQR+QNLQLHRRGHNLPWKLKQR  +E+VK++VY+CPE TC  H  S+ALGDL+GI
Sbjct  70    CNKGFQRDQNLQLHRRGHNLPWKLKQRNKDEIVKKKVYICPEKTCIHHDASRALGDLTGI  129

Query  982   KKHFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRV  803
             KKHF RKHG + +KCEKC+K YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  
Sbjct  130   KKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAF  189

Query  802   CYA-SQaltvtapsaspppqpptpSMAVLSPTLSLHSIQ---SFELPEDRVMG-GANYKE  638
             C A ++  +      +     P  +  +L+   SLH I    +F  P+   M  G +  +
Sbjct  190   CDALAEESSRITSVGANNMNFPNTNDTLLNQQSSLHGISQIGTFYRPDFASMATGNSLHQ  249

Query  637   RTQAPSSSFGLVIGDN-----------------GEEDF-----SSVFRLSLRSGNEEEAT  524
             + Q P  S  L   +N                 G  D      S+VF  S  + N   ++
Sbjct  250   QQQKPRLSLWLDQANNPLQTSANSNIFESTTTSGFVDMIQMPSSNVFGSSSTAANFSLSS  309

Query  523   PACAAIMERpvplllstpppVYHASNPPVLSATALLQKAAEM  398
                 ++ E    L   +       S+ P +SATALLQKAA+M
Sbjct  310   SQGTSMAETLSSLYSDSQNNHLTKSSTP-MSATALLQKAAQM  350



>ref|XP_009805010.1| PREDICTED: zinc finger protein JACKDAW-like isoform X3 [Nicotiana 
sylvestris]
Length=443

 Score =   267 bits (683),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 143/183 (78%), Gaps = 2/183 (1%)
 Frame = -1

Query  1342  MEDPRQMTTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDV  1163
             ME+   MT      E   +++Q    K+KR+ PG PD E EVIALSPK+L+ TNR+VC++
Sbjct  4     MENSSSMTVAGSSLEET-ITQQNFPVKKKRNLPGNPDPEAEVIALSPKALMATNRFVCEI  62

Query  1162  CGKGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGI  983
             C KGFQR+QNLQLHRRGHNLPWKL+QR  +EV K+RVYVCPE TC  H PS+ALGDL+GI
Sbjct  63    CNKGFQRDQNLQLHRRGHNLPWKLRQRTSKEV-KKRVYVCPEATCIHHDPSRALGDLTGI  121

Query  982   KKHFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRV  803
             KKHFCRKHG + FKCE+C K YAVQ DWKAHMKTCGTR+Y CDCG LF+R+DSF+ H+  
Sbjct  122   KKHFCRKHGEKKFKCERCTKKYAVQSDWKAHMKTCGTREYRCDCGTLFSRRDSFVTHRAF  181

Query  802   CYA  794
             C A
Sbjct  182   CDA  184



>ref|XP_011074522.1| PREDICTED: zinc finger protein NUTCRACKER-like [Sesamum indicum]
Length=538

 Score =   269 bits (688),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = -1

Query  1300  ESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLH  1121
             +S QL+E     K+KRS PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLH
Sbjct  28    KSDQLAETAQPTKKKRSLPGMPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLH  87

Query  1120  RRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFK  941
             RRGHNLPWKL+QR  +EV ++RVYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +K
Sbjct  88    RRGHNLPWKLRQRTSKEV-RKRVYVCPEPTCIHHDPSRALGDLTGIKKHFCRKHGEKKYK  146

Query  940   CEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             CE+C+K YAV  DWKAHMKTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  147   CERCSKKYAVHSDWKAHMKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  195



>gb|KHG04949.1| Zinc finger MAGPIE -like protein [Gossypium arboreum]
Length=522

 Score =   269 bits (687),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 144/175 (82%), Gaps = 1/175 (1%)
 Frame = -1

Query  1318  TVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQRE  1139
             T   GE SA  +++ +  K+KR+ PG PD E EVIALSPK+LL TNR++C++C KGFQR+
Sbjct  15    TSTSGEVSASTNQEPLS-KKKRNLPGNPDPETEVIALSPKTLLATNRFICEICNKGFQRD  73

Query  1138  QNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKH  959
             QNLQLHRRGHNLPWKLKQR  +EVV+++VYVCPETTC  HHPS+ALGDL+GIKKHFCRKH
Sbjct  74    QNLQLHRRGHNLPWKLKQRTKKEVVRKKVYVCPETTCVHHHPSRALGDLTGIKKHFCRKH  133

Query  958   GHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             G + +KCEKC+K YAVQ DWK+H K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  134   GEKKWKCEKCSKRYAVQSDWKSHSKICGTREYRCDCGNLFSRRDSFITHRAFCDA  188



>ref|XP_009805007.1| PREDICTED: zinc finger protein MAGPIE-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009805008.1| PREDICTED: zinc finger protein MAGPIE-like isoform X1 [Nicotiana 
sylvestris]
Length=501

 Score =   268 bits (684),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 143/183 (78%), Gaps = 2/183 (1%)
 Frame = -1

Query  1342  MEDPRQMTTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDV  1163
             ME+   MT      E   +++Q    K+KR+ PG PD E EVIALSPK+L+ TNR+VC++
Sbjct  4     MENSSSMTVAGSSLEET-ITQQNFPVKKKRNLPGNPDPEAEVIALSPKALMATNRFVCEI  62

Query  1162  CGKGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGI  983
             C KGFQR+QNLQLHRRGHNLPWKL+QR  +EV K+RVYVCPE TC  H PS+ALGDL+GI
Sbjct  63    CNKGFQRDQNLQLHRRGHNLPWKLRQRTSKEV-KKRVYVCPEATCIHHDPSRALGDLTGI  121

Query  982   KKHFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRV  803
             KKHFCRKHG + FKCE+C K YAVQ DWKAHMKTCGTR+Y CDCG LF+R+DSF+ H+  
Sbjct  122   KKHFCRKHGEKKFKCERCTKKYAVQSDWKAHMKTCGTREYRCDCGTLFSRRDSFVTHRAF  181

Query  802   CYA  794
             C A
Sbjct  182   CDA  184



>ref|NP_001280800.1| zinc finger protein NUTCRACKER-like [Malus domestica]
 gb|ADL36639.1| C2H2L domain class transcription factor [Malus domestica]
Length=541

 Score =   268 bits (686),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD E EVIALSP +LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  40    KKKRNLPGMPDPEAEVIALSPTTLLATNRFVCEICSKGFQRDQNLQLHRRGHNLPWKLKQ  99

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPET+C  HHP++ALGDL+GIKKHFCRKHG + +KCE+C+K YAVQ 
Sbjct  100   RTSKEV-RKRVYVCPETSCVHHHPTRALGDLTGIKKHFCRKHGEKKWKCERCSKKYAVQS  158

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAHMKTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  159   DWKAHMKTCGTREYKCDCGTLFSRRDSFITHRAFCDA  195



>ref|XP_009338257.1| PREDICTED: zinc finger protein JACKDAW-like [Pyrus x bretschneideri]
Length=433

 Score =   265 bits (677),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKRS PG PD E EVIA+SPKSL+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  35    KRKRSLPGTPDPEAEVIAMSPKSLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  94

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   EV++++VYVCPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  95    RSKTEVIRKKVYVCPEKTCVHHEPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  154

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  155   DWKAHSKVCGTREYRCDCGTLFSRKDSFITHRAFCDA  191



>ref|XP_004146819.1| PREDICTED: zinc finger protein MAGPIE-like [Cucumis sativus]
 gb|KGN59816.1| hypothetical protein Csa_3G848250 [Cucumis sativus]
Length=527

 Score =   268 bits (684),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = -1

Query  1312  LPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQN  1133
             +P   S Q       PK+KR+ PG PD + EVIALSPK+L+ TNR+VC++C KGFQR+QN
Sbjct  39    IPTNYSGQFFSTPPPPKKKRNLPGNPDPDAEVIALSPKTLMATNRFVCEICSKGFQRDQN  98

Query  1132  LQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGH  953
             LQLHRRGHNLPWKLKQR  +EV++++VYVCPET+C  H PS+ALGDL+GIKKHFCRKHG 
Sbjct  99    LQLHRRGHNLPWKLKQRANKEVIRKKVYVCPETSCVHHDPSRALGDLTGIKKHFCRKHGE  158

Query  952   RTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             + +KC+KC+K YAVQ DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  159   KKWKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  211



>ref|XP_010038657.1| PREDICTED: zinc finger protein JACKDAW-like [Eucalyptus grandis]
 gb|KCW84646.1| hypothetical protein EUGRSUZ_B01471 [Eucalyptus grandis]
Length=485

 Score =   266 bits (681),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 148/183 (81%), Gaps = 3/183 (2%)
 Frame = -1

Query  1339  EDPRQMTTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVC  1160
             + P+Q+ T +    ++   +Q  K ++KRS PG PD + EVIALSPK+L+ TNR+VC++C
Sbjct  48    QQPQQLITTV--HNNSPQHQQQKKIRKKRSLPGNPDPDAEVIALSPKTLMATNRFVCEIC  105

Query  1159  GKGFQREQNLQLHRRGHNLPWKLKQR-GPEEVVKRRVYVCPETTCSRHHPSKALGDLSGI  983
              KGFQR+QNLQLHRRGHNLPWKLKQR G ++VV++R YVCPE TC  HHPS+ALGDL+GI
Sbjct  106   NKGFQRDQNLQLHRRGHNLPWKLKQRSGKDQVVRKRAYVCPEPTCVHHHPSRALGDLTGI  165

Query  982   KKHFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRV  803
             KKH+CRKHG + +KCEKC+K+YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSF+ H+  
Sbjct  166   KKHYCRKHGEKKWKCEKCSKIYAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFVTHRAF  225

Query  802   CYA  794
             C A
Sbjct  226   CDA  228



>ref|XP_008358430.1| PREDICTED: zinc finger protein JACKDAW-like [Malus domestica]
 ref|XP_008358437.1| PREDICTED: zinc finger protein JACKDAW-like [Malus domestica]
 ref|XP_008358444.1| PREDICTED: zinc finger protein JACKDAW-like [Malus domestica]
Length=432

 Score =   265 bits (676),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKRS PG PD + EVIA+SPKSL+ TNR+VC+VC KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  35    KRKRSLPGTPDPDAEVIAMSPKSLMATNRFVCEVCNKGFQRDQNLQLHRRGHNLPWKLKQ  94

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   EV++++VYVCPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  95    RSKTEVIRKKVYVCPEKTCVHHEPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  154

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  155   DWKAHSKVCGTREYRCDCGTLFSRKDSFITHRAFCDA  191



>ref|XP_008465570.1| PREDICTED: zinc finger protein NUTCRACKER-like, partial [Cucumis 
melo]
Length=529

 Score =   268 bits (684),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = -1

Query  1312  LPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQN  1133
             +P   S Q       PK+KR+ PG PD + EVIALSPK+L+ TNR+VC++C KGFQR+QN
Sbjct  39    IPTNYSGQFFSTPPPPKKKRNLPGNPDPDAEVIALSPKTLMATNRFVCEICSKGFQRDQN  98

Query  1132  LQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGH  953
             LQLHRRGHNLPWKLKQR  +EV++++VYVCPET+C  H PS+ALGDL+GIKKHFCRKHG 
Sbjct  99    LQLHRRGHNLPWKLKQRANKEVIRKKVYVCPETSCVHHDPSRALGDLTGIKKHFCRKHGE  158

Query  952   RTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             + +KC+KC+K YAVQ DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  159   KKWKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  211



>ref|XP_009778699.1| PREDICTED: zinc finger protein JACKDAW-like [Nicotiana sylvestris]
Length=491

 Score =   266 bits (681),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 150/342 (44%), Positives = 197/342 (58%), Gaps = 32/342 (9%)
 Frame = -1

Query  1333  PRQMTTVLPGEESAQLSEQTVKP---KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDV  1163
             P  +  VLP  E          P   K++R+ PG PD + EVIALSPKSL+ TNR++C++
Sbjct  10    PSSVKAVLPQHELQTNPNPRPNPSSSKKRRNLPGTPDPDAEVIALSPKSLMATNRFLCEI  69

Query  1162  CGKGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGI  983
             C KGFQR+QNLQLHRRGHNLPWKLKQR  +E+VK++VY+CPE TC  H  S+ALGDL+GI
Sbjct  70    CNKGFQRDQNLQLHRRGHNLPWKLKQRNKDEIVKKKVYICPEKTCIHHDASRALGDLTGI  129

Query  982   KKHFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRV  803
             KKHF RKHG + +KCEKC+K YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  
Sbjct  130   KKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAF  189

Query  802   CYA-SQaltvtapsaspppqpptpSMAVLSPTLSLHSIQ---SFELPEDRVMGGANYKER  635
             C A ++  +      +     P  +  +L+   +LH I    +F  PE     G +  ++
Sbjct  190   CDALAEESSRITSVGANNMNFPNINDTLLNQQSNLHGISQIGTFYRPE--FGNGNSLNQQ  247

Query  634   TQAPSSSFGLVIGDN------------------GEEDF-----SSVFRLSLRSGNEEEAT  524
              Q P  S  L   +N                  G  D      S+VF  S    N   ++
Sbjct  248   QQKPRLSLWLDQANNNPLQMSANSNLFESTTTSGFVDMMQMPSSNVFGSSSTVANFSLSS  307

Query  523   PACAAIMERpvplllstpppVYHASNPPVLSATALLQKAAEM  398
                 ++ E    L   +    + A +   +SATALLQKAA+M
Sbjct  308   SQGTSMAETLSSLYSDSTQNNHLAKSSTPMSATALLQKAAQM  349



>ref|XP_007017487.1| C2H2-like zinc finger protein [Theobroma cacao]
 gb|EOY14712.1| C2H2-like zinc finger protein [Theobroma cacao]
Length=496

 Score =   266 bits (681),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 152/338 (45%), Positives = 196/338 (58%), Gaps = 61/338 (18%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ PGMPD + EVIALSPKSLL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+
Sbjct  39    PKKKRNLPGMPDPDAEVIALSPKSLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLR  98

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             QR  +E+ ++RVYVCPE +C  H+P++ALGDL+GIKKHFCRKHG + +KCE+C+K YAVQ
Sbjct  99    QRTSKEI-RKRVYVCPEPSCVHHNPARALGDLTGIKKHFCRKHGEKKWKCERCSKKYAVQ  157

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA----------------------  794
              DWKAHMKTCGTR+Y CDCG +F+R+DSFI H+  C A                      
Sbjct  158   SDWKAHMKTCGTREYKCDCGTIFSRRDSFITHRAFCDALAEESARAQTLAIANTEGNVNV  217

Query  793   --------SQaltvtapsaspppqpptpSMAVLSPTLSLHSIQSFELPEDRVMGGANYKE  638
                        +   A ++ PP      + +V+SP L   SIQS E+P D  MG      
Sbjct  218   SGNGNGNGKTMVGGAAATSPPPQPLTPSTASVVSPGL---SIQSSEIP-DNPMG------  267

Query  637   RTQAPSSSFGLVIGDNGEEDFSSVFRLSLRSGNEEEATPA--CAAIMERpvplllstppp  464
                +P +        +    F+S+F  + +       +P    AA +ER    L S    
Sbjct  268   --LSPPTPAATSTSTSNSNVFASIFAPNSQPSKIPAPSPIFRSAAPLERTSLSLSSPLYL  325

Query  463   V----------------YHASNPPVLSATALLQKAAEM  398
                              Y  S  P +SATALLQKAA+M
Sbjct  326   SNNGSSIFTGPEHDHCHYAPSPQPAMSATALLQKAAQM  363



>ref|XP_006342212.1| PREDICTED: zinc finger protein MAGPIE-like [Solanum tuberosum]
Length=293

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 137/171 (80%), Gaps = 1/171 (1%)
 Frame = -1

Query  1306  GEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQ  1127
             G     +++Q    KR+R+ PG PD E EVIALSPK+L+ TNR+VC++C KGFQR+QNLQ
Sbjct  11    GSLEESITQQNFPVKRRRNLPGNPDPEAEVIALSPKTLMATNRFVCEICNKGFQRDQNLQ  70

Query  1126  LHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRT  947
             LHRRGHNLPWKL+QR   EV K+RVYVCPE++C  H PS+ALGDL+GIKKHFCRKHG + 
Sbjct  71    LHRRGHNLPWKLRQRTSNEV-KKRVYVCPESSCVHHDPSRALGDLTGIKKHFCRKHGEKK  129

Query  946   FKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             FKCE+C K YAV  DWKAHMKTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  130   FKCERCTKKYAVHSDWKAHMKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  180



>ref|XP_002510356.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF52543.1| nucleic acid binding protein, putative [Ricinus communis]
Length=502

 Score =   266 bits (681),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 136/158 (86%), Gaps = 1/158 (1%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLK
Sbjct  38    PKKKRNLPGMPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLK  97

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             QR  +E +KR VYVCPE +C  H+P++ALGDL+GIKKHFCRKHG + +KCE+C+K YAVQ
Sbjct  98    QRTSKEPIKR-VYVCPEASCVHHNPARALGDLTGIKKHFCRKHGEKKWKCERCSKKYAVQ  156

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAHMKTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  157   SDWKAHMKTCGTREYKCDCGTLFSRRDSFITHRAFCDA  194



>ref|XP_007225628.1| hypothetical protein PRUPE_ppa003844mg [Prunus persica]
 gb|EMJ26827.1| hypothetical protein PRUPE_ppa003844mg [Prunus persica]
Length=544

 Score =   268 bits (684),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 137/158 (87%), Gaps = 1/158 (1%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ PGMPD E EVIALSP +LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+
Sbjct  38    PKKKRNLPGMPDPEAEVIALSPTTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLR  97

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             QR  +E+ ++RVYVCPET+C  H+P++ALGDL+GIKKHFCRKHG + +KCE+C+K YAVQ
Sbjct  98    QRTTKEI-RKRVYVCPETSCVHHNPTRALGDLTGIKKHFCRKHGEKKWKCERCSKKYAVQ  156

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAHMKTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  157   SDWKAHMKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  194



>ref|XP_004290634.1| PREDICTED: zinc finger protein NUTCRACKER-like [Fragaria vesca 
subsp. vesca]
Length=446

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  1270  KPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKL  1091
             K K+KRS PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL
Sbjct  51    KIKKKRSLPGNPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKL  110

Query  1090  KQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAV  911
             KQR  +++VK+R YVCPE +C  HHPS+ALGDL+GIKKHFCRKHG + +KC+KC+K+YAV
Sbjct  111   KQRSSKDLVKKRAYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKIYAV  170

Query  910   QCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             Q DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  171   QSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  209



>ref|XP_010262086.1| PREDICTED: zinc finger protein NUTCRACKER isoform X2 [Nelumbo 
nucifera]
Length=493

 Score =   266 bits (680),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 152/312 (49%), Positives = 196/312 (63%), Gaps = 15/312 (5%)
 Frame = -1

Query  1303  EESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQL  1124
             ++S     QT   K+KR+ PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQL
Sbjct  44    QQSFASPNQTPVVKKKRNLPGNPDPDAEVIALSPKALLATNRFVCEICSKGFQRDQNLQL  103

Query  1123  HRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTF  944
             HRRGHNLPWKLKQR  +EV K+RVYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +
Sbjct  104   HRRGHNLPWKLKQRTSKEV-KKRVYVCPEPTCVHHDPSRALGDLTGIKKHFCRKHGEKKW  162

Query  943   KCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA----SQaltv  776
             KC+KC+K YAVQ DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A    S     
Sbjct  163   KCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDALAEESARAIT  222

Query  775   tapsaspppqpptpSMAVLSPTLSLHSIQSFELP-EDRVMGGANYKERTQAP-----SSS  614
             T P  +P P   T  + +    ++ H +Q+  L  E +      +  R+  P     SS 
Sbjct  223   TNPLLAPQPGSSTSHINLQPQLINNHDLQALSLKREQQQQQQQLFNLRSDTPPWLACSSV  282

Query  613   FGLVIGDNGEEDFSSVFRLSLRSGNEEEATPACAAIMERpvplllstpppVYHASNPPVL  434
              G   G    +  SS+F   +    ++E +    +I    +    +   P Y+ S  P +
Sbjct  283   VGAGPGPPPIDFSSSLFSTRI----DQEFSRTQPSIHHENLNPNPTPSLPPYNPSASPHM  338

Query  433   SATALLQKAAEM  398
             SATALLQKAA+M
Sbjct  339   SATALLQKAAQM  350



>ref|XP_008673471.1| PREDICTED: zinc finger protein NUTCRACKER-like [Zea mays]
Length=399

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 145/302 (48%), Positives = 185/302 (61%), Gaps = 40/302 (13%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD   EVIALSP++LL TNR+VC++CGKGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  42    KKKRNLPGTPDPAAEVIALSPRTLLATNRFVCEICGKGFQRDQNLQLHRRGHNLPWKLRQ  101

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   +  ++RVYVCPE TC  H+PS+ALGDL+GIKKHFCRKHG + +KC+KCNK YAVQ 
Sbjct  102   RSAGKEPRKRVYVCPEKTCVHHNPSRALGDLTGIKKHFCRKHGEKKWKCDKCNKRYAVQS  161

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYASQaltvtapsaspppqpptpSMA  725
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A                    + A
Sbjct  162   DWKAHAKTCGTREYRCDCGTLFSRRDSFITHRAFCDA---------------LAEETAYA  206

Query  724   VLSP---TLSLHSIQSFELPEDRVM-GGAN---YKERTQAPSSSFGLVIGDNGEEDFSSV  566
              L P    LSL S+         +M  GA    Y +         G + G+NG+   S+ 
Sbjct  207   PLGPHVGDLSLPSMVGHIGANGSIMLPGAPPQLYADLFAPAPPQLGWLCGNNGKLASSNA  266

Query  565   FRLSLRSGNEEEATPACAAIMERpvplllstpppVYHASNPPV------LSATALLQKAA  404
               L+  + + ++ T +  ++  R             HA NP V      +SATALLQKAA
Sbjct  267   SELTSAAASGKQETDSVLSMFSRQQ-----------HA-NPAVAGAGDMMSATALLQKAA  314

Query  403   EM  398
             +M
Sbjct  315   QM  316



>ref|XP_009612196.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009612198.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X1 [Nicotiana 
tomentosiformis]
Length=500

 Score =   266 bits (680),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 142/183 (78%), Gaps = 2/183 (1%)
 Frame = -1

Query  1342  MEDPRQMTTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDV  1163
             ME+   MT      E   +++Q    K+KR+ PG PD E EVIALSPK+L+ TNR+VC++
Sbjct  4     MENSSSMTVAGSSLEET-ITQQNFPVKKKRNLPGNPDPEAEVIALSPKTLMATNRFVCEI  62

Query  1162  CGKGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGI  983
             C KGFQR+QNLQLHRRGHNLPWKL+QR  +EV K+RVYVCPE  C  H PS+ALGDL+GI
Sbjct  63    CNKGFQRDQNLQLHRRGHNLPWKLRQRTSKEV-KKRVYVCPEAMCVHHDPSRALGDLTGI  121

Query  982   KKHFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRV  803
             KKHFCRKHG + FKCE+C K YAVQ DWKAHMKTCGTR+Y CDCG LF+R+DSFI H+  
Sbjct  122   KKHFCRKHGEKKFKCERCTKKYAVQSDWKAHMKTCGTREYRCDCGTLFSRRDSFITHRAF  181

Query  802   CYA  794
             C A
Sbjct  182   CDA  184



>ref|XP_008235356.1| PREDICTED: zinc finger protein MAGPIE [Prunus mume]
Length=461

 Score =   265 bits (677),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = -1

Query  1321  TTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQR  1142
             T + P +   Q    T K K KRS PG PD + EVIALSPK+LL TNR+VC++C KGFQR
Sbjct  32    TNISPHQSDHQHPYPTNKIKMKRSLPGNPDPDAEVIALSPKTLLATNRFVCEICNKGFQR  91

Query  1141  EQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRK  962
             +QNLQLHRRGHNLPWKLKQR  ++ +++R YVCPE +C  HHPS+ALGDL+GIKKHFCRK
Sbjct  92    DQNLQLHRRGHNLPWKLKQRNNKDQIRKRAYVCPEPSCVHHHPSRALGDLTGIKKHFCRK  151

Query  961   HGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             HG + +KC+KC+K+YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  152   HGEKKWKCDKCSKIYAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  207



>ref|XP_011043608.1| PREDICTED: zinc finger protein NUTCRACKER-like [Populus euphratica]
Length=474

 Score =   265 bits (677),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  33    KKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  92

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV K+RVYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  93    RTNKEV-KKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  151

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  152   DWKAHSKTCGTREYKCDCGTLFSRRDSFITHRAFCDA  188



>emb|CBI21907.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 191/316 (60%), Gaps = 37/316 (12%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  28    KKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  87

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E  ++RVYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  88    RSSKEP-RKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  146

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVC--YASQaltvtapsaspppqpptpS  731
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C   A +   VTA S           
Sbjct  147   DWKAHTKTCGTREYKCDCGTLFSRRDSFITHRAFCDALAEETARVTAASNINNGTINYHF  206

Query  730   MAV-LSPTLSLH------SIQSFELPEDRV-------MG---------GANYKERTQAPS  620
             M   L+P++  H       I S +   D+        MG         G N +E  Q  S
Sbjct  207   MGTSLAPSMPQHFSSIFKPISSNDEATDQTRRGLSLWMGQGSQGHETMGTNLQEIHQLRS  266

Query  619   SSFGLVIGDNGEEDFSSVFRLSLRSGNEEEATPACAAIMERpvplllstpppVYHASNPP  440
             S       +N E+  +S   L L +  E   +   +           S     +H+   P
Sbjct  267   SMSPGSSSNNTEDQLTSSTSLPLSNVKEAAGSQIVSV---------PSLYSSQHHSHQTP  317

Query  439   V--LSATALLQKAAEM  398
             +  +SATALLQKAA+M
Sbjct  318   LGNMSATALLQKAAQM  333



>ref|XP_006361805.1| PREDICTED: zinc finger protein JACKDAW-like, partial [Solanum 
tuberosum]
Length=429

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 141/297 (47%), Positives = 185/297 (62%), Gaps = 13/297 (4%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K++R+ PG PD + EVIA+SPK+L+ TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  3     KKRRNLPGTPDPDAEVIAISPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLKQ  62

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E+VK++VY+CPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  63    RNKQEIVKKKVYICPEKTCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  122

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYASQaltvtapsaspppqpptpSMA  725
             DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A    +    S    P     +  
Sbjct  123   DWKAHTKTCGTREYKCDCGTLFSRKDSFITHRAFCDALAEESARITSVGTTPNNLNFNQQ  182

Query  724   VLSPTLSLHSIQSFELPEDRVMGGAN-YKERTQAPSSSFGLVIGDNGEEDFSSVFRL---  557
                P + +  I +  + +   M   N   +  Q P  S  L   +N     S++F L   
Sbjct  183   QQQP-VGISQIGTSFVQDFTSMTTVNPLHQHQQKPRLSLWLNQPNNMSSPSSNLFGLPDH  241

Query  556   ---SLRSGNEEEATPACAAIMERpvplllstpppVYHASNPPV-LSATALLQKAAEM  398
                 + S N        A+ +   +    +T       SNPP+ +SATALLQKAA+M
Sbjct  242   HMVQIPSPNMF----GTASSIGNQILTPTTTTTNTPATSNPPIPMSATALLQKAAQM  294



>ref|XP_010689779.1| PREDICTED: zinc finger protein MAGPIE [Beta vulgaris subsp. vulgaris]
Length=507

 Score =   266 bits (679),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = -1

Query  1285  SEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHN  1106
             S  T+ PK+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHN
Sbjct  20    SNDTLPPKKKRNLPGNPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHN  79

Query  1105  LPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCN  926
             LPWKLKQR  +E  ++RVYVCPE TC  +HPS+ALGDL+GIKKHFCRKHG + +KCEKCN
Sbjct  80    LPWKLKQRTSKEP-RKRVYVCPEKTCVHNHPSRALGDLTGIKKHFCRKHGEKKWKCEKCN  138

Query  925   KMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             K YAVQ DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  139   KKYAVQSDWKAHSKTCGTREYKCDCGTIFSRRDSFITHRAFCDA  182



>ref|XP_007050479.1| Indeterminate(ID)-domain 12 [Theobroma cacao]
 gb|EOX94636.1| Indeterminate(ID)-domain 12 [Theobroma cacao]
Length=438

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 136/162 (84%), Gaps = 1/162 (1%)
 Frame = -1

Query  1279  QTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLP  1100
             Q  K K+KRS PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLP
Sbjct  42    QPQKVKKKRSLPGNPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLP  101

Query  1099  WKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKM  920
             WKLKQR  +E+ K+R YVCPE TC  HHPS+ALGDL+GIKKH+CRKHG + +KCEKC+K+
Sbjct  102   WKLKQRNSKEI-KKRAYVCPEPTCVHHHPSRALGDLTGIKKHYCRKHGEKKWKCEKCSKI  160

Query  919   YAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  161   YAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  202



>ref|XP_006372765.1| zinc finger family protein [Populus trichocarpa]
 gb|ERP50562.1| zinc finger family protein [Populus trichocarpa]
Length=475

 Score =   265 bits (676),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  33    KKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  92

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV K+RVYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  93    RTNKEV-KKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  151

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  152   DWKAHSKTCGTREYKCDCGTLFSRRDSFITHRAFCDA  188



>gb|ADL36647.1| C2H2L domain class transcription factor [Malus domestica]
Length=478

 Score =   265 bits (676),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKRS PG PD + EVIA+SPKSL+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  35    KRKRSLPGTPDPDAEVIAMSPKSLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  94

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   EV++++VYVCPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  95    RSKTEVIRKKVYVCPEKTCVHHEPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  154

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  155   DWKAHSKVCGTREYRCDCGTLFSRKDSFITHRAFCDA  191



>ref|XP_004495164.1| PREDICTED: zinc finger protein MAGPIE-like [Cicer arietinum]
Length=356

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -1

Query  1285  SEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHN  1106
             S+Q  K K+KR+ PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHN
Sbjct  34    SQQPQKTKKKRNLPGNPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHN  93

Query  1105  LPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCN  926
             LPWKLKQR  +EV+K+R YVCPE +C  H+P +ALGDL+GIKKHF RKHG + +KC+KC+
Sbjct  94    LPWKLKQRNNKEVIKKRAYVCPEPSCVHHNPLRALGDLTGIKKHFSRKHGEKKWKCDKCS  153

Query  925   KMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             K+YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  154   KIYAVQSDWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDA  197



>ref|XP_008385294.1| PREDICTED: zinc finger protein JACKDAW-like [Malus domestica]
Length=478

 Score =   265 bits (676),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKRS PG PD + EVIA+SPKSL+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  35    KRKRSLPGTPDPDAEVIAMSPKSLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  94

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   EV++++VYVCPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  95    RSKTEVIRKKVYVCPEKTCVHHEPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  154

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  155   DWKAHSKVCGTREYRCDCGTLFSRKDSFITHRAFCDA  191



>ref|XP_008359126.1| PREDICTED: zinc finger protein JACKDAW-like [Malus domestica]
 ref|XP_008359127.1| PREDICTED: zinc finger protein JACKDAW-like [Malus domestica]
Length=478

 Score =   265 bits (676),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKRS PG PD + EVIA+SPKSL+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  35    KRKRSLPGTPDPDAEVIAMSPKSLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  94

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   EV++++VYVCPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  95    RSKTEVIRKKVYVCPEKTCVHHEPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  154

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  155   DWKAHSKVCGTREYRCDCGTLFSRKDSFITHRAFCDA  191



>ref|XP_011083713.1| PREDICTED: zinc finger protein NUTCRACKER-like [Sesamum indicum]
Length=548

 Score =   266 bits (681),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 141/167 (84%), Gaps = 2/167 (1%)
 Frame = -1

Query  1291  QLSEQTVKP-KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRR  1115
             Q +E  ++P K+KRS PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRR
Sbjct  36    QSAETILQPTKKKRSLPGMPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRR  95

Query  1114  GHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCE  935
             GHNLPWKL+QR  +++ ++RVYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +KCE
Sbjct  96    GHNLPWKLRQRTSKDI-RKRVYVCPEPTCVHHDPSRALGDLTGIKKHFCRKHGEKKYKCE  154

Query  934   KCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             +C+K YAVQ DWKAHMKTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  155   RCSKKYAVQSDWKAHMKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  201



>ref|XP_002872826.1| atidd12-domain 12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49085.1| atidd12-domain 12 [Arabidopsis lyrata subsp. lyrata]
Length=405

 Score =   262 bits (670),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  1279  QTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLP  1100
             +T K K++R  PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLP
Sbjct  50    ETHKTKKRRGLPGNPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLP  109

Query  1099  WKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKM  920
             WKLKQ+  +E  K++VYVCPET C  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K 
Sbjct  110   WKLKQKNSKEQQKKKVYVCPETNCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKF  169

Query  919   YAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             YAVQ DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  170   YAVQSDWKAHTKICGTREYRCDCGTLFSRKDSFITHRAFCDA  211



>ref|XP_010664668.1| PREDICTED: zinc finger protein JACKDAW-like isoform X2 [Vitis 
vinifera]
Length=503

 Score =   265 bits (677),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 162/219 (74%), Gaps = 10/219 (5%)
 Frame = -1

Query  1291  QLSEQTVKP-KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRR  1115
             Q + Q V P K+KR+ PG PD + EVIALSPK+L+ TNR+VC++C KGFQR+QNLQLHRR
Sbjct  27    QTAPQPVAPTKKKRNLPGTPDPDAEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRR  86

Query  1114  GHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCE  935
             GHNLPWKL+QR  +EV ++RVYVCPE TC  H P++ALGDL+GIKKHFCRKHG + +KCE
Sbjct  87    GHNLPWKLRQRTSKEV-RKRVYVCPEPTCVHHDPTRALGDLTGIKKHFCRKHGEKKWKCE  145

Query  934   KCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVC--YASQaltvtapsa  761
             +C+K YAVQ DWKAH+KTCGTR+Y CDCG LF+R+DSFI H+  C   A ++       +
Sbjct  146   RCSKKYAVQSDWKAHLKTCGTREYKCDCGTLFSRRDSFITHRAFCDALAQESARAQVLPS  205

Query  760   spppqpptpSMAV------LSPTLSLHSIQSFELPEDRV  662
             +   + P    AV      LSP+ ++ SIQS ++ E+ V
Sbjct  206   TNTEENPEIETAVSSSPTALSPSTTVLSIQSPDMTENPV  244



>ref|XP_006396480.1| hypothetical protein EUTSA_v10028701mg [Eutrema salsugineum]
 gb|ESQ37933.1| hypothetical protein EUTSA_v10028701mg [Eutrema salsugineum]
Length=405

 Score =   262 bits (669),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  1279  QTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLP  1100
             +T K K++R  PG PD E EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLP
Sbjct  45    ETQKTKKRRGIPGNPDPEAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLP  104

Query  1099  WKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKM  920
             WKLKQ+  +E  K++VYVCPET C  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K 
Sbjct  105   WKLKQKNSKEHQKKKVYVCPETNCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKF  164

Query  919   YAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             YAVQ DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  165   YAVQSDWKAHTKVCGTREYRCDCGTLFSRKDSFITHRAFCDA  206



>ref|XP_004138788.1| PREDICTED: zinc finger protein MAGPIE-like [Cucumis sativus]
 gb|KGN63204.1| hypothetical protein Csa_2G409480 [Cucumis sativus]
Length=422

 Score =   263 bits (671),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+LL TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  28    KKKRNLPGTPDPEAEVIALSPKTLLATNRFICEICGKGFQRDQNLQLHRRGHNLPWKLKQ  87

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E  K+RVYVCPE +C  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  88    RSNKEA-KKRVYVCPEKSCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  146

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  147   DWKAHSKTCGTREYKCDCGTLFSRRDSFITHRAFCDA  183



>ref|XP_004170825.1| PREDICTED: zinc finger protein MAGPIE-like [Cucumis sativus]
Length=422

 Score =   262 bits (670),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+LL TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  28    KKKRNLPGTPDPEAEVIALSPKTLLATNRFICEICGKGFQRDQNLQLHRRGHNLPWKLKQ  87

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E  K+RVYVCPE +C  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  88    RSNKEA-KKRVYVCPEKSCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  146

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  147   DWKAHSKTCGTREYKCDCGTLFSRRDSFITHRAFCDA  183



>gb|KHG28179.1| Zinc finger MAGPIE -like protein [Gossypium arboreum]
Length=486

 Score =   264 bits (675),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 137/158 (87%), Gaps = 1/158 (1%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+
Sbjct  30    PKKKRNLPGMPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLR  89

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             QR  +E+ ++RVYVCPE +C  H+P++ALGDL+GIKKHFCRKHG + +KCE+C+K YAVQ
Sbjct  90    QRTSKEI-RKRVYVCPEPSCVHHNPARALGDLTGIKKHFCRKHGEKKWKCERCSKKYAVQ  148

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAHMKTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  149   SDWKAHMKTCGTREYKCDCGTIFSRRDSFITHRAFCDA  186



>ref|XP_008455947.1| PREDICTED: zinc finger protein MAGPIE-like [Cucumis melo]
Length=425

 Score =   262 bits (670),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+LL TNR+VC++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  28    KKKRNLPGTPDPEAEVIALSPKTLLATNRFVCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  87

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E  K+RVYVCPE +C  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  88    RSNKEA-KKRVYVCPEKSCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  146

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  147   DWKAHSKTCGTREYKCDCGTLFSRRDSFITHRAFCDA  183



>ref|XP_009364602.1| PREDICTED: zinc finger protein NUTCRACKER-like [Pyrus x bretschneideri]
Length=538

 Score =   266 bits (679),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD E EVIALSP +LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLK 
Sbjct  33    KKKRNLPGMPDPEAEVIALSPTTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKH  92

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             +   + V++RVYVCPET+C  HHP++ALGDL+GIKKHFCRKHG + +KCE+C+K YAVQ 
Sbjct  93    QRTSKEVRKRVYVCPETSCVHHHPTRALGDLTGIKKHFCRKHGEKKWKCERCSKKYAVQS  152

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAHMKTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  153   DWKAHMKTCGTREYKCDCGTLFSRRDSFITHRAFCDA  189



>ref|XP_010262085.1| PREDICTED: zinc finger protein NUTCRACKER isoform X1 [Nelumbo 
nucifera]
Length=546

 Score =   266 bits (679),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 152/312 (49%), Positives = 196/312 (63%), Gaps = 15/312 (5%)
 Frame = -1

Query  1303  EESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQL  1124
             ++S     QT   K+KR+ PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQL
Sbjct  44    QQSFASPNQTPVVKKKRNLPGNPDPDAEVIALSPKALLATNRFVCEICSKGFQRDQNLQL  103

Query  1123  HRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTF  944
             HRRGHNLPWKLKQR  +EV K+RVYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +
Sbjct  104   HRRGHNLPWKLKQRTSKEV-KKRVYVCPEPTCVHHDPSRALGDLTGIKKHFCRKHGEKKW  162

Query  943   KCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA----SQaltv  776
             KC+KC+K YAVQ DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A    S     
Sbjct  163   KCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDALAEESARAIT  222

Query  775   tapsaspppqpptpSMAVLSPTLSLHSIQSFELP-EDRVMGGANYKERTQAP-----SSS  614
             T P  +P P   T  + +    ++ H +Q+  L  E +      +  R+  P     SS 
Sbjct  223   TNPLLAPQPGSSTSHINLQPQLINNHDLQALSLKREQQQQQQQLFNLRSDTPPWLACSSV  282

Query  613   FGLVIGDNGEEDFSSVFRLSLRSGNEEEATPACAAIMERpvplllstpppVYHASNPPVL  434
              G   G    +  SS+F   +    ++E +    +I    +    +   P Y+ S  P +
Sbjct  283   VGAGPGPPPIDFSSSLFSTRI----DQEFSRTQPSIHHENLNPNPTPSLPPYNPSASPHM  338

Query  433   SATALLQKAAEM  398
             SATALLQKAA+M
Sbjct  339   SATALLQKAAQM  350



>gb|KDO84481.1| hypothetical protein CISIN_1g026210mg [Citrus sinensis]
 gb|KDO84482.1| hypothetical protein CISIN_1g026210mg [Citrus sinensis]
Length=241

 Score =   256 bits (654),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 139/164 (85%), Gaps = 3/164 (2%)
 Frame = -1

Query  1279  QTVKP--KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHN  1106
             Q + P  K+KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHN
Sbjct  29    QVIPPTQKKKRNLPGMPDPDSEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHN  88

Query  1105  LPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCN  926
             LPWKLKQR  +EV +++VYVCPE+TC  H+P++ALGDL+GIKKHF RKHG + +KCE+C+
Sbjct  89    LPWKLKQRNSKEV-RKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCS  147

Query  925   KMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             K YAVQ DWKAHMKTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  148   KKYAVQSDWKAHMKTCGTREYKCDCGTIFSRRDSFITHRAFCDA  191



>ref|XP_009350365.1| PREDICTED: zinc finger protein MAGPIE-like [Pyrus x bretschneideri]
Length=465

 Score =   263 bits (673),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 144/181 (80%), Gaps = 3/181 (2%)
 Frame = -1

Query  1336  DPRQMTTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCG  1157
             +P  ++T +   +S Q      K K+KRS PG PD + EVIALSPK+LL TNR+VC++C 
Sbjct  28    NPLLLSTNISSHQSDQPPN---KIKKKRSLPGNPDPDAEVIALSPKTLLATNRFVCEICN  84

Query  1156  KGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKK  977
             KGFQR+QNLQLHRRGHNLPWKLKQR  ++ +++R YVCPE +C  HHPS+ALGDL+GIKK
Sbjct  85    KGFQRDQNLQLHRRGHNLPWKLKQRNSKDQIRKRAYVCPEPSCVHHHPSRALGDLTGIKK  144

Query  976   HFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCY  797
             HFCRKHG + +KC+KC+K+YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C 
Sbjct  145   HFCRKHGEKKWKCDKCSKIYAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCD  204

Query  796   A  794
             A
Sbjct  205   A  205



>ref|XP_006443977.1| hypothetical protein CICLE_v10019959mg [Citrus clementina]
 ref|XP_006479646.1| PREDICTED: zinc finger protein NUTCRACKER-like [Citrus sinensis]
 gb|ESR57217.1| hypothetical protein CICLE_v10019959mg [Citrus clementina]
 gb|KDO68624.1| hypothetical protein CISIN_1g011807mg [Citrus sinensis]
Length=477

 Score =   263 bits (673),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  1255  RSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQRGP  1076
             RS PG PD + EVIALSPK+LL TNR+VC+VC KGFQR+QNLQLHRRGHNLPWKLKQR  
Sbjct  55    RSLPGNPDPDAEVIALSPKTLLATNRFVCEVCNKGFQRDQNLQLHRRGHNLPWKLKQRSN  114

Query  1075  EEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQCDWK  896
             ++++K++ YVCPE +C  HHPS+ALGDL+GIKKHFCRKHG R +KCEKC+K+YAVQ DWK
Sbjct  115   KDIIKKKAYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGERKWKCEKCSKVYAVQSDWK  174

Query  895   AHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             AH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  175   AHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  208



>ref|XP_004238241.1| PREDICTED: zinc finger protein NUTCRACKER-like [Solanum lycopersicum]
Length=501

 Score =   264 bits (675),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 140/172 (81%), Gaps = 3/172 (2%)
 Frame = -1

Query  1303  EESAQLS--EQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNL  1130
             E+SA+ S  +Q    KRKR+ PG PD E EVIALSP++L+ TNR+VC++C KGFQR+QNL
Sbjct  5     EKSAEESIIQQNFPVKRKRNLPGNPDPEAEVIALSPRTLMATNRFVCEICNKGFQRDQNL  64

Query  1129  QLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHR  950
             QLHRRGHNLPWKL+QR   EV K+RVYVCPE++C  H PS+ALGDL+GIKKHFCRKHG +
Sbjct  65    QLHRRGHNLPWKLRQRTSNEV-KKRVYVCPESSCVHHDPSRALGDLTGIKKHFCRKHGEK  123

Query  949   TFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              FKCE+C K YAV  DWKAHMKTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  124   KFKCERCTKKYAVHSDWKAHMKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  175



>ref|XP_008225411.1| PREDICTED: zinc finger protein JACKDAW [Prunus mume]
Length=494

 Score =   264 bits (675),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKR+ PG PD + EVIALSPKSL+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  35    KRKRNLPGTPDPDAEVIALSPKSLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  94

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV++++VYVCPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  95    RSNKEVIRKKVYVCPERTCVHHEPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  154

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  155   DWKAHSKVCGTREYRCDCGTLFSRKDSFITHRAFCDA  191



>ref|XP_004971461.1| PREDICTED: zinc finger protein NUTCRACKER-like [Setaria italica]
Length=375

 Score =   260 bits (665),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KRS PG PD + EVIALSP++L+ TNR+VC++CGKGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  37    KKKRSLPGTPDPDAEVIALSPRTLMATNRFVCEICGKGFQRDQNLQLHRRGHNLPWKLRQ  96

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E  ++RVYVCPET+C  H+PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  97    RSGKEPPRKRVYVCPETSCVHHNPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQS  156

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  157   DWKAHAKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  193



>ref|XP_003523580.1| PREDICTED: zinc finger protein MAGPIE-like [Glycine max]
Length=473

 Score =   263 bits (673),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 152/334 (46%), Positives = 199/334 (60%), Gaps = 46/334 (14%)
 Frame = -1

Query  1273  VKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWK  1094
             + PKRKRS PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWK
Sbjct  24    LPPKRKRSLPGMPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWK  83

Query  1093  LKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYA  914
             L+QRG  E  +++ YVCPE +C  H+P++ALGDL+GIKKHFCRKHG + ++CE+C+K YA
Sbjct  84    LRQRGSTEP-RKKAYVCPEPSCVHHNPARALGDLTGIKKHFCRKHGEKKWQCERCSKKYA  142

Query  913   VQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVC---------------YASQalt  779
             V  DWKAHMKTCG+R+Y CDCG LF+R+DSFI H+  C                   + +
Sbjct  143   VHSDWKAHMKTCGSREYRCDCGTLFSRRDSFITHRAFCDVLAQESARAQAQAQGQGGSNS  202

Query  778   vtapsaspppqpptpSMAVLSPTLSLHSIQSFELPEDR---------------VMGGANY  644
                 ++SPP  P TPS +V+ PTL   SIQS E+PE+                V   ++ 
Sbjct  203   KVVEASSPPTPPLTPSASVVPPTL---SIQSSEIPENPSTKLSPTSPNATACFVTSSSST  259

Query  643   KERTQAPSSSFGLVIG------------DNGEEDFSSVFRLSLRSGNEEEATPACAAIME  500
                +   ++ F  V+              N    F+++     RS N         ++  
Sbjct  260   PSNSTTCTTVFASVLAPSPTTPSTPQSPSNSTSSFTNLISNLARSQNPNTIMRESTSLSL  319

Query  499   RpvplllstpppVYHASNPPVLSATALLQKAAEM  398
                  L +  P  Y AS  P LSATALLQKAA+M
Sbjct  320   STPLYLSNNDPLHYTASPQPALSATALLQKAAQM  353



>ref|XP_008386413.1| PREDICTED: zinc finger protein MAGPIE-like [Malus domestica]
Length=466

 Score =   263 bits (672),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 143/181 (79%), Gaps = 3/181 (2%)
 Frame = -1

Query  1336  DPRQMTTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCG  1157
             +P  ++T +   +S Q      K K+KRS PG PD + EVIALSPK+LL TNR+VC++C 
Sbjct  28    NPLLLSTNISSHQSDQPPN---KIKKKRSLPGNPDPDAEVIALSPKTLLATNRFVCEICN  84

Query  1156  KGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKK  977
             KGFQR+QNLQLHRRGHNLPWKLKQR   + +++R YVCPE +C  HHPS+ALGDL+GIKK
Sbjct  85    KGFQRDQNLQLHRRGHNLPWKLKQRNSNDQIRKRAYVCPEPSCVHHHPSRALGDLTGIKK  144

Query  976   HFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCY  797
             HFCRKHG + +KC+KC+K+YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C 
Sbjct  145   HFCRKHGEKKWKCDKCSKIYAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCD  204

Query  796   A  794
             A
Sbjct  205   A  205



>ref|XP_008368735.1| PREDICTED: zinc finger protein MAGPIE-like [Malus domestica]
Length=464

 Score =   263 bits (672),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -1

Query  1270  KPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKL  1091
             K K+KRS PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL
Sbjct  47    KIKKKRSLPGNPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKL  106

Query  1090  KQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAV  911
             KQR  ++ +++R YVCPE +C  HHPS+ALGDL+GIKKHFCRKHG + +KC+KC+K+YAV
Sbjct  107   KQRNSKDQIRKRAYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKIYAV  166

Query  910   QCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             Q DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  167   QSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  205



>ref|XP_009370754.1| PREDICTED: zinc finger protein MAGPIE-like [Pyrus x bretschneideri]
Length=465

 Score =   263 bits (672),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = -1

Query  1291  QLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRG  1112
             Q  +   K K+KRS PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRG
Sbjct  40    QYDQPPNKIKKKRSLPGNPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRG  99

Query  1111  HNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEK  932
             HNLPWKLKQR  ++ +++R YVCPE +C  HHPS+ALGDL+GIKKHFCRKHG + +KC+K
Sbjct  100   HNLPWKLKQRNSQDQIRKRAYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCDK  159

Query  931   CNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             C+K+YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  160   CSKIYAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  205



>gb|KDO49571.1| hypothetical protein CISIN_1g048287mg, partial [Citrus sinensis]
Length=365

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  32    KKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  91

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  92    RTSKEV-RKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  150

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  151   DWKAHSKTCGTREYKCDCGTVFSRRDSFITHRAFCDA  187



>gb|EPS58012.1| hypothetical protein M569_16805, partial [Genlisea aurea]
Length=297

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 153/311 (49%), Positives = 191/311 (61%), Gaps = 50/311 (16%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  1     KRKRNLPGMPDPDAEVIALSPKALLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  60

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPE+TC  H P++ALGDL+GIKKHFCRKHG + +KCE+C+K YAVQ 
Sbjct  61    RSSKEV-RKRVYVCPESTCVHHDPARALGDLTGIKKHFCRKHGDKKYKCERCSKKYAVQS  119

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA----------SQaltvtapsasp  755
             D KAHMKTCGTR+Y CDCG LF+R+DSFI H+  C A               + A S SP
Sbjct  120   DLKAHMKTCGTREYRCDCGTLFSRRDSFITHRSFCDALAQETARSHPPPIPPLAAASCSP  179

Query  754   ppqpptpSMAVLSPTLSLHSIQSFELPEDRVMGGANYKERTQAPSSSF------------  611
             PP P +P+   LSP LS+ S  +F+LP       A   E  Q+P+               
Sbjct  180   PPPPLSPTTDALSPVLSVQS-SAFDLP-----AAAELPENLQSPAVLLPSTASAATVSSS  233

Query  610   ------GLVIGDNGEEDFSSVFRLSLRSGNEEEATPACAAIMERpvplllstpppVYHAS  449
                   G +    G   FS +F  S             A+ + +        PPP Y  +
Sbjct  234   SSTTSGGTIANHCGA--FSGIFSSS-------------ASELTQSSHPHPPPPPPHYIQT  278

Query  448   NPPVLSATALL  416
             +PP LSATALL
Sbjct  279   SPPALSATALL  289



>emb|CDP03675.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   263 bits (672),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 141/172 (82%), Gaps = 1/172 (1%)
 Frame = -1

Query  1309  PGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNL  1130
             P  +++   +Q  K K+KR+ PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNL
Sbjct  27    PMVQTSSSHQQPQKIKKKRNLPGNPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNL  86

Query  1129  QLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHR  950
             QLHRRGHNLPWKLKQR  +E+ K+R YVCPE TC  HHPS+ALGDL+GIKKH+CRKHG +
Sbjct  87    QLHRRGHNLPWKLKQRNNKEI-KKRAYVCPEPTCVHHHPSRALGDLTGIKKHYCRKHGEK  145

Query  949   TFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              +KCEKC+K+YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  146   KWKCEKCSKIYAVQSDWKAHTKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  197



>ref|XP_006380280.1| hypothetical protein POPTR_0007s01380g [Populus trichocarpa]
 gb|ERP58077.1| hypothetical protein POPTR_0007s01380g [Populus trichocarpa]
Length=477

 Score =   263 bits (672),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  33    KKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  92

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   EV ++RVYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  93    RTNNEV-RKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  151

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  152   DWKAHSKTCGTREYKCDCGTLFSRRDSFITHRAFCDA  188



>ref|XP_010097054.1| Zinc finger protein MAGPIE [Morus notabilis]
 gb|EXB66855.1| Zinc finger protein MAGPIE [Morus notabilis]
Length=542

 Score =   265 bits (676),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = -1

Query  1303  EESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQL  1124
             ++S+  + Q   PK+KRS PG PD + EV+ALSPK+LL TNR++C++C KGFQR+QNLQL
Sbjct  38    QQSSASTNQPPPPKKKRSLPGNPDPDAEVVALSPKTLLTTNRFICEICNKGFQRDQNLQL  97

Query  1123  HRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTF  944
             HRRGHNLPWKLKQR  +EVV+++VYVCPE TC  H PS+ALGDL+GIKKHF RKHG + +
Sbjct  98    HRRGHNLPWKLKQRTNKEVVRKKVYVCPEPTCVHHDPSRALGDLTGIKKHFFRKHGEKKW  157

Query  943   KCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             KCEKC+K YAVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  158   KCEKCSKRYAVQSDWKAHSKICGTREYRCDCGTLFSRRDSFITHRAFCDA  207



>ref|XP_010932829.1| PREDICTED: zinc finger protein MAGPIE-like [Elaeis guineensis]
 ref|XP_010932830.1| PREDICTED: zinc finger protein MAGPIE-like [Elaeis guineensis]
Length=406

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  1270  KPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKL  1091
             K K+KRS PG PD + EVIALSPK+L+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL
Sbjct  54    KSKKKRSQPGNPDPDAEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKL  113

Query  1090  KQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAV  911
             +QR  +E V++RVYVCPE TC  HHPS+ALGDL+GIKKH+ RKHG + +KC+KC+K+YAV
Sbjct  114   RQRSSKEGVRKRVYVCPEPTCVHHHPSRALGDLTGIKKHYSRKHGEKKWKCDKCSKIYAV  173

Query  910   QCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
               DWKAH+KTCGTR+Y CDCGALF+RKDSFI H+  C A
Sbjct  174   HSDWKAHVKTCGTREYRCDCGALFSRKDSFITHRAFCDA  212



>ref|XP_009335059.1| PREDICTED: zinc finger protein JACKDAW-like [Pyrus x bretschneideri]
 ref|XP_009335060.1| PREDICTED: zinc finger protein JACKDAW-like [Pyrus x bretschneideri]
Length=478

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKRS PG PD + EVIA+SPKSL+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  35    KRKRSLPGTPDPDAEVIAMSPKSLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  94

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   EV++++VYVCPE +C  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  95    RSKTEVIRKKVYVCPEKSCVHHEPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  154

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  155   DWKAHSKVCGTREYRCDCGTLFSRKDSFITHRAFCDA  191



>emb|CBI19670.3| unnamed protein product [Vitis vinifera]
Length=496

 Score =   263 bits (672),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 139/167 (83%), Gaps = 2/167 (1%)
 Frame = -1

Query  1291  QLSEQTVKP-KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRR  1115
             Q + Q V P K+KR+ PG PD + EVIALSPK+L+ TNR+VC++C KGFQR+QNLQLHRR
Sbjct  18    QTAPQPVAPTKKKRNLPGTPDPDAEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRR  77

Query  1114  GHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCE  935
             GHNLPWKL+QR  +EV ++RVYVCPE TC  H P++ALGDL+GIKKHFCRKHG + +KCE
Sbjct  78    GHNLPWKLRQRTSKEV-RKRVYVCPEPTCVHHDPTRALGDLTGIKKHFCRKHGEKKWKCE  136

Query  934   KCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             +C+K YAVQ DWKAH+KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  137   RCSKKYAVQSDWKAHLKTCGTREYKCDCGTLFSRRDSFITHRAFCDA  183



>ref|XP_003590506.1| Zinc finger protein [Medicago truncatula]
Length=500

 Score =   263 bits (673),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ PG PD + EVIALSPK+L+ TNR++C++C KGFQR+QNLQLHRRGHNLPWKL+
Sbjct  37    PKKKRNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLR  96

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             QR  ++V+K++VY+CPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ
Sbjct  97    QRSNKDVIKKKVYICPEKTCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQ  156

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  157   SDWKAHTKTCGTREYKCDCGTLFSRKDSFITHRAFCDA  194



>ref|XP_002281605.1| PREDICTED: zinc finger protein JACKDAW-like isoform X1 [Vitis 
vinifera]
Length=505

 Score =   263 bits (673),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 139/167 (83%), Gaps = 2/167 (1%)
 Frame = -1

Query  1291  QLSEQTVKP-KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRR  1115
             Q + Q V P K+KR+ PG PD + EVIALSPK+L+ TNR+VC++C KGFQR+QNLQLHRR
Sbjct  27    QTAPQPVAPTKKKRNLPGTPDPDAEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRR  86

Query  1114  GHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCE  935
             GHNLPWKL+QR  +EV ++RVYVCPE TC  H P++ALGDL+GIKKHFCRKHG + +KCE
Sbjct  87    GHNLPWKLRQRTSKEV-RKRVYVCPEPTCVHHDPTRALGDLTGIKKHFCRKHGEKKWKCE  145

Query  934   KCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             +C+K YAVQ DWKAH+KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  146   RCSKKYAVQSDWKAHLKTCGTREYKCDCGTLFSRRDSFITHRAFCDA  192



>ref|XP_008452730.1| PREDICTED: zinc finger protein MAGPIE-like [Cucumis melo]
 ref|XP_008452731.1| PREDICTED: zinc finger protein MAGPIE-like [Cucumis melo]
Length=268

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPKSLL TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  62    KKKRNLPGNPDPEAEVIALSPKSLLATNRFICEICKKGFQRDQNLQLHRRGHNLPWKLKQ  121

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             RG +EV +++VYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  122   RGNKEV-RKKVYVCPELTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  180

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  181   DWKAHSKICGTREYRCDCGTLFSRRDSFITHRAFCNA  217



>ref|XP_008649012.1| PREDICTED: LOC542697 isoform X5 [Zea mays]
 tpg|DAA48719.1| TPA: hypothetical protein ZEAMMB73_834941 [Zea mays]
Length=545

 Score =   264 bits (675),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 134/158 (85%), Gaps = 1/158 (1%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ PG P+ + EVIALSPK+L+ TNR+VC+VC KGFQREQNLQLHRRGHNLPWKLK
Sbjct  40    PKKKRNQPGNPNPDAEVIALSPKTLMATNRFVCEVCNKGFQREQNLQLHRRGHNLPWKLK  99

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             Q+ P+E  +RRVY+CPE TC  H PS+ALGDL+GIKKH+CRKHG + +KC+KCNK YAVQ
Sbjct  100   QKNPKET-RRRVYLCPEPTCVHHDPSRALGDLTGIKKHYCRKHGEKKWKCDKCNKRYAVQ  158

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  159   SDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  196



>ref|XP_003527695.1| PREDICTED: zinc finger protein MAGPIE-like [Glycine max]
Length=469

 Score =   262 bits (669),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 205/347 (59%), Gaps = 52/347 (15%)
 Frame = -1

Query  1309  PGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNL  1130
             P  E A  ++    PK+KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNL
Sbjct  14    PALEIAPQTQPLPPPKKKRNLPGMPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNL  73

Query  1129  QLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHR  950
             QLHRRGHNLPWKL+QRG +E  +++ YVCPE +C  H+P++ALGDL+GIKKHFCRKHG +
Sbjct  74    QLHRRGHNLPWKLRQRGSKEP-QKKAYVCPEPSCVHHNPARALGDLTGIKKHFCRKHGEK  132

Query  949   TFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCY---------  797
              ++CE+C+K YAV  DWKAHMKTCGTR+Y CDCG LF+R+DSFI H+  C          
Sbjct  133   KWQCERCSKKYAVHSDWKAHMKTCGTREYRCDCGTLFSRRDSFITHRAFCDVLAQESARA  192

Query  796   ------ASQaltvtapsaspppqpptpSMAVLSPTLSLHSIQSFELPEDRVMGGANYKER  635
                    S    V   S+SPP  P TPS +V+SPTL   SIQS E+PE+      + K  
Sbjct  193   QDQAQGGSSNSYVVVVSSSPPTPPLTPSASVVSPTL---SIQSSEIPEN-----PSTKVS  244

Query  634   TQAPSSS----------------FGLVIG------------DNGEEDFSSVFRLSLRSGN  539
               +P++S                F  V+              N    FS++     RS N
Sbjct  245   PTSPNASCFVTSSSSTPSSTTSVFASVLAPSTTPTTPSQSPSNSTCSFSNLMSNLARSEN  304

Query  538   EEEATPACAAIMERpvplllstpppVYHASNPPVLSATALLQKAAEM  398
                      ++     P   +  P  Y A   P LSATALLQKAA+M
Sbjct  305   SNALMREPTSLSLSTPPYHSNNDPLHYTALPQPALSATALLQKAAQM  351



>ref|XP_006856069.1| hypothetical protein AMTR_s00059p00106830 [Amborella trichopoda]
 gb|ERN17536.1| hypothetical protein AMTR_s00059p00106830 [Amborella trichopoda]
Length=527

 Score =   263 bits (673),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 143/178 (80%), Gaps = 4/178 (2%)
 Frame = -1

Query  1318  TVLPGEESAQLSEQTV---KPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGF  1148
             +V  G  S Q   QT+     K+KR+ PGMPD E EVIALSPK+L+ TNR+VC++C KGF
Sbjct  28    SVSSGARSQQNQNQTMVAATTKKKRNLPGMPDPEAEVIALSPKTLMATNRFVCEICNKGF  87

Query  1147  QREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFC  968
             QR+QNLQLHRRGHNLPWKL+QR  +EV ++RVY+CPE +C  H PS+ALGDL+GIKKHFC
Sbjct  88    QRDQNLQLHRRGHNLPWKLRQRTSKEV-RKRVYICPEVSCVHHDPSRALGDLTGIKKHFC  146

Query  967   RKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             RKHG + FKC+KC+K YAVQ DWKAH KTCGTR+Y CDCG LF+R+DSF++H+  C A
Sbjct  147   RKHGEKKFKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFVSHRAFCDA  204



>emb|CDX91304.1| BnaC02g27150D [Brassica napus]
Length=404

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  1279  QTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLP  1100
             +T K K++R  PG PD + EV+ALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLP
Sbjct  50    ETQKTKKRRGVPGNPDPDAEVVALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLP  109

Query  1099  WKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKM  920
             WKLKQ+  +E  K++VYVCP+T C  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K 
Sbjct  110   WKLKQKNTKEQQKKKVYVCPDTNCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKF  169

Query  919   YAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             YAVQ DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  170   YAVQSDWKAHTKVCGTREYRCDCGTLFSRKDSFITHRAFCDA  211



>ref|XP_007149800.1| hypothetical protein PHAVU_005G099800g [Phaseolus vulgaris]
 gb|ESW21794.1| hypothetical protein PHAVU_005G099800g [Phaseolus vulgaris]
Length=463

 Score =   261 bits (668),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 143/182 (79%), Gaps = 2/182 (1%)
 Frame = -1

Query  1336  DPRQMTTVLPGEE-SAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVC  1160
             D  +++   P +  S   S Q    KRKR+ PG PD E EVIALSPK+L+ TNR+VC++C
Sbjct  6     DDGEISNAFPLQNPSTAASNQPPALKRKRNLPGNPDPEAEVIALSPKTLMATNRFVCEIC  65

Query  1159  GKGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIK  980
              KGFQR+QNLQLHRRGHNLPWKLKQR  +EV ++RVYVCPE TC  HHPS+ALGDL+GIK
Sbjct  66    LKGFQRDQNLQLHRRGHNLPWKLKQRTSKEV-RKRVYVCPEKTCVHHHPSRALGDLTGIK  124

Query  979   KHFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVC  800
             KHFCRKHG + +KCEKC+K YAVQ DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  C
Sbjct  125   KHFCRKHGEKKWKCEKCSKRYAVQSDWKAHSKTCGTREYKCDCGTIFSRRDSFITHRAFC  184

Query  799   YA  794
              A
Sbjct  185   DA  186



>ref|XP_004141426.1| PREDICTED: zinc finger protein NUTCRACKER-like [Cucumis sativus]
Length=426

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPKSLL TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  63    KKKRNLPGNPDPEAEVIALSPKSLLATNRFICEICKKGFQRDQNLQLHRRGHNLPWKLKQ  122

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             RG +EV +++VYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  123   RGNKEV-RKKVYVCPELTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  181

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  182   DWKAHSKICGTREYRCDCGTLFSRRDSFITHRAFCNA  218



>ref|XP_006480617.1| PREDICTED: zinc finger protein JACKDAW-like [Citrus sinensis]
 gb|KDO51070.1| hypothetical protein CISIN_1g011334mg [Citrus sinensis]
Length=488

 Score =   262 bits (670),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD + EVIALSPK+L+ TNR++C++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  35    KKKRNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQ  94

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  ++V+K++VY+CPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  95    RTNKDVIKKKVYICPEKTCVHHEPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  154

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  155   DWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDA  191



>ref|XP_007043706.1| C2H2 and C2HC zinc fingers superfamily protein [Theobroma cacao]
 gb|EOX99537.1| C2H2 and C2HC zinc fingers superfamily protein [Theobroma cacao]
Length=458

 Score =   261 bits (667),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  28    KKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  87

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E  ++RVYVCPE +C  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  88    RTTKEA-RKRVYVCPEKSCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  146

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  147   DWKAHSKTCGTREYKCDCGTLFSRRDSFITHRAFCDA  183



>ref|XP_002275400.3| PREDICTED: zinc finger protein MAGPIE [Vitis vinifera]
Length=454

 Score =   261 bits (667),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  28    KKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  87

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E  ++RVYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  88    RSSKEP-RKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  146

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  147   DWKAHTKTCGTREYKCDCGTLFSRRDSFITHRAFCDA  183



>ref|XP_006434957.1| hypothetical protein CICLE_v10001017mg [Citrus clementina]
 gb|ESR48197.1| hypothetical protein CICLE_v10001017mg [Citrus clementina]
Length=476

 Score =   261 bits (668),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 139/164 (85%), Gaps = 3/164 (2%)
 Frame = -1

Query  1279  QTVKP--KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHN  1106
             Q + P  K++R+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHN
Sbjct  29    QVIPPTQKKRRNLPGMPDPDSEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHN  88

Query  1105  LPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCN  926
             LPWKLKQR  +EV +++VYVCPE+TC  H+P++ALGDL+GIKKHF RKHG + +KCE+C+
Sbjct  89    LPWKLKQRNSKEV-RKKVYVCPESTCVHHNPARALGDLTGIKKHFSRKHGEKKYKCERCS  147

Query  925   KMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             K YAVQ DWKAHMKTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  148   KKYAVQSDWKAHMKTCGTREYKCDCGTIFSRRDSFITHRAFCDA  191



>gb|KDP38479.1| hypothetical protein JCGZ_04404 [Jatropha curcas]
Length=496

 Score =   262 bits (670),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 136/158 (86%), Gaps = 1/158 (1%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLK
Sbjct  37    PKKKRNLPGMPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLK  96

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             QR  +E  ++RVYVCPE +C  H+P++ALGDL+GIKKHFCRKHG + +KCE+C+K YAVQ
Sbjct  97    QRTSKEP-RKRVYVCPEKSCVHHNPARALGDLTGIKKHFCRKHGEKKWKCERCSKKYAVQ  155

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAHMKTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  156   SDWKAHMKTCGTREYKCDCGTLFSRRDSFITHRAFCDA  193



>ref|XP_006428811.1| hypothetical protein CICLE_v10011592mg [Citrus clementina]
 gb|ESR42051.1| hypothetical protein CICLE_v10011592mg [Citrus clementina]
Length=488

 Score =   262 bits (669),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD + EVIALSPK+L+ TNR++C++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  35    KKKRNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQ  94

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  ++V+K++VY+CPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  95    RTNKDVIKKKVYICPEKTCVHHEPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  154

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  155   DWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDA  191



>ref|XP_006365738.1| PREDICTED: zinc finger protein JACKDAW-like [Solanum tuberosum]
Length=528

 Score =   263 bits (672),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKR+ PG PD + EVIALSPKSL+ TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  34    KRKRNLPGKPDPDAEVIALSPKSLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLKQ  93

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   EV+K++VY+CPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  94    RNKNEVIKKKVYICPEKTCIHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  153

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  154   DWKAHTKICGTREYKCDCGTLFSRKDSFITHRAFCDA  190



>ref|XP_006597191.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X1 [Glycine 
max]
 ref|XP_006597192.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X2 [Glycine 
max]
 gb|KHN32694.1| Zinc finger protein MAGPIE [Glycine soja]
Length=455

 Score =   261 bits (666),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EV+ALSPK+LL TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  43    KKKRNLPGNPDPEAEVVALSPKTLLATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLKQ  102

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   E+++++VYVCPE +C  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  103   RSSNEIIRKKVYVCPEASCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQS  162

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  163   DWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  199



>ref|XP_006339068.1| PREDICTED: zinc finger protein JACKDAW-like [Solanum tuberosum]
Length=492

 Score =   262 bits (669),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 141/185 (76%), Gaps = 5/185 (3%)
 Frame = -1

Query  1333  PRQMTTVLPGE-ESAQLSEQTVKP----KRKRSTPGMPDAEVEVIALSPKSLLETNRYVC  1169
             P  +  VLP   +  Q +    KP    K++R+ PG PD + EVIALSPKSL+ TNR++C
Sbjct  10    PSSVKAVLPHHHQELQTTNPNPKPNTSSKKRRNLPGTPDPDAEVIALSPKSLMATNRFIC  69

Query  1168  DVCGKGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLS  989
             ++C KGFQR+QNLQLHRRGHNLPWKLKQR   E VK++VY+CPE TC  H PS+ALGDL+
Sbjct  70    EICNKGFQRDQNLQLHRRGHNLPWKLKQRNKLEQVKKKVYICPEKTCIHHDPSRALGDLT  129

Query  988   GIKKHFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHK  809
             GIKKHF RKHG + +KCEKC+K YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+
Sbjct  130   GIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKTCGTREYKCDCGTLFSRKDSFITHR  189

Query  808   RVCYA  794
               C A
Sbjct  190   AFCDA  194



>ref|XP_004295016.1| PREDICTED: zinc finger protein NUTCRACKER-like [Fragaria vesca 
subsp. vesca]
Length=497

 Score =   262 bits (669),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKR+ PG PD + EVIALSPKSL+ TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  39    KRKRNLPGTPDPDAEVIALSPKSLMATNRFLCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  98

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   EV++++VYVCPE +C  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  99    RSKLEVIRKKVYVCPEKSCVHHEPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  158

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  159   DWKAHSKICGTREYRCDCGTLFSRKDSFITHRAFCDA  195



>ref|XP_004171470.1| PREDICTED: zinc finger protein NUTCRACKER-like, partial [Cucumis 
sativus]
Length=486

 Score =   262 bits (669),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = -1

Query  1270  KPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKL  1091
             KPK+KRS PG PD + +VIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL
Sbjct  48    KPKKKRSLPGNPDPDADVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKL  107

Query  1090  KQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAV  911
             KQR  +EV K++ YVCPE +C  HHPS+ALGDL+GIKKH+CRKHG + +KC+KC+K+YAV
Sbjct  108   KQRNNKEV-KKKAYVCPEPSCVHHHPSRALGDLTGIKKHYCRKHGEKKWKCDKCSKVYAV  166

Query  910   QCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             Q DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  167   QSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  205



>ref|XP_007136579.1| hypothetical protein PHAVU_009G056800g [Phaseolus vulgaris]
 gb|ESW08573.1| hypothetical protein PHAVU_009G056800g [Phaseolus vulgaris]
Length=411

 Score =   259 bits (663),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKRS PGMPD + EVIALSPK+L+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  31    KRKRSLPGMPDPDAEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  90

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             RG +E  +++ YVCPE +C  H+P++ALGDL+GIKKHFCRKHG + +KCE+C+K YAVQ 
Sbjct  91    RGSKEP-RKKAYVCPEPSCVHHNPARALGDLTGIKKHFCRKHGEKKWKCERCSKKYAVQS  149

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVC  800
             DWKAHMKTCG+R+Y CDCGALF+R+DSFI H+  C
Sbjct  150   DWKAHMKTCGSREYRCDCGALFSRRDSFITHRAFC  184



>ref|XP_004173254.1| PREDICTED: zinc finger protein NUTCRACKER-like [Cucumis sativus]
Length=408

 Score =   259 bits (662),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPKSLL TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  63    KKKRNLPGNPDPEAEVIALSPKSLLATNRFICEICKKGFQRDQNLQLHRRGHNLPWKLKQ  122

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             RG +EV +++VYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  123   RGNKEV-RKKVYVCPELTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  181

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  182   DWKAHSKICGTREYRCDCGTLFSRRDSFITHRAFCNA  218



>ref|XP_006838942.1| hypothetical protein AMTR_s00002p00270520 [Amborella trichopoda]
 gb|ERN01511.1| hypothetical protein AMTR_s00002p00270520 [Amborella trichopoda]
Length=493

 Score =   262 bits (669),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 137/163 (84%), Gaps = 3/163 (2%)
 Frame = -1

Query  1282  EQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNL  1103
             +QTVK  RKR+ PG PD + EVIALSPK+L+ TNR+VC++C KGFQR+QNLQLHRRGHNL
Sbjct  44    QQTVK--RKRNLPGNPDPDAEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRRGHNL  101

Query  1102  PWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNK  923
             PWKL+QR  +E+ ++RVYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +KCEKC+K
Sbjct  102   PWKLRQRSSKEI-RKRVYVCPELTCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCEKCSK  160

Query  922   MYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  161   KYAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  203



>gb|KGN55339.1| hypothetical protein Csa_4G646130 [Cucumis sativus]
Length=408

 Score =   259 bits (662),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPKSLL TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  63    KKKRNLPGNPDPEAEVIALSPKSLLATNRFICEICKKGFQRDQNLQLHRRGHNLPWKLKQ  122

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             RG +EV +++VYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  123   RGNKEV-RKKVYVCPELTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  181

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  182   DWKAHSKICGTREYRCDCGTLFSRRDSFITHRAFCNA  218



>ref|XP_003541898.2| PREDICTED: zinc finger protein MAGPIE-like [Glycine max]
Length=474

 Score =   261 bits (668),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 142/183 (78%), Gaps = 3/183 (2%)
 Frame = -1

Query  1336  DPRQMTTVLPGEESAQLSEQTVKP--KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDV  1163
             D  +++   P +  +  +     P  KRKR+ PG PD E EVI LSPK+L+ TNR+VC++
Sbjct  6     DDGEISNAFPHQNPSTAASNNQPPTLKRKRNLPGNPDPEAEVIVLSPKTLMATNRFVCEI  65

Query  1162  CGKGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGI  983
             C KGFQR+QNLQLHRRGHNLPWKLKQR  +EV ++RVYVCPE TC  HHPS+ALGDL+GI
Sbjct  66    CLKGFQRDQNLQLHRRGHNLPWKLKQRTSKEV-RKRVYVCPEKTCVHHHPSRALGDLTGI  124

Query  982   KKHFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRV  803
             KKHFCRKHG + +KCEKC+K YAVQ DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  
Sbjct  125   KKHFCRKHGEKKWKCEKCSKRYAVQSDWKAHSKTCGTREYKCDCGTIFSRRDSFITHRAF  184

Query  802   CYA  794
             C A
Sbjct  185   CDA  187



>gb|EYU46525.1| hypothetical protein MIMGU_mgv1a017919mg [Erythranthe guttata]
Length=395

 Score =   259 bits (661),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = -1

Query  1315  VLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQ  1136
             +LP   S   SE  +  K+KR+ PG PD + EVIALSP +L+ TNR+VC+VC KGFQR+Q
Sbjct  1     MLPHHNSLT-SEHKIITKKKRNLPGNPDPDAEVIALSPATLMATNRFVCEVCNKGFQRDQ  59

Query  1135  NLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHG  956
             NLQLHRRGHNLPWKLKQR  +E+ K+R YVCPE TC  HHPS+ALGDL+GIKKH+CRKHG
Sbjct  60    NLQLHRRGHNLPWKLKQRSGKEI-KKRAYVCPEATCLHHHPSRALGDLTGIKKHYCRKHG  118

Query  955   HRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              + +KC+KC+K+YAVQ DWKAH KTCGTR+Y CDCGALF+RKDSFI H+  C A
Sbjct  119   EKKWKCDKCSKVYAVQSDWKAHSKTCGTREYRCDCGALFSRKDSFITHRAFCDA  172



>ref|XP_003590574.1| Zinc finger protein-like protein [Medicago truncatula]
Length=524

 Score =   263 bits (671),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 151/208 (73%), Gaps = 0/208 (0%)
 Frame = -1

Query  1285  SEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHN  1106
             S+Q  K K+KRS PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHN
Sbjct  33    SQQPQKTKKKRSLPGNPDPDAEVIALSPKTLLTTNRFVCEICNKGFQRDQNLQLHRRGHN  92

Query  1105  LPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCN  926
             LPWKLKQR  ++V+K+R YVCPE +C  H+PS+ALGDL+GIKKH+ RKHG + +KC+KC+
Sbjct  93    LPWKLKQRNNKDVIKKRAYVCPEPSCVHHNPSRALGDLTGIKKHYSRKHGEKKWKCDKCS  152

Query  925   KMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYASQaltvtapsaspppq  746
             K+YAV  DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A    +    +      
Sbjct  153   KIYAVHSDWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDALAEESARMSANQLAIT  212

Query  745   pptpSMAVLSPTLSLHSIQSFELPEDRV  662
                 +  V S  L  +  QSF+ P+  +
Sbjct  213   TTNTNPLVQSLFLFPNQQQSFQNPQSHI  240



>ref|XP_004241270.1| PREDICTED: zinc finger protein JACKDAW [Solanum lycopersicum]
Length=528

 Score =   263 bits (671),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKR+ PG PD + EVIALSPKSL+ TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  34    KRKRNLPGKPDPDAEVIALSPKSLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLKQ  93

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   EV+K++VY+CPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  94    RNKNEVIKKKVYICPEKTCIHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  153

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  154   DWKAHTKICGTREYKCDCGTLFSRKDSFITHRAFCDA  190



>ref|XP_011082585.1| PREDICTED: zinc finger protein MAGPIE-like [Sesamum indicum]
 ref|XP_011082586.1| PREDICTED: zinc finger protein MAGPIE-like [Sesamum indicum]
Length=421

 Score =   259 bits (663),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 136/162 (84%), Gaps = 1/162 (1%)
 Frame = -1

Query  1279  QTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLP  1100
             Q +K K+KR+ PG PD + EVIALSPK+LL TNR++C++C KGFQR+QNLQLHRRGHNLP
Sbjct  45    QPLKTKKKRNLPGNPDPDAEVIALSPKTLLATNRFICEICNKGFQRDQNLQLHRRGHNLP  104

Query  1099  WKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKM  920
             WKLKQR  +E  K+R YVCPE TC  HHPS+ALGDL+GIKKH+CRKHG + +KCEKC+K+
Sbjct  105   WKLKQRNSKEN-KKRAYVCPEPTCVHHHPSRALGDLTGIKKHYCRKHGEKKWKCEKCSKI  163

Query  919   YAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  164   YAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  205



>ref|XP_010099839.1| Zinc finger protein MAGPIE [Morus notabilis]
 gb|EXB80599.1| Zinc finger protein MAGPIE [Morus notabilis]
Length=532

 Score =   263 bits (671),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 134/158 (85%), Gaps = 1/158 (1%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ PGMPD + EVIALSPK+LL TNR++C++C KGFQR+QNLQLHRRGHNLPWKL+
Sbjct  33    PKKKRNLPGMPDPDAEVIALSPKALLATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLR  92

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             QR  +EV K+RVYVCPE +C  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ
Sbjct  93    QRSSKEV-KKRVYVCPEPSCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQ  151

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  152   SDWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  189



>ref|XP_010032012.1| PREDICTED: zinc finger protein JACKDAW [Eucalyptus grandis]
 ref|XP_010032013.1| PREDICTED: zinc finger protein JACKDAW [Eucalyptus grandis]
 gb|KCW51402.1| hypothetical protein EUGRSUZ_J00939 [Eucalyptus grandis]
Length=478

 Score =   261 bits (667),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 139/182 (76%), Gaps = 9/182 (5%)
 Frame = -1

Query  1339  EDPRQMTTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVC  1160
             +DP  +T   P    +         K+KRS PG PD + EVIALSPKSL+ TNR++C++C
Sbjct  19    QDPSSLTNPNPSSNPS---------KKKRSLPGTPDPDAEVIALSPKSLMATNRFICEIC  69

Query  1159  GKGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIK  980
              KGFQR+QNLQLHRRGHNLPWKLKQR  +E+++R+VY+CPE TC  H PS+ALGDL+GIK
Sbjct  70    NKGFQRDQNLQLHRRGHNLPWKLKQRTNKELIRRKVYICPEETCVHHDPSRALGDLTGIK  129

Query  979   KHFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVC  800
             KH+ RKHG + +KCEKC+K YAVQ DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C
Sbjct  130   KHYSRKHGEKKWKCEKCSKKYAVQSDWKAHSKICGTREYKCDCGTLFSRKDSFITHRAFC  189

Query  799   YA  794
              A
Sbjct  190   DA  191



>ref|XP_009789501.1| PREDICTED: zinc finger protein JACKDAW-like [Nicotiana sylvestris]
Length=511

 Score =   262 bits (669),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKR+ PG PD + EVIALSPKSL+ TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  22    KRKRNLPGKPDPDAEVIALSPKSLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLKQ  81

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   EV+K++VY+CPE TC  H PS+ALGDL+GIKKH+ RKHG + +KCEKC+K YAVQ 
Sbjct  82    RNKNEVIKKKVYICPEKTCIHHDPSRALGDLTGIKKHYSRKHGEKKWKCEKCSKKYAVQS  141

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  142   DWKAHTKICGTREYKCDCGTLFSRKDSFITHRAFCDA  178



>ref|XP_008350745.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein MAGPIE-like, 
partial [Malus domestica]
Length=279

 Score =   254 bits (650),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 137/171 (80%), Gaps = 1/171 (1%)
 Frame = -1

Query  1306  GEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQ  1127
             G  +AQ+ +Q    K+KR+ PG PD   EVIALSPK+L+ TNR+VC++C KGFQR+QNLQ
Sbjct  54    GISTAQVQKQPPPAKKKRNLPGTPDPSAEVIALSPKTLMATNRFVCEICKKGFQRDQNLQ  113

Query  1126  LHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRT  947
             LHRRGHNLPWKLKQR   E++KR VYVCPE +C  H PS+ALGDL+GIKKHFCRKHG + 
Sbjct  114   LHRRGHNLPWKLKQRTSTEIIKR-VYVCPEPSCVHHDPSRALGDLTGIKKHFCRKHGEKK  172

Query  946   FKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             +KC+KC+K YAVQ DWKAH K CGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  173   WKCDKCSKKYAVQSDWKAHSKICGTREYKCDCGTIFSRRDSFITHRAFCDA  223



>gb|KGN44789.1| hypothetical protein Csa_7G387730 [Cucumis sativus]
Length=483

 Score =   261 bits (667),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = -1

Query  1270  KPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKL  1091
             KPK+KRS PG PD + +VIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL
Sbjct  48    KPKKKRSLPGNPDPDADVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKL  107

Query  1090  KQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAV  911
             KQR  +EV K++ YVCPE +C  HHPS+ALGDL+GIKKH+CRKHG + +KC+KC+K+YAV
Sbjct  108   KQRNNKEV-KKKAYVCPEPSCVHHHPSRALGDLTGIKKHYCRKHGEKKWKCDKCSKVYAV  166

Query  910   QCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             Q DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  167   QSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  205



>gb|KDP44082.1| hypothetical protein JCGZ_05549 [Jatropha curcas]
Length=492

 Score =   261 bits (668),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKR+ PG PD + EVIALSPKSL+ TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  35    KRKRNLPGTPDPDAEVIALSPKSLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLKQ  94

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV++++VY+CPE +C  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  95    RSNKEVIRKKVYICPEKSCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  154

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  155   DWKAHSKICGTREYRCDCGTLFSRKDSFITHRAFCDA  191



>ref|XP_006469076.1| PREDICTED: zinc finger protein MAGPIE-like [Citrus sinensis]
Length=488

 Score =   261 bits (667),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  32    KKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  91

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  92    RTSKEV-RKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  150

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  151   DWKAHSKTCGTREYKCDCGTVFSRRDSFITHRAFCDA  187



>ref|XP_009620251.1| PREDICTED: zinc finger protein JACKDAW-like [Nicotiana tomentosiformis]
Length=518

 Score =   262 bits (670),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKR+ PG PD + EVIALSPKSL+ TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  31    KRKRNLPGKPDPDAEVIALSPKSLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLKQ  90

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   EV+K++VY+CPE TC  H PS+ALGDL+GIKKH+ RKHG + +KCEKC+K YAVQ 
Sbjct  91    RNKNEVIKKKVYICPEKTCIHHDPSRALGDLTGIKKHYSRKHGEKKWKCEKCSKKYAVQS  150

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  151   DWKAHTKICGTREYKCDCGTLFSRKDSFITHRAFCDA  187



>ref|XP_006446712.1| hypothetical protein CICLE_v10015043mg [Citrus clementina]
 gb|ESR59952.1| hypothetical protein CICLE_v10015043mg [Citrus clementina]
Length=488

 Score =   261 bits (667),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  32    KKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  91

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  92    RTSKEV-RKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  150

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  151   DWKAHSKTCGTREYKCDCGTVFSRRDSFITHRAFCDA  187



>ref|XP_004154868.1| PREDICTED: zinc finger protein MAGPIE-like [Cucumis sativus]
Length=490

 Score =   261 bits (667),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD + EVIALSPK+L+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  20    KKKRNLPGNPDPDAEVIALSPKTLMATNRFVCEICSKGFQRDQNLQLHRRGHNLPWKLKQ  79

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV++++VYVCPET+C  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  80    RANKEVIRKKVYVCPETSCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVQS  139

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  140   DWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  176



>ref|XP_011047708.1| PREDICTED: zinc finger protein NUTCRACKER-like [Populus euphratica]
Length=477

 Score =   261 bits (666),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  33    KKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  92

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPE TC  +HPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  93    RTNKEV-RKRVYVCPEKTCVHNHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  151

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  152   DWKAHSKTCGTREYKCDCGTLFSRRDSFITHRAFCDA  188



>ref|XP_009144549.1| PREDICTED: zinc finger protein MAGPIE [Brassica rapa]
Length=404

 Score =   258 bits (660),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  1279  QTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLP  1100
             +T K K++R  PG PD + EV+ALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLP
Sbjct  50    ETQKTKKRRGVPGNPDPDAEVVALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLP  109

Query  1099  WKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKM  920
             WKLKQ+  +E  K++VYVCP+T C  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K 
Sbjct  110   WKLKQKNTKEQQKKKVYVCPDTNCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKF  169

Query  919   YAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             YAVQ DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  170   YAVQSDWKAHTKVCGTREYRCDCGTLFSRKDSFITHRAFCDA  211



>emb|CDP21823.1| unnamed protein product [Coffea canephora]
Length=217

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = -1

Query  1288  LSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGH  1109
             ++ Q    K+KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGH
Sbjct  2     IAAQVGPVKKKRNLPGMPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGH  61

Query  1108  NLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKC  929
             NLPWKL+QR  +EV K+RVYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +KCE+C
Sbjct  62    NLPWKLRQRNGKEV-KKRVYVCPEATCIHHDPSRALGDLTGIKKHFCRKHGEKKWKCERC  120

Query  928   NKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             +K YAV  DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  121   SKKYAVISDWKAHTKTCGTREYRCDCGTLFSRRDSFITHRAFCNA  165



>gb|KHN00558.1| Zinc finger protein MAGPIE-like protein [Glycine soja]
Length=503

 Score =   261 bits (668),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 134/158 (85%), Gaps = 1/158 (1%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ PGMPD E EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+
Sbjct  30    PKKKRNLPGMPDPEAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLR  89

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             QR  +EV ++RVYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ
Sbjct  90    QRSSKEV-RKRVYVCPEPTCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQ  148

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAH K CGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  149   SDWKAHSKVCGTREYKCDCGTVFSRRDSFITHRAFCDA  186



>ref|XP_010904556.1| PREDICTED: zinc finger protein NUTCRACKER-like [Elaeis guineensis]
 ref|XP_010904558.1| PREDICTED: zinc finger protein NUTCRACKER-like [Elaeis guineensis]
 ref|XP_010904559.1| PREDICTED: zinc finger protein NUTCRACKER-like [Elaeis guineensis]
 ref|XP_010904560.1| PREDICTED: zinc finger protein NUTCRACKER-like [Elaeis guineensis]
Length=601

 Score =   264 bits (674),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 141/179 (79%), Gaps = 1/179 (1%)
 Frame = -1

Query  1330  RQMTTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKG  1151
             +Q    +P   SA   +     K+KR+ PG P+ + EVIALSPK+LL TNR++C+VC KG
Sbjct  24    QQQPASMPTSSSAAAPQTAAPVKKKRNLPGNPNPDAEVIALSPKALLATNRFICEVCNKG  83

Query  1150  FQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHF  971
             FQREQNLQLHRRGHNLPWKL+Q+  +EV +RRVYVCPETTC  H PS+ALGDL+GIKKHF
Sbjct  84    FQREQNLQLHRRGHNLPWKLRQKSTKEV-RRRVYVCPETTCVHHDPSRALGDLTGIKKHF  142

Query  970   CRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             CRKHG + +KC+KC+K YAVQ DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  143   CRKHGEKKWKCDKCSKKYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  201



>ref|XP_009406262.1| PREDICTED: zinc finger protein NUTCRACKER-like [Musa acuminata 
subsp. malaccensis]
Length=422

 Score =   259 bits (661),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KRS PG PD E EVIALSPK+L+ TNR+VC++CGKGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  23    KKKRSLPGTPDPEAEVIALSPKTLMATNRFVCEICGKGFQRDQNLQLHRRGHNLPWKLRQ  82

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E  ++RVYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC++ YAVQ 
Sbjct  83    RTSKEP-RKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSRCYAVQS  141

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  142   DWKAHSKTCGTREYRCDCGTIFSRRDSFITHRAFCDA  178



>ref|XP_006287797.1| hypothetical protein CARUB_v10001008mg, partial [Capsella rubella]
 gb|EOA20695.1| hypothetical protein CARUB_v10001008mg, partial [Capsella rubella]
Length=431

 Score =   259 bits (662),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K++R  PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  90    KKRRGLPGNPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  149

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             +  +E  +++VYVCPET+C+ HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  150   KSSKEQQRKKVYVCPETSCAHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKFYAVQS  209

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  210   DWKAHTKICGTREYRCDCGTLFSRKDSFITHRAFCDA  246



>ref|XP_010552209.1| PREDICTED: zinc finger protein NUTCRACKER-like [Tarenaya hassleriana]
 ref|XP_010552210.1| PREDICTED: zinc finger protein NUTCRACKER-like [Tarenaya hassleriana]
 ref|XP_010552211.1| PREDICTED: zinc finger protein NUTCRACKER-like [Tarenaya hassleriana]
 ref|XP_010552212.1| PREDICTED: zinc finger protein NUTCRACKER-like [Tarenaya hassleriana]
 ref|XP_010552213.1| PREDICTED: zinc finger protein NUTCRACKER-like [Tarenaya hassleriana]
Length=509

 Score =   261 bits (668),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -1

Query  1291  QLSEQTVKP-KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRR  1115
             QL  Q+ +P K+KR+ PG PD E EVIALSPK+L+ TNR++CD+C KGFQR+QNLQLHRR
Sbjct  68    QLQAQSSQPPKKKRNQPGNPDPEAEVIALSPKTLMATNRFICDICNKGFQRDQNLQLHRR  127

Query  1114  GHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCE  935
             GHNLPWKLKQR   E V+++VYVCPE +C  H PS+ALGDL+GIKKHFCRKHG + +KC+
Sbjct  128   GHNLPWKLKQRSKTEAVRKKVYVCPEASCVHHEPSRALGDLTGIKKHFCRKHGEKKWKCD  187

Query  934   KCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             KC+K YAVQ D KAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  188   KCSKRYAVQSDCKAHFKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  234



>ref|XP_009793158.1| PREDICTED: zinc finger protein NUTCRACKER-like [Nicotiana sylvestris]
Length=494

 Score =   261 bits (666),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPKSLL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  54    KKKRNLPGNPDPEAEVIALSPKSLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  113

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV K++VYVCPE +C  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  114   RTNKEV-KKKVYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  172

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  173   DWKAHSKICGTREYRCDCGTLFSRRDSFITHRAFCDA  209



>ref|XP_010534894.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010534896.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010534897.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X2 [Tarenaya 
hassleriana]
Length=453

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 145/296 (49%), Positives = 180/296 (61%), Gaps = 38/296 (13%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  83    KKKRNQPGNPDPEAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  142

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   EVV+++VYVCPE +C  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  143   RSKTEVVRKKVYVCPEPSCVHHDPSRALGDLTGIKKHFFRKHGEKKWKCEKCSKRYAVQS  202

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYASQaltvtapsaspppqpptpSMA  725
             DWKAH KTCGT++Y CDCG LF+R+DSFI H+  C A     +   SA   P      + 
Sbjct  203   DWKAHSKTCGTKEYRCDCGTLFSRRDSFITHRAFCDA-----LAEESAKAVPTHQPNPLM  257

Query  724   VLSPTLSLHSIQSFELPEDRVMGGANYKERTQAPSSSFGLVIGDNGEEDFSSVFRLSLRS  545
             V S + S + I + E          NY   T +    F +     G  + +  F   L  
Sbjct  258   VQSSSSSHNLITTLE----------NYS--TDSNPHPFSMKKEHEGSFNHTLTFPPWLSP  305

Query  544   GNEEEAT------PACAAIMERpvplllstpppVYHASNP-PVLSATALLQKAAEM  398
              N   +       PA AA                +H S P P +SATALLQ+AA+M
Sbjct  306   SNPNPSAGLFPFGPATAASF--------------HHPSPPSPAISATALLQRAAQM  347



>ref|XP_010679126.1| PREDICTED: zinc finger protein NUTCRACKER [Beta vulgaris subsp. 
vulgaris]
Length=510

 Score =   261 bits (667),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  1255  RSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQRGP  1076
             RS PG PD + EVIALSPK+LL TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQR  
Sbjct  51    RSLPGNPDPDAEVIALSPKTLLATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLKQRSK  110

Query  1075  EEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQCDWK  896
              ++V+++ YVCPE++C  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K+YAVQ DWK
Sbjct  111   TDIVRKKAYVCPESSCVHHHPSRALGDLTGIKKHFCRKHGEKKYKCEKCSKIYAVQSDWK  170

Query  895   AHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             AH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  171   AHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  204



>ref|XP_004146996.1| PREDICTED: zinc finger protein NUTCRACKER-like [Cucumis sativus]
Length=520

 Score =   261 bits (668),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = -1

Query  1270  KPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKL  1091
             KPK+KRS PG PD + +VIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL
Sbjct  48    KPKKKRSLPGNPDPDADVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKL  107

Query  1090  KQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAV  911
             KQR  +EV K++ YVCPE +C  HHPS+ALGDL+GIKKH+CRKHG + +KC+KC+K+YAV
Sbjct  108   KQRNNKEV-KKKAYVCPEPSCVHHHPSRALGDLTGIKKHYCRKHGEKKWKCDKCSKVYAV  166

Query  910   QCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             Q DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  167   QSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  205



>ref|XP_004249492.1| PREDICTED: zinc finger protein JACKDAW [Solanum lycopersicum]
Length=493

 Score =   261 bits (666),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 141/185 (76%), Gaps = 5/185 (3%)
 Frame = -1

Query  1333  PRQMTTVLPGE-ESAQLSEQTVKP----KRKRSTPGMPDAEVEVIALSPKSLLETNRYVC  1169
             P  +  VLP   +  Q +    KP    K++R+ PG PD + EVIALSPKSL+ TNR++C
Sbjct  10    PSSVKAVLPHHHQELQTANPNPKPNTSSKKRRNLPGTPDPDAEVIALSPKSLMATNRFIC  69

Query  1168  DVCGKGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLS  989
             ++C KGFQR+QNLQLHRRGHNLPWKLKQR   E VK++VY+CPE TC  H PS+ALGDL+
Sbjct  70    EICNKGFQRDQNLQLHRRGHNLPWKLKQRNKLEQVKKKVYICPEKTCIHHDPSRALGDLT  129

Query  988   GIKKHFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHK  809
             GIKKHF RKHG + +KCEKC+K YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+
Sbjct  130   GIKKHFSRKHGEKKWKCEKCSKKYAVQSDWKAHSKTCGTREYKCDCGTLFSRKDSFITHR  189

Query  808   RVCYA  794
               C A
Sbjct  190   AFCDA  194



>ref|XP_010547496.1| PREDICTED: zinc finger protein MAGPIE-like isoform X1 [Tarenaya 
hassleriana]
Length=510

 Score =   261 bits (667),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  32    KKKRNLPGMPDPDAEVIALSPKALLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  91

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV K++VYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  92    RSSKEV-KKKVYVCPEPTCVHHEPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKKYAVQS  150

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGT++Y CDCG LF+R+DSFI H+  C A
Sbjct  151   DWKAHSKICGTKEYKCDCGTLFSRRDSFITHRAFCDA  187



>ref|XP_010521474.1| PREDICTED: zinc finger protein MAGPIE-like [Tarenaya hassleriana]
Length=475

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KRS PGMPD E EVI+LSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  32    KKKRSLPGMPDPEAEVISLSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLQQ  91

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV K++VYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  92    RSSKEV-KKKVYVCPEPTCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKKYAVQS  150

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGT++Y CDCG LF+R+DSFI H+  C A
Sbjct  151   DWKAHSKICGTKEYKCDCGTLFSRRDSFITHRAFCDA  187



>gb|KHG05632.1| Zinc finger MAGPIE -like protein [Gossypium arboreum]
Length=524

 Score =   261 bits (668),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD + EVIALSP +LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  32    KKKRNLPGMPDPDAEVIALSPSTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  91

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV K+RVYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  92    RSSKEV-KKRVYVCPEITCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQS  150

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVC  800
             DWKAH K CGTR+Y CDCG +F+R+DSFI H+  C
Sbjct  151   DWKAHSKICGTREYKCDCGTVFSRRDSFITHRAFC  185



>ref|XP_010087102.1| Zinc finger protein MAGPIE [Morus notabilis]
 gb|EXB26542.1| Zinc finger protein MAGPIE [Morus notabilis]
Length=459

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 137/163 (84%), Gaps = 1/163 (1%)
 Frame = -1

Query  1282  EQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNL  1103
             ++  K K+KR+ PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNL
Sbjct  41    QEPQKLKKKRNLPGNPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNL  100

Query  1102  PWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNK  923
             PWKLKQR  +E+ K+R YVCPE TC  HHPS+ALGDL+GIKKH+CRKHG + +KCEKC+K
Sbjct  101   PWKLKQRSSKEI-KKRAYVCPEPTCVHHHPSRALGDLTGIKKHYCRKHGEKKWKCEKCSK  159

Query  922   MYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             +YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  160   IYAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  202



>gb|KDP31793.1| hypothetical protein JCGZ_12254 [Jatropha curcas]
Length=522

 Score =   261 bits (668),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 135/163 (83%), Gaps = 1/163 (1%)
 Frame = -1

Query  1282  EQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNL  1103
             + T   K+KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNL
Sbjct  28    KSTATGKKKRNLPGMPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNL  87

Query  1102  PWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNK  923
             PWKL+QR  +EV K+RVYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K
Sbjct  88    PWKLRQRSSKEV-KKRVYVCPEPTCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSK  146

Query  922   MYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              YAVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  147   KYAVQSDWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  189



>ref|XP_011025733.1| PREDICTED: zinc finger protein NUTCRACKER-like [Populus euphratica]
Length=536

 Score =   262 bits (669),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 135/164 (82%), Gaps = 1/164 (1%)
 Frame = -1

Query  1285  SEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHN  1106
             S+     K+KR+ PGMPD E EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHN
Sbjct  36    SKSAATAKKKRNLPGMPDPEAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHN  95

Query  1105  LPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCN  926
             LPWKL+QR  +EV K+RVYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+
Sbjct  96    LPWKLRQRSSKEV-KKRVYVCPEPTCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCS  154

Query  925   KMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             K YAVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  155   KKYAVQSDWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  198



>ref|XP_011100239.1| PREDICTED: zinc finger protein NUTCRACKER [Sesamum indicum]
Length=463

 Score =   260 bits (664),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSP++L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  24    KKKRNLPGTPDPEAEVIALSPQTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  83

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  84    RSSKEV-RKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVQS  142

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  143   DWKAHSKTCGTREYKCDCGTIFSRRDSFITHRAFCDA  179



>ref|XP_009365587.1| PREDICTED: zinc finger protein NUTCRACKER-like [Pyrus x bretschneideri]
Length=535

 Score =   262 bits (669),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD E +VI LSP +LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  40    KKKRNLPGMPDPEADVITLSPTTLLATNRFVCEICSKGFQRDQNLQLHRRGHNLPWKLKQ  99

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPET+C  H+P++ALGDL+GIKKHFCRKHG + ++CE+C+K YAVQ 
Sbjct  100   RTSKEV-RKRVYVCPETSCVHHNPTRALGDLTGIKKHFCRKHGEKKWQCERCSKKYAVQS  158

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAHMKTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  159   DWKAHMKTCGTREYKCDCGTLFSRRDSFITHRAFCDA  195



>emb|CDP06730.1| unnamed protein product [Coffea canephora]
Length=554

 Score =   262 bits (670),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD + EVIALSPK+L+ TNR++C++C KGFQREQNLQLHRRGHNLPWKLKQ
Sbjct  46    KKKRNLPGNPDPDAEVIALSPKTLMATNRFICEICNKGFQREQNLQLHRRGHNLPWKLKQ  105

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E VKR+VY+CPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  106   RTTKEQVKRKVYICPEKTCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  165

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  166   DWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDA  202



>ref|XP_004304416.1| PREDICTED: zinc finger protein MAGPIE-like [Fragaria vesca subsp. 
vesca]
Length=464

 Score =   260 bits (664),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD + EVIALSP +L+ TNR++C++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  37    KKKRNLPGTPDPDAEVIALSPTTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLRQ  96

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  ++V+K++VY+CPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  97    RTNKDVIKKKVYICPEKTCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  156

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  157   DWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDA  193



>ref|XP_003518037.1| PREDICTED: zinc finger protein JACKDAW-like [Glycine max]
 ref|XP_003518040.1| PREDICTED: zinc finger protein JACKDAW-like [Glycine max]
Length=525

 Score =   261 bits (668),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 134/158 (85%), Gaps = 1/158 (1%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ PGMPD E EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+
Sbjct  30    PKKKRNLPGMPDPEAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLR  89

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             QR  +EV ++RVYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ
Sbjct  90    QRSSKEV-RKRVYVCPEPTCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQ  148

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAH K CGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  149   SDWKAHSKVCGTREYKCDCGTVFSRRDSFITHRAFCDA  186



>ref|XP_009781290.1| PREDICTED: zinc finger protein JACKDAW-like isoform X1 [Nicotiana 
sylvestris]
Length=494

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 139/180 (77%), Gaps = 6/180 (3%)
 Frame = -1

Query  1315  VLPGEESAQLSEQTVKPK------RKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGK  1154
             VLP      L E    PK      ++R+ PG PD + EVIALSPK+L+ TNR++C++C K
Sbjct  17    VLPHHPQDVLLEPNPNPKANSSSKKRRNLPGTPDPDAEVIALSPKTLMATNRFLCEICNK  76

Query  1153  GFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKH  974
             GFQR+QNLQLHRRGHNLPWKLKQR  +E+VK++VY+CPE TC  + PS+ALGDL+GIKKH
Sbjct  77    GFQRDQNLQLHRRGHNLPWKLKQRNKQEIVKKKVYICPEKTCVHNDPSRALGDLTGIKKH  136

Query  973   FCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             F RKHG + +KCEKC+K YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  137   FSRKHGEKKWKCEKCSKKYAVQSDWKAHTKTCGTREYKCDCGTLFSRKDSFITHRAFCDA  196



>ref|XP_002302090.2| hypothetical protein POPTR_0002s04880g [Populus trichocarpa]
 gb|EEE81363.2| hypothetical protein POPTR_0002s04880g [Populus trichocarpa]
Length=472

 Score =   260 bits (664),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 145/176 (82%), Gaps = 3/176 (2%)
 Frame = -1

Query  1321  TTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQR  1142
             +T+ P ++  Q  ++T+K  +KR+ PG PD + EVIALSPK+LL TNR+VC++C KGFQR
Sbjct  35    STISPLQQQQQQQQRTIK--KKRNLPGNPDPDAEVIALSPKTLLTTNRFVCEICNKGFQR  92

Query  1141  EQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRK  962
             +QNLQLHRRGHNLPWKLKQR  +E+ K++ YVCPE TC  HHPS+ALGDL+GIKKH+CRK
Sbjct  93    DQNLQLHRRGHNLPWKLKQRNSKEI-KKKAYVCPEPTCVHHHPSRALGDLTGIKKHYCRK  151

Query  961   HGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             HG + +KCEKC+K+YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  152   HGEKKWKCEKCSKIYAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  207



>ref|XP_010547497.1| PREDICTED: zinc finger protein MAGPIE-like isoform X2 [Tarenaya 
hassleriana]
Length=508

 Score =   261 bits (666),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  32    KKKRNLPGMPDPDAEVIALSPKALLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  91

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV K++VYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  92    RSSKEV-KKKVYVCPEPTCVHHEPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKKYAVQS  150

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGT++Y CDCG LF+R+DSFI H+  C A
Sbjct  151   DWKAHSKICGTKEYKCDCGTLFSRRDSFITHRAFCDA  187



>gb|EAY72878.1| hypothetical protein OsI_00752 [Oryza sativa Indica Group]
Length=487

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 137/171 (80%), Gaps = 2/171 (1%)
 Frame = -1

Query  1300  ESAQLSEQTVKP--KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQ  1127
             + A +S     P  K+KRS PG PD E EVIALSP++L+ TNRYVC++CGKGFQR+QNLQ
Sbjct  31    DQASVSSHPAPPPAKKKRSLPGNPDPEAEVIALSPRTLMATNRYVCEICGKGFQRDQNLQ  90

Query  1126  LHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRT  947
             LHRRGHNLPWKLKQR P+EVV+++VYVCPE  C  H P++ALGDL+GIKKHF RKHG + 
Sbjct  91    LHRRGHNLPWKLKQRNPKEVVRKKVYVCPEPGCVHHDPARALGDLTGIKKHFSRKHGEKK  150

Query  946   FKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             +KC+KC+K YAV  DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  151   WKCDKCSKRYAVHSDWKAHSKVCGTREYRCDCGTLFSRRDSFITHRAFCDA  201



>ref|XP_011026098.1| PREDICTED: zinc finger protein NUTCRACKER-like [Populus euphratica]
Length=474

 Score =   260 bits (664),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  51    KKKRNLPGNPDPDAEVIALSPKTLLTTNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  110

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E+ K++ YVCPE TC  HHPS+ALGDL+GIKKH+CRKHG + +KCEKC+K+YAVQ 
Sbjct  111   RNSKEI-KKKAYVCPEPTCVHHHPSRALGDLTGIKKHYCRKHGEKKWKCEKCSKIYAVQS  169

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  170   DWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  206



>emb|CDP02817.1| unnamed protein product [Coffea canephora]
Length=502

 Score =   261 bits (666),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 134/161 (83%), Gaps = 1/161 (1%)
 Frame = -1

Query  1276  TVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPW  1097
             T   K+KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPW
Sbjct  24    TSSAKKKRNLPGMPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPW  83

Query  1096  KLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMY  917
             KL+QR  +EV K+RVYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K Y
Sbjct  84    KLRQRSSKEV-KKRVYVCPELTCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKY  142

Query  916   AVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             AVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  143   AVQSDWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  183



>gb|KDP24073.1| hypothetical protein JCGZ_25730 [Jatropha curcas]
Length=472

 Score =   259 bits (663),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  30    KKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  89

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E  ++RVYVCPE +C  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  90    RTTKEA-RKRVYVCPEKSCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  148

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  149   DWKAHSKTCGTREYKCDCGTLFSRRDSFITHRAFCDA  185



>ref|XP_007204325.1| hypothetical protein PRUPE_ppa004299mg [Prunus persica]
 gb|EMJ05524.1| hypothetical protein PRUPE_ppa004299mg [Prunus persica]
Length=517

 Score =   261 bits (667),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 140/176 (80%), Gaps = 6/176 (3%)
 Frame = -1

Query  1306  GEESAQLS-EQTVKPK----RKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQR  1142
             GE S   S  QT  PK    +KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR
Sbjct  13    GEASVSSSGNQTAPPKPTTKKKRNLPGMPDPDAEVIALSPKTLLATNRFVCEICNKGFQR  72

Query  1141  EQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRK  962
             +QNLQLHRRGHNLPWKL+QR  +EV K+RVYVCPE +C  H PS+ALGDL+GIKKHFCRK
Sbjct  73    DQNLQLHRRGHNLPWKLRQRSSKEV-KKRVYVCPEPSCVHHDPSRALGDLTGIKKHFCRK  131

Query  961   HGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             HG + +KC+KC+K YAVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  132   HGEKKWKCDKCSKKYAVQSDWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  187



>ref|XP_002894488.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70747.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=456

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 140/179 (78%), Gaps = 4/179 (2%)
 Frame = -1

Query  1318  TVLPGEESAQLSEQTVKP----KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKG  1151
             T   G    Q  EQ   P    KRKR+ PG PD E EV+ALSPK+L+ TNR++C+VC KG
Sbjct  41    TETSGSNINQRQEQCFVPQSSLKRKRNQPGNPDPEAEVMALSPKTLMATNRFICEVCNKG  100

Query  1150  FQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHF  971
             FQR+QNLQLH+RGHNLPWKLKQR  ++V++++VYVCPE +C  HHPS+ALGDL+GIKKHF
Sbjct  101   FQRDQNLQLHKRGHNLPWKLKQRSNKDVIRKKVYVCPEPSCVHHHPSRALGDLTGIKKHF  160

Query  970   CRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              RKHG + +KCEKC+K YAVQ DWKAH KTCGT++Y CDCG LF+R+DSFI H+  C A
Sbjct  161   FRKHGEKKWKCEKCSKKYAVQSDWKAHAKTCGTKEYRCDCGTLFSRRDSFITHRAFCDA  219



>gb|ADL36648.1| C2H2L domain class transcription factor [Malus domestica]
Length=528

 Score =   261 bits (667),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 140/176 (80%), Gaps = 6/176 (3%)
 Frame = -1

Query  1306  GEESAQLS-EQTVKPK----RKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQR  1142
             GE S   S  QT  PK    +KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR
Sbjct  13    GEASVSSSGNQTAPPKPATKKKRNLPGMPDPDAEVIALSPKTLLATNRFVCEICSKGFQR  72

Query  1141  EQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRK  962
             +QNLQLHRRGHNLPWKL+QR  +EV K+RVYVCPE +C  H PS+ALGDL+GIKKHFCRK
Sbjct  73    DQNLQLHRRGHNLPWKLRQRSSKEV-KKRVYVCPEASCVHHDPSRALGDLTGIKKHFCRK  131

Query  961   HGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             HG + +KC+KC+K YAVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  132   HGEKKWKCDKCSKKYAVQSDWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  187



>emb|CDX97281.1| BnaA02g20720D [Brassica napus]
Length=385

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = -1

Query  1279  QTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLP  1100
             +T K K++R  PG PD + EV+ALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLP
Sbjct  50    ETQKTKKRRGVPGNPDPDAEVVALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLP  109

Query  1099  WKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKM  920
             WKLKQ+  +E  K++VYVCP+T C  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K 
Sbjct  110   WKLKQKNTKEQQKKKVYVCPDTKCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKF  169

Query  919   YAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             YAVQ DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  170   YAVQSDWKAHTKVCGTREYRCDCGTLFSRKDSFITHRAFCDA  211



>ref|NP_001042288.1| Os01g0195000 [Oryza sativa Japonica Group]
 dbj|BAD72204.1| putative zinc finger protein ID1 [Oryza sativa Japonica Group]
 dbj|BAD72423.1| putative zinc finger protein ID1 [Oryza sativa Japonica Group]
 dbj|BAF04202.1| Os01g0195000 [Oryza sativa Japonica Group]
 gb|EAZ10885.1| hypothetical protein OsJ_00729 [Oryza sativa Japonica Group]
Length=487

 Score =   260 bits (664),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 137/171 (80%), Gaps = 2/171 (1%)
 Frame = -1

Query  1300  ESAQLSEQTVKP--KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQ  1127
             + A +S     P  K+KRS PG PD E EVIALSP++L+ TNRYVC++CGKGFQR+QNLQ
Sbjct  31    DQASVSSHPAPPPAKKKRSLPGNPDPEAEVIALSPRTLMATNRYVCEICGKGFQRDQNLQ  90

Query  1126  LHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRT  947
             LHRRGHNLPWKLKQR P+EVV+++VYVCPE  C  H P++ALGDL+GIKKHF RKHG + 
Sbjct  91    LHRRGHNLPWKLKQRNPKEVVRKKVYVCPEAGCVHHDPARALGDLTGIKKHFSRKHGEKK  150

Query  946   FKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             +KC+KC+K YAV  DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  151   WKCDKCSKRYAVHSDWKAHSKVCGTREYRCDCGTLFSRRDSFITHRAFCDA  201



>ref|XP_010043069.1| PREDICTED: zinc finger protein MAGPIE [Eucalyptus grandis]
 gb|KCW85101.1| hypothetical protein EUGRSUZ_B01936 [Eucalyptus grandis]
Length=485

 Score =   259 bits (663),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 147/331 (44%), Positives = 196/331 (59%), Gaps = 25/331 (8%)
 Frame = -1

Query  1282  EQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNL  1103
             +Q  + K+KRS PG PD   EVIALSP +L+ TNR+VC++C KGFQR+QNLQLHRRGHNL
Sbjct  59    QQAPQAKKKRSLPGNPDPSAEVIALSPTTLMATNRFVCEICNKGFQRDQNLQLHRRGHNL  118

Query  1102  PWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNK  923
             PWKLKQRG  E+ ++RVYVCPE +C  H+P++ALGDL+GIKKHFCRKHG + +KCE+C+K
Sbjct  119   PWKLKQRGSAEI-RKRVYVCPEPSCVHHNPARALGDLTGIKKHFCRKHGEKKWKCERCSK  177

Query  922   MYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA---SQaltvtapsaspp  752
              YAVQ DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  C A          A +   P
Sbjct  178   KYAVQSDWKAHSKTCGTREYKCDCGTIFSRRDSFITHRAFCDALTEENTKLNQALAPHLP  237

Query  751   pqpptpSMAVLSPTLSLHSIQSFELPEDRVMGGANYKERTQAPSSSF--GLVIGDNGEED  578
                      + S ++ L   QS  +P       AN+ + T+ P  S   GL++     + 
Sbjct  238   SSVGQQPNNLSSSSVPLSQAQSNTIPSTEAPEFANHAD-TKPPLFSLPQGLIL----HQS  292

Query  577   FSSVFRLSLRSGNEEEATPACAAIMERpvplllstpppVYHASNPP-----VLSATALLQ  413
                    +L SGN    T     +            P + H  N P      +SATALLQ
Sbjct  293   KPMTMPQTLFSGNNLFGTTNARTV------APPPISPSLIHGMNSPQRGSAFMSATALLQ  346

Query  412   KAAEMgssfssggsfFAGYGLTMPATPAQWG  320
             KAA+M    ++  +  A   ++ P  P+ +G
Sbjct  347   KAAQM---GATVSNNSATSFVSAPMAPSSFG  374



>ref|XP_004246670.1| PREDICTED: zinc finger protein JACKDAW isoform X1 [Solanum lycopersicum]
Length=459

 Score =   259 bits (661),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 137/171 (80%), Gaps = 6/171 (4%)
 Frame = -1

Query  1288  LSEQTVKPK------RKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQ  1127
             L EQ   PK      ++R+ PG PD + EVIA+SPK+L+ TNR++C++C KGFQR+QNLQ
Sbjct  18    LVEQNPNPKANSSSKKRRNLPGTPDPDAEVIAISPKTLMATNRFICEICNKGFQRDQNLQ  77

Query  1126  LHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRT  947
             LHRRGHNLPWKLKQR  +E+VK++VY+CPE +C  H PS+ALGDL+GIKKHF RKHG + 
Sbjct  78    LHRRGHNLPWKLKQRNKQEIVKKKVYICPEKSCVHHDPSRALGDLTGIKKHFSRKHGEKK  137

Query  946   FKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             +KCEKC+K YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  138   WKCEKCSKKYAVQSDWKAHTKTCGTREYKCDCGTLFSRKDSFITHRAFCDA  188



>ref|XP_011012272.1| PREDICTED: zinc finger protein NUTCRACKER-like [Populus euphratica]
Length=489

 Score =   260 bits (664),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  66    KKKRNLPGNPDPDAEVIALSPKTLLTTNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  125

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E+ K++ YVCPE TC  HHPS+ALGDL+GIKKH+CRKHG + +KCEKC+K+YAVQ 
Sbjct  126   RNSKEI-KKKAYVCPEPTCVHHHPSRALGDLTGIKKHYCRKHGEKKWKCEKCSKIYAVQS  184

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  185   DWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  221



>ref|XP_007132765.1| hypothetical protein PHAVU_011G123200g [Phaseolus vulgaris]
 gb|ESW04759.1| hypothetical protein PHAVU_011G123200g [Phaseolus vulgaris]
Length=467

 Score =   259 bits (662),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 143/187 (76%), Gaps = 5/187 (3%)
 Frame = -1

Query  1342  MEDPRQMTTVLPGEESAQLSEQTVKP----KRKRSTPGMPDAEVEVIALSPKSLLETNRY  1175
             M++   +T   P   +A  +  +  P    KRKR+ PG PD E EV+ALSPK+L+ TNR+
Sbjct  5     MDEGEIITNAFPQNLTASAASNSSNPPPALKRKRNLPGNPDPEAEVVALSPKTLMATNRF  64

Query  1174  VCDVCGKGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGD  995
             +C+ CGKGFQR+QNLQLHRRGHNLPWKLKQR  +E  ++RVYVCPE +C  H PS+ALGD
Sbjct  65    LCETCGKGFQRDQNLQLHRRGHNLPWKLKQRTGKEA-RKRVYVCPEKSCVHHDPSRALGD  123

Query  994   LSGIKKHFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIA  815
             L+GIKKHFCRKHG + +KCEKC+K YAVQ DWKAH KTCGTR+Y CDCG +F+R+DSFI 
Sbjct  124   LTGIKKHFCRKHGEKKWKCEKCSKRYAVQSDWKAHSKTCGTREYKCDCGTIFSRRDSFIT  183

Query  814   HKRVCYA  794
             H+  C A
Sbjct  184   HRAFCDA  190



>ref|XP_011048567.1| PREDICTED: zinc finger protein JACKDAW-like [Populus euphratica]
Length=512

 Score =   260 bits (665),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKR+ PG PD + EVIALSPKSL+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  38    KRKRNLPGTPDPDAEVIALSPKSLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  97

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV +++VY+CPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  98    RTNKEV-RKKVYICPEKTCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  156

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  157   DWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDA  193



>emb|CDP08272.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   260 bits (665),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 138/166 (83%), Gaps = 2/166 (1%)
 Frame = -1

Query  1285  SEQTVKP--KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRG  1112
             + Q+ +P  K+KR+ PG PD E EVIALSP++LL TNR++C++C KGFQR+QNLQLHRRG
Sbjct  39    TNQSAQPASKKKRNLPGNPDPEAEVIALSPRTLLATNRFICEICNKGFQRDQNLQLHRRG  98

Query  1111  HNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEK  932
             HNLPWKLKQR  +EV++++VY+CPETTC  H PS+ALGDL+G+KKHF RKHG + +KCEK
Sbjct  99    HNLPWKLKQRSNKEVIRKKVYICPETTCVHHDPSRALGDLTGVKKHFSRKHGEKKWKCEK  158

Query  931   CNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             C+K YAVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  159   CSKRYAVQSDWKAHSKICGTREYRCDCGTLFSRRDSFITHRAFCDA  204



>gb|KHN22265.1| Zinc finger protein MAGPIE [Glycine soja]
Length=465

 Score =   259 bits (661),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 150/335 (45%), Positives = 196/335 (59%), Gaps = 32/335 (10%)
 Frame = -1

Query  1309  PGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNL  1130
             P  E A  ++    PK+KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNL
Sbjct  14    PALEIAPQTQPLPPPKKKRNLPGMPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNL  73

Query  1129  QLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHR  950
             QLHRRGHNLPWKL+QRG +E  +++ YVCPE +C  H+P++ALGDL+GIKKHFCRKHG +
Sbjct  74    QLHRRGHNLPWKLRQRGSKEP-QKKAYVCPEPSCVHHNPARALGDLTGIKKHFCRKHGEK  132

Query  949   TFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYASQaltvta  770
              ++CE+C+K YAV  DWKAHMKTCG+R+Y CDCG LF+R+DSFI H+  C      +  A
Sbjct  133   KWQCERCSKKYAVHSDWKAHMKTCGSREYRCDCGTLFSRRDSFITHRAFCDVLAQESARA  192

Query  769   psasp---------------ppqpptpSMAVLSPTLSLHSIQSFELPEDRV---------  662
                +                P  P TPS +V+SPTLS+ S +  E P  +V         
Sbjct  193   QDQAQGGSSNSYVVVVSSSPPTPPLTPSASVVSPTLSIQSSEIPENPSTKVSPTSPNASC  252

Query  661   -----MGGANYKERTQAPSSSFGLV--IGDNGEEDFSSVFRLSLRSGNEEEATPACAAIM  503
                      +      APS++         N    FS++     RS N         ++ 
Sbjct  253   FVTSSSSTPSSTTSVLAPSTTPTTPSQSPSNSTCSFSNLMSNLARSENSNALMREPTSLS  312

Query  502   ERpvplllstpppVYHASNPPVLSATALLQKAAEM  398
                     +  P  Y A   P LSATALLQKAA+M
Sbjct  313   LSTPLYHSNNDPLHYTALPQPALSATALLQKAAQM  347



>ref|XP_008813524.1| PREDICTED: zinc finger protein MAGPIE-like [Phoenix dactylifera]
 ref|XP_008813525.1| PREDICTED: zinc finger protein MAGPIE-like [Phoenix dactylifera]
Length=418

 Score =   258 bits (658),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -1

Query  1270  KPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKL  1091
             K K+KRS PG PD + EVIALSPK+L+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL
Sbjct  54    KAKKKRSQPGNPDPDAEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKL  113

Query  1090  KQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAV  911
             +Q+  +E V++RVYVCPE +C  HHPS+ALGDL+GIKKH+ RKHG + +KCEKC+K YAV
Sbjct  114   RQKSSKEGVRKRVYVCPEASCIHHHPSRALGDLTGIKKHYSRKHGEKKWKCEKCSKRYAV  173

Query  910   QCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
               DWKAH+KTCGTR+Y CDCGALF+RKDSFI H+  C A
Sbjct  174   HSDWKAHVKTCGTREYRCDCGALFSRKDSFITHRAFCDA  212



>ref|XP_008648994.1| PREDICTED: LOC542697 isoform X4 [Zea mays]
 ref|XP_008649003.1| PREDICTED: LOC542697 isoform X4 [Zea mays]
 tpg|DAA48718.1| TPA: hypothetical protein ZEAMMB73_834941 [Zea mays]
Length=546

 Score =   261 bits (667),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 134/159 (84%), Gaps = 2/159 (1%)
 Frame = -1

Query  1267  PKRKRSTPGMP-DAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKL  1091
             PK+KR+ PG P D + EVIALSPK+L+ TNR+VC+VC KGFQREQNLQLHRRGHNLPWKL
Sbjct  40    PKKKRNQPGNPTDPDAEVIALSPKTLMATNRFVCEVCNKGFQREQNLQLHRRGHNLPWKL  99

Query  1090  KQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAV  911
             KQ+ P+E  +RRVY+CPE TC  H PS+ALGDL+GIKKH+CRKHG + +KC+KCNK YAV
Sbjct  100   KQKNPKET-RRRVYLCPEPTCVHHDPSRALGDLTGIKKHYCRKHGEKKWKCDKCNKRYAV  158

Query  910   QCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             Q DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  159   QSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  197



>ref|XP_010999961.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X2 [Populus 
euphratica]
Length=544

 Score =   261 bits (667),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD E EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  38    KKKRNLPGMPDPEAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  97

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV K+RVYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  98    RSSKEV-KKRVYVCPEPTCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQS  156

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  157   DWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  193



>ref|XP_010244313.1| PREDICTED: zinc finger protein NUTCRACKER-like [Nelumbo nucifera]
 ref|XP_010244314.1| PREDICTED: zinc finger protein NUTCRACKER-like [Nelumbo nucifera]
Length=511

 Score =   260 bits (665),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  37    KKKRNLPGTPDPEAEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  96

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPET+C  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  97    RSSKEV-RKRVYVCPETSCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQS  155

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  156   DWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  192



>ref|XP_006380751.1| hypothetical protein POPTR_0007s12520g [Populus trichocarpa]
 gb|ERP58548.1| hypothetical protein POPTR_0007s12520g [Populus trichocarpa]
Length=536

 Score =   261 bits (666),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 135/164 (82%), Gaps = 1/164 (1%)
 Frame = -1

Query  1285  SEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHN  1106
             S+     K+KR+ PGMPD E EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHN
Sbjct  32    SKSAATAKKKRNLPGMPDPEAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHN  91

Query  1105  LPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCN  926
             LPWKL+QR  ++V K+RVYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+
Sbjct  92    LPWKLRQRSSKDV-KKRVYVCPEPTCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCS  150

Query  925   KMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             K YAVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  151   KKYAVQSDWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  194



>ref|XP_010088951.1| Zinc finger protein MAGPIE [Morus notabilis]
 gb|EXB37166.1| Zinc finger protein MAGPIE [Morus notabilis]
Length=519

 Score =   260 bits (665),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = -1

Query  1321  TTVLPGEESAQLS-EQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQ  1145
             TT+  G  + QL  +Q+   K+KR+ PG PD   EV+ALSP +LL  NR+VC++C KGFQ
Sbjct  59    TTLSNGSTTQQLVLDQSPPVKKKRNPPGNPDPSAEVVALSPNTLLARNRFVCEICNKGFQ  118

Query  1144  REQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCR  965
             R+QNLQLHRRGHNLPWKLKQR   EV++RRVY+CPE +C  H+P++ALGDL+GIKKHFCR
Sbjct  119   RDQNLQLHRRGHNLPWKLKQRNSNEVIRRRVYICPEPSCVHHNPARALGDLTGIKKHFCR  178

Query  964   KHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             KHG + +KCEKC+K YAVQ DWKAH KTCGTR+Y C+CG LF+R+DSFI H+  C A
Sbjct  179   KHGEKKWKCEKCSKKYAVQSDWKAHSKTCGTREYKCECGTLFSRRDSFITHRAFCDA  235



>ref|XP_010046700.1| PREDICTED: zinc finger protein JACKDAW-like [Eucalyptus grandis]
Length=502

 Score =   260 bits (664),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD + EVIALSPK+L+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  38    KKKRNLPGTPDPDAEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  97

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E+VK++VY+CPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  98    RS-KEIVKKKVYICPEKTCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  156

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  157   DWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDA  193



>ref|XP_006381470.1| hypothetical protein POPTR_0006s13130g [Populus trichocarpa]
 gb|ERP59267.1| hypothetical protein POPTR_0006s13130g [Populus trichocarpa]
Length=512

 Score =   260 bits (665),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKR+ PG PD + EVIALSPKSL+ TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  38    KRKRNLPGTPDPDAEVIALSPKSLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLKQ  97

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV +++VY+CPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  98    RTNKEV-RKKVYICPEKTCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  156

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  157   DWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDA  193



>ref|XP_009598165.1| PREDICTED: zinc finger protein JACKDAW-like isoform X1 [Nicotiana 
tomentosiformis]
Length=495

 Score =   259 bits (663),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 139/180 (77%), Gaps = 6/180 (3%)
 Frame = -1

Query  1315  VLPGEESAQLSEQTVKPK------RKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGK  1154
             VLP      L E    PK      ++R+ PG PD + EVIALSPK+L+ TNR++C++C K
Sbjct  17    VLPHHPQDVLLEPNPNPKSNSSSKKRRNLPGTPDPDAEVIALSPKTLMATNRFICEICNK  76

Query  1153  GFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKH  974
             GFQR+QNLQLHRRGHNLPWKLKQR  +E+VK++VY+CPE +C  + PS+ALGDL+GIKKH
Sbjct  77    GFQRDQNLQLHRRGHNLPWKLKQRNKQEIVKKKVYICPEKSCVHNDPSRALGDLTGIKKH  136

Query  973   FCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             F RKHG + +KCEKC+K YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  137   FSRKHGEKKWKCEKCSKKYAVQSDWKAHTKTCGTREYKCDCGTLFSRKDSFITHRAFCDA  196



>ref|XP_010260340.1| PREDICTED: zinc finger protein MAGPIE-like [Nelumbo nucifera]
Length=469

 Score =   259 bits (661),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD + EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  30    KKKRNLPGNPDPDAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  89

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E  ++RVYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  90    RTSKEP-RKRVYVCPEKTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  148

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  149   DWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  185



>tpg|DAA48715.1| TPA: hypothetical protein ZEAMMB73_834941 [Zea mays]
Length=612

 Score =   263 bits (671),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 134/158 (85%), Gaps = 1/158 (1%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ PG P+ + EVIALSPK+L+ TNR+VC+VC KGFQREQNLQLHRRGHNLPWKLK
Sbjct  107   PKKKRNQPGNPNPDAEVIALSPKTLMATNRFVCEVCNKGFQREQNLQLHRRGHNLPWKLK  166

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             Q+ P+E  +RRVY+CPE TC  H PS+ALGDL+GIKKH+CRKHG + +KC+KCNK YAVQ
Sbjct  167   QKNPKET-RRRVYLCPEPTCVHHDPSRALGDLTGIKKHYCRKHGEKKWKCDKCNKRYAVQ  225

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  226   SDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  263



>ref|XP_010540892.1| PREDICTED: zinc finger protein NUTCRACKER-like [Tarenaya hassleriana]
Length=477

 Score =   259 bits (662),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 134/158 (85%), Gaps = 1/158 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSP +L+ TNR+VC++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  25    KKKRNLPGNPDPEAEVIALSPNTLMATNRFVCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  84

Query  1084  RGPEEV-VKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             R  ++  V++RVYVCPE  C  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAV 
Sbjct  85    RANKDAAVRKRVYVCPEKACVHHHPSRALGDLTGIKKHFCRKHGDKKYKCEKCSKRYAVP  144

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAHMKTCGTR+Y CDCG++F+R+DSFI H+  C A
Sbjct  145   SDWKAHMKTCGTREYRCDCGSVFSRRDSFITHRAFCDA  182



>ref|XP_007012298.1| Indeterminate(ID)-domain 7, putative [Theobroma cacao]
 gb|EOY29917.1| Indeterminate(ID)-domain 7, putative [Theobroma cacao]
Length=552

 Score =   261 bits (667),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = -1

Query  1330  RQMTTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKG  1151
             R  T  L  ++S   + Q    K+KRS PG PD + EVIALSPK+L+ TNR++C++C KG
Sbjct  28    RIETGTLYPQQSFASTNQAPPSKKKRSLPGNPDPDAEVIALSPKTLMATNRFICEICNKG  87

Query  1150  FQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHF  971
             FQR+QNLQLH+RGHNLPWKLKQR  +E+++++VYVCPE TC  H P++ALGDL+GIKKHF
Sbjct  88    FQRDQNLQLHKRGHNLPWKLKQRTNKELIRKKVYVCPEPTCVHHDPARALGDLTGIKKHF  147

Query  970   CRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             CRKHG + +KCEKC+K YAVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  148   CRKHGEKKWKCEKCSKRYAVQSDWKAHSKICGTREYRCDCGTLFSRRDSFITHRAFCDA  206



>ref|XP_011089888.1| PREDICTED: zinc finger protein JACKDAW [Sesamum indicum]
Length=492

 Score =   259 bits (663),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKR+ PG PD + EVIALSPKSL+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  40    KRKRNLPGTPDPDAEVIALSPKSLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  99

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EVV+++VY+CPE TC  H PS+ALGDL+GIKKH+ RKHG + +KCEKC+K YAVQ 
Sbjct  100   RTNKEVVRKKVYICPEKTCVHHDPSRALGDLTGIKKHYSRKHGEKKWKCEKCSKKYAVQS  159

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG +F+RKDSFI H+  C A
Sbjct  160   DWKAHSKICGTREYKCDCGTIFSRKDSFITHRAFCDA  196



>ref|XP_004487192.1| PREDICTED: zinc finger protein MAGPIE-like [Cicer arietinum]
Length=454

 Score =   258 bits (660),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKR+ PG PD E EVI+LSPK+L+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  31    KRKRNLPGNPDPEAEVISLSPKTLMATNRFVCEICLKGFQRDQNLQLHRRGHNLPWKLKQ  90

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPE TC  +HPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  91    RTSQEV-RKRVYVCPEKTCVHNHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKFYAVQS  149

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG +F+R+DSF+ H+  C A
Sbjct  150   DWKAHSKTCGTREYKCDCGTIFSRRDSFVTHRAFCDA  186



>ref|XP_009596422.1| PREDICTED: zinc finger protein NUTCRACKER-like [Nicotiana tomentosiformis]
Length=495

 Score =   259 bits (663),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPKSLL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  56    KKKRNLPGNPDPEAEVIALSPKSLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  115

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV K++VYVCPE +C  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  116   RTNKEV-KKKVYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  174

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  175   DWKAHSKICGTREYRCDCGTLFSRRDSFITHRAFCDA  211



>ref|XP_002876042.1| ATIDD2-DOMAIN 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52301.1| ATIDD2-DOMAIN 2 [Arabidopsis lyrata subsp. lyrata]
Length=446

 Score =   258 bits (659),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 141/177 (80%), Gaps = 2/177 (1%)
 Frame = -1

Query  1321  TTVLPGEESAQ-LSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQ  1145
             ++ + GE S   LS      K+KR+ PGMPD E EVIALSPK+LL TNR+VC++C KGFQ
Sbjct  8     SSTVSGEASVSILSTGKSTGKKKRNLPGMPDPESEVIALSPKTLLATNRFVCEICNKGFQ  67

Query  1144  REQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCR  965
             R+QNLQLHRRGHNLPWKL+Q+  +EV K++VYVCPE +C  H PS+ALGDL+GIKKHFCR
Sbjct  68    RDQNLQLHRRGHNLPWKLRQKSNKEV-KKKVYVCPEVSCVHHDPSRALGDLTGIKKHFCR  126

Query  964   KHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             KHG + +KC+KC+K YAVQ DWKAH K CGT++Y CDCG LF+R+DSFI H+  C A
Sbjct  127   KHGEKKWKCDKCSKKYAVQSDWKAHSKICGTKEYKCDCGTLFSRRDSFITHRAFCDA  183



>gb|KHF99746.1| Zinc finger MAGPIE -like protein [Gossypium arboreum]
Length=445

 Score =   258 bits (659),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 2/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD + EVIALSPK+LL TNR+VC+VC KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  49    KKKRNLPGNPDPDSEVIALSPKTLLSTNRFVCEVCNKGFQRDQNLQLHRRGHNLPWKLKQ  108

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  E  +K++VYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K+YAVQ 
Sbjct  109   RSKE--MKKKVYVCPEPTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKIYAVQS  166

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  167   DWKAHSKICGTREYRCDCGTLFSRKDSFITHRAFCDA  203



>ref|XP_009805009.1| PREDICTED: zinc finger protein MAGPIE-like isoform X2 [Nicotiana 
sylvestris]
Length=498

 Score =   259 bits (663),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 142/183 (78%), Gaps = 5/183 (3%)
 Frame = -1

Query  1342  MEDPRQMTTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDV  1163
             ME+   MT      E   +++Q    K+KR+   +PD E EVIALSPK+L+ TNR+VC++
Sbjct  4     MENSSSMTVAGSSLEET-ITQQNFPVKKKRN---LPDPEAEVIALSPKALMATNRFVCEI  59

Query  1162  CGKGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGI  983
             C KGFQR+QNLQLHRRGHNLPWKL+QR  +EV K+RVYVCPE TC  H PS+ALGDL+GI
Sbjct  60    CNKGFQRDQNLQLHRRGHNLPWKLRQRTSKEV-KKRVYVCPEATCIHHDPSRALGDLTGI  118

Query  982   KKHFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRV  803
             KKHFCRKHG + FKCE+C K YAVQ DWKAHMKTCGTR+Y CDCG LF+R+DSF+ H+  
Sbjct  119   KKHFCRKHGEKKFKCERCTKKYAVQSDWKAHMKTCGTREYRCDCGTLFSRRDSFVTHRAF  178

Query  802   CYA  794
             C A
Sbjct  179   CDA  181



>ref|XP_007156918.1| hypothetical protein PHAVU_002G028100g [Phaseolus vulgaris]
 gb|ESW28912.1| hypothetical protein PHAVU_002G028100g [Phaseolus vulgaris]
Length=521

 Score =   260 bits (664),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 141/176 (80%), Gaps = 6/176 (3%)
 Frame = -1

Query  1306  GEESAQLS-EQTVKPK----RKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQR  1142
             GE S   S  QTV PK    +KR+ PGMPD + EVIALSPK+L+ TNR+VC++C KGFQR
Sbjct  13    GEASVSSSGNQTVPPKPTTKKKRNLPGMPDPDAEVIALSPKTLMATNRFVCEICNKGFQR  72

Query  1141  EQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRK  962
             +QNLQLHRRGHNLPWKL+QR  +EV ++RVYVCPE TC  H PS+ALGDL+GIKKHFCRK
Sbjct  73    DQNLQLHRRGHNLPWKLRQRSSKEV-RKRVYVCPEPTCVHHDPSRALGDLTGIKKHFCRK  131

Query  961   HGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             HG + +KC+KC+K YAVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  132   HGEKKWKCDKCSKKYAVQSDWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  187



>ref|XP_008440687.1| PREDICTED: zinc finger protein NUTCRACKER-like [Cucumis melo]
Length=507

 Score =   259 bits (663),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  32    KKKRNLPGMPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  91

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   EV K++VYVCPET+C  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  92    RSSNEV-KKKVYVCPETSCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQS  150

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  151   DWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  187



>ref|XP_006351575.1| PREDICTED: zinc finger protein NUTCRACKER-like [Solanum tuberosum]
Length=468

 Score =   258 bits (660),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 154/207 (74%), Gaps = 11/207 (5%)
 Frame = -1

Query  1279  QTVKP--KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHN  1106
             QT  P  K+KR+ PG PD E EV+ALSP+SLL TNR+VC++C KGFQR+QNLQLHRRGHN
Sbjct  44    QTQPPPNKKKRNLPGNPDPEAEVVALSPRSLLATNRFVCEICNKGFQRDQNLQLHRRGHN  103

Query  1105  LPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCN  926
             LPWKLKQR  +EV K++VYVCPE +C  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+
Sbjct  104   LPWKLKQRTNKEV-KKKVYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCS  162

Query  925   KMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYASQaltvtapsaspppq  746
             K YAVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A         +      
Sbjct  163   KRYAVQSDWKAHSKICGTREYRCDCGTLFSRRDSFITHRAFCDA--------LTEESSRT  214

Query  745   pptpSMAVLSPTLSLHSIQSFELPEDR  665
                P  +  S  L+LH++Q+F++ +++
Sbjct  215   IIPPPNSSTSHHLNLHTLQNFQMKQEQ  241



>ref|XP_008338682.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X1 [Malus 
domestica]
Length=520

 Score =   260 bits (664),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 140/176 (80%), Gaps = 6/176 (3%)
 Frame = -1

Query  1306  GEESAQLS-EQTVKPK----RKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQR  1142
             GE S   S  QT  PK    +KR+ PGMPD + EVIALSPK+L+ TNR+VC++C KGFQR
Sbjct  13    GEASVSSSGNQTAPPKPATKKKRNLPGMPDPDAEVIALSPKTLMATNRFVCEICSKGFQR  72

Query  1141  EQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRK  962
             +QNLQLHRRGHNLPWKL+QR  +EV K+RVYVCPE +C  H PS+ALGDL+GIKKHFCRK
Sbjct  73    DQNLQLHRRGHNLPWKLRQRSGKEV-KKRVYVCPEASCVHHDPSRALGDLTGIKKHFCRK  131

Query  961   HGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             HG + +KC+KC+K YAVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  132   HGEKKWKCDKCSKKYAVQSDWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  187



>ref|XP_011072643.1| PREDICTED: zinc finger protein NUTCRACKER-like, partial [Sesamum 
indicum]
Length=347

 Score =   254 bits (650),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 137/166 (83%), Gaps = 1/166 (1%)
 Frame = -1

Query  1291  QLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRG  1112
             Q   Q+   K+KR+ PG PD + EVIALSP++LL TNR+VC++C KGFQR+QNLQLHRRG
Sbjct  50    QPQPQSQPVKKKRNQPGHPDPDAEVIALSPRTLLATNRFVCEICNKGFQRDQNLQLHRRG  109

Query  1111  HNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEK  932
             HNLPWKLKQR  +EV +++VYVCPET+C  H PS+ALGDL+GIKKHFCRKHG + +KC+K
Sbjct  110   HNLPWKLKQRNSKEV-RKKVYVCPETSCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDK  168

Query  931   CNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             C+K YAVQ DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  169   CSKKYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  214



>ref|XP_008338685.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X2 [Malus 
domestica]
Length=513

 Score =   259 bits (663),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 140/176 (80%), Gaps = 6/176 (3%)
 Frame = -1

Query  1306  GEESAQLS-EQTVKPK----RKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQR  1142
             GE S   S  QT  PK    +KR+ PGMPD + EVIALSPK+L+ TNR+VC++C KGFQR
Sbjct  13    GEASVSSSGNQTAPPKPATKKKRNLPGMPDPDAEVIALSPKTLMATNRFVCEICSKGFQR  72

Query  1141  EQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRK  962
             +QNLQLHRRGHNLPWKL+QR  +EV K+RVYVCPE +C  H PS+ALGDL+GIKKHFCRK
Sbjct  73    DQNLQLHRRGHNLPWKLRQRSGKEV-KKRVYVCPEASCVHHDPSRALGDLTGIKKHFCRK  131

Query  961   HGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             HG + +KC+KC+K YAVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  132   HGEKKWKCDKCSKKYAVQSDWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  187



>ref|XP_010106246.1| hypothetical protein L484_005111 [Morus notabilis]
 gb|EXC09155.1| hypothetical protein L484_005111 [Morus notabilis]
Length=506

 Score =   259 bits (663),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 134/158 (85%), Gaps = 1/158 (1%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ PG PD + EVIALSPKSLL TNR++C++C KGFQR+QNLQLHRRGHNLPWKLK
Sbjct  59    PKKKRNLPGNPDPDAEVIALSPKSLLATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLK  118

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             QR  +EV K++VYVCPE +C  H P++ALGDL+G+KKHFCRKHG + +KC+KC+K YAVQ
Sbjct  119   QRASKEV-KKKVYVCPEASCVHHDPARALGDLTGVKKHFCRKHGEKKWKCDKCSKRYAVQ  177

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  178   SDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  215



>ref|XP_010534893.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X1 [Tarenaya 
hassleriana]
Length=474

 Score =   259 bits (661),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 145/296 (49%), Positives = 180/296 (61%), Gaps = 38/296 (13%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  104   KKKRNQPGNPDPEAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  163

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   EVV+++VYVCPE +C  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  164   RSKTEVVRKKVYVCPEPSCVHHDPSRALGDLTGIKKHFFRKHGEKKWKCEKCSKRYAVQS  223

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYASQaltvtapsaspppqpptpSMA  725
             DWKAH KTCGT++Y CDCG LF+R+DSFI H+  C A     +   SA   P      + 
Sbjct  224   DWKAHSKTCGTKEYRCDCGTLFSRRDSFITHRAFCDA-----LAEESAKAVPTHQPNPLM  278

Query  724   VLSPTLSLHSIQSFELPEDRVMGGANYKERTQAPSSSFGLVIGDNGEEDFSSVFRLSLRS  545
             V S + S + I + E          NY   T +    F +     G  + +  F   L  
Sbjct  279   VQSSSSSHNLITTLE----------NYS--TDSNPHPFSMKKEHEGSFNHTLTFPPWLSP  326

Query  544   GNEEEAT------PACAAIMERpvplllstpppVYHASNP-PVLSATALLQKAAEM  398
              N   +       PA AA                +H S P P +SATALLQ+AA+M
Sbjct  327   SNPNPSAGLFPFGPATAASF--------------HHPSPPSPAISATALLQRAAQM  368



>ref|XP_009396147.1| PREDICTED: zinc finger protein MAGPIE-like [Musa acuminata subsp. 
malaccensis]
Length=551

 Score =   261 bits (666),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 138/172 (80%), Gaps = 1/172 (1%)
 Frame = -1

Query  1309  PGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNL  1130
             P   S+        PK+KR+ PG P+ + EV+ALSPK+LL TNR++C+VC KGFQREQNL
Sbjct  26    PQPSSSSTPTAAAPPKKKRNLPGNPNPDAEVVALSPKTLLATNRFICEVCNKGFQREQNL  85

Query  1129  QLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHR  950
             QLHRRGHNLPWKLKQ+ P+EV +RRVY+CPE TC  + PS+ALGDL+GIKKH+CRKHG +
Sbjct  86    QLHRRGHNLPWKLKQKNPKEV-RRRVYICPEPTCVHYEPSRALGDLTGIKKHYCRKHGEK  144

Query  949   TFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              +KC+KC+K YAVQ DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  145   KWKCDKCSKRYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  196



>ref|XP_006643871.1| PREDICTED: zinc finger protein NUTCRACKER-like [Oryza brachyantha]
Length=484

 Score =   259 bits (661),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 136/171 (80%), Gaps = 2/171 (1%)
 Frame = -1

Query  1300  ESAQLSEQTVKP--KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQ  1127
             + A +S     P  K+KRS PG PD E EVIALSPK+L+ TNRYVC++CGKGFQR+QNLQ
Sbjct  31    DQASVSSHPAPPPAKKKRSLPGNPDPEAEVIALSPKTLMATNRYVCEICGKGFQRDQNLQ  90

Query  1126  LHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRT  947
             LHRRGHNLPWKLKQR P+E V+++VYVCPE  C  H P++ALGDL+GIKKHF RKHG + 
Sbjct  91    LHRRGHNLPWKLKQRNPKEAVRKKVYVCPEAGCVHHDPARALGDLTGIKKHFSRKHGEKK  150

Query  946   FKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             +KC+KC+K YAV  DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  151   WKCDKCSKRYAVHSDWKAHSKVCGTREYRCDCGTLFSRRDSFITHRAFCDA  201



>ref|XP_010475014.1| PREDICTED: zinc finger protein MAGPIE-like isoform X1 [Camelina 
sativa]
Length=509

 Score =   259 bits (663),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  40    KKKRNLPGNPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  99

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPE +C  HHP++ALGDL+GIKKHFCRKHG + +KCEKC K YAVQ 
Sbjct  100   RTSKEV-RKRVYVCPEKSCVHHHPTRALGDLTGIKKHFCRKHGEKKWKCEKCAKRYAVQS  158

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  159   DWKAHSKTCGTREYRCDCGTIFSRRDSFITHRAFCDA  195



>ref|XP_010917616.1| PREDICTED: zinc finger protein MAGPIE-like [Elaeis guineensis]
Length=391

 Score =   256 bits (654),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -1

Query  1270  KPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKL  1091
             K K+KRS PG PD + EVIALSPK+L+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL
Sbjct  54    KAKKKRSQPGNPDPDAEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKL  113

Query  1090  KQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAV  911
             +QR  +E V++RVYVCPE++C  HHPS+ALGDL+GIKKH+ RKHG + +KCEKC+K YAV
Sbjct  114   RQRSSKEGVRKRVYVCPESSCIHHHPSRALGDLTGIKKHYSRKHGEKKWKCEKCSKRYAV  173

Query  910   QCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
               DWKAH+KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  174   HSDWKAHVKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  212



>gb|EYU42150.1| hypothetical protein MIMGU_mgv1a006193mg [Erythranthe guttata]
Length=453

 Score =   258 bits (659),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 135/158 (85%), Gaps = 1/158 (1%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLK
Sbjct  24    PKKKRNLPGTPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLK  83

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             QR  +EV ++RVYVCPE TC  +HPS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAV 
Sbjct  84    QRSTKEV-RKRVYVCPEKTCVHNHPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVH  142

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  143   SDWKAHSKTCGTREYKCDCGTIFSRRDSFITHRAFCDA  180



>ref|XP_007156028.1| hypothetical protein PHAVU_003G252400g [Phaseolus vulgaris]
 gb|ESW28022.1| hypothetical protein PHAVU_003G252400g [Phaseolus vulgaris]
Length=506

 Score =   259 bits (663),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 153/372 (41%), Positives = 195/372 (52%), Gaps = 76/372 (20%)
 Frame = -1

Query  1306  GEESAQLSEQTVKP--KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQN  1133
             GE S   S    KP  KRKR+ PGMPD E EVIALSPK+LL TNR+VC++C KGFQR+QN
Sbjct  13    GEASISSSGNQTKPTPKRKRNLPGMPDPEAEVIALSPKTLLATNRFVCEICNKGFQRDQN  72

Query  1132  LQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGH  953
             LQLHRRGHNLPWKL+QR  +EV ++RVYVCPE  C  H PS+ALGDL+GIKKHFCRKH  
Sbjct  73    LQLHRRGHNLPWKLRQRSTKEV-RKRVYVCPEPACVHHDPSRALGDLTGIKKHFCRKHCE  131

Query  952   RTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYASQaltvt  773
             + +KC+KC+K YAVQ DWKAH K CG R+Y CDCG +F+R+DSFI H+  C A    ++ 
Sbjct  132   KKWKCDKCSKKYAVQSDWKAHSKVCGNREYKCDCGTVFSRRDSFITHRAFCDALAKESMR  191

Query  772   apsaspppqppt-------------pSMAVLSPTLSLHSI------QSFELPEDRVMGGA  650
             + +                       +    SP  S  +I      Q+ ELPE+      
Sbjct  192   SHTDVTKANEENDSKVLTDSPPPEVAAATATSPAQSNSAISSGGQTQNPELPEN------  245

Query  649   NYKERTQAPSS-------------------SFGLVIGDNGEEDFSSVFRLSLRSGNEEEA  527
             N  + T+ P +                   + G     N    F+S+F  S  +G ++  
Sbjct  246   NLPQVTEEPQALTATSGSCGSNSSNNCSTSNGGATSNSNSSSMFASLFASSTSTGTQQSQ  305

Query  526   TPA----------------------------CAAIMERpvplllstpppVYHASNP-PVL  434
             TPA                            C +                 +AS P P +
Sbjct  306   TPAFSDLVRAMGPPDHHADISAPSSSEAISLCLSTSNASPIFATGGQEHRQYASPPQPAM  365

Query  433   SATALLQKAAEM  398
             SATALLQKAA+M
Sbjct  366   SATALLQKAAQM  377



>emb|CBI25044.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   256 bits (654),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = -1

Query  1255  RSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQRGP  1076
             R+ PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQR  
Sbjct  46    RNLPGNPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNS  105

Query  1075  EEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQCDWK  896
             +E+ K++ YVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K+YAVQ DWK
Sbjct  106   KEI-KKKAYVCPEPTCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKIYAVQSDWK  164

Query  895   AHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             AH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  165   AHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  198



>ref|XP_009762294.1| PREDICTED: zinc finger protein JACKDAW-like isoform X2 [Nicotiana 
sylvestris]
Length=505

 Score =   259 bits (662),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = -1

Query  1318  TVLPGEESAQLSEQTVKPKRKRSTPGM-PDAEVEVIALSPKSLLETNRYVCDVCGKGFQR  1142
             T+ P    AQ   Q    K++R+ PG  P  + EVIALSPKSL+ TNR++C+VC KGFQR
Sbjct  15    TLAPSSSMAQTQAQATPTKKRRNQPGTTPYPDAEVIALSPKSLMATNRFLCEVCNKGFQR  74

Query  1141  EQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRK  962
             EQNLQLHRRGHNLPWKLKQ+  +EVVKR+VY+CPE TC  H  S+ALGDL+GIKKH+ RK
Sbjct  75    EQNLQLHRRGHNLPWKLKQKNTKEVVKRKVYLCPEITCVHHEISRALGDLTGIKKHYFRK  134

Query  961   HGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             HG + FKCEKC+K YAVQ DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  135   HGEKKFKCEKCSKKYAVQSDWKAHTKTCGTREYRCDCGTLFSRRDSFITHRAFCVA  190



>ref|XP_010669389.1| PREDICTED: zinc finger protein NUTCRACKER-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010669390.1| PREDICTED: zinc finger protein NUTCRACKER-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010669391.1| PREDICTED: zinc finger protein NUTCRACKER-like [Beta vulgaris 
subsp. vulgaris]
Length=562

 Score =   261 bits (666),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR  PG PD + EVIALSPKSLL TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  75    KKKRGLPGNPDPDSEVIALSPKSLLATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLKQ  134

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  ++++KR+VYVCPE +C  H PS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  135   RPKDQIIKRKVYVCPEPSCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKKYAVQS  194

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  195   DWKAHSKICGTREYRCDCGTLFSRRDSFITHRAFCDA  231



>ref|NP_171880.1| zinc finger protein MAGPIE [Arabidopsis thaliana]
 sp|Q9ZWA6.1|IDD3_ARATH RecName: Full=Zinc finger protein MAGPIE; AltName: Full=Protein 
indeterminate-domain 3 [Arabidopsis thaliana]
 gb|AAD10684.1| putative zinc-finger protein [Arabidopsis thaliana]
 gb|AAP12858.1| At1g03840 [Arabidopsis thaliana]
 dbj|BAE99815.1| putative DNA-binding protein [Arabidopsis thaliana]
 dbj|BAH30266.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE27620.1| zinc finger protein MAGPIE [Arabidopsis thaliana]
Length=506

 Score =   259 bits (662),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  41    KKKRNLPGNPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  100

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPE +C  HHP++ALGDL+GIKKHFCRKHG + +KCEKC K YAVQ 
Sbjct  101   RTSKEV-RKRVYVCPEKSCVHHHPTRALGDLTGIKKHFCRKHGEKKWKCEKCAKRYAVQS  159

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  160   DWKAHSKTCGTREYRCDCGTIFSRRDSFITHRAFCDA  196



>ref|XP_004143503.1| PREDICTED: uncharacterized protein LOC101217597 [Cucumis sativus]
 gb|KGN48816.1| hypothetical protein Csa_6G502050 [Cucumis sativus]
Length=507

 Score =   259 bits (662),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  32    KKKRNLPGMPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  91

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   EV K++VYVCPET+C  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  92    RSSNEV-KKKVYVCPETSCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQS  150

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  151   DWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  187



>ref|XP_002306797.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE93793.2| zinc finger family protein [Populus trichocarpa]
Length=474

 Score =   258 bits (660),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 141/195 (72%), Gaps = 1/195 (1%)
 Frame = -1

Query  1255  RSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQRGP  1076
             RS PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQR  
Sbjct  54    RSLPGNPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNS  113

Query  1075  EEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQCDWK  896
             +E+ K++ YVCPE TC  HHPS+ALGDL+GIKKH+CRKHG + +KCEKC+K+YAVQ DWK
Sbjct  114   KEI-KKKAYVCPEPTCVHHHPSRALGDLTGIKKHYCRKHGEKKWKCEKCSKIYAVQSDWK  172

Query  895   AHMKTCGTRDYICDCGALFARKDSFIAHKRVCYASQaltvtapsaspppqpptpSMAVLS  716
             AH KTCGTR+Y CDCG LF+RKDSF+ H+  C A    +    +       P     +L 
Sbjct  173   AHSKTCGTREYRCDCGTLFSRKDSFVTHRAFCDALAEESARLSAHQLISTDPNAQALLLQ  232

Query  715   PTLSLHSIQSFELPE  671
               L  H I  F  P 
Sbjct  233   NALQAHPISLFSAPN  247



>ref|XP_006418198.1| hypothetical protein EUTSA_v10009734mg [Eutrema salsugineum]
 gb|ESQ36551.1| hypothetical protein EUTSA_v10009734mg [Eutrema salsugineum]
Length=504

 Score =   259 bits (662),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  39    KKKRNLPGNPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  98

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPE +C  HHP++ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  99    RTSKEV-RKRVYVCPEKSCVHHHPTRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  157

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  158   DWKAHSKTCGTREYRCDCGTIFSRRDSFITHRAFCDA  194



>ref|XP_010919168.1| PREDICTED: zinc finger protein MAGPIE-like [Elaeis guineensis]
Length=450

 Score =   258 bits (658),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD + EVIALSPK+LL TNR+VC++CGKGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  24    KKKRNQPGNPDPQAEVIALSPKTLLATNRFVCEICGKGFQRDQNLQLHRRGHNLPWKLRQ  83

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E  ++RVYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  84    RSTKEP-RKRVYVCPEKTCIHHHPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVQS  142

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  143   DWKAHSKTCGTREYRCDCGTIFSRRDSFITHRAFCDA  179



>ref|XP_004245090.1| PREDICTED: zinc finger protein NUTCRACKER [Solanum lycopersicum]
Length=467

 Score =   258 bits (659),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 136/164 (83%), Gaps = 3/164 (2%)
 Frame = -1

Query  1279  QTVKP--KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHN  1106
             QT  P  K+KR+ PG PD E EV+ALSP+SLL TNR+VC++C KGFQR+QNLQLHRRGHN
Sbjct  45    QTQPPPNKKKRNLPGNPDPEAEVVALSPRSLLATNRFVCEICNKGFQRDQNLQLHRRGHN  104

Query  1105  LPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCN  926
             LPWKLKQR  +EV K++VYVCPE +C  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+
Sbjct  105   LPWKLKQRSNKEV-KKKVYVCPEASCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCS  163

Query  925   KMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             K YAVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  164   KRYAVQSDWKAHSKICGTREYRCDCGTLFSRRDSFITHRAFCDA  207



>ref|XP_006307283.1| hypothetical protein CARUB_v10008897mg [Capsella rubella]
 gb|EOA40181.1| hypothetical protein CARUB_v10008897mg [Capsella rubella]
Length=508

 Score =   259 bits (662),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  42    KKKRNLPGNPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  101

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPE +C  HHP++ALGDL+GIKKHFCRKHG + +KCEKC K YAVQ 
Sbjct  102   RTSKEV-RKRVYVCPEKSCVHHHPTRALGDLTGIKKHFCRKHGEKKWKCEKCAKRYAVQS  160

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  161   DWKAHSKTCGTREYRCDCGTIFSRRDSFITHRAFCDA  197



>ref|XP_010503736.1| PREDICTED: zinc finger protein MAGPIE-like isoform X1 [Camelina 
sativa]
Length=451

 Score =   257 bits (657),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD E EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  34    KKKRNLPGMPDPESEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  93

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             +  +EV +++VYVCPE +C  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K+YAVQ 
Sbjct  94    KSSKEV-RKKVYVCPEVSCVHHEPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKIYAVQS  152

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGT++Y CDCG LF+R+DSFI H+  C A
Sbjct  153   DWKAHSKICGTKEYKCDCGTLFSRRDSFITHRAFCDA  189



>ref|XP_002527396.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF34962.1| nucleic acid binding protein, putative [Ricinus communis]
Length=552

 Score =   260 bits (665),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD + EVIALSPK+L+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  58    KKKRNLPGNPDPDAEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  117

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV++++VYVCPET+C  H PS+ALGDL+GIKKHF RKHG + +KC+KC+K YAVQ 
Sbjct  118   RTNKEVIRKKVYVCPETSCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCDKCSKRYAVQS  177

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  178   DWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  214



>ref|XP_006291095.1| hypothetical protein CARUB_v10017209mg [Capsella rubella]
 gb|EOA23993.1| hypothetical protein CARUB_v10017209mg [Capsella rubella]
Length=458

 Score =   258 bits (658),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 137/167 (82%), Gaps = 3/167 (2%)
 Frame = -1

Query  1288  LSEQTVKP--KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRR  1115
             L    VKP  K+KR+ PGMPD E EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRR
Sbjct  28    LPNPAVKPTGKKKRNLPGMPDPESEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRR  87

Query  1114  GHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCE  935
             GHNLPWKL+Q+  +EV +++VYVCPE +C  H PS+ALGDL+GIKKHFCRKHG + +KC+
Sbjct  88    GHNLPWKLRQKSSKEV-RKKVYVCPELSCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCD  146

Query  934   KCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             KC+K YAVQ DWKAH K CGT++Y CDCG LF+R+DSFI H+  C A
Sbjct  147   KCSKKYAVQSDWKAHSKICGTKEYKCDCGTLFSRRDSFITHRAFCDA  193



>gb|AFY26885.1| zinc finger protein [Morella rubra]
Length=514

 Score =   259 bits (662),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 139/176 (79%), Gaps = 6/176 (3%)
 Frame = -1

Query  1306  GEESAQLSEQTVKP-----KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQR  1142
             GE S   S    +P     K+KR+ PGMPD + EVIALSPK+L+ TNR+VC++C KGFQR
Sbjct  13    GEASVSSSGNQSQPPKPTAKKKRNLPGMPDPDAEVIALSPKTLMATNRFVCEICNKGFQR  72

Query  1141  EQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRK  962
             +QNLQLHRRGHNLPWKL+QR  +EV K+RVYVCPE +C  H PS+ALGDL+GIKKHFCRK
Sbjct  73    DQNLQLHRRGHNLPWKLRQRSSKEV-KKRVYVCPEPSCVHHDPSRALGDLTGIKKHFCRK  131

Query  961   HGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             HG + +KC+KC+K YAVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  132   HGEKKWKCDKCSKKYAVQSDWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  187



>ref|XP_003540171.1| PREDICTED: zinc finger protein JACKDAW-like [Glycine max]
 gb|KHN25044.1| Zinc finger protein JACKDAW [Glycine soja]
Length=500

 Score =   259 bits (661),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKRS PG PD   EVIALSPKSL+ TNR++C+VC KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  38    KRKRSLPGTPDPNAEVIALSPKSLMATNRFICEVCNKGFQRDQNLQLHRRGHNLPWKLRQ  97

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  EEVVK++VYVCPE TC  H P +ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  98    RNKEEVVKKKVYVCPEKTCVHHDPCRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  157

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR Y CDCG +F+RKDSF+ H+  C A
Sbjct  158   DWKAHNKICGTRQYKCDCGTIFSRKDSFVTHRAFCDA  194



>ref|XP_004501031.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X1 [Cicer 
arietinum]
 ref|XP_004501032.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X2 [Cicer 
arietinum]
 ref|XP_004501033.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X3 [Cicer 
arietinum]
 ref|XP_004501034.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X4 [Cicer 
arietinum]
Length=402

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 190/295 (64%), Gaps = 22/295 (7%)
 Frame = -1

Query  1246  PGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQRGPEEV  1067
             PGMPD + EVIALSP++LL TNR++C++C KGFQREQNLQLHRRGHNLPWKL+QR  EE+
Sbjct  22    PGMPDPDAEVIALSPQTLLATNRFICEICNKGFQREQNLQLHRRGHNLPWKLRQRASEEI  81

Query  1066  VKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQCDWKAHM  887
              +++VYVCPET+C  H+PS+ALGDL+G+KKHFCRKHG + +KCE+C+K YAV+ DWKAHM
Sbjct  82    -RKKVYVCPETSCVHHNPSRALGDLTGVKKHFCRKHGEKKWKCERCSKNYAVKSDWKAHM  140

Query  886   KTCGTRDYICDCGALFARKDSFIAHKRVCY----------ASQaltvtapsaspppqppt  737
             K+CGTR+Y CDCG LF+R+DSF+ H+  C           ++     ++ S+ P P    
Sbjct  141   KSCGTREYKCDCGTLFSRRDSFMTHRAFCDVLGNESGKGGSNFVAVTSSSSSQPTPPLTP  200

Query  736   pSMAVLSPTLSLHSIQSFELPED--RVMGGANYKERTQAPSSSFGLVIGDNGEEDFSSVF  563
                +VLS T +L SIQS +  E+  R+   ++    + +  S+F  ++      D  + F
Sbjct  201   SKSSVLSTTANL-SIQSSDTAENQTRLSPPSSNASNSTSCCSTFSNLMSSLAHSDCPTTF  259

Query  562   RLSLRSGNEEEATPACAAIMERpvplllstpppVYHASNPPVLSATALLQKAAEM  398
              ++      E  T + +  +            P Y     P LSATALLQKAAEM
Sbjct  260   SIT------EPTTLSLSTPLYLSNNNNKDYLLPHYPPQ--PALSATALLQKAAEM  306



>ref|XP_010503737.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X2 [Camelina 
sativa]
Length=423

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD E EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  34    KKKRNLPGMPDPESEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  93

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             +  +EV +++VYVCPE +C  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K+YAVQ 
Sbjct  94    KSSKEV-RKKVYVCPEVSCVHHEPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKIYAVQS  152

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGT++Y CDCG LF+R+DSFI H+  C A
Sbjct  153   DWKAHSKICGTKEYKCDCGTLFSRRDSFITHRAFCDA  189



>ref|XP_008673585.1| PREDICTED: zinc finger protein NUTCRACKER-like [Zea mays]
 tpg|DAA52992.1| TPA: hypothetical protein ZEAMMB73_513383 [Zea mays]
Length=497

 Score =   258 bits (660),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 138/171 (81%), Gaps = 2/171 (1%)
 Frame = -1

Query  1300  ESAQLSEQTVKP--KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQ  1127
             + A +S   V P  K+KRS PG PD + EVIALSP++L+ TNRYVC+VCGKGFQR+QNLQ
Sbjct  36    DQASVSSHPVPPPAKKKRSLPGNPDPDAEVIALSPRTLMATNRYVCEVCGKGFQRDQNLQ  95

Query  1126  LHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRT  947
             LHRRGHNLPWKLKQR P+EVV+++VYVCPE  C  H P++ALGDL+GIKKHF RKHG + 
Sbjct  96    LHRRGHNLPWKLKQRNPKEVVRKKVYVCPEPGCVHHDPARALGDLTGIKKHFSRKHGEKK  155

Query  946   FKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             +KC++C K YAVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  156   WKCDRCAKRYAVQSDWKAHSKVCGTREYRCDCGTLFSRRDSFITHRAFCDA  206



>emb|CBI32713.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 133/158 (84%), Gaps = 1/158 (1%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ PG PD + EVIALSPK+L+ TNR++C++C KGFQR+QNLQLHRRGHNLPWKLK
Sbjct  33    PKKKRNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLK  92

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             QR  +EV +++VY+CPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ
Sbjct  93    QRSNKEV-RKKVYICPEKTCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQ  151

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  152   SDWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDA  189



>ref|XP_002462813.1| hypothetical protein SORBIDRAFT_02g032400 [Sorghum bicolor]
 gb|EER99334.1| hypothetical protein SORBIDRAFT_02g032400 [Sorghum bicolor]
Length=533

 Score =   259 bits (663),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG P+ + EVIALSP++LL TNR+VC+VC KGFQREQNLQLHRRGHNLPWKLKQ
Sbjct  42    KKKRNQPGNPNPDAEVIALSPRTLLATNRFVCEVCNKGFQREQNLQLHRRGHNLPWKLKQ  101

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             + P++V +RRVY+CPE TC  H PS+ALGDL+GIKKH+CRKHG + +KC+KCNK YAVQ 
Sbjct  102   KNPKDV-RRRVYLCPEPTCVHHDPSRALGDLTGIKKHYCRKHGEKKWKCDKCNKRYAVQS  160

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  161   DWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  197



>gb|ABR17388.1| unknown [Picea sitchensis]
Length=698

 Score =   263 bits (673),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 137/163 (84%), Gaps = 1/163 (1%)
 Frame = -1

Query  1282  EQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNL  1103
             +Q   PKRKR+ PGMPD + EVIALSPK+L+ TNR+VC++C KGFQR+QNLQLHRRGHNL
Sbjct  88    QQPGVPKRKRNLPGMPDPDAEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRRGHNL  147

Query  1102  PWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNK  923
             PWKL+QR  +E+ ++RVY+CPE +C  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K
Sbjct  148   PWKLRQRTSKEI-RKRVYICPEPSCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSK  206

Query  922   MYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              YAVQ DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  207   RYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  249



>ref|XP_009420841.1| PREDICTED: zinc finger protein NUTCRACKER-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420842.1| PREDICTED: zinc finger protein NUTCRACKER-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420843.1| PREDICTED: zinc finger protein NUTCRACKER-like [Musa acuminata 
subsp. malaccensis]
Length=534

 Score =   259 bits (663),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 139/175 (79%), Gaps = 7/175 (4%)
 Frame = -1

Query  1318  TVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQRE  1139
             + +PG  +A         K+KR+ PG P+ + EVIALSP+SLL TNR+VC+VC KGFQRE
Sbjct  34    STIPGSSAA------APQKKKRNLPGKPNPDAEVIALSPRSLLATNRFVCEVCNKGFQRE  87

Query  1138  QNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKH  959
             QNLQLHRRGHNLPWKLKQ+ PEEV +RRVYVCPE TC  H PS+ALGDL+G+KKHFCRKH
Sbjct  88    QNLQLHRRGHNLPWKLKQKNPEEV-RRRVYVCPEPTCVHHDPSRALGDLTGVKKHFCRKH  146

Query  958   GHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             G + +KC+KC+K YAVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  147   GEKRWKCDKCSKRYAVQSDWKAHSKICGTREYRCDCGTLFSRRDSFITHRAFCDA  201



>ref|XP_010653553.1| PREDICTED: zinc finger protein JACKDAW [Vitis vinifera]
 ref|XP_002275477.3| PREDICTED: zinc finger protein JACKDAW [Vitis vinifera]
Length=492

 Score =   258 bits (660),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 133/158 (84%), Gaps = 1/158 (1%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ PG PD + EVIALSPK+L+ TNR++C++C KGFQR+QNLQLHRRGHNLPWKLK
Sbjct  33    PKKKRNLPGTPDPDAEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLK  92

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             QR  +EV +++VY+CPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ
Sbjct  93    QRSNKEV-RKKVYICPEKTCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQ  151

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  152   SDWKAHSKTCGTREYKCDCGTLFSRKDSFITHRAFCDA  189



>gb|KFK34317.1| hypothetical protein AALP_AA5G129400 [Arabis alpina]
Length=451

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 159/381 (42%), Positives = 214/381 (56%), Gaps = 32/381 (8%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD E EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  31    KKKRNLPGMPDPESEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  90

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             +  ++V K++VYVCPE +C  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  91    KSNKQV-KKKVYVCPELSCVHHEPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQS  149

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA---------SQaltvtapsaspp  752
             DWKAH K CGT++Y CDCG LF+R+DSFI H+  C A         +Q+    +      
Sbjct  150   DWKAHSKICGTKEYKCDCGTLFSRRDSFITHRAFCDALAEESARSHNQSNKKQSHEVLTR  209

Query  751   pqpptpSMAVLSP-----TLSLHSIQSFELPEDRVMGGANYKERTQAPSSSFGLVIGDNG  587
              +    S    SP     T  + S Q+ ++ +          E  Q      GL +  NG
Sbjct  210   KKHVPDSSIAPSPVETQSTARVKSSQAIKIKQSESP--KTPPESVQEALKPCGLNVTSNG  267

Query  586   EEDFSSVFRLSLRSGNEEEATPACAAI------MERpvplllstpppVYHASN----PPV  437
                F+ +F+ S  S +   A+ +  ++      +E     L +T    +  SN     P 
Sbjct  268   V--FAGLFQSSSASPSIYTASSSSRSLFAPSSSIEPISLGLSTTHGSSFLGSNRFPTQPA  325

Query  436   LSATALLQKAAEMgssfssggsfFAGYGLTMPATPAQWGM--Hanapelalelalrpasa  263
             +SATALLQKAA+MG++ S G     G G+    +P+   +  H                 
Sbjct  326   MSATALLQKAAQMGATSSGGSLLH-GLGIVSSTSPSMDSIVPHGLGLGQPCGGESSSGLK  384

Query  262   aatafAGSVFSSHRQTLDFLG  200
                    SVF   + TLDFLG
Sbjct  385   ELMMGNSSVFGPKQTTLDFLG  405



>ref|XP_004235590.1| PREDICTED: zinc finger protein NUTCRACKER-like [Solanum lycopersicum]
 ref|XP_004235591.1| PREDICTED: zinc finger protein NUTCRACKER-like [Solanum lycopersicum]
 ref|XP_010318499.1| PREDICTED: zinc finger protein NUTCRACKER-like [Solanum lycopersicum]
Length=544

 Score =   259 bits (663),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 141/180 (78%), Gaps = 4/180 (2%)
 Frame = -1

Query  1333  PRQMTTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGK  1154
             P       P  +  Q ++Q    K+KR+ PG PD E EVIALSPK+L+ TNR+VC++C K
Sbjct  52    PHHQYNFAPPNQQTQPAQQI---KKKRNQPGNPDPEAEVIALSPKTLMATNRFVCEICNK  108

Query  1153  GFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKH  974
             GFQR+QNLQLHRRGHNLPWKLKQR  +E+ +++VYVCPET+C  H P++ALGDL+GIKKH
Sbjct  109   GFQRDQNLQLHRRGHNLPWKLKQRTSKEI-RKKVYVCPETSCVHHDPARALGDLTGIKKH  167

Query  973   FCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             FCRKHG + +KCEKC+K YAVQ DWKAH KTCGT++Y CDCG LF+R+DSFI H+  C A
Sbjct  168   FCRKHGEKKWKCEKCSKRYAVQSDWKAHSKTCGTKEYRCDCGTLFSRRDSFITHRAFCDA  227



>ref|XP_002892182.1| hypothetical protein ARALYDRAFT_470357 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68441.1| hypothetical protein ARALYDRAFT_470357 [Arabidopsis lyrata subsp. 
lyrata]
Length=509

 Score =   259 bits (661),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  40    KKKRNLPGNPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  99

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPE +C  HHP++ALGDL+GIKKHFCRKHG + +KCEKC K YAVQ 
Sbjct  100   RTSKEV-RKRVYVCPEKSCVHHHPTRALGDLTGIKKHFCRKHGEKKWKCEKCAKRYAVQS  158

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  159   DWKAHSKTCGTREYRCDCGTIFSRRDSFITHRAFCDA  195



>ref|XP_010558174.1| PREDICTED: zinc finger protein NUTCRACKER [Tarenaya hassleriana]
Length=503

 Score =   258 bits (660),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  32    KKKRNLPGMPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  91

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV K++VYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  92    RSSKEV-KKKVYVCPEPTCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKKYAVQS  150

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGT++Y CDCG LF+R+DSFI H+  C A
Sbjct  151   DWKAHSKICGTKEYKCDCGTLFSRRDSFITHRAFCDA  187



>ref|XP_009803272.1| PREDICTED: putative uncharacterized protein FLJ22184 [Nicotiana 
sylvestris]
Length=536

 Score =   259 bits (663),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 135/164 (82%), Gaps = 1/164 (1%)
 Frame = -1

Query  1291  QLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRG  1112
             Q+  Q    K+KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRG
Sbjct  28    QVPPQKESAKKKRNLPGMPDPDAEVIALSPKTLLATNRFVCEICSKGFQRDQNLQLHRRG  87

Query  1111  HNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEK  932
             HNLPWKL+QR  +EV K+RVYVCPETTC  H PS+ALGDL+GIKKHFCRKHG + +KC+K
Sbjct  88    HNLPWKLRQRSSQEV-KKRVYVCPETTCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDK  146

Query  931   CNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVC  800
             C+K YAVQ D KAH K CGTR+Y CDCG LF+R+DSFI H+  C
Sbjct  147   CSKKYAVQSDLKAHSKICGTREYKCDCGTLFSRRDSFITHRAFC  190



>ref|XP_004300616.1| PREDICTED: uncharacterized protein LOC101300627 [Fragaria vesca 
subsp. vesca]
Length=506

 Score =   259 bits (661),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD + EVIALSPK+L+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  33    KKKRNLPGMPDPDAEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  92

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV K+RVYVCPE +C  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  93    RSSKEV-KKRVYVCPEVSCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQS  151

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  152   DWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  188



>ref|XP_006383231.1| hypothetical protein POPTR_0005s12710g [Populus trichocarpa]
 gb|ERP61028.1| hypothetical protein POPTR_0005s12710g [Populus trichocarpa]
Length=505

 Score =   258 bits (660),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 133/158 (84%), Gaps = 2/158 (1%)
 Frame = -1

Query  1264  KRKRSTPGMP-DAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             K+KR+ PGMP D E EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+
Sbjct  38    KKKRNLPGMPVDPEAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLR  97

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             QR   EV K+RVYVCPETTC  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ
Sbjct  98    QRSSNEV-KKRVYVCPETTCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQ  156

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  157   SDWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  194



>ref|XP_007144666.1| hypothetical protein PHAVU_007G174900g [Phaseolus vulgaris]
 gb|ESW16660.1| hypothetical protein PHAVU_007G174900g [Phaseolus vulgaris]
Length=444

 Score =   257 bits (656),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 137/163 (84%), Gaps = 1/163 (1%)
 Frame = -1

Query  1282  EQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNL  1103
             +Q  K K+KR+ PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNL
Sbjct  38    QQPQKIKKKRNLPGNPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNL  97

Query  1102  PWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNK  923
             PWKLKQR  +EV K++ YVCPE +C  H+PS+ALGDL+GIKKH+CRKHG + +KCEKC+K
Sbjct  98    PWKLKQRNNKEV-KKKAYVCPEPSCVHHNPSRALGDLTGIKKHYCRKHGEKKWKCEKCSK  156

Query  922   MYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             +YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  157   IYAVQSDWKAHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  199



>gb|KHN11278.1| Zinc finger protein MAGPIE [Glycine soja]
Length=530

 Score =   259 bits (662),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 138/167 (83%), Gaps = 1/167 (1%)
 Frame = -1

Query  1294  AQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRR  1115
             AQ   QT + K+KR+ PG PD + EVIALSPKSLL TNR++C++C KGFQR+QNLQLHRR
Sbjct  49    AQPPSQTQQSKKKRNLPGNPDPDAEVIALSPKSLLATNRFICEICNKGFQRDQNLQLHRR  108

Query  1114  GHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCE  935
             GHNLPWKLKQR  +EV +++VYVCPE +C  H PS+ALGDL+GIKKHFCRKHG + +KC+
Sbjct  109   GHNLPWKLKQRTSKEV-RKKVYVCPEPSCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCD  167

Query  934   KCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             KC+K YAVQ DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  168   KCSKKYAVQSDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  214



>ref|XP_009762293.1| PREDICTED: zinc finger protein JACKDAW-like isoform X1 [Nicotiana 
sylvestris]
Length=526

 Score =   259 bits (662),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = -1

Query  1318  TVLPGEESAQLSEQTVKPKRKRSTPGM-PDAEVEVIALSPKSLLETNRYVCDVCGKGFQR  1142
             T+ P    AQ   Q    K++R+ PG  P  + EVIALSPKSL+ TNR++C+VC KGFQR
Sbjct  36    TLAPSSSMAQTQAQATPTKKRRNQPGTTPYPDAEVIALSPKSLMATNRFLCEVCNKGFQR  95

Query  1141  EQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRK  962
             EQNLQLHRRGHNLPWKLKQ+  +EVVKR+VY+CPE TC  H  S+ALGDL+GIKKH+ RK
Sbjct  96    EQNLQLHRRGHNLPWKLKQKNTKEVVKRKVYLCPEITCVHHEISRALGDLTGIKKHYFRK  155

Query  961   HGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             HG + FKCEKC+K YAVQ DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  156   HGEKKFKCEKCSKKYAVQSDWKAHTKTCGTREYRCDCGTLFSRRDSFITHRAFCVA  211



>gb|KHN36136.1| Zinc finger protein MAGPIE [Glycine soja]
Length=448

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 140/176 (80%), Gaps = 6/176 (3%)
 Frame = -1

Query  1306  GEESAQLSEQ-TVKPK----RKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQR  1142
             GE S   S   TV PK    +KR+ PGMPD + EVIALSPK+L+ TNR+VC++C KGFQR
Sbjct  13    GEASVSSSGNLTVPPKPTTKKKRNLPGMPDPDAEVIALSPKTLMATNRFVCEICNKGFQR  72

Query  1141  EQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRK  962
             +QNLQLHRRGHNLPWKL+QR  +EV ++RVYVCPE TC  H PS+ALGDL+GIKKHFCRK
Sbjct  73    DQNLQLHRRGHNLPWKLRQRSSKEV-RKRVYVCPEPTCVHHDPSRALGDLTGIKKHFCRK  131

Query  961   HGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             HG + +KC+KC+K YAVQ DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  132   HGEKKWKCDKCSKKYAVQSDWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  187



>ref|XP_008798275.1| PREDICTED: zinc finger protein NUTCRACKER-like [Phoenix dactylifera]
Length=457

 Score =   257 bits (656),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K++R+ PG PD E EVIALSPK+LL TNR+VC++CGKGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  24    KKRRNLPGNPDPEAEVIALSPKTLLATNRFVCEICGKGFQRDQNLQLHRRGHNLPWKLRQ  83

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E  ++RVYVCPE TC  HHPS+ALGDL+G+KKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  84    RSTKER-RKRVYVCPEKTCIHHHPSRALGDLTGVKKHFCRKHGEKKWKCEKCSKRYAVQS  142

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  143   DWKAHSKVCGTREYRCDCGTLFSRRDSFITHRAFCDA  179



>gb|KHN30052.1| Zinc finger protein MAGPIE [Glycine soja]
Length=480

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EV+ALSPK+LL TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  63    KKKRNLPGNPDPEAEVVALSPKTLLATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLKQ  122

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +++++++VYVCPE +C  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  123   RSSKDIIRKKVYVCPEPSCVHHEPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQS  182

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  183   DWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  219



>ref|XP_002320649.2| hypothetical protein POPTR_0014s17900g [Populus trichocarpa]
 gb|EEE98964.2| hypothetical protein POPTR_0014s17900g [Populus trichocarpa]
Length=519

 Score =   259 bits (661),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = -1

Query  1306  GEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQ  1127
             G +   LS    +PK+KR+ PGMPD + EV+ALSPKSLL TNR+VC++C KGFQR+QNLQ
Sbjct  42    GNQDMPLSVAVPQPKKKRNLPGMPDPDAEVVALSPKSLLATNRFVCEICNKGFQRDQNLQ  101

Query  1126  LHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRT  947
             LHRRGHNLPWKLKQR  +E  ++RVYVCPE +C  H+P +ALGDL+GIKKHF RKHG + 
Sbjct  102   LHRRGHNLPWKLKQRTNKEP-RKRVYVCPEPSCVHHNPVRALGDLTGIKKHFSRKHGEKK  160

Query  946   FKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             +KCE+C+K YAVQ DWKAHMKTCGTR+Y CDCG LF+R+DS I H+  C A
Sbjct  161   WKCERCSKKYAVQSDWKAHMKTCGTREYKCDCGTLFSRRDSLITHRAFCDA  211



>ref|XP_009612199.1| PREDICTED: zinc finger protein NUTCRACKER-like isoform X2 [Nicotiana 
tomentosiformis]
Length=497

 Score =   258 bits (659),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 141/183 (77%), Gaps = 5/183 (3%)
 Frame = -1

Query  1342  MEDPRQMTTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDV  1163
             ME+   MT      E   +++Q    K+KR+   +PD E EVIALSPK+L+ TNR+VC++
Sbjct  4     MENSSSMTVAGSSLEET-ITQQNFPVKKKRN---LPDPEAEVIALSPKTLMATNRFVCEI  59

Query  1162  CGKGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGI  983
             C KGFQR+QNLQLHRRGHNLPWKL+QR  +EV K+RVYVCPE  C  H PS+ALGDL+GI
Sbjct  60    CNKGFQRDQNLQLHRRGHNLPWKLRQRTSKEV-KKRVYVCPEAMCVHHDPSRALGDLTGI  118

Query  982   KKHFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRV  803
             KKHFCRKHG + FKCE+C K YAVQ DWKAHMKTCGTR+Y CDCG LF+R+DSFI H+  
Sbjct  119   KKHFCRKHGEKKFKCERCTKKYAVQSDWKAHMKTCGTREYRCDCGTLFSRRDSFITHRAF  178

Query  802   CYA  794
             C A
Sbjct  179   CDA  181



>ref|XP_004172936.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228313 
[Cucumis sativus]
Length=507

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  32    KXKRNLPGMPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  91

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   EV K++VYVCPET+C  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  92    RSSNEV-KKKVYVCPETSCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQS  150

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  151   DWKAHSKICGTREYKCDCGTLFSRRDSFITHRAFCDA  187



>ref|XP_003539541.2| PREDICTED: zinc finger protein MAGPIE-like [Glycine max]
Length=480

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 144/185 (78%), Gaps = 5/185 (3%)
 Frame = -1

Query  1336  DPRQMTTVLPGEE-SAQLSEQTVKP---KRKRSTPGMPDAEVEVIALSPKSLLETNRYVC  1169
             D  +++ V P +  S   S    +P   KRKR+ PG PD + EVI LSPK+L+ TNR+VC
Sbjct  6     DDGEISNVFPHQNPSIAASNNHDQPPILKRKRNLPGNPDPDAEVITLSPKTLMATNRFVC  65

Query  1168  DVCGKGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLS  989
             ++C KGFQR+QNLQLHRRGHNLPWKLKQR  +EV ++RVYVCPE TC  HHPS+ALGDL+
Sbjct  66    EICLKGFQRDQNLQLHRRGHNLPWKLKQRTSKEV-RKRVYVCPEKTCVHHHPSRALGDLT  124

Query  988   GIKKHFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHK  809
             GIKKHFCRKHG + ++CEKC+K YAVQ DWKAH KTCGTR+Y CDCG +F+R+DSFI H+
Sbjct  125   GIKKHFCRKHGEKKWRCEKCSKRYAVQSDWKAHSKTCGTREYKCDCGTIFSRRDSFITHR  184

Query  808   RVCYA  794
               C A
Sbjct  185   AFCDA  189



>ref|XP_009590472.1| PREDICTED: zinc finger protein NUTCRACKER-like [Nicotiana tomentosiformis]
Length=537

 Score =   259 bits (662),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 135/164 (82%), Gaps = 1/164 (1%)
 Frame = -1

Query  1291  QLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRG  1112
             Q+  Q    K+KR+ PGMPD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRG
Sbjct  28    QVPPQKESAKKKRNLPGMPDPDAEVIALSPKTLLATNRFVCEICSKGFQRDQNLQLHRRG  87

Query  1111  HNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEK  932
             HNLPWKL+QR  +EV K+RVYVCPETTC  H PS+ALGDL+GIKKHFCRKHG + +KC+K
Sbjct  88    HNLPWKLRQRSGQEV-KKRVYVCPETTCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDK  146

Query  931   CNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVC  800
             C+K YAVQ D KAH K CGTR+Y CDCG LF+R+DSFI H+  C
Sbjct  147   CSKKYAVQSDLKAHSKICGTREYKCDCGTLFSRRDSFITHRAFC  190



>ref|XP_008649017.1| PREDICTED: LOC542697 isoform X1 [Zea mays]
 gb|ACL52563.1| unknown [Zea mays]
 tpg|DAA48716.1| TPA: INDETERMINATE protein 1 [Zea mays]
Length=543

 Score =   259 bits (662),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 133/158 (84%), Gaps = 3/158 (2%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ P  PDAEV  IALSPK+L+ TNR+VC+VC KGFQREQNLQLHRRGHNLPWKLK
Sbjct  40    PKKKRNQPADPDAEV--IALSPKTLMATNRFVCEVCNKGFQREQNLQLHRRGHNLPWKLK  97

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             Q+ P+E  +RRVY+CPE TC  H PS+ALGDL+GIKKH+CRKHG + +KC+KCNK YAVQ
Sbjct  98    QKNPKET-RRRVYLCPEPTCVHHDPSRALGDLTGIKKHYCRKHGEKKWKCDKCNKRYAVQ  156

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  157   SDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  194



>ref|XP_002865381.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41640.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=464

 Score =   257 bits (656),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  35    KKKRNLPGNPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  94

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPE TC  HH S+ALGDL+GIKKHFCRKHG + +KCEKC K YAVQ 
Sbjct  95    RTSKEV-RKRVYVCPEKTCVHHHSSRALGDLTGIKKHFCRKHGEKKWKCEKCAKRYAVQS  153

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  154   DWKAHSKTCGTREYRCDCGTIFSRRDSFITHRAFCDA  190



>gb|KHN44500.1| Zinc finger protein MAGPIE [Glycine soja]
Length=507

 Score =   258 bits (659),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ PGMPD E EVIALSP +LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+
Sbjct  30    PKKKRNLPGMPDPEAEVIALSPTALLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLR  89

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             QR  +EV ++RVYVCPE TC  H P++ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ
Sbjct  90    QRSSKEV-RKRVYVCPEPTCVHHDPARALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQ  148

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVC  800
              DWKAH K CGTR+Y CDCG +F+R+DSFI H+  C
Sbjct  149   SDWKAHSKVCGTREYKCDCGTVFSRRDSFITHRAFC  184



>ref|XP_003565455.1| PREDICTED: zinc finger protein MAGPIE [Brachypodium distachyon]
Length=466

 Score =   257 bits (656),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KRS PG PD E EVIALSP++L+ TNRYVC++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  39    KKKRSLPGNPDPEAEVIALSPRALMATNRYVCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  98

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R P E V+++VYVCPE  C  H P++ALGDL+GIKKHF RKHG + ++C++C K YAVQ 
Sbjct  99    RNPNEAVRKKVYVCPEPGCVHHDPARALGDLTGIKKHFSRKHGEKRWRCDRCGKKYAVQS  158

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  159   DWKAHSKVCGTREYRCDCGTLFSRRDSFITHRAFCDA  195



>dbj|BAD10885.1| zinc finger protein [Malus domestica]
Length=522

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = -1

Query  1306  GEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQ  1127
             G  + Q+ +Q    K+KR+ PG PD   EVIALSPK+L+ TNR+VC++C KGFQR+QNLQ
Sbjct  54    GISTTQVQKQPPPAKKKRNLPGTPDPTAEVIALSPKTLMATNRFVCEICKKGFQRDQNLQ  113

Query  1126  LHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRT  947
             LHRRGHNLPWKLKQR   E++KR VY+CPE++C  H PS+ALGDL+GIKKHF RKHG +T
Sbjct  114   LHRRGHNLPWKLKQRTSTEIIKR-VYICPESSCVHHDPSRALGDLTGIKKHFFRKHGEKT  172

Query  946   FKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             +KC+KC+K YAVQ DWKAH+KTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  173   WKCDKCSKKYAVQSDWKAHLKTCGTREYKCDCGTIFSRRDSFITHRAFCDA  223



>ref|XP_001760619.1| predicted protein [Physcomitrella patens]
 gb|EDQ74694.1| predicted protein [Physcomitrella patens]
Length=226

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKR+ PG PD E EVIALSPK+L+ TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  1     KRKRNLPGTPDPEAEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  60

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E+ ++RVY+CPE +C  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  61    RTSKEI-RKRVYICPEPSCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVQS  119

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  120   DWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  156



>gb|KFK28353.1| hypothetical protein AALP_AA8G504900 [Arabis alpina]
Length=492

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 134/163 (82%), Gaps = 1/163 (1%)
 Frame = -1

Query  1282  EQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNL  1103
              Q   PK+KR+ PGMPD E EVIALSPK+L+ TNR+VC++C KGFQR+QNLQLHRRGHNL
Sbjct  22    NQNPPPKKKRNLPGMPDPEAEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRRGHNL  81

Query  1102  PWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNK  923
             PWKL+QR  +EV +++VYVCP + C  H PS+ALGDL+GIKKHFCRKHG + +KCEKC+K
Sbjct  82    PWKLRQRSSKEV-RKKVYVCPVSGCVHHEPSRALGDLTGIKKHFCRKHGEKKWKCEKCSK  140

Query  922   MYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              YAVQ DWKAH K CGT++Y CDCG LF+R+DSFI H+  C A
Sbjct  141   KYAVQSDWKAHSKICGTKEYKCDCGTLFSRRDSFITHRAFCDA  183



>ref|NP_001241804.1| INDETERMINATE-related protein 1 [Zea mays]
 gb|ACG48075.1| INDETERMINATE-related protein 1 [Zea mays]
Length=543

 Score =   259 bits (662),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 133/158 (84%), Gaps = 3/158 (2%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ P  PDAEV  IALSPK+L+ TNR+VC+VC KGFQREQNLQLHRRGHNLPWKLK
Sbjct  40    PKKKRNQPADPDAEV--IALSPKTLMATNRFVCEVCNKGFQREQNLQLHRRGHNLPWKLK  97

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             Q+ P+E  +RRVY+CPE TC  H PS+ALGDL+GIKKH+CRKHG + +KC+KCNK YAVQ
Sbjct  98    QKNPKET-RRRVYLCPEPTCVHHDPSRALGDLTGIKKHYCRKHGEKKWKCDKCNKRYAVQ  156

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  157   SDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  194



>ref|NP_190639.1| indeterminate-domain 2 protein [Arabidopsis thaliana]
 sp|Q9SCQ6.1|IDD2_ARATH RecName: Full=Protein indeterminate-domain 2 [Arabidopsis thaliana]
 emb|CAB62439.1| zinc finger protein [Arabidopsis thaliana]
 gb|AAT47798.1| At3g50700 [Arabidopsis thaliana]
 gb|AAU94399.1| At3g50700 [Arabidopsis thaliana]
 dbj|BAE99004.1| zinc finger protein [Arabidopsis thaliana]
 gb|AEE78699.1| indeterminate-domain 2 protein [Arabidopsis thaliana]
Length=452

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD E EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  34    KKKRNLPGMPDPESEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  93

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             +  +EV K++VYVCPE +C  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  94    KSNKEV-KKKVYVCPEVSCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQS  152

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGT++Y CDCG LF+R+DSFI H+  C A
Sbjct  153   DWKAHSKICGTKEYKCDCGTLFSRRDSFITHRAFCDA  189



>ref|XP_009587634.1| PREDICTED: zinc finger protein MAGPIE [Nicotiana tomentosiformis]
Length=468

 Score =   257 bits (656),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  22    KKKRNLPGNPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  81

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPE +C  HH S+ALGDL+GIKKH+CRKHG + +KCEKC+K YAVQ 
Sbjct  82    RTSKEV-RKRVYVCPEKSCVHHHASRALGDLTGIKKHYCRKHGEKKWKCEKCSKRYAVQS  140

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG +F+R+DSF+ H+  C A
Sbjct  141   DWKAHSKTCGTREYRCDCGTIFSRRDSFVTHRAFCDA  177



>ref|NP_001105282.1| LOC542198 [Zea mays]
 gb|AAV51391.1| INDETERMINATE-related protein 7 [Zea mays]
Length=518

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 133/158 (84%), Gaps = 1/158 (1%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ PG P+ + EVIALSP++LL TNR+VC+VC KGFQREQNLQLHRRGHNLPWKLK
Sbjct  27    PKKKRNQPGNPNPDAEVIALSPRTLLATNRFVCEVCNKGFQREQNLQLHRRGHNLPWKLK  86

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             Q+ P E  +RRVY+CPE TC  H PS+ALGDL+GIKKH+CRKHG + +KC+KC+K YAVQ
Sbjct  87    QKNPREA-RRRVYLCPEPTCVHHDPSRALGDLTGIKKHYCRKHGEKKWKCDKCSKRYAVQ  145

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  146   SDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  183



>gb|KDP21398.1| hypothetical protein JCGZ_21869 [Jatropha curcas]
Length=434

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = -1

Query  1255  RSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQRGP  1076
             RS PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQR  
Sbjct  43    RSLPGNPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRNS  102

Query  1075  EEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQCDWK  896
             +E+ K+R YVCPE +C  HHPS+ALGDL+GIKKH+CRKHG + +KCEKC+K+YAVQ DWK
Sbjct  103   KEI-KKRAYVCPEPSCVHHHPSRALGDLTGIKKHYCRKHGEKKWKCEKCSKIYAVQSDWK  161

Query  895   AHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             AH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  162   AHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  195



>gb|KFK42728.1| hypothetical protein AALP_AA1G032000 [Arabis alpina]
Length=513

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 135/157 (86%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+L+ TNR++C++CGKGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  41    KKKRNLPGNPDPEAEVIALSPKTLMATNRFLCEICGKGFQRDQNLQLHRRGHNLPWKLKQ  100

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV ++RVYVCPE +C  HHP++ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  101   RTSKEV-RKRVYVCPEKSCVHHHPTRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  159

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  160   DWKAHSKTCGTREYRCDCGTIFSRRDSFITHRAFCDA  196



>ref|XP_010426610.1| PREDICTED: zinc finger protein MAGPIE-like isoform X1 [Camelina 
sativa]
Length=453

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 133/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD E EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  34    KKKRNLPGMPDPESEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  93

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             +  +EV +++VYVCPE +C  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  94    KSSKEV-RKKVYVCPEVSCVHHEPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQS  152

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGT++Y CDCG LF+R+DSFI H+  C A
Sbjct  153   DWKAHSKICGTKEYKCDCGTLFSRRDSFITHRAFCDA  189



>gb|KHG24773.1| Zinc finger MAGPIE -like protein [Gossypium arboreum]
Length=546

 Score =   259 bits (662),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PGMPD + EVIALSP +LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  31    KKKRNLPGMPDPDAEVIALSPTTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQ  90

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV K+RVYVCPE TC  H PS+ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  91    RSSKEV-KKRVYVCPEPTCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQS  149

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG +F+R+DSFI H+  C A
Sbjct  150   DWKAHSKICGTREYKCDCGTVFSRRDSFITHRAFCDA  186



>ref|NP_001105683.1| LOC542697 [Zea mays]
 gb|AAV51393.1| INDETERMINATE-related protein 1 [Zea mays]
Length=544

 Score =   259 bits (662),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 132/158 (84%), Gaps = 2/158 (1%)
 Frame = -1

Query  1267  PKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLK  1088
             PK+KR+ P  PDAEV  IALSPK+L+ TNR+VC+VC KGFQR++NLQLHRRGHNLPWKLK
Sbjct  40    PKKKRNQPADPDAEV--IALSPKTLMATNRFVCEVCNKGFQRDENLQLHRRGHNLPWKLK  97

Query  1087  QRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQ  908
             Q+ P+E   RRVY+CPE TC  H PS+ALGDL+GIKKH+CRKHG + +KC+KCNK YAVQ
Sbjct  98    QKNPKETRLRRVYLCPEPTCVHHDPSRALGDLTGIKKHYCRKHGEKKWKCDKCNKRYAVQ  157

Query  907   CDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
              DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  158   SDWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  195



>ref|XP_006342974.1| PREDICTED: zinc finger protein MAGPIE-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342975.1| PREDICTED: zinc finger protein MAGPIE-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006342976.1| PREDICTED: zinc finger protein MAGPIE-like isoform X3 [Solanum 
tuberosum]
Length=541

 Score =   259 bits (661),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 141/180 (78%), Gaps = 4/180 (2%)
 Frame = -1

Query  1333  PRQMTTVLPGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGK  1154
             P       P  +  Q ++Q    K+KR+ PG PD E EVIALSPK+L+ TNR+VC++C K
Sbjct  52    PHHQYNFAPPNQQTQPAQQI---KKKRNQPGNPDPEAEVIALSPKTLMATNRFVCEICNK  108

Query  1153  GFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKH  974
             GFQR+QNLQLHRRGHNLPWKLKQR  +E+ +++VYVCPET+C  H P++ALGDL+GIKKH
Sbjct  109   GFQRDQNLQLHRRGHNLPWKLKQRTSKEI-RKKVYVCPETSCVHHDPARALGDLTGIKKH  167

Query  973   FCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             FCRKHG + +KCEKC+K YAVQ DWKAH KTCGT++Y CDCG LF+R+DSFI H+  C A
Sbjct  168   FCRKHGEKKWKCEKCSKRYAVQSDWKAHSKTCGTKEYRCDCGTLFSRRDSFITHRAFCDA  227



>gb|AAG50836.1|AC073944_3 zinc finger protein, putative [Arabidopsis thaliana]
Length=439

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKR+ PG PD E EV+ALSPK+L+ TNR++C+VC KGFQR+QNLQLH+RGHNLPWKLKQ
Sbjct  47    KRKRNQPGNPDPEAEVMALSPKTLMATNRFICEVCNKGFQRDQNLQLHKRGHNLPWKLKQ  106

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  ++VV+++VYVCPE  C  HHPS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  107   RSNKDVVRKKVYVCPEPGCVHHHPSRALGDLTGIKKHFFRKHGEKKWKCEKCSKKYAVQS  166

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGT++Y CDCG LF+R+DSFI H+  C A
Sbjct  167   DWKAHAKTCGTKEYKCDCGTLFSRRDSFITHRAFCDA  203



>ref|XP_008798233.1| PREDICTED: zinc finger protein MAGPIE [Phoenix dactylifera]
Length=447

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPKSLL TNR+VC++CGKGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  24    KKKRNQPGNPDPEAEVIALSPKSLLATNRFVCEICGKGFQRDQNLQLHRRGHNLPWKLRQ  83

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E  ++RVYVCPE TC  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ 
Sbjct  84    RSSKEP-RKRVYVCPEKTCIHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQS  142

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG +F+R+DSFI H   C A
Sbjct  143   DWKAHSKACGTREYRCDCGTIFSRRDSFITHWAFCDA  179



>gb|KHG14531.1| Zinc finger MAGPIE -like protein [Gossypium arboreum]
Length=516

 Score =   258 bits (659),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/290 (46%), Positives = 177/290 (61%), Gaps = 5/290 (2%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD   EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  49    KKKRNLPGTPDPNAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQ  108

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R   E+ ++RVYVCPE +C  H+P++ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  109   RTSTEI-RKRVYVCPEPSCVHHNPARALGDLTGIKKHFCRKHGEKKWKCDKCSKKYAVQS  167

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYASQaltvtapsaspppqpptpSMA  725
             DWKAH KTCGT++Y CDCG +F+R+DSFI H+  C A       A               
Sbjct  168   DWKAHSKTCGTKEYKCDCGTIFSRRDSFITHRAFCDALTEENNKASRGLINVGSNLQGQV  227

Query  724   VLSPTLSLHSIQSFELPEDRVMGGAN-YKERTQAPSSSFGLVIGDNGEEDFSSVFRLSLR  548
             V +  L + +I     P    +  +  +   T++   S  L  G       SS+F  +  
Sbjct  228   VAADQL-ISAIPVNNNPNTSAINISEPFSNDTKSSLQSLNLAAGTMFSNGSSSLFGGTKV  286

Query  547   SGNEEEATPACAAIMERpvplllstpppVYHASNPPVLSATALLQKAAEM  398
             +     ++ +C  +      L       ++  S    +SATALLQKAA+M
Sbjct  287   TTVPNPSSTSCLQLNGNSSTLFEGNGGHLFSGS--ASMSATALLQKAAQM  334



>ref|XP_010279249.1| PREDICTED: zinc finger protein NUTCRACKER-like [Nelumbo nucifera]
Length=467

 Score =   257 bits (656),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = -1

Query  1255  RSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQRGP  1076
             R+ PG PD + EVIALSPK+LL TNR+VC++C KGFQR+QNLQLHRRGHNLPWKL+QR  
Sbjct  50    RNLPGNPDPDAEVIALSPKTLLATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLRQRTS  109

Query  1075  EEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQCDWK  896
             +E+ K+RVYVCPE +C  HHPS+ALGDL+GIKKHFCRKHG + +KCEKC+K YAVQ DWK
Sbjct  110   KEI-KKRVYVCPEPSCVHHHPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKRYAVQSDWK  168

Query  895   AHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             AH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  169   AHSKTCGTREYRCDCGTLFSRKDSFITHRAFCDA  202



>ref|XP_009409481.1| PREDICTED: zinc finger protein NUTCRACKER-like [Musa acuminata 
subsp. malaccensis]
Length=461

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             K+KR+ PG PD E EVIALSPK+LL TNR+VC++CGKGFQR+QNLQLHRRGHNLPWKL+Q
Sbjct  46    KKKRNLPGTPDPEAEVIALSPKTLLATNRFVCEICGKGFQRDQNLQLHRRGHNLPWKLRQ  105

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +E  ++RVYVCPE TC  H+P++ALGDL+GIKKHFCRKHG + +KC+KC+K YAVQ 
Sbjct  106   RSSKEP-RKRVYVCPEPTCIHHNPARALGDLTGIKKHFCRKHGEKKWKCDKCSKRYAVQS  164

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH KTCGTR+Y CDCG LF+R+DSFI H+  C A
Sbjct  165   DWKAHSKTCGTREYRCDCGTLFSRRDSFITHRAFCDA  201



>ref|XP_009612448.1| PREDICTED: zinc finger protein JACKDAW-like [Nicotiana tomentosiformis]
Length=472

 Score =   257 bits (656),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKR+ PG PD + EVIALSPKSL+ TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  39    KRKRNLPGNPDPDAEVIALSPKSLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLKQ  98

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV K++VY+CPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  99    RTNKEV-KKKVYICPEKTCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKQYAVQS  157

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  158   DWKAHSKICGTREYKCDCGTLFSRKDSFITHRAFCDA  194



>ref|XP_009771226.1| PREDICTED: zinc finger protein JACKDAW-like [Nicotiana sylvestris]
Length=471

 Score =   257 bits (656),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = -1

Query  1264  KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQ  1085
             KRKR+ PG PD + EVIALSPKSL+ TNR++C++C KGFQR+QNLQLHRRGHNLPWKLKQ
Sbjct  37    KRKRNLPGNPDPDAEVIALSPKSLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLKQ  96

Query  1084  RGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQC  905
             R  +EV K++VY+CPE TC  H PS+ALGDL+GIKKHF RKHG + +KCEKC+K YAVQ 
Sbjct  97    RTNKEV-KKKVYICPEKTCVHHDPSRALGDLTGIKKHFSRKHGEKKWKCEKCSKKYAVQS  155

Query  904   DWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             DWKAH K CGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  156   DWKAHSKICGTREYKCDCGTLFSRKDSFITHRAFCDA  192



>ref|XP_009393052.1| PREDICTED: zinc finger protein MAGPIE-like [Musa acuminata subsp. 
malaccensis]
Length=333

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -1

Query  1255  RSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRGHNLPWKLKQRGP  1076
             RS PG PD E EV+ALSP +L+ TNR++C++C KGF+REQNLQLHRRGHNLPWKL+QRG 
Sbjct  56    RSQPGNPDPEAEVVALSPTTLMATNRFICEICNKGFKREQNLQLHRRGHNLPWKLRQRGS  115

Query  1075  EEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEKCNKMYAVQCDWK  896
             EEV ++RVYVCPE +C  HHPS+ALGDL+GIKKHF RKHG + +KC+KC+K YAV  DWK
Sbjct  116   EEVARKRVYVCPEPSCVHHHPSRALGDLTGIKKHFSRKHGEKKWKCDKCSKRYAVNSDWK  175

Query  895   AHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             AH+KTCG R+Y CDCG LF+RKD+FI H+  C A
Sbjct  176   AHVKTCGAREYRCDCGTLFSRKDTFITHRAFCDA  209



>ref|XP_010558265.1| PREDICTED: zinc finger protein JACKDAW-like isoform X1 [Tarenaya 
hassleriana]
Length=522

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 135/166 (81%), Gaps = 4/166 (2%)
 Frame = -1

Query  1279  QTVKP----KRKRSTPGMPDAEVEVIALSPKSLLETNRYVCDVCGKGFQREQNLQLHRRG  1112
             Q+ KP    KRKRS PG PD + EV+ALSPK+L+ TNR+VC++C KGFQR+QNLQLHRRG
Sbjct  42    QSAKPNPSSKRKRSQPGTPDPDAEVMALSPKTLMATNRFVCEICNKGFQRDQNLQLHRRG  101

Query  1111  HNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSGIKKHFCRKHGHRTFKCEK  932
             HNLPWKL+QR  +E VK++VYVCP  TC  H PS+ALGDL+GIKKH+ RKHG + +KCEK
Sbjct  102   HNLPWKLRQRTNKEAVKKKVYVCPIKTCVHHEPSRALGDLTGIKKHYSRKHGEKKWKCEK  161

Query  931   CNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKRVCYA  794
             C+K YAVQ DWKAH KTCGTR+Y CDCG LF+RKDSFI H+  C A
Sbjct  162   CSKKYAVQSDWKAHTKTCGTREYKCDCGTLFSRKDSFITHRAFCDA  207



>ref|XP_008444696.1| PREDICTED: zinc finger protein MAGPIE-like [Cucumis melo]
Length=461

 Score =   256 bits (655),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 140/184 (76%), Gaps = 3/184 (2%)
 Frame = -1

Query  1339  EDPRQMTTVL--PGEESAQLSEQTVKPKRKRSTPGMPDAEVEVIALSPKSLLETNRYVCD  1166
               P  M T    P  +  ++ +     K+KR+ PGMPD   EVIALSPKSLL TNR+VC+
Sbjct  7     NSPTAMVTASSPPAVDEVEIIDTVTPAKKKRNLPGMPDPTAEVIALSPKSLLATNRFVCE  66

Query  1165  VCGKGFQREQNLQLHRRGHNLPWKLKQRGPEEVVKRRVYVCPETTCSRHHPSKALGDLSG  986
             +C KGFQR+QNLQLHRRGHNLPWKL+QR   E+ ++RVYVCPE +C  H+P++ALGDL+G
Sbjct  67    ICNKGFQRDQNLQLHRRGHNLPWKLRQRTSNEI-RKRVYVCPEPSCVHHNPARALGDLTG  125

Query  985   IKKHFCRKHGHRTFKCEKCNKMYAVQCDWKAHMKTCGTRDYICDCGALFARKDSFIAHKR  806
             IKKHF RKH  + +KCE+C+K YAVQ DWKAHMKTCGTR+Y CDCG LF+R+DSFI H+ 
Sbjct  126   IKKHFSRKHCEKKWKCERCSKKYAVQSDWKAHMKTCGTREYKCDCGTLFSRRDSFITHRA  185

Query  805   VCYA  794
              C A
Sbjct  186   FCDA  189



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4247309536456