BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15845_g1_i2 len=1761 path=[1:0-706 @708@!:707-1225 1227:1226-1760]

Length=1761
                                                                      Score     E

gb|AAC78479.1|  3-oxoacyl-[acyl-carrier-protein] synthase               734   0.0      Capsicum chinense [bonnet pepper]
ref|XP_002299456.1|  hypothetical protein POPTR_0001s10890g             728   0.0      Populus trichocarpa [western balsam poplar]
emb|CDP12182.1|  unnamed protein product                                723   0.0      
ref|XP_011026849.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    722   0.0      
ref|XP_006343829.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    718   0.0      
gb|KDP25270.1|  hypothetical protein JCGZ_20426                         716   0.0      
ref|XP_011022477.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    714   0.0      
ref|XP_007040574.1|  3-ketoacyl-acyl carrier protein synthase I         710   0.0      
ref|XP_004245499.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    707   0.0      
ref|XP_002303661.2|  hypothetical protein POPTR_0003s14190g             706   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009590113.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    704   0.0      
gb|AIQ82743.1|  3-oxoacyl-(acyl-carrier-protein) synthase               704   0.0      
gb|AIQ82742.1|  3-oxoacyl-(acyl-carrier-protein) synthase               704   0.0      
gb|AIQ82734.1|  3-oxoacyl-(acyl-carrier-protein) synthase               703   0.0      
ref|XP_002518849.1|  3-oxoacyl-[acyl-carrier-protein] synthase, p...    702   0.0      Ricinus communis
gb|AIQ82747.1|  3-oxoacyl-(acyl-carrier-protein) synthase               701   0.0      
gb|AIQ82746.1|  3-oxoacyl-(acyl-carrier-protein) synthase               701   0.0      
gb|AIQ82745.1|  3-oxoacyl-(acyl-carrier-protein) synthase               700   0.0      
gb|KHG26930.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    699   0.0      
ref|XP_002265207.2|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    699   0.0      Vitis vinifera
gb|KDO76592.1|  hypothetical protein CISIN_1g010896mg                   699   0.0      
ref|XP_009341875.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    699   0.0      
ref|XP_006476353.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    698   0.0      
gb|AGJ84410.1|  beta-ketoacyl-ACP synthase I                            698   0.0      
ref|XP_010915981.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    697   0.0      
ref|XP_009803233.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    696   0.0      
ref|XP_008341776.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    696   0.0      
ref|XP_008783167.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    695   0.0      
gb|ADZ05697.1|  3-oxoacyl-(acyl-carrier-protein) synthase               694   0.0      
ref|XP_008239156.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    694   0.0      
ref|XP_007209938.1|  hypothetical protein PRUPE_ppa004714mg             694   0.0      
ref|XP_009358636.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    693   0.0      
ref|XP_006439308.1|  hypothetical protein CICLE_v10019855mg             691   0.0      
ref|XP_011082304.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    691   0.0      
gb|EYU23310.1|  hypothetical protein MIMGU_mgv1a005480mg                690   0.0      
ref|XP_011082303.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    691   0.0      
ref|XP_007160188.1|  hypothetical protein PHAVU_002G300400g             688   0.0      
ref|XP_008352311.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    686   0.0      
ref|XP_006584770.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    682   0.0      
ref|XP_003530435.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    680   0.0      
ref|XP_006584769.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    677   0.0      
ref|XP_010109776.1|  hypothetical protein L484_003136                   678   0.0      
ref|XP_006584772.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    677   0.0      
ref|XP_006584771.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    676   0.0      
ref|XP_004301818.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    676   0.0      
ref|NP_001241906.1|  uncharacterized protein LOC100808453               673   0.0      
ref|XP_010053160.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    669   0.0      
ref|XP_006579442.1|  PREDICTED: uncharacterized protein LOC100808...    670   0.0      
ref|XP_008352312.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    662   0.0      
gb|KEH21260.1|  3-oxoacyl-(acyl carrier) synthase II                    659   0.0      
gb|ADE76842.1|  unknown                                                 651   0.0      
ref|XP_006579443.1|  PREDICTED: uncharacterized protein LOC100808...    647   0.0      
gb|EYU26414.1|  hypothetical protein MIMGU_mgv1a024999mg                644   0.0      
gb|EYU26415.1|  hypothetical protein MIMGU_mgv1a006855mg                638   0.0      
ref|XP_010241300.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    639   0.0      
gb|KHG12491.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    634   0.0      
ref|XP_007158937.1|  hypothetical protein PHAVU_002G194300g             632   0.0      
gb|AGH32916.1|  ketoacyl-ACP synthase I                                 632   0.0      
ref|XP_001776124.1|  predicted protein                                  631   0.0      
ref|XP_010275024.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    630   0.0      
ref|XP_001762048.1|  predicted protein                                  629   0.0      
gb|KHG12107.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    630   0.0      
emb|CAN70157.1|  hypothetical protein VITISV_030014                     628   0.0      Vitis vinifera
ref|XP_002272874.2|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    629   0.0      Vitis vinifera
gb|KHG22354.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    628   0.0      
ref|XP_001762687.1|  predicted protein                                  627   0.0      
gb|ACZ06069.1|  beta-ketoacyl-ACP synthetase I                          627   0.0      
gb|ACJ07141.1|  beta-ketoacyl-ACP synthase I-2                          626   0.0      
ref|XP_010529153.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    626   0.0      
gb|ACJ07140.1|  beta-ketoacyl-ACP synthase I-1                          626   0.0      
ref|XP_006365563.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    626   0.0      
ref|XP_006467495.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    625   0.0      
ref|XP_009101526.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    625   0.0      
ref|XP_002316735.1|  3-oxoacyl-[acyl-carrier-protein] synthase I        624   0.0      Populus trichocarpa [western balsam poplar]
gb|ABM53471.1|  plastid 3-keto-acyl-ACP synthase I                      624   0.0      Helianthus annuus
ref|XP_007025113.1|  3-ketoacyl-acyl carrier protein synthase I i...    627   0.0      
ref|NP_001238610.1|  beta-ketoacyl-ACP synthetase I                     624   0.0      
ref|XP_006366097.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    624   0.0      
emb|CDX77646.1|  BnaC07g19000D                                          624   0.0      
ref|XP_009401483.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    623   0.0      
emb|CDY33467.1|  BnaA06g36060D                                          623   0.0      
ref|XP_011011532.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    622   0.0      
ref|XP_009801210.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    622   0.0      
gb|ABR18442.1|  unknown                                                 625   0.0      Picea sitchensis
ref|XP_006449664.1|  hypothetical protein CICLE_v10015139mg             622   0.0      
ref|XP_011096538.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    622   0.0      
ref|XP_009596105.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    622   0.0      
ref|XP_004244796.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    622   0.0      
ref|XP_006280411.1|  hypothetical protein CARUB_v10026344mg             620   0.0      
gb|KFK31480.1|  hypothetical protein AALP_AA6G117600                    620   0.0      
ref|XP_006398324.1|  hypothetical protein EUTSA_v10000874mg             620   0.0      
emb|CDY03228.1|  BnaC09g19280D                                          620   0.0      
emb|CDY35156.1|  BnaA09g17930D                                          620   0.0      
ref|XP_009763087.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    620   0.0      
ref|XP_002863412.1|  kas I                                              620   0.0      
ref|XP_004233105.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    620   0.0      
ref|XP_002519707.1|  50 kDa ketoavyl-ACP synthase                       620   0.0      Ricinus communis
ref|XP_008444105.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    620   0.0      
gb|ABA07910.1|  plastid 3-ketoacyl-ACP synthase I                       620   0.0      Cuphea avigera var. pulcherrima
gb|KEH43811.1|  3-oxoacyl-(acyl carrier) synthase II                    619   0.0      
ref|XP_004147414.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    619   0.0      
ref|XP_004161144.1|  PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[a...    619   0.0      
ref|XP_010538529.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    619   0.0      
gb|KHM99882.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    616   0.0      
ref|XP_009114364.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    618   0.0      
gb|ABJ90468.1|  beta-ketoacyl-ACP synthase I                            618   0.0      Jatropha curcas
ref|XP_010666593.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    618   0.0      
ref|XP_008383499.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    617   0.0      
ref|NP_199441.1|  beta-ketoacyl-[acyl carrier protein] synthase I       617   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008349175.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    617   0.0      
ref|XP_008371590.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    617   0.0      
ref|XP_009627828.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    617   0.0      
gb|KDP37953.1|  hypothetical protein JCGZ_04596                         616   0.0      
ref|XP_008784346.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    615   0.0      
ref|XP_011085258.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    615   0.0      
ref|XP_004504688.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    615   0.0      
gb|EYU43272.1|  hypothetical protein MIMGU_mgv1a005817mg                615   0.0      
ref|NP_001237654.1|  beta-ketoacyl-ACP synthetase I-2                   614   0.0      
ref|XP_002305334.1|  3-oxoacyl-[acyl-carrier-protein] synthase I        614   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010441599.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    613   0.0      
ref|XP_009128853.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    613   0.0      
ref|XP_007211401.1|  hypothetical protein PRUPE_ppa005228mg             613   0.0      
gb|AAC04691.1|  beta-ketoacyl-ACP synthase I                            613   0.0      Perilla frutescens [beefsteak-mint]
ref|XP_010917436.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    612   0.0      
ref|XP_002438009.1|  hypothetical protein SORBIDRAFT_10g006430          612   0.0      Sorghum bicolor [broomcorn]
ref|XP_008225453.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    612   0.0      
ref|XP_009360871.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    612   0.0      
ref|XP_006845316.1|  hypothetical protein AMTR_s00141p00029880          611   0.0      
ref|XP_010052073.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    610   0.0      
ref|XP_010932377.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    610   0.0      
gb|EPS68881.1|  hypothetical protein M569_05881                         611   0.0      
ref|NP_001149639.1|  3-oxoacyl-synthase I                               610   0.0      Zea mays [maize]
ref|XP_011012842.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    610   0.0      
ref|XP_004293525.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    609   0.0      
ref|XP_010481467.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    609   0.0      
emb|CDP06309.1|  unnamed protein product                                609   0.0      
emb|CDY43962.1|  BnaA02g24400D                                          608   0.0      
ref|NP_001146139.1|  uncharacterized protein LOC100279707               607   0.0      Zea mays [maize]
gb|AFW85455.1|  hypothetical protein ZEAMMB73_016804                    607   0.0      
ref|XP_004503596.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    607   0.0      
gb|AAC49118.1|  3-ketoacyl-acyl carrier protein synthase I              608   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190479.1|  beta-ketoacyl-[acyl carrier protein] synthase I    607   0.0      
gb|EAY94286.1|  hypothetical protein OsI_16057                          606   0.0      Oryza sativa Indica Group [Indian rice]
gb|KCW75931.1|  hypothetical protein EUGRSUZ_D00305                     606   0.0      
ref|XP_002960175.1|  hypothetical protein SELMODRAFT_229853             604   0.0      
ref|XP_004964587.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    605   0.0      
ref|XP_010495756.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    609   0.0      
ref|XP_003564149.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    604   0.0      
ref|NP_001052904.1|  Os04g0445700                                       602   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006653452.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    602   0.0      
ref|XP_010111005.1|  3-oxoacyl-[acyl-carrier-protein] synthase I        602   0.0      
ref|NP_001057053.1|  Os06g0196600                                       602   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006656734.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    600   0.0      
ref|XP_009391220.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    601   0.0      
ref|XP_003608492.1|  Beta-ketoacyl-ACP synthase I                       601   0.0      
dbj|BAH00228.1|  unnamed protein product                                599   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AFK43304.1|  unknown                                                 599   0.0      
dbj|BAJ86549.1|  predicted protein                                      597   0.0      
ref|XP_002969875.1|  hypothetical protein SELMODRAFT_171238             596   0.0      
ref|XP_004975743.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    596   0.0      
sp|P23902.1|KASC1_HORVU  RecName: Full=3-oxoacyl-[acyl-carrier-pr...    594   0.0      Hordeum vulgare [barley]
ref|XP_004975742.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    594   0.0      
gb|KHG12490.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    594   0.0      
emb|CBI30851.3|  unnamed protein product                                590   0.0      
ref|XP_003579824.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    591   0.0      
emb|CDX87726.1|  BnaC02g32230D                                          591   0.0      
emb|CAH67240.1|  OSIGBa0140O07.8                                        587   0.0      Oryza sativa [red rice]
emb|CAD40964.2|  OSJNBa0027P08.14                                       587   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_007025114.1|  3-ketoacyl-acyl carrier protein synthase I i...    591   0.0      
ref|XP_010917434.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    583   0.0      
gb|EAZ30871.1|  hypothetical protein OsJ_14945                          578   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002964698.1|  hypothetical protein SELMODRAFT_230451             570   0.0      
gb|AGV54408.1|  beta-ketoacyl-ACP synthetase I                          571   0.0      
gb|AFW85456.1|  hypothetical protein ZEAMMB73_016804                    567   0.0      
gb|AAK58535.1|  beta-ketoacyl-ACP synthetase I                          557   0.0      Coriandrum sativum [cilantro]
ref|XP_010239948.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    549   0.0      
gb|KEH21263.1|  3-oxoacyl-[acyl-carrier] synthase I                     544   0.0      
gb|KHN12535.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    540   0.0      
ref|XP_001416469.1|  predicted protein                                  536   0.0      Ostreococcus lucimarinus CCE9901
dbj|BAK03950.1|  predicted protein                                      537   0.0      
emb|CEG00998.1|  Beta-ketoacyl synthase, active site                    535   0.0      
ref|XP_003074998.1|  beta-ketoacyl-ACP synthase (ISS)                   534   0.0      
ref|XP_005643461.1|  3-oxoacyl-synth                                    535   0.0      
ref|XP_005843858.1|  hypothetical protein CHLNCDRAFT_27559              528   2e-179   
ref|XP_002956811.1|  hypothetical protein VOLCADRAFT_83790              524   4e-178   
ref|XP_002961627.1|  hypothetical protein SELMODRAFT_230041             521   4e-178   
ref|XP_004959862.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    524   5e-178   
ref|XP_004987019.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    520   1e-176   
ref|XP_007509323.1|  predicted protein                                  519   5e-176   
gb|KFM25387.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    512   1e-173   
ref|NP_001032018.1|  beta-ketoacyl-[acyl carrier protein] synthase I    511   2e-173   Arabidopsis thaliana [mouse-ear cress]
gb|AEF13159.1|  beta-ketoacyl acyl carrier protein synthase             512   2e-173   
ref|XP_002463312.1|  hypothetical protein SORBIDRAFT_02g041620          511   1e-172   Sorghum bicolor [broomcorn]
gb|EAZ36138.1|  hypothetical protein OsJ_20447                          508   2e-172   Oryza sativa Japonica Group [Japonica rice]
gb|EMT20383.1|  3-oxoacyl-(acyl-carrier-protein) synthase I, chlo...    503   6e-170   
ref|XP_002504288.1|  predicted protein                                  504   9e-170   Micromonas commoda
ref|XP_003060067.1|  predicted protein                                  501   3e-169   
ref|XP_006852603.1|  hypothetical protein AMTR_s00021p00221400          471   2e-159   
gb|KHN28969.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    467   4e-158   
gb|EAZ00014.1|  hypothetical protein OsI_22012                          467   9e-158   Oryza sativa Indica Group [Indian rice]
ref|NP_001152921.1|  uncharacterized protein LOC100279917               466   1e-157   Zea mays [maize]
ref|XP_005642959.1|  3-ketoacyl-ACP-synthase                            469   1e-156   
ref|WP_011175788.1|  3-oxoacyl-ACP synthase                             468   1e-156   
ref|WP_039359465.1|  3-oxoacyl-ACP synthase                             467   2e-156   
gb|EMT32067.1|  3-oxoacyl-(acyl-carrier-protein) synthase I, chlo...    456   1e-153   
gb|EMS63377.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    464   1e-153   
gb|KDD75769.1|  beta-ketoacyl synthase                                  461   2e-153   
gb|EMS61772.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    455   3e-153   
gb|KHN25892.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    467   6e-153   
ref|WP_013182436.1|  3-oxoacyl-ACP synthase                             456   6e-152   
ref|WP_006340838.1|  3-oxoacyl-ACP synthase                             456   6e-152   
ref|WP_032125192.1|  3-oxoacyl-ACP synthase                             454   2e-151   
ref|XP_001773138.1|  predicted protein                                  454   2e-149   
ref|WP_039384131.1|  3-oxoacyl-ACP synthase                             445   7e-148   
gb|EAZ42784.1|  hypothetical protein OsJ_27364                          446   8e-148   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002986735.1|  hypothetical protein SELMODRAFT_158169             447   2e-147   
ref|XP_002516228.1|  46 kDa ketoavyl-ACP synthase                       449   3e-147   Ricinus communis
gb|AAA33872.1|  chloroplast beta-ketoacyl-ACP synthase precursor        448   3e-147   Ricinus communis
gb|EAZ04708.1|  hypothetical protein OsI_26869                          446   4e-147   Oryza sativa Indica Group [Indian rice]
ref|XP_002973275.1|  hypothetical protein SELMODRAFT_149056             446   5e-147   
ref|NP_001060274.1|  Os07g0616200                                       446   5e-147   Oryza sativa Japonica Group [Japonica rice]
gb|KIC73224.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    441   4e-146   
ref|XP_001763306.1|  predicted protein                                  440   5e-145   
ref|XP_001700152.1|  3-ketoacyl-ACP-synthase                            439   7e-145   Chlamydomonas reinhardtii
ref|XP_006381576.1|  FATTY ACID BIOSYNTHESIS 1 family protein           438   3e-144   
emb|CBI27767.3|  unnamed protein product                                438   8e-144   
ref|XP_001768994.1|  predicted protein                                  439   2e-143   
ref|XP_002276214.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    438   2e-143   Vitis vinifera
ref|XP_009104733.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    437   7e-143   
ref|XP_011039936.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    437   8e-143   
emb|CDX68154.1|  BnaA07g21940D                                          437   9e-143   
ref|XP_005707986.1|  3-oxoacyl-[acyl-carrier-protein] synthase II       434   1e-142   
ref|XP_010533238.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    436   2e-142   
gb|AAL91174.1|  putative 3-ketoacyl-ACP synthase                        435   3e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003638193.1|  Beta-ketoacyl-ACP synthase I                       432   5e-142   
ref|XP_006658817.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    428   5e-141   
ref|XP_008651372.1|  PREDICTED: uncharacterized protein LOC100280...    430   7e-141   
ref|NP_001132041.1|  uncharacterized protein LOC100193451 precursor     430   7e-141   Zea mays [maize]
ref|XP_002463181.1|  hypothetical protein SORBIDRAFT_02g039230          430   1e-140   Sorghum bicolor [broomcorn]
emb|CDP03046.1|  unnamed protein product                                431   1e-140   
gb|ACG25173.1|  3-oxoacyl-synthase I                                    430   1e-140   Zea mays [maize]
ref|XP_002989269.1|  hypothetical protein SELMODRAFT_129433             427   1e-140   
gb|EMS61602.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    427   1e-140   
ref|XP_011006167.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    431   2e-140   
ref|XP_002950994.1|  hypothetical protein VOLCADRAFT_104947             427   2e-140   
ref|XP_006416523.1|  hypothetical protein EUTSA_v10007353mg             430   3e-140   
gb|KDO73814.1|  hypothetical protein CISIN_1g008146mg                   426   3e-140   
ref|XP_004488123.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    426   1e-139   
ref|XP_006307215.1|  hypothetical protein CARUB_v10008814mg             427   3e-139   
dbj|BAJ91001.1|  predicted protein                                      424   9e-139   
gb|KCW81914.1|  hypothetical protein EUGRSUZ_C03291                     425   1e-138   
ref|WP_013944050.1|  3-oxoacyl-ACP synthase                             421   1e-138   
ref|XP_009149615.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    426   2e-138   
emb|CAA84022.1|  beta-ketoacyl-ACP synthase                             424   2e-138   Hordeum vulgare [barley]
ref|XP_010498338.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    424   3e-138   
gb|KDO73811.1|  hypothetical protein CISIN_1g008146mg                   426   4e-138   
ref|XP_010459587.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    424   6e-138   
ref|XP_009390876.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    423   9e-138   
ref|XP_006452865.1|  hypothetical protein CICLE_v10007846mg             425   9e-138   
ref|XP_010477131.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    423   1e-137   
gb|AAF91318.1|AF242848_1  beta-ketoacyl-acyl carrier protein synt...    424   1e-137   Brassica napus [oilseed rape]
ref|XP_006474686.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    424   1e-137   
gb|AAF61739.1|AF244520_1  beta-ketoacyl-ACP synthetase 2                419   1e-137   Brassica napus [oilseed rape]
ref|XP_006390366.1|  hypothetical protein EUTSA_v10018368mg             423   1e-137   
ref|XP_004508026.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    422   1e-137   
ref|XP_010089666.1|  3-oxoacyl-[acyl-carrier-protein] synthase II       423   2e-137   
gb|ACJ85772.1|  unknown                                                 421   3e-137   Medicago truncatula
emb|CDY26686.1|  BnaA06g13360D                                          421   4e-137   
emb|CDR33578.1|  3-oxoacyl-[acyl-carrier-protein] synthase II           417   6e-137   
ref|XP_003609968.1|  3-oxoacyl-ACP synthase                             419   9e-137   
ref|XP_010932373.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    422   1e-136   
ref|XP_010932372.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    422   1e-136   
emb|CDX73128.1|  BnaC06g35760D                                          421   1e-136   
emb|CDX85866.1|  BnaC06g22680D                                          420   2e-136   
emb|CDY45409.1|  BnaA07g31890D                                          420   2e-136   
ref|XP_002324139.2|  hypothetical protein POPTR_0018s07450g             421   2e-136   Populus trichocarpa [western balsam poplar]
ref|XP_009106152.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    421   2e-136   
gb|AGC65509.1|  keto acyl-acyl carrier protein synthase II              421   2e-136   
ref|XP_004984084.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    419   2e-136   
emb|CDY41034.1|  BnaC05g14920D                                          419   2e-136   
gb|KDP33964.1|  hypothetical protein JCGZ_07535                         421   2e-136   
ref|XP_011093876.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    420   2e-136   
ref|XP_001768920.1|  predicted protein                                  415   2e-136   
ref|NP_001169617.1|  uncharacterized protein LOC100383498 precursor     418   3e-136   
ref|NP_565097.1|  3-oxoacyl-[acyl-carrier-protein] synthase II          420   3e-136   
ref|XP_008337819.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    420   4e-136   
gb|AAB37270.1|  beta-ketoacyl-ACP synthase II                           419   4e-136   
ref|XP_002889002.1|  hypothetical protein ARALYDRAFT_476635             419   4e-136   
ref|NP_001290396.1|  3-oxoacyl-[acyl-carrier-protein] synthase II...    420   4e-136   
ref|NP_001289900.1|  3-oxoacyl-[acyl-carrier-protein] synthase II...    420   5e-136   
gb|KEH37628.1|  3-oxoacyl-(acyl carrier) synthase II                    417   5e-136   
ref|XP_006300437.1|  hypothetical protein CARUB_v10020101mg             419   5e-136   
ref|XP_004287663.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    417   5e-136   
emb|CBI35831.3|  unnamed protein product                                419   6e-136   
ref|XP_002965643.1|  hypothetical protein SELMODRAFT_230708             414   7e-136   
gb|AGH32917.1|  ketoacyl-ACP synthase II                                419   9e-136   
ref|XP_007154557.1|  hypothetical protein PHAVU_003G128700g             417   9e-136   
ref|XP_010428495.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    419   9e-136   
ref|XP_006651481.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    415   1e-135   
gb|AIL53811.1|  beta-ketoacyl-[acyl carrier protein] synthase II        419   1e-135   
ref|XP_009359705.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    419   1e-135   
ref|XP_008338300.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    419   1e-135   
ref|XP_010654405.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    419   2e-135   
ref|XP_008784350.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    419   2e-135   
ref|XP_006353782.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    417   2e-135   
ref|XP_004243689.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    417   3e-135   
gb|AAC68860.1|  3-ketoacyl-ACP synthase                                 417   4e-135   
ref|XP_009767768.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    414   9e-135   
ref|XP_008242279.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    417   1e-134   
gb|ABJ90469.2|  beta-ketoacyl-ACP synthase II                           416   2e-134   
ref|XP_009337172.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    416   2e-134   
ref|XP_009625177.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    413   3e-134   
ref|XP_010313772.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    412   3e-134   
ref|XP_007204195.1|  hypothetical protein PRUPE_ppa003597mg             415   3e-134   
ref|XP_010049368.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    415   4e-134   
gb|EYU28306.1|  hypothetical protein MIMGU_mgv1a004039mg                414   4e-134   
ref|XP_007012570.1|  Fatty acid biosynthesis 1 isoform 5                411   4e-134   
gb|EMT21411.1|  3-oxoacyl-(acyl-carrier-protein) synthase I, chlo...    413   5e-134   
gb|KHG18322.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    415   6e-134   
gb|EMS48560.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    406   6e-134   
ref|XP_003557750.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    412   7e-134   
emb|CDY46021.1|  BnaA02g17050D                                          412   8e-134   
ref|XP_009128067.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    411   1e-133   
ref|XP_004251704.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    412   2e-133   
ref|XP_010932371.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    414   2e-133   
gb|ADK23940.1|  KASII                                                   414   2e-133   
gb|AAF26738.2|AF220453_1  beta-ketoacyl-ACP synthase II                 413   3e-133   
gb|EYU25822.1|  hypothetical protein MIMGU_mgv1a004003mg                412   3e-133   
ref|XP_010932370.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    413   4e-133   
emb|CDZ80412.1|  3-oxoacyl-[acyl-carrier-protein] synthase 2            407   4e-133   
ref|XP_011078136.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    412   5e-133   
gb|ACJ07142.1|  beta-ketoacyl-ACP synthase II-1                         411   9e-133   
gb|AAC68861.1|  3-ketoacyl-ACP synthase                                 410   1e-132   
ref|XP_007012566.1|  Fatty acid biosynthesis 1 isoform 1                412   1e-132   
emb|CAA84023.1|  beta-ketoacyl-ACP synthase                             408   2e-132   
ref|XP_003547514.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    408   2e-132   
gb|AAB37271.1|  beta-ketoacyl-ACP synthase II                           410   2e-132   
ref|XP_010539937.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    412   2e-132   
ref|XP_006600238.1|  PREDICTED: beta-ketoacyl-ACP synthetase 2 is...    408   3e-132   
ref|XP_006345248.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    409   3e-132   
emb|CAC59946.1|  beta-ketoacyl-ACP synthase IV                          409   3e-132   
ref|XP_003562655.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    407   7e-132   
ref|XP_010937286.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    409   9e-132   
ref|XP_006426725.1|  hypothetical protein CICLE_v10027447mg             404   1e-131   
gb|ABI18155.1|  plastid 3-keto-acyl-ACP synthase II                     406   1e-131   
ref|WP_020370551.1|  MULTISPECIES: beta-ketoacyl-acyl-carrier-pro...    402   4e-131   
gb|AAC04692.1|  beta-ketoacyl-ACP synthase II                           406   6e-131   
ref|XP_006426741.1|  hypothetical protein CICLE_v10027240mg             404   7e-131   
ref|XP_010937284.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    406   1e-130   
ref|XP_005537149.1|  3-oxoacyl-[acyl-carrier-protein] synthase I,...    403   2e-130   
ref|XP_009336709.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    402   2e-130   
ref|WP_013712221.1|  3-oxoacyl-ACP synthase                             400   3e-130   
ref|NP_001235052.1|  beta-ketoacyl-ACP synthetase 2 precursor           401   8e-130   
ref|XP_010687531.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    403   9e-130   
gb|AAD55280.1|AC008263_11  Similar to gb|AF060519 3-ketoacyl-ACP ...    404   1e-129   
emb|CDO97819.1|  unnamed protein product                                403   2e-129   
ref|XP_006342938.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    403   2e-129   
gb|KHN17744.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    407   2e-129   
ref|XP_010047453.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    402   4e-129   
ref|XP_008228351.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    401   7e-129   
ref|XP_009771698.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    399   1e-128   
ref|XP_011072620.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    400   2e-128   
ref|XP_010261746.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    400   2e-128   
ref|XP_009587352.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    398   3e-128   
ref|XP_010937285.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    399   4e-128   
ref|XP_004305765.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    399   5e-128   
ref|WP_010229532.1|  3-oxoacyl-ACP synthase                             394   6e-128   
ref|WP_020967796.1|  3-oxoacyl-ACP synthase                             394   9e-128   
ref|WP_009872915.1|  3-oxoacyl-ACP synthase                             393   1e-127   
ref|WP_009872150.1|  3-oxoacyl-ACP synthase                             393   2e-127   
ref|WP_035407645.1|  3-oxoacyl-ACP synthase                             392   3e-127   
ref|XP_006426733.1|  hypothetical protein CICLE_v10025676mg             392   4e-127   
ref|XP_010318480.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    396   6e-127   
ref|WP_024067272.1|  3-oxoacyl-ACP synthase                             391   7e-127   
ref|WP_009873390.1|  3-oxoacyl-ACP synthase                             391   1e-126   
ref|XP_006426746.1|  hypothetical protein CICLE_v10025485mg             393   1e-126   
ref|XP_010554926.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    394   1e-126   
ref|WP_011324861.1|  3-oxoacyl-ACP synthase                             390   1e-126   
ref|XP_011072618.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    395   4e-126   
ref|WP_006344425.1|  3-oxoacyl-ACP synthase                             389   4e-126   
ref|XP_006843870.1|  hypothetical protein AMTR_s00007p00265100          395   5e-126   
ref|WP_011097353.1|  3-oxoacyl-ACP synthase                             389   6e-126   
ref|XP_009380020.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    394   7e-126   
gb|AIL53812.1|  beta-ketoacyl-[acyl carrier protein] synthase II        392   1e-125   
ref|WP_011457720.1|  3-oxoacyl-ACP synthase                             388   1e-125   
gb|KDO73815.1|  hypothetical protein CISIN_1g008146mg                   393   1e-125   
gb|KHG27960.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    392   1e-125   
ref|XP_008450963.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    392   3e-125   
ref|NP_001236069.1|  plastid 3-keto-acyl-ACP synthase II-B precursor    389   5e-125   
ref|WP_006343509.1|  3-oxoacyl-ACP synthase                             387   5e-125   
ref|WP_014945306.1|  3-oxoacyl-ACP synthase                             386   6e-125   
ref|WP_014518181.1|  3-oxoacyl-ACP synthase                             386   8e-125   
ref|XP_006466138.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    388   1e-124   
ref|WP_010883551.1|  3-oxoacyl-ACP synthase                             385   1e-124   
ref|XP_006603178.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    379   2e-124   
ref|WP_021828618.1|  MULTISPECIES: beta-ketoacyl-acyl-carrier-pro...    385   2e-124   
ref|XP_010273891.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    390   3e-124   
ref|WP_011006808.1|  3-oxoacyl-ACP synthase                             384   4e-124   
ref|XP_008782971.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    389   5e-124   
ref|XP_002893037.1|  predicted protein                                  385   9e-124   
ref|XP_004169836.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    388   1e-123   
ref|XP_004144052.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    388   1e-123   
ref|XP_010273890.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    389   1e-123   
ref|WP_020356536.1|  beta-ketoacyl-acyl-carrier-protein synthase II     383   1e-123   
ref|XP_008782961.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    387   2e-123   
gb|AFW88075.1|  hypothetical protein ZEAMMB73_812704                    383   4e-123   
ref|XP_005847731.1|  hypothetical protein CHLNCDRAFT_31085              380   5e-123   
gb|KEH37629.1|  3-oxoacyl-(acyl carrier) synthase II                    382   5e-123   
ref|XP_007024704.1|  Fatty acid biosynthesis 1                          384   6e-123   
ref|XP_003083296.1|  Animal-type fatty acid synthase and related ...    382   2e-122   
ref|XP_004984083.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    383   4e-122   
gb|KHG11340.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    380   4e-122   
gb|AFW88073.1|  hypothetical protein ZEAMMB73_812704                    381   6e-122   
ref|XP_002505037.1|  predicted protein                                  378   1e-121   
ref|XP_008782980.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    382   3e-121   
gb|EEC75431.1|  hypothetical protein OsI_11955                          378   7e-121   
gb|KHN07879.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    377   8e-121   
gb|KFM26022.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    376   1e-120   
gb|EEE59220.1|  hypothetical protein OsJ_11186                          378   1e-120   
ref|XP_010939869.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    380   1e-120   
gb|KHG11339.1|  3-oxoacyl-[acyl-carrier-protein] synthase II, chl...    380   2e-120   
ref|XP_010939870.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    379   2e-120   
gb|KDO45708.1|  hypothetical protein CISIN_1g0114931mg                  375   2e-120   
ref|XP_006466136.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    374   9e-120   
ref|XP_006597884.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    375   9e-120   
emb|CAN81160.1|  hypothetical protein VITISV_012302                     371   2e-118   
ref|XP_007024707.1|  Fatty acid biosynthesis 1                          371   4e-118   
gb|KEH32421.1|  3-oxoacyl-(acyl carrier) synthase II                    366   5e-118   
gb|ACQ41833.1|  beta-ketoacyl-ACP synthase II                           373   6e-118   
gb|KDO45712.1|  hypothetical protein CISIN_1g037985mg                   371   9e-118   
ref|XP_001421246.1|  predicted protein                                  366   3e-117   
ref|XP_001421280.1|  predicted protein                                  364   2e-116   
gb|EKE22156.1|  hypothetical protein ACD_7C00036G0001                   358   4e-115   
tpg|DAA41444.1|  TPA: hypothetical protein ZEAMMB73_227409              357   5e-115   
gb|KEH21261.1|  3-oxoacyl-[acyl-carrier] synthase                       355   1e-114   
gb|EMS48559.1|  3-oxoacyl-[acyl-carrier-protein] synthase I, chlo...    362   1e-114   
ref|XP_011072621.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    363   2e-114   
ref|XP_007514613.1|  predicted protein                                  362   3e-114   
ref|XP_002509140.1|  predicted protein                                  358   6e-114   
emb|CDY37268.1|  BnaCnng08220D                                          357   2e-113   
ref|XP_010932374.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    360   3e-113   
ref|XP_003060578.1|  predicted protein                                  360   1e-112   
ref|WP_006036553.1|  3-oxoacyl-ACP synthase                             353   2e-112   
ref|WP_003386033.1|  3-oxoacyl-(acyl-carrier-protein) synthase 2        353   3e-112   
ref|XP_003061616.1|  predicted protein                                  356   3e-112   
ref|XP_011078137.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    356   3e-112   
ref|WP_016743279.1|  3-oxoacyl-ACP synthase                             352   6e-112   
ref|WP_015891895.1|  3-oxoacyl-ACP synthase                             352   7e-112   
ref|WP_017249371.1|  3-oxoacyl-ACP synthase                             352   1e-111   
ref|WP_013120920.1|  3-oxoacyl-ACP synthase                             352   1e-111   
ref|WP_007719724.1|  3-oxoacyl-ACP synthase                             352   1e-111   
ref|WP_027718279.1|  3-oxoacyl-ACP synthase                             352   2e-111   
ref|WP_019120484.1|  3-oxoacyl-ACP synthase                             351   2e-111   
ref|WP_026326403.1|  3-oxoacyl-ACP synthase                             351   2e-111   
ref|WP_018757771.1|  3-oxoacyl-ACP synthase                             351   3e-111   
gb|KDO45710.1|  hypothetical protein CISIN_1g0448241mg                  348   6e-111   
ref|WP_013919533.1|  3-oxoacyl-ACP synthase                             350   8e-111   
ref|WP_028595616.1|  3-oxoacyl-ACP synthase                             350   8e-111   
ref|WP_005834333.1|  MULTISPECIES: 3-oxoacyl-ACP synthase               349   1e-110   
ref|WP_033099761.1|  3-oxoacyl-ACP synthase                             349   1e-110   
ref|WP_024630177.1|  MULTISPECIES: 3-oxoacyl-ACP synthase               349   1e-110   
ref|WP_026145451.1|  3-oxoacyl-ACP synthase                             348   3e-110   
ref|WP_036609459.1|  MULTISPECIES: 3-oxoacyl-ACP synthase               348   3e-110   
ref|WP_026007445.1|  3-oxoacyl-ACP synthase                             348   5e-110   
ref|WP_023557213.1|  3-oxoacyl-ACP synthase                             347   9e-110   
ref|WP_029100165.1|  3-oxoacyl-ACP synthase                             347   9e-110   
ref|WP_015255002.1|  3-oxoacyl-ACP synthase                             347   1e-109   
ref|WP_026081143.1|  3-oxoacyl-ACP synthase                             347   1e-109   
ref|WP_010447163.1|  3-oxoacyl-ACP synthase                             346   2e-109   
gb|ADE77460.1|  unknown                                                 341   3e-109   
ref|WP_028550391.1|  3-oxoacyl-ACP synthase                             345   3e-109   
ref|WP_008931242.1|  3-oxoacyl-ACP synthase                             345   5e-109   
ref|WP_017366310.1|  3-oxoacyl-ACP synthase                             345   7e-109   
ref|WP_008096407.1|  3-oxoacyl-ACP synthase                             345   7e-109   
ref|WP_027596081.1|  3-oxoacyl-ACP synthase                             345   8e-109   
ref|WP_009685064.1|  MULTISPECIES: 3-oxoacyl-ACP synthase               343   2e-108   
ref|WP_016715142.1|  MULTISPECIES: 3-oxoacyl-ACP synthase               343   3e-108   
ref|WP_015845064.1|  3-oxoacyl-ACP synthase                             343   3e-108   
ref|WP_010952938.1|  3-oxoacyl-ACP synthase                             343   3e-108   
ref|WP_021784984.1|  MULTISPECIES: 3-oxoacyl-ACP synthase               343   4e-108   
ref|WP_011380424.1|  3-oxoacyl-ACP synthase                             343   4e-108   
ref|WP_012271164.1|  MULTISPECIES: 3-oxoacyl-ACP synthase               343   4e-108   
ref|WP_014591924.1|  3-oxoacyl-ACP synthase                             343   4e-108   
ref|WP_016391228.1|  3-oxoacyl-(acyl carrier protein) synthase II       343   4e-108   
gb|AHD13545.1|  3-oxoacyl-ACP synthase                                  342   5e-108   
ref|WP_015269411.1|  MULTISPECIES: 3-oxoacyl-(acyl carrier protei...    342   5e-108   
ref|WP_018883539.1|  3-oxoacyl-ACP synthase                             342   5e-108   
ref|WP_013275861.1|  3-oxoacyl-ACP synthase                             342   5e-108   
ref|WP_010269672.1|  3-oxoacyl-ACP synthase                             342   5e-108   
ref|WP_011532888.1|  3-oxoacyl-ACP synthase                             342   7e-108   
gb|AHV97309.1|  3-oxoacyl-(acyl-carrier-protein) synthase 2             342   8e-108   
ref|WP_028592362.1|  3-oxoacyl-ACP synthase                             342   8e-108   
ref|WP_023533084.1|  MULTISPECIES: beta-ketoacyl-acyl-carrier-pro...    342   1e-107   
ref|WP_028633630.1|  3-oxoacyl-ACP synthase                             342   1e-107   
ref|WP_038595825.1|  3-oxoacyl-ACP synthase                             342   1e-107   
ref|WP_023379409.1|  MULTISPECIES: 3-oxoacyl-(acyl carrier protei...    342   1e-107   
ref|WP_014859697.1|  3-oxoacyl-ACP synthase                             341   1e-107   
ref|WP_033700571.1|  3-oxoacyl-ACP synthase                             341   1e-107   
ref|WP_003247162.1|  3-oxoacyl-ACP synthase                             341   1e-107   
gb|ABQ79922.1|  3-oxoacyl-[acyl-carrier-protein] synthase II            342   1e-107   



>gb|AAC78479.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Capsicum chinense]
Length=488

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/489 (77%), Positives = 425/489 (87%), Gaps = 3/489 (1%)
 Frame = +1

Query  112   MASIAPS--SGLIFKSKESSKNGASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKC  285
             M+SI  S  S LI K KES  NG   LQY+GL+ +E++Q    SVAYK +  K   RI+ 
Sbjct  1     MSSITSSCYSNLILKKKESRINGGFHLQYNGLRAIESVQMPASSVAYKPKVVK-WGRIRV  59

Query  286   MISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFS  465
             M SPAVSAPKR++DPKKR+VITGMGLVSVFGSD++ FYN LLEG+SGISLIDRFDAS ++
Sbjct  60    MASPAVSAPKRETDPKKRIVITGMGLVSVFGSDIDNFYNKLLEGQSGISLIDRFDASSYT  119

Query  466   VRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigav  645
             VRFAGQI  F+SEGYID KNDRRLD  WRYCLVAGK+AL DANLG++VL+ MDKTRIG +
Sbjct  120   VRFAGQIRDFSSEGYIDGKNDRRLDDCWRYCLVAGKRALEDANLGQQVLDTMDKTRIGVL  179

Query  646   igsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTAC  825
             +GS  GG  VF + V  LVQ GYKKI PFFIPYSITNMGSALLAI+ GLMGPTYSISTAC
Sbjct  180   VGSSMGGSKVFADAVEALVQRGYKKINPFFIPYSITNMGSALLAIDTGLMGPTYSISTAC  239

Query  826   ATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWD  1005
             ATANYCFY++ANHIR+GEADIM+AGGT+A I+  GVGG IACRALSQRN E E+ASRPWD
Sbjct  240   ATANYCFYASANHIRRGEADIMVAGGTDAFISAIGVGGLIACRALSQRNDEYEKASRPWD  299

Query  1006  KDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCI  1185
             ++RDGFVIGEG GVLVME L+HA+KRGA +IAEYLGGA TCDAHH+T+PR DGLGVSSCI
Sbjct  300   RNRDGFVIGEGSGVLVMENLEHALKRGAPIIAEYLGGAITCDAHHITDPRADGLGVSSCI  359

Query  1186  TKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGA  1365
               SL DAGVSPEEVNYINAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLGA
Sbjct  360   VMSLVDAGVSPEEVNYINAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHGLGA  419

Query  1366  SGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNS  1545
             SGGLEAIATIKAITTGWLHPTINQY+LEP+VTIDTVPNVKKQH+VNV ISNSFGFGGHNS
Sbjct  420   SGGLEAIATIKAITTGWLHPTINQYDLEPQVTIDTVPNVKKQHEVNVGISNSFGFGGHNS  479

Query  1546  VIVFGPFKP  1572
             V+VF P+KP
Sbjct  480   VVVFAPYKP  488



>ref|XP_002299456.1| hypothetical protein POPTR_0001s10890g [Populus trichocarpa]
 gb|EEE84261.1| hypothetical protein POPTR_0001s10890g [Populus trichocarpa]
Length=495

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/490 (76%), Positives = 420/490 (86%), Gaps = 5/490 (1%)
 Frame = +1

Query  112   MASIAPSSGLIFKSKESSKNGASLLQYSGLKPVETMQ-----NQPDSVAYKAQAAKKCRR  276
             +A  A SS ++F S+E   +GASL QY GL+PVE MQ      +P      +    K R 
Sbjct  4     IAGAACSSNVLFGSREVGSDGASLAQYRGLRPVENMQLAPTGRRPSGSISTSGMTSKSRT  63

Query  277   IKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDAS  456
             I+ M+S  VSAPKR+ DPKKRVVITGMGLVSVFGS ++TFY+ LLEG SGISLIDRFDAS
Sbjct  64    IRAMVSQTVSAPKREKDPKKRVVITGMGLVSVFGSGIDTFYDKLLEGESGISLIDRFDAS  123

Query  457   DFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRi  636
              FSVRFAGQI  F+S+GYID KNDRRLD  WRYCLVAGK+AL DANLG EVL NMD+TRI
Sbjct  124   SFSVRFAGQIRDFSSKGYIDGKNDRRLDDCWRYCLVAGKRALEDANLGSEVLENMDRTRI  183

Query  637   gavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSIS  816
             G ++G+G GGL  F NGV +LVQ GYKK++PFFIPYSITNMGSALLAI+ GLMGP YSIS
Sbjct  184   GVLVGTGMGGLTAFSNGVESLVQKGYKKMSPFFIPYSITNMGSALLAIDTGLMGPNYSIS  243

Query  817   TACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASR  996
             TACATANYCFYSAANHIR+GEADIM+AGGTEA +   GVGGFIACRALSQRN +P++ASR
Sbjct  244   TACATANYCFYSAANHIRRGEADIMVAGGTEASVIPAGVGGFIACRALSQRNEDPKKASR  303

Query  997   PWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVS  1176
             PWDKDRDGFV+GEG GVL+ME LDHAMKRGAN+IAEYLGGA TCDAHHMT+PR+DGLGVS
Sbjct  304   PWDKDRDGFVMGEGSGVLIMESLDHAMKRGANIIAEYLGGAVTCDAHHMTDPRSDGLGVS  363

Query  1177  SCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHG  1356
             +CI KSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFK+TSEIKMNGTKS+IGHG
Sbjct  364   TCIAKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKNTSEIKMNGTKSMIGHG  423

Query  1357  LGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGG  1536
             LGA+G LEAIATIKAI TGWLHPTINQ N+E +VTIDTVPNVKKQH+VNV ISNSFGFGG
Sbjct  424   LGAAGALEAIATIKAINTGWLHPTINQDNIELDVTIDTVPNVKKQHEVNVGISNSFGFGG  483

Query  1537  HNSVIVFGPF  1566
             HNSV+VF PF
Sbjct  484   HNSVVVFAPF  493



>emb|CDP12182.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/490 (78%), Positives = 436/490 (89%), Gaps = 3/490 (1%)
 Frame = +1

Query  112   MASIAP--SSGLIFKSKESSKNGASLLQYSGLKPVETMQ-NQPDSVAYKAQAAKKCRRIK  282
             MASIA   SS  I K+ ES +NG+SL QYSGL+ V++ + +      + +++A KCR I+
Sbjct  1     MASIAGTFSSSSILKNSESGRNGSSLCQYSGLRTVDSFKLDSSKPKGFISRSASKCRGIR  60

Query  283   CMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDF  462
              M SP VSAPKR++DPKKR+VITGMGLVSVFGSD +TFY+ LLEG SGISLIDRFDAS++
Sbjct  61    AMASPTVSAPKRETDPKKRIVITGMGLVSVFGSDNDTFYSKLLEGESGISLIDRFDASNY  120

Query  463   SVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRiga  642
             SVRFAGQI  F+S+GYID KNDRRLD  WRYCLVAG++AL+DA+LG+EVL  MD++RIG 
Sbjct  121   SVRFAGQIRDFSSKGYIDGKNDRRLDDCWRYCLVAGRRALDDASLGQEVLETMDRSRIGV  180

Query  643   vigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTA  822
             ++GSG GGL  F NGV  L+Q GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSISTA
Sbjct  181   LVGSGMGGLTAFSNGVEALIQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSISTA  240

Query  823   CATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPW  1002
             CATANYCFY+AANHIR+GEADIM+AGGTEA +  TGVGGFIACRALSQRN EPE+ASRPW
Sbjct  241   CATANYCFYAAANHIRRGEADIMVAGGTEAAVMATGVGGFIACRALSQRNDEPEKASRPW  300

Query  1003  DKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSC  1182
             DKDRDGFVIGEG GVL+ME L++A KRGAN+IAEYLGGA TCDAHHMT+PR+DGLGVSSC
Sbjct  301   DKDRDGFVIGEGSGVLIMESLENAEKRGANIIAEYLGGAITCDAHHMTDPRSDGLGVSSC  360

Query  1183  ITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLG  1362
             ITKSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMNGTKS+IGHGLG
Sbjct  361   ITKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSEMKMNGTKSMIGHGLG  420

Query  1363  ASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHN  1542
             A+GGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKK+H+VNVAISNSFGFGGHN
Sbjct  421   AAGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKRHEVNVAISNSFGFGGHN  480

Query  1543  SVIVFGPFKP  1572
             SV+VF PFKP
Sbjct  481   SVVVFAPFKP  490



>ref|XP_011026849.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Populus euphratica]
Length=493

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/488 (76%), Positives = 419/488 (86%), Gaps = 3/488 (1%)
 Frame = +1

Query  112   MASIAPSSGLIFKSKESSKNGASLLQYSGLKPVETMQNQPDSVAYK---AQAAKKCRRIK  282
             +A  A SS ++F S+E   +GASL QY GL+PVE MQ  P         + +A K R I+
Sbjct  4     IAGAACSSNVLFGSREVGSDGASLAQYRGLRPVENMQLAPTGSKPSGSISTSASKSRTIR  63

Query  283   CMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDF  462
              M+S  VSAPKR+ DPKKRVVITGMGLVSVFGS ++TFY+ LLEG SGISLIDRFDAS F
Sbjct  64    AMVSQTVSAPKREKDPKKRVVITGMGLVSVFGSGIDTFYDKLLEGESGISLIDRFDASSF  123

Query  463   SVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRiga  642
             SVRFAGQI  F+S+GYID KNDRRLD  WRYCLVAGK+AL DANLG EVL NMD+TRIG 
Sbjct  124   SVRFAGQIRDFSSKGYIDGKNDRRLDDCWRYCLVAGKRALEDANLGSEVLENMDRTRIGV  183

Query  643   vigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTA  822
             ++G+G GGL  F NGV +LVQ GYKK++PFFIPYSITNMGSALLA + GLMGP YSISTA
Sbjct  184   LVGTGMGGLTAFSNGVESLVQKGYKKMSPFFIPYSITNMGSALLARDTGLMGPNYSISTA  243

Query  823   CATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPW  1002
             CATANYCFYSAANHIR+GEADIM+AGGTEA +   GVGGFIACRALSQRN +P++A RPW
Sbjct  244   CATANYCFYSAANHIRRGEADIMVAGGTEASVIPAGVGGFIACRALSQRNEDPKKAPRPW  303

Query  1003  DKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSC  1182
             DKDRDGFV+GEG GVL+ME L+HAMKRGAN+IAEYLGGA TCDAHHMT+PR+DGLGVS+C
Sbjct  304   DKDRDGFVMGEGSGVLIMESLEHAMKRGANIIAEYLGGAVTCDAHHMTDPRSDGLGVSTC  363

Query  1183  ITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLG  1362
             I KSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFK+TSEIKMNGTKS+IGHGLG
Sbjct  364   IVKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKNTSEIKMNGTKSMIGHGLG  423

Query  1363  ASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHN  1542
             A+G LEAIATIKAI TGWLHPTINQ N+E +VTIDTVPNVKKQH+VNV ISNSFGFGGHN
Sbjct  424   AAGALEAIATIKAINTGWLHPTINQDNIEHDVTIDTVPNVKKQHEVNVGISNSFGFGGHN  483

Query  1543  SVIVFGPF  1566
             SV+VF PF
Sbjct  484   SVVVFAPF  491



>ref|XP_006343829.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Solanum tuberosum]
Length=485

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/487 (77%), Positives = 428/487 (88%), Gaps = 2/487 (0%)
 Frame = +1

Query  112   MASIAPSSGLIFKSKESSKNGASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMI  291
             M+SI  S+ LI K +ES  NG S LQY+GL+ +ET++   +S + K +A K C RI+ M 
Sbjct  1     MSSITYSN-LILKKRESRINGGSHLQYNGLRAIETVKLTANSASCKPKAVK-CGRIRAMA  58

Query  292   SPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVR  471
             SPAVSAPKR++DPKKRVVITGMGLVSVFGSD++ FYN LLEG+SGISLID FDAS++SVR
Sbjct  59    SPAVSAPKRETDPKKRVVITGMGLVSVFGSDIDNFYNKLLEGQSGISLIDSFDASNYSVR  118

Query  472   FAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavig  651
             FAGQI  F+SEGYID KNDRRLD+ WRYCLVAGK+AL+DANLG++VL  MDKTRIG ++G
Sbjct  119   FAGQIRDFSSEGYIDGKNDRRLDNCWRYCLVAGKRALDDANLGRQVLETMDKTRIGVLVG  178

Query  652   sgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACAT  831
             SG GGL VF +GV TL+Q GYKKI+PFFIPYSITNMGSALLAIE GLMGP YSISTACAT
Sbjct  179   SGMGGLKVFSDGVETLLQRGYKKISPFFIPYSITNMGSALLAIETGLMGPNYSISTACAT  238

Query  832   ANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKD  1011
             AN+   +AANHIR+G+ADIM+AGGTEAG+T   VGGFIACRALSQRN + E+ASRPWD +
Sbjct  239   ANHSLCAAANHIRRGDADIMVAGGTEAGVTAATVGGFIACRALSQRNDDYEKASRPWDTN  298

Query  1012  RDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITK  1191
             RDGFV+GEG G+LVME L+HA+KRGAN+IAEYLGGA TCDAHHMT+PR DGLGVSSCITK
Sbjct  299   RDGFVVGEGSGILVMESLEHALKRGANIIAEYLGGAVTCDAHHMTDPRPDGLGVSSCITK  358

Query  1192  SLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASG  1371
              L DA +SPEEVNYINAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLGA+G
Sbjct  359   GLLDARISPEEVNYINAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSIIGHGLGAAG  418

Query  1372  GLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVI  1551
             G+EAIATIKAI TGWLHPTINQY LEP+VTIDTVPNVKKQH+VNV ISNSFGFGGHNSV+
Sbjct  419   GIEAIATIKAIKTGWLHPTINQYELEPQVTIDTVPNVKKQHEVNVGISNSFGFGGHNSVV  478

Query  1552  VFGPFKP  1572
             VF P+KP
Sbjct  479   VFAPYKP  485



>gb|KDP25270.1| hypothetical protein JCGZ_20426 [Jatropha curcas]
Length=489

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/492 (77%), Positives = 430/492 (87%), Gaps = 8/492 (2%)
 Frame = +1

Query  112   MASIAP--SSGLIFKSKESSKNGASLLQYSGLKPVETMQNQP---DSVAYKAQAAKKCRR  276
             MA++A   SS ++F+S+    NGASL QY+GL+P+ET+Q  P    S  + + +  K R 
Sbjct  1     MATVAGTCSSSVLFRSRS---NGASLAQYNGLRPLETVQMAPAGTKSSGFLSTSVPKSRT  57

Query  277   IKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDAS  456
             I+ M SP VSAPKR+ DPKKRVVITGMG+VSVFG+DV+ FYN LLEG SGISLIDRFDAS
Sbjct  58    IRAMASPNVSAPKREKDPKKRVVITGMGVVSVFGNDVDAFYNKLLEGESGISLIDRFDAS  117

Query  457   DFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRi  636
              FSVRFAGQI  F+S+GYID KNDRRLD  WRYCLVAGK+AL DANLG EVL+NMD+TR 
Sbjct  118   SFSVRFAGQIRDFSSKGYIDGKNDRRLDDCWRYCLVAGKRALEDANLGPEVLDNMDRTRT  177

Query  637   gavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSIS  816
             G +IG+G GGL  F NGV  L+Q GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSIS
Sbjct  178   GVLIGTGMGGLTAFSNGVEALIQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSIS  237

Query  817   TACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASR  996
             TACATANYCFY+AANHIR+GEADIM+AGGTEA +  TGVGGFIACRALSQRN +P+RASR
Sbjct  238   TACATANYCFYAAANHIRRGEADIMVAGGTEAAVMPTGVGGFIACRALSQRNDDPKRASR  297

Query  997   PWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVS  1176
             PWDK+RDGFV+GEG GVL+ME LDHA+KRGAN+IAEYLGGA TCDAHHMT+PR+DGLGVS
Sbjct  298   PWDKNRDGFVMGEGAGVLIMESLDHALKRGANIIAEYLGGAVTCDAHHMTDPRSDGLGVS  357

Query  1177  SCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHG  1356
             +CITKSLEDA VSPEEVNYINAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHG
Sbjct  358   TCITKSLEDAKVSPEEVNYINAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHG  417

Query  1357  LGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGG  1536
             LGA+GGLEA+ATIKAITTGWLHPTINQ NLEP+VTIDTVPN+KKQHQVNV ISNSFGFGG
Sbjct  418   LGAAGGLEAVATIKAITTGWLHPTINQDNLEPDVTIDTVPNLKKQHQVNVGISNSFGFGG  477

Query  1537  HNSVIVFGPFKP  1572
             HNSV+VF PF P
Sbjct  478   HNSVVVFAPFTP  489



>ref|XP_011022477.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Populus euphratica]
Length=493

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/490 (77%), Positives = 428/490 (87%), Gaps = 3/490 (1%)
 Frame = +1

Query  112   MASIAPSSGLIFKSKESSKNGASLLQYSGLKPVETMQNQPDSV---AYKAQAAKKCRRIK  282
             +A  A SS ++F+S++  K+G S+ QY+GL+PVE MQ  P         + +A K R ++
Sbjct  4     VAGAACSSNVLFRSRDVGKHGVSMAQYNGLRPVENMQIAPTGSKPSGSVSTSASKLRTVR  63

Query  283   CMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDF  462
              M+S AVSAPKR+ DPKKRVVITGMGLVSVFGSD++TFYN LLEG SGISLIDRFDAS F
Sbjct  64    AMVSQAVSAPKREKDPKKRVVITGMGLVSVFGSDIDTFYNKLLEGESGISLIDRFDASSF  123

Query  463   SVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRiga  642
              VRFAGQI  F+S+GYID KNDRRLD  WRYCLVAGK+AL DANLG EVL NMD+TRIG 
Sbjct  124   PVRFAGQIRDFSSKGYIDGKNDRRLDDCWRYCLVAGKRALVDANLGSEVLENMDRTRIGV  183

Query  643   vigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTA  822
             ++G+G GGL  F NGV +LVQ GYKKI+PFFIPYSITNMGSALLAI+ GLMGP YSISTA
Sbjct  184   LVGTGMGGLTAFSNGVESLVQKGYKKISPFFIPYSITNMGSALLAIDTGLMGPNYSISTA  243

Query  823   CATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPW  1002
             CATANYCFY++ANHIR+GEADIM+AGGTEA +  TGV GFIACRALSQRN +P++ASRPW
Sbjct  244   CATANYCFYASANHIRRGEADIMVAGGTEAAVMPTGVSGFIACRALSQRNEDPKKASRPW  303

Query  1003  DKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSC  1182
             DKDRDGFV+GEG GVL+ME L+HAMKRGAN+IAEYLGGA TCDAHHMT+PR+DGLGVS+C
Sbjct  304   DKDRDGFVMGEGSGVLIMESLEHAMKRGANIIAEYLGGAATCDAHHMTDPRSDGLGVSTC  363

Query  1183  ITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLG  1362
             I KSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLG
Sbjct  364   IAKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHGLG  423

Query  1363  ASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHN  1542
             A+GGLEAIATIKAI+TGWLHPTINQ N+E +VTIDTVPNVKKQH+VNVAISNSFGFGGHN
Sbjct  424   AAGGLEAIATIKAISTGWLHPTINQDNIELDVTIDTVPNVKKQHEVNVAISNSFGFGGHN  483

Query  1543  SVIVFGPFKP  1572
             SV+VF PF P
Sbjct  484   SVVVFAPFTP  493



>ref|XP_007040574.1| 3-ketoacyl-acyl carrier protein synthase I [Theobroma cacao]
 gb|EOY25075.1| 3-ketoacyl-acyl carrier protein synthase I [Theobroma cacao]
Length=494

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/493 (77%), Positives = 433/493 (88%), Gaps = 8/493 (2%)
 Frame = +1

Query  112   MASIAPSSGLIFKSKE-SSKNGASLLQYSGLKPVETMQ-----NQPDSVAYKAQAAKKCR  273
             +A+ A  SGL+F+++E  S NGASL QY+GL+ VE++Q      +P+   + + +A K R
Sbjct  4     IATAACPSGLLFRNREVGSNNGASLAQYNGLRAVESVQLALTCTKPNR--FISSSAPKGR  61

Query  274   RIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDA  453
              I+ + SP VSAPKR+ DPKKR+VITGMGLVSVFGSD++ FYN LLEG SGIS IDRFDA
Sbjct  62    TIRAVASPTVSAPKREKDPKKRIVITGMGLVSVFGSDIDNFYNKLLEGESGISEIDRFDA  121

Query  454   SDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTR  633
             S +SVRF GQI  F+S+GYID KNDRRLD  WRYCLVAGK+AL DANLG +VL  MD+TR
Sbjct  122   STYSVRFGGQIRDFSSKGYIDGKNDRRLDDCWRYCLVAGKRALEDANLGSQVLEKMDRTR  181

Query  634   igavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSI  813
             +G ++G+G GGL VF NGV  L+Q GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSI
Sbjct  182   VGVLVGTGMGGLTVFSNGVEALIQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSI  241

Query  814   STACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERAS  993
             STACATANYCFY+AANHIR+GEADIM+AGGTEA I  TG+GGFIACRALSQRN+EP++AS
Sbjct  242   STACATANYCFYAAANHIRRGEADIMVAGGTEAAIIPTGIGGFIACRALSQRNNEPKKAS  301

Query  994   RPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGV  1173
             RPWDKDRDGFV+GEG GVL+ME L+HAMKRGAN+IAEYLGGA TCDAHHMT+PR+DGLGV
Sbjct  302   RPWDKDRDGFVMGEGSGVLIMESLEHAMKRGANIIAEYLGGAVTCDAHHMTDPRSDGLGV  361

Query  1174  SSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGH  1353
             SSCITKSL+DAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGH
Sbjct  362   SSCITKSLDDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGH  421

Query  1354  GLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFG  1533
             GLGA+GGLEAIATIKAITTGWLHPTINQ NLEP+VTIDTVPNVKKQH+VNV ISNSFGFG
Sbjct  422   GLGAAGGLEAIATIKAITTGWLHPTINQDNLEPDVTIDTVPNVKKQHEVNVGISNSFGFG  481

Query  1534  GHNSVIVFGPFKP  1572
             GHNSV+VF PFKP
Sbjct  482   GHNSVVVFAPFKP  494



>ref|XP_004245499.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Solanum lycopersicum]
Length=485

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/487 (75%), Positives = 426/487 (87%), Gaps = 2/487 (0%)
 Frame = +1

Query  112   MASIAPSSGLIFKSKESSKNGASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMI  291
             M+SI  S+ LI K +ES  NG S LQY+GL+ +ET++   +S + K +A K C RI+ M 
Sbjct  1     MSSITYSN-LILKRRESRINGGSHLQYNGLRAIETVKLTANSASCKPKAVK-CGRIRAMA  58

Query  292   SPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVR  471
             SPAVSAPKR++DPKKRVVITGMGLVSVFGSD++ FYN LLEG+SGISLID FDAS + VR
Sbjct  59    SPAVSAPKRETDPKKRVVITGMGLVSVFGSDIDNFYNKLLEGQSGISLIDSFDASSYPVR  118

Query  472   FAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavig  651
             FAGQI  F+SEGYID KNDRRLD+ WRYCLVAGK+AL+DANLG++VL  MDKTRIG ++G
Sbjct  119   FAGQIRDFSSEGYIDGKNDRRLDNCWRYCLVAGKRALDDANLGQQVLETMDKTRIGVLVG  178

Query  652   sgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACAT  831
             SG GGL VF +GV  L+Q GYKK++PFFIPYSITNMGSALLAIE GLMGP YSISTACA+
Sbjct  179   SGMGGLNVFSDGVEALLQRGYKKVSPFFIPYSITNMGSALLAIETGLMGPNYSISTACAS  238

Query  832   ANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKD  1011
             AN+ F +AANHIR+G+ADIM+ GGTEAG+T TGVGGFIACRALSQRN + E+ASRPWD +
Sbjct  239   ANHSFCAAANHIRRGDADIMVTGGTEAGVTATGVGGFIACRALSQRNDDYEKASRPWDTN  298

Query  1012  RDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITK  1191
             RDGFV+GEG G+LVME L+HA+KRGA++IAEYLGGA TCDAHHMT+PR DGLGV SCITK
Sbjct  299   RDGFVVGEGSGILVMESLEHALKRGASIIAEYLGGAATCDAHHMTDPRPDGLGVWSCITK  358

Query  1192  SLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASG  1371
              L DA +SPEEVNYINAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLGA+G
Sbjct  359   GLLDARISPEEVNYINAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHGLGAAG  418

Query  1372  GLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVI  1551
             G+EAI TIKAITTGWLHPTINQ+ LEP+VTIDTVPNVKKQH+VNV ISNSFGFGGHNSV+
Sbjct  419   GIEAIVTIKAITTGWLHPTINQHELEPQVTIDTVPNVKKQHEVNVGISNSFGFGGHNSVV  478

Query  1552  VFGPFKP  1572
             VF P++P
Sbjct  479   VFAPYRP  485



>ref|XP_002303661.2| hypothetical protein POPTR_0003s14190g [Populus trichocarpa]
 gb|EEE78640.2| hypothetical protein POPTR_0003s14190g [Populus trichocarpa]
Length=493

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/490 (77%), Positives = 423/490 (86%), Gaps = 3/490 (1%)
 Frame = +1

Query  112   MASIAPSSGLIFKSKESSKNGASLLQYSGLKPVETMQNQPDSVAYKAQA---AKKCRRIK  282
             +A  A SS ++F+S+E   +GAS+  Y+GL+PV  MQ  P            A K R ++
Sbjct  4     VAGAACSSNVLFRSREVGNHGASMAPYNGLRPVVNMQMAPTGSKPSGSVSTPASKLRTVR  63

Query  283   CMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDF  462
              M+S  VSAPKR+ DPKKRVVITGMGLVSVFGSD++TFYN LLEG SGISLIDRFDAS F
Sbjct  64    AMVSQTVSAPKREKDPKKRVVITGMGLVSVFGSDIDTFYNKLLEGESGISLIDRFDASSF  123

Query  463   SVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRiga  642
             SVRFAGQI  F+S+GYID KNDRRLD  WRYCLVAGK+AL DANLG E+L NMD+TRIG 
Sbjct  124   SVRFAGQIRDFSSKGYIDGKNDRRLDDCWRYCLVAGKRALVDANLGSELLENMDRTRIGV  183

Query  643   vigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTA  822
             ++G+G GGL  F NGV +LVQ GYKKI+PFFIPYSITNMGSALLAI+ GLMGP YSISTA
Sbjct  184   LVGTGMGGLTAFSNGVESLVQKGYKKISPFFIPYSITNMGSALLAIDTGLMGPNYSISTA  243

Query  823   CATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPW  1002
             CATANYCFY+AANHIR+GEADIM+AGGTEA +  TGVGGFIACRALSQRN +P++ASRPW
Sbjct  244   CATANYCFYAAANHIRRGEADIMVAGGTEAAVMPTGVGGFIACRALSQRNEDPKKASRPW  303

Query  1003  DKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSC  1182
             DKDRDGFV+GEG GVL+ME L+HAMKRGAN+IAEYLGGA TCDAHHMT PR+DGLGVS+C
Sbjct  304   DKDRDGFVMGEGSGVLIMESLEHAMKRGANIIAEYLGGAATCDAHHMTNPRSDGLGVSTC  363

Query  1183  ITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLG  1362
             I KSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLG
Sbjct  364   IAKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHGLG  423

Query  1363  ASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHN  1542
             A+GGLEAIATIKAI TGWLHPTINQ N+E +VTIDTVPNVKKQH+VNVAISNSFGFGGHN
Sbjct  424   AAGGLEAIATIKAINTGWLHPTINQDNIELDVTIDTVPNVKKQHEVNVAISNSFGFGGHN  483

Query  1543  SVIVFGPFKP  1572
             SV+VF PF P
Sbjct  484   SVVVFAPFTP  493



>ref|XP_009590113.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=481

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/481 (78%), Positives = 425/481 (88%), Gaps = 8/481 (2%)
 Frame = +1

Query  130   SSGLIFKSKESSKNGASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSA  309
             SS LI K +ES   G  L QY+GL+ +E+MQ   +S ++K +A K C RIK M     SA
Sbjct  9     SSALILKQRES---GTYLFQYNGLRAIESMQMPVESNSWKPKAVK-CGRIKAM----ASA  60

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             PKR+ DPKKR+VI+GMGLVSVFGSD++ FYN LLEG+SGI+LIDRFDAS++SVRFAGQI 
Sbjct  61    PKREKDPKKRIVISGMGLVSVFGSDIDNFYNKLLEGQSGITLIDRFDASNYSVRFAGQIR  120

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfggl  669
              F+S GYID KNDRRLD  WRYCLVAGKKALNDANLG+EVL  MDKTRIG ++G+G GGL
Sbjct  121   DFSSVGYIDGKNDRRLDDCWRYCLVAGKKALNDANLGQEVLETMDKTRIGVLVGTGMGGL  180

Query  670   gvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFY  849
               F +GV +LVQ GYKKI+PFFIPYSITNMGSALLAI+ GLMGP YSISTACATANYCFY
Sbjct  181   TAFSSGVESLVQKGYKKISPFFIPYSITNMGSALLAIDTGLMGPNYSISTACATANYCFY  240

Query  850   SAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVI  1029
             +AANHIR+GEADI++AGGTEA I  TGVGGFIACRALSQRN EP +ASRPWDK+RDGFV+
Sbjct  241   AAANHIRRGEADIIVAGGTEAAIMPTGVGGFIACRALSQRNDEPHKASRPWDKNRDGFVM  300

Query  1030  GEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAG  1209
             GEG GVLVME L+HA+KRGAN+IAEYLGGA TCDAHHMT+PR+DGLGVSSCITKSLED+G
Sbjct  301   GEGSGVLVMESLEHALKRGANIIAEYLGGAVTCDAHHMTDPRSDGLGVSSCITKSLEDSG  360

Query  1210  VSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIA  1389
             VSPEEVNYINAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLGA+GGLEAIA
Sbjct  361   VSPEEVNYINAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHGLGAAGGLEAIA  420

Query  1390  TIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             TIKAITTGWLHPTINQY+LEP+VTIDTVPNVKKQH+VNV ISNSFGFGGHNSV+VF P+ 
Sbjct  421   TIKAITTGWLHPTINQYDLEPQVTIDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAPYN  480

Query  1570  P  1572
             P
Sbjct  481   P  481



>gb|AIQ82743.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82744.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/478 (78%), Positives = 420/478 (88%), Gaps = 1/478 (0%)
 Frame = +1

Query  139   LIFKSKESSKNGASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKR  318
             LI K KES  NG   LQY+  K +ET+Q    SVAYK +A K C R++ M SPAVSAPKR
Sbjct  12    LILKKKESRINGGFNLQYNEPKAIETVQMPASSVAYKPKAVK-CGRVRAMASPAVSAPKR  70

Query  319   QSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFT  498
              +DPKKR+VITGMGLVSVFGSD++ FYN LLEG+SGI+LIDRFDAS ++VRFAGQI  F+
Sbjct  71    ATDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGQSGITLIDRFDASSYAVRFAGQIRDFS  130

Query  499   SEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvf  678
             SEGYID KNDRRLD  W+YCLVAGK+AL DANLG++VL+ MDKTRIG ++GSG GG  VF
Sbjct  131   SEGYIDGKNDRRLDDCWKYCLVAGKRALEDANLGQQVLDTMDKTRIGVLVGSGMGGSKVF  190

Query  679   gngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAA  858
              + V  LVQ GYKKI+PFF+PY+ITNMGSALLAI  GLMGP YSISTACATANYCFY+AA
Sbjct  191   TDAVEALVQRGYKKISPFFVPYTITNMGSALLAINTGLMGPCYSISTACATANYCFYAAA  250

Query  859   NHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEG  1038
             NHIR+GEADIM+AGGTEA I+  GVGGFIACRALSQRN E E+ASRPWDK+RDGFVIGEG
Sbjct  251   NHIRRGEADIMVAGGTEAFISAIGVGGFIACRALSQRNDEYEKASRPWDKNRDGFVIGEG  310

Query  1039  CGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSP  1218
              GVLVME L+HA+KRGA +IAEYLGGA TCDAHHMT+PR DGLGVSSC+ KSL DAGVSP
Sbjct  311   SGVLVMESLEHALKRGAPIIAEYLGGAVTCDAHHMTDPRADGLGVSSCMVKSLVDAGVSP  370

Query  1219  EEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIK  1398
             EEVNYINAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLGA+GGLEAIATIK
Sbjct  371   EEVNYINAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIK  430

Query  1399  AITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             AITTGWLHPTINQ++LEP+VTIDTVPNVKKQH+VNV ISNSFGFGGHNSV+VF P+KP
Sbjct  431   AITTGWLHPTINQHDLEPQVTIDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAPYKP  488



>gb|AIQ82742.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/478 (78%), Positives = 420/478 (88%), Gaps = 1/478 (0%)
 Frame = +1

Query  139   LIFKSKESSKNGASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKR  318
             LI K KES  NG   LQY+  K +ET+Q    SVAYK +A K C R++ M SPAVSAPKR
Sbjct  12    LILKKKESRINGGFNLQYNEPKAIETVQMPASSVAYKPKAVK-CVRVRAMASPAVSAPKR  70

Query  319   QSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFT  498
              +DPKKR+VITGMGLVSVFGSD++ FYN LLEG+SGI+LIDRFDAS ++VRFAGQI  F+
Sbjct  71    ATDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGQSGITLIDRFDASSYAVRFAGQIRDFS  130

Query  499   SEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvf  678
             SEGYID KNDRRLD  W+YCLVAGK+AL DANLG++VL+ MDKTRIG ++GSG GG  VF
Sbjct  131   SEGYIDGKNDRRLDDCWKYCLVAGKRALEDANLGQQVLDTMDKTRIGVLVGSGMGGSKVF  190

Query  679   gngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAA  858
              + V  LVQ GYKKI+PFF+PY+ITNMGSALLAI  GLMGP YSISTACATANYCFY+AA
Sbjct  191   TDAVEALVQRGYKKISPFFVPYTITNMGSALLAINTGLMGPCYSISTACATANYCFYAAA  250

Query  859   NHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEG  1038
             NHIR+GEADIM+AGGTEA I+  GVGGFIACRALSQRN E E+ASRPWDK+RDGFVIGEG
Sbjct  251   NHIRRGEADIMVAGGTEAFISAIGVGGFIACRALSQRNDEYEKASRPWDKNRDGFVIGEG  310

Query  1039  CGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSP  1218
              GVLVME L+HA+KRG+ +IAEYLGGA TCDAHHMT+PR DGLGVSSC+ KSL DAGVSP
Sbjct  311   SGVLVMESLEHALKRGSPIIAEYLGGAVTCDAHHMTDPRADGLGVSSCMVKSLVDAGVSP  370

Query  1219  EEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIK  1398
             EEVNYINAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLGA+GGLEAIATIK
Sbjct  371   EEVNYINAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIK  430

Query  1399  AITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             AITTGWLHPTINQ++LEP+VTIDTVPNVKKQH+VNV ISNSFGFGGHNSV+VF P+KP
Sbjct  431   AITTGWLHPTINQHDLEPQVTIDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAPYKP  488



>gb|AIQ82734.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82735.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82736.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82737.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82738.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82739.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82740.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82741.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82749.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/478 (78%), Positives = 420/478 (88%), Gaps = 1/478 (0%)
 Frame = +1

Query  139   LIFKSKESSKNGASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKR  318
             LI K KES  NG   LQY+  K +ET+Q    SVAYK +A K C R++ M SPAVSAPKR
Sbjct  12    LILKKKESRINGGFNLQYNEPKAIETVQMPASSVAYKPKAVK-CGRVRAMASPAVSAPKR  70

Query  319   QSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFT  498
              +DPKKR+VITGMGLVSVFGSD++ FYN LLEG+SGI+LIDRFDAS ++VRFAGQI  F+
Sbjct  71    ATDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGQSGITLIDRFDASSYAVRFAGQIRDFS  130

Query  499   SEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvf  678
             SEGYID KNDRRLD  W+YCLVAGK+AL DANLG++VL+ MDKTRIG ++GSG GG  VF
Sbjct  131   SEGYIDGKNDRRLDDCWKYCLVAGKRALEDANLGQQVLDTMDKTRIGVLVGSGMGGSKVF  190

Query  679   gngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAA  858
              + V  LVQ GYKKI+PFF+PY+ITNMGSALLAI  GLMGP YSISTACATANYCFY+AA
Sbjct  191   TDAVEALVQRGYKKISPFFVPYTITNMGSALLAINTGLMGPCYSISTACATANYCFYAAA  250

Query  859   NHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEG  1038
             NHIR+GEADIM+AGGTEA I+  GVGGFIACRALSQRN E E+ASRPWDK+RDGFVIGEG
Sbjct  251   NHIRRGEADIMVAGGTEAFISAIGVGGFIACRALSQRNDEYEKASRPWDKNRDGFVIGEG  310

Query  1039  CGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSP  1218
              GVLVME L+HA+KRG+ +IAEYLGGA TCDAHHMT+PR DGLGVSSC+ KSL DAGVSP
Sbjct  311   SGVLVMESLEHALKRGSPIIAEYLGGAVTCDAHHMTDPRADGLGVSSCMVKSLVDAGVSP  370

Query  1219  EEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIK  1398
             EEVNYINAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLGA+GGLEAIATIK
Sbjct  371   EEVNYINAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIK  430

Query  1399  AITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             AITTGWLHPTINQ++LEP+VTIDTVPNVKKQH+VNV ISNSFGFGGHNSV+VF P+KP
Sbjct  431   AITTGWLHPTINQHDLEPQVTIDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAPYKP  488



>ref|XP_002518849.1| 3-oxoacyl-[acyl-carrier-protein] synthase, putative [Ricinus 
communis]
 gb|EEF43382.1| 3-oxoacyl-[acyl-carrier-protein] synthase, putative [Ricinus 
communis]
Length=485

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/489 (77%), Positives = 424/489 (87%), Gaps = 8/489 (2%)
 Frame = +1

Query  112   MASIAPSSGLIFKSKESSKNGASLLQYSGLKPVETMQ---NQPDSVAYKAQAAKKCRRIK  282
             MASIA   G    +    KNGASL Q++GL+PVE MQ    +P    +    A K   IK
Sbjct  1     MASIA---GTCSSNVLCMKNGASLGQFNGLRPVENMQMAATKPTGFLF--TLAPKSGIIK  55

Query  283   CMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDF  462
              M SP +SAPKR+ DPKKRVVITGMGLVSVFGSD++TFYN LLEG SGISLIDRFDAS F
Sbjct  56    AMASPNISAPKRERDPKKRVVITGMGLVSVFGSDIDTFYNKLLEGESGISLIDRFDASGF  115

Query  463   SVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRiga  642
             SVRFAGQI  F+S+GYID KNDRRLD  WRYCLVAGK+AL+DANLG +VL +MD+T+IG 
Sbjct  116   SVRFAGQIRDFSSKGYIDGKNDRRLDDCWRYCLVAGKRALDDANLGSQVLEDMDRTKIGV  175

Query  643   vigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTA  822
             +IG+G GGL  F NGV  LVQ GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSISTA
Sbjct  176   LIGTGMGGLTAFSNGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSISTA  235

Query  823   CATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPW  1002
             CATANYCFY+AANHIR+GEADIM+ GGTEA +  TGVGGFIACRALSQRN +P+RASRPW
Sbjct  236   CATANYCFYAAANHIRRGEADIMVVGGTEAAVMPTGVGGFIACRALSQRNEDPKRASRPW  295

Query  1003  DKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSC  1182
             DK+RDGFV+GEG GVL+ME LDHAMKRGAN+IAEYLGGA TCDAHHMT+PR+DGLGVS+C
Sbjct  296   DKNRDGFVMGEGAGVLIMESLDHAMKRGANIIAEYLGGAVTCDAHHMTDPRSDGLGVSTC  355

Query  1183  ITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLG  1362
             I++SLEDA VSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMNGTKS+IGHGLG
Sbjct  356   ISRSLEDAKVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSEMKMNGTKSMIGHGLG  415

Query  1363  ASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHN  1542
             A+GGLEAIATIKAITTGWLHPTINQ NLEP+VTIDTVPNVKKQH+VNVAISNSFGFGGHN
Sbjct  416   AAGGLEAIATIKAITTGWLHPTINQDNLEPDVTIDTVPNVKKQHEVNVAISNSFGFGGHN  475

Query  1543  SVIVFGPFK  1569
             SV+VF PF+
Sbjct  476   SVVVFAPFR  484



>gb|AIQ82747.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/478 (78%), Positives = 419/478 (88%), Gaps = 1/478 (0%)
 Frame = +1

Query  139   LIFKSKESSKNGASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKR  318
             LI K KES  NG   LQY+  K +ET+Q    SVAYK +A K C R++ M SPAVSAPKR
Sbjct  12    LILKKKESRINGGFNLQYNEPKAIETVQMPASSVAYKPKAVK-CERVRAMASPAVSAPKR  70

Query  319   QSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFT  498
              +DPKKR+VITGMGLVSVFGSD++ FYN LLEG+SGI+LIDRFDAS ++VRFAGQI  F+
Sbjct  71    ATDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGQSGITLIDRFDASSYAVRFAGQIRDFS  130

Query  499   SEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvf  678
             SEGYID KNDR LD  W+YCLVAGK+AL DANLG++VL+ MDKTRIG ++GSG GG  VF
Sbjct  131   SEGYIDGKNDRHLDDCWKYCLVAGKRALEDANLGQQVLDTMDKTRIGVLVGSGMGGSKVF  190

Query  679   gngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAA  858
              + V  LVQ GYKKI+PFF+PY+ITNMGSALLAI  GLMGP YSISTACATANYCFY+AA
Sbjct  191   TDAVEALVQRGYKKISPFFVPYTITNMGSALLAINTGLMGPCYSISTACATANYCFYAAA  250

Query  859   NHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEG  1038
             NHIR+GEADIM+AGGTEA I+  GVGGFIACRALSQRN E E+ASRPWDK+RDGFVIGEG
Sbjct  251   NHIRRGEADIMVAGGTEAFISAIGVGGFIACRALSQRNDEYEKASRPWDKNRDGFVIGEG  310

Query  1039  CGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSP  1218
              GVLVME L+HA+KRG+ +IAEYLGGA TCDAHHMT+PR DGLGVSSC+ KSL DAGVSP
Sbjct  311   SGVLVMESLEHALKRGSPIIAEYLGGAVTCDAHHMTDPRADGLGVSSCMVKSLVDAGVSP  370

Query  1219  EEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIK  1398
             EEVNYINAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLGA+GGLEAIATIK
Sbjct  371   EEVNYINAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIK  430

Query  1399  AITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             AITTGWLHPTINQ++LEP+VTIDTVPNVKKQH+VNV ISNSFGFGGHNSV+VF P+KP
Sbjct  431   AITTGWLHPTINQHDLEPQVTIDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAPYKP  488



>gb|AIQ82746.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/478 (78%), Positives = 419/478 (88%), Gaps = 1/478 (0%)
 Frame = +1

Query  139   LIFKSKESSKNGASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKR  318
             LI K KES  NG   LQY+  K +ET+Q    SVAYK +A K C R++ M SPAVSAPKR
Sbjct  12    LILKKKESRINGGFNLQYNEPKAIETVQMPASSVAYKPKAVK-CGRVRAMASPAVSAPKR  70

Query  319   QSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFT  498
              +DPKKR+VITGMGLVSVFGSD++ FYN LLEG+SGI+LIDRFDAS ++VRFAGQI  F+
Sbjct  71    ATDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGQSGITLIDRFDASSYAVRFAGQIRDFS  130

Query  499   SEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvf  678
             SEGYID KNDRRLD  W+YCLVAGK+AL DANLG++VL+ MDKTRIG ++GSG GG  VF
Sbjct  131   SEGYIDGKNDRRLDDCWKYCLVAGKRALEDANLGQQVLDTMDKTRIGVLVGSGMGGSKVF  190

Query  679   gngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAA  858
              + V  LVQ GYKKI+PFF+PY+ITNMGS LLAI  GLMGP YSISTACATANYCFY+AA
Sbjct  191   TDAVEALVQRGYKKISPFFVPYTITNMGSTLLAINTGLMGPCYSISTACATANYCFYAAA  250

Query  859   NHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEG  1038
             NHIR+GEADIM+AGGTEA I+  GVGGFIACRALSQRN E E+ASRPWDK+RDGFVIGEG
Sbjct  251   NHIRRGEADIMVAGGTEAFISAIGVGGFIACRALSQRNDEYEKASRPWDKNRDGFVIGEG  310

Query  1039  CGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSP  1218
              GVLVME L+HA+KRG+ +IAEYLGGA TCDAHHMT+PR DGLGVSSC+ KSL DAGVSP
Sbjct  311   SGVLVMESLEHALKRGSPIIAEYLGGAVTCDAHHMTDPRADGLGVSSCMVKSLVDAGVSP  370

Query  1219  EEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIK  1398
             EEVNYINAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLGA+GGLEAIATIK
Sbjct  371   EEVNYINAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIK  430

Query  1399  AITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             AITTGWLHPTINQ++LEP+VTIDTVPNVKKQH+VNV ISNSFGFGGHNSV+VF P+KP
Sbjct  431   AITTGWLHPTINQHDLEPQVTIDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAPYKP  488



>gb|AIQ82745.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82748.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82750.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82751.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82752.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
 gb|AIQ82753.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/478 (78%), Positives = 419/478 (88%), Gaps = 1/478 (0%)
 Frame = +1

Query  139   LIFKSKESSKNGASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKR  318
             LI K KES  NG   LQY+  K +ET+Q    SVAYK +A K C R++ M SPAVSAPKR
Sbjct  12    LILKKKESRINGGFNLQYNEPKAIETVQMPASSVAYKPKAVK-CGRVRAMASPAVSAPKR  70

Query  319   QSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFT  498
              +DPKKR+VITGMGLVSVFGSD++ FYN LLEG+SGI+LIDRFDAS ++VRFAGQI  F+
Sbjct  71    ATDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGQSGITLIDRFDASSYAVRFAGQIRDFS  130

Query  499   SEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvf  678
             SEGYID KNDR LD  W+YCLVAGK+AL DANLG++VL+ MDKTRIG ++GSG GG  VF
Sbjct  131   SEGYIDGKNDRHLDDCWKYCLVAGKRALEDANLGQQVLDTMDKTRIGVLVGSGMGGSKVF  190

Query  679   gngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAA  858
              + V  LVQ GYKKI+PFF+PY+ITNMGSALLAI  GLMGP YSISTACATANYCFY+AA
Sbjct  191   TDAVEALVQRGYKKISPFFVPYTITNMGSALLAINTGLMGPCYSISTACATANYCFYAAA  250

Query  859   NHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEG  1038
             NHIR+GEADIM+AGGTEA I+  GVGGFIACRALSQRN E E+ASRPWDK+RDGFVIGEG
Sbjct  251   NHIRRGEADIMVAGGTEAFISAIGVGGFIACRALSQRNDEYEKASRPWDKNRDGFVIGEG  310

Query  1039  CGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSP  1218
              GVLVME L+HA+KRG+ +IAEYLGGA TCDAHHMT+PR DGLGVSSC+ KSL DAGVSP
Sbjct  311   SGVLVMESLEHALKRGSPIIAEYLGGAVTCDAHHMTDPRADGLGVSSCMVKSLVDAGVSP  370

Query  1219  EEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIK  1398
             EEVNYINAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLGA+GGLEAIATIK
Sbjct  371   EEVNYINAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIK  430

Query  1399  AITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             AITTGWLHPTINQ++LEP+VTIDTVPNVKKQH+VNV ISNSFGFGGHNSV+VF P+KP
Sbjct  431   AITTGWLHPTINQHDLEPQVTIDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAPYKP  488



>gb|KHG26930.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic -like 
protein [Gossypium arboreum]
Length=486

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/481 (76%), Positives = 419/481 (87%), Gaps = 5/481 (1%)
 Frame = +1

Query  130   SSGLIFKSKESSKNGASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSA  309
             SS L+ + +E+  NGASL QY+GLK V+TM          + +  KCR I+ M SP VSA
Sbjct  11    SSRLLLRDREAGSNGASLAQYNGLKAVDTMHLPSSGTPKLSCSGPKCRTIRAMASPTVSA  70

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             PKR++DPKKR+VITGMGLVSVFGSD++ FYN LLEG SGI+ ID+FDA+++SVRFAGQI 
Sbjct  71    PKRETDPKKRIVITGMGLVSVFGSDIDNFYNKLLEGESGITQIDKFDATNYSVRFAGQIR  130

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfggl  669
              F+S+GYID KNDRRLD  WRYCLVAG++AL++ANLG E L  +DKTRIG ++G+G GGL
Sbjct  131   DFSSKGYIDGKNDRRLDDCWRYCLVAGRRALDEANLGSEALEKLDKTRIGVLVGTGMGGL  190

Query  670   gvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFY  849
               F NGV  L+Q GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSISTACATANYCFY
Sbjct  191   TAFSNGVEALIQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSISTACATANYCFY  250

Query  850   SAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVI  1029
             +AANHIR+GEADIM+AGGTEA +  TG+GGFIACRALSQRN EP+RASRPWDKDRDGFV+
Sbjct  251   AAANHIRRGEADIMVAGGTEAAVMPTGIGGFIACRALSQRNDEPKRASRPWDKDRDGFVM  310

Query  1030  GEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAG  1209
             GEGCGVLVME LDHAM+RGAN+IAEYLGGA TCDAHHMT+PR+DGLGVSSCI+KSLEDAG
Sbjct  311   GEGCGVLVMESLDHAMQRGANIIAEYLGGAVTCDAHHMTDPRSDGLGVSSCISKSLEDAG  370

Query  1210  VSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIA  1389
                  VNY+NAHATST+AGD+ EVNAIK VFK+TSEIKMNGTKS+IGHGLGA+GGLEAIA
Sbjct  371   -----VNYVNAHATSTLAGDLAEVNAIKMVFKNTSEIKMNGTKSMIGHGLGAAGGLEAIA  425

Query  1390  TIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             T+KAITTGWLHPTINQ NLEPEVTIDTVPNVKKQH+VNVAISNSFGFGGHNSV+VF PFK
Sbjct  426   TVKAITTGWLHPTINQDNLEPEVTIDTVPNVKKQHEVNVAISNSFGFGGHNSVVVFAPFK  485

Query  1570  P  1572
             P
Sbjct  486   P  486



>ref|XP_002265207.2| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Vitis vinifera]
 emb|CBI34509.3| unnamed protein product [Vitis vinifera]
Length=488

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/484 (77%), Positives = 423/484 (87%), Gaps = 7/484 (1%)
 Frame = +1

Query  130   SSGLIFKSKESSKNGASLLQYSGLKPVETMQNQPDSV---AYKAQAAKKCRRIKCMISPA  300
             SSG+ F+ KES     SL QY GL+PVE+ +     V      +  A+KCR I+ + SP 
Sbjct  9     SSGVRFRGKES----GSLAQYHGLRPVESKKMASAMVRPSGSISSPARKCRTIRAVASPT  64

Query  301   VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAG  480
             VSAPKR+ DPKKR+VITGMGLVSVFGSD++TFY+ LL+G SGISLIDRFDAS+FSVRF G
Sbjct  65    VSAPKREKDPKKRIVITGMGLVSVFGSDIDTFYDKLLQGVSGISLIDRFDASNFSVRFGG  124

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgf  660
             QI  F+S+GYID KNDRRLD  WRYCLVAG++AL++A+LG EVL  MD++RIG ++GSG 
Sbjct  125   QIRDFSSKGYIDGKNDRRLDDCWRYCLVAGRRALDNASLGTEVLETMDRSRIGVLVGSGM  184

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GGL  F NGV  L+Q GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSISTACATANY
Sbjct  185   GGLTAFSNGVEALIQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSISTACATANY  244

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
             CFY+AANHIR+GEADIM+AGGTEA I  TGVGGFIACRALSQRN +P++ASRPWDKDRDG
Sbjct  245   CFYAAANHIRRGEADIMVAGGTEAAIMATGVGGFIACRALSQRNEDPQKASRPWDKDRDG  304

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVL+ME L+HAMKRGAN+IAEYLGGA TCDAHHMT+PR+DGLGVSSCI KSLE
Sbjct  305   FVMGEGSGVLIMESLEHAMKRGANIIAEYLGGAITCDAHHMTDPRSDGLGVSSCIAKSLE  364

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
             DAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLGA+GGLE
Sbjct  365   DAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHGLGAAGGLE  424

Query  1381  AIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFG  1560
             AIATIKAITTGW+HPTINQYNLEP+VTIDTVPNVKK+H+V+V ISNSFGFGGHNSV+VF 
Sbjct  425   AIATIKAITTGWIHPTINQYNLEPDVTIDTVPNVKKKHEVHVGISNSFGFGGHNSVVVFA  484

Query  1561  PFKP  1572
             PF P
Sbjct  485   PFNP  488



>gb|KDO76592.1| hypothetical protein CISIN_1g010896mg [Citrus sinensis]
Length=498

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/493 (76%), Positives = 416/493 (84%), Gaps = 8/493 (2%)
 Frame = +1

Query  118   SIAPSSGLIFKSKESSKNGA-SLLQYSGLKPVETMQNQPDSVAYKAQ-------AAKKCR  273
             S A + G++F +K+   NGA SL QYSGL+P E  Q     +    +       +  KCR
Sbjct  6     STASALGVVFGNKQVKSNGAASLAQYSGLRPAENFQFASAGITTTIKQSGLICSSGPKCR  65

Query  274   RIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDA  453
              I+ M SP  SAPKR+ DPKKR+VITGMGLVSVFGSD++ FYN LLEG SGIS IDRFDA
Sbjct  66    TIRVMASPTASAPKREKDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGESGISPIDRFDA  125

Query  454   SDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTR  633
             S FSVRF GQI  F+S+GYID KNDRRLD  WRYCLVAG++AL +A+L  +VL NMD+TR
Sbjct  126   SSFSVRFGGQIRDFSSKGYIDGKNDRRLDDCWRYCLVAGRRALEEASLSPQVLENMDRTR  185

Query  634   igavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSI  813
             IG V+GSG GGL  F  GV  L+Q GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSI
Sbjct  186   IGVVVGSGMGGLTSFTTGVEALIQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSI  245

Query  814   STACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERAS  993
             STACATANYCFY+AANHIR+GE DIM+AGGTEA I  TGVGGFIACRALSQRN  P+RAS
Sbjct  246   STACATANYCFYAAANHIRRGETDIMVAGGTEAAIIPTGVGGFIACRALSQRNEYPKRAS  305

Query  994   RPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGV  1173
             RPWDKDRDGFV+GEGCG+LVME L+HAMKRGAN+IAEYLGGA TCDAHHMT+PR+DGLGV
Sbjct  306   RPWDKDRDGFVMGEGCGILVMESLEHAMKRGANIIAEYLGGAVTCDAHHMTDPRSDGLGV  365

Query  1174  SSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGH  1353
             SSCI KSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMNGTKS+IGH
Sbjct  366   SSCIAKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSEMKMNGTKSMIGH  425

Query  1354  GLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFG  1533
             GLGA+GGLEAI TIKAITTGWLHPT+NQ NLEPEVTIDTVPNVKKQH VNVAISNSFGFG
Sbjct  426   GLGAAGGLEAITTIKAITTGWLHPTLNQDNLEPEVTIDTVPNVKKQHHVNVAISNSFGFG  485

Query  1534  GHNSVIVFGPFKP  1572
             GHNSV+VF PF P
Sbjct  486   GHNSVVVFAPFSP  498



>ref|XP_009341875.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Pyrus x bretschneideri]
Length=493

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/493 (76%), Positives = 423/493 (86%), Gaps = 6/493 (1%)
 Frame = +1

Query  112   MASIAP--SSGLIFKSKESSK-NGASLLQYSGLKPVETMQ---NQPDSVAYKAQAAKKCR  273
             MA IA   SSG++F+S+E+   NGAS+ Q+ GL+ VETM    N   S      +A KCR
Sbjct  1     MAGIAGPCSSGVLFRSREAGGINGASMAQFDGLRQVETMHMPVNGNKSNGLGFTSAPKCR  60

Query  274   RIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDA  453
              IK M S  VSAPKR++DPKKR VITGMGLVSVFGSD++TFYN LLEG SGI+LIDRFDA
Sbjct  61    IIKAMASLTVSAPKRETDPKKRTVITGMGLVSVFGSDIDTFYNKLLEGESGITLIDRFDA  120

Query  454   SDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTR  633
             S FSVRFAGQIH F+S+GYID KNDRRLD  WRY +VAGKKAL DANLG EVL  MD+TR
Sbjct  121   STFSVRFAGQIHAFSSKGYIDGKNDRRLDDCWRYGIVAGKKALEDANLGPEVLQTMDRTR  180

Query  634   igavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSI  813
             IG ++G+G GGL  F  GV +L+Q GYKKI+PFFIPYSITNMGSALLAI+ GLMGP YSI
Sbjct  181   IGVIVGTGMGGLTAFSAGVESLIQKGYKKISPFFIPYSITNMGSALLAIDTGLMGPNYSI  240

Query  814   STACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERAS  993
             STACATANYCFY+AANHIR+GEADIM+ GGTEA +  TGVGGFIACRALSQRN EP RAS
Sbjct  241   STACATANYCFYAAANHIRRGEADIMVVGGTEAAVMPTGVGGFIACRALSQRNDEPHRAS  300

Query  994   RPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGV  1173
             RPWDK+RDGFV+GEG GVLVME L+ A+KRGA +IAEYLGGA TCDAHHMT+PR+DGLGV
Sbjct  301   RPWDKNRDGFVMGEGAGVLVMESLESALKRGAPIIAEYLGGAVTCDAHHMTDPRSDGLGV  360

Query  1174  SSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGH  1353
             SSCITKSLEDAGVSPEEVNY+NAHATST+AGD+ E NAIKKVFKDTSE+K+NGTKS+IGH
Sbjct  361   SSCITKSLEDAGVSPEEVNYVNAHATSTLAGDLAEFNAIKKVFKDTSEMKINGTKSMIGH  420

Query  1354  GLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFG  1533
             GLGA+GGLEAIATIKAI TGWLHPTINQ +LEP VTIDTVPNVKKQH+VNVAISNSFGFG
Sbjct  421   GLGAAGGLEAIATIKAINTGWLHPTINQDDLEPTVTIDTVPNVKKQHEVNVAISNSFGFG  480

Query  1534  GHNSVIVFGPFKP  1572
             GHNSV+VF PF P
Sbjct  481   GHNSVVVFAPFSP  493



>ref|XP_006476353.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Citrus sinensis]
Length=498

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/493 (75%), Positives = 416/493 (84%), Gaps = 8/493 (2%)
 Frame = +1

Query  118   SIAPSSGLIFKSKESSKNGA-SLLQYSGLKPVETMQNQPDSVAYKAQ-------AAKKCR  273
             S A + G++F +++   NGA SL QYSGL+P E  Q     +    +       +  KCR
Sbjct  6     STASALGVVFGNRQVKSNGAASLAQYSGLRPAENFQFASAGITTTIKQSGLICSSGPKCR  65

Query  274   RIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDA  453
              I+ M SP  SAPKR+ DPKKR+VITGMGLVSVFGSD++ FYN LLEG SGIS IDRFDA
Sbjct  66    TIRVMASPTASAPKREKDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGESGISPIDRFDA  125

Query  454   SDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTR  633
             S FSVRF GQI  F+S+GYID KNDRRLD  WRYCLVAG++AL +A+L  +VL NMD+TR
Sbjct  126   SSFSVRFGGQIRDFSSKGYIDGKNDRRLDDCWRYCLVAGRRALEEASLSPQVLENMDRTR  185

Query  634   igavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSI  813
             IG V+GSG GGL  F  GV  L+Q GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSI
Sbjct  186   IGVVVGSGMGGLTSFTTGVEALIQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSI  245

Query  814   STACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERAS  993
             STACATANYCFY+AANHIR+GE DIM+AGGTEA I  TGVGGFIACRALSQRN  P+RAS
Sbjct  246   STACATANYCFYAAANHIRRGETDIMVAGGTEAAIIPTGVGGFIACRALSQRNEYPKRAS  305

Query  994   RPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGV  1173
             RPWDKDRDGFV+GEGCG+LVME L+HAMKRGAN+IAEYLGGA TCDAHHMT+PR+DGLGV
Sbjct  306   RPWDKDRDGFVMGEGCGILVMESLEHAMKRGANIIAEYLGGAVTCDAHHMTDPRSDGLGV  365

Query  1174  SSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGH  1353
             SSCI KSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMNGTKS+IGH
Sbjct  366   SSCIAKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSEMKMNGTKSMIGH  425

Query  1354  GLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFG  1533
             GLGA+GGLEAI TIKAITTGWLHPT+NQ NLEPEVTIDTVPNVKKQH VNVAISNSFGFG
Sbjct  426   GLGAAGGLEAITTIKAITTGWLHPTLNQDNLEPEVTIDTVPNVKKQHHVNVAISNSFGFG  485

Query  1534  GHNSVIVFGPFKP  1572
             GHNSV+VF PF P
Sbjct  486   GHNSVVVFAPFSP  498



>gb|AGJ84410.1| beta-ketoacyl-ACP synthase I [Cocos nucifera]
Length=494

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/477 (75%), Positives = 412/477 (86%), Gaps = 7/477 (1%)
 Frame = +1

Query  163   SKNGASLLQYSGLKPVETMQNQPDSVA-------YKAQAAKKCRRIKCMISPAVSAPKRQ  321
             S+  + L +Y+GL+P+   +      A       + +  + K  RI+ + SP V+APKR+
Sbjct  18    SEASSPLKRYNGLRPLLGSKQMASFAAMRKPNGPFPSLPSLKSPRIRAVASPTVAAPKRE  77

Query  322   SDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTS  501
              DPKKR+V+TG+GLVSVFGSD++TFYN LLEG+SGISLIDRFDAS +SVRF GQI  F+S
Sbjct  78    KDPKKRIVVTGIGLVSVFGSDIDTFYNKLLEGQSGISLIDRFDASSYSVRFGGQIRDFSS  137

Query  502   EGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfg  681
             +GYID KNDRRLD  WRYCLVAGK+AL+DANLG EVL +MD++RIG ++G+G GGL  F 
Sbjct  138   KGYIDGKNDRRLDDCWRYCLVAGKRALDDANLGPEVLQSMDRSRIGVLVGTGMGGLTAFS  197

Query  682   ngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAAN  861
             NGV  L+Q GYKKITPFFIPYSITNMGSALLAIE GLMGP YSISTACATANYCFY+AAN
Sbjct  198   NGVEALIQKGYKKITPFFIPYSITNMGSALLAIETGLMGPNYSISTACATANYCFYAAAN  257

Query  862   HIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGC  1041
             HIR+GEADIM+AGGTEA I  TGVGGFIACRALSQRN EP++ASRPWDKDRDGFV+GEG 
Sbjct  258   HIRRGEADIMVAGGTEAAILPTGVGGFIACRALSQRNDEPQKASRPWDKDRDGFVMGEGS  317

Query  1042  GVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPE  1221
             GVL+ME L+HA KRGA +IAEYLGGA TCDAHHMT+PR+DGLGVSSCI KSLEDAGVSPE
Sbjct  318   GVLIMESLEHARKRGATIIAEYLGGAITCDAHHMTDPRSDGLGVSSCIVKSLEDAGVSPE  377

Query  1222  EVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKA  1401
             EVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMNGTKS+IGH LGA+GGLEAIATIKA
Sbjct  378   EVNYVNAHATSTLAGDLAEVNAIKKVFKDTSEMKMNGTKSMIGHCLGAAGGLEAIATIKA  437

Query  1402  ITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             ITTGWLHPTINQ NLEP+VT+DT+PNVKK+H+VNVAISNSFGFGGHNSV+VF PF P
Sbjct  438   ITTGWLHPTINQNNLEPDVTVDTIPNVKKKHEVNVAISNSFGFGGHNSVVVFAPFMP  494



>ref|XP_010915981.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Elaeis guineensis]
Length=493

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/476 (75%), Positives = 408/476 (86%), Gaps = 6/476 (1%)
 Frame = +1

Query  163   SKNGASLLQYSGLKPVETMQNQPDSVAYKAQAA------KKCRRIKCMISPAVSAPKRQS  324
             S+  + L QY+GL+P+   +        K   +       K  RI+ + SP V+APKR+ 
Sbjct  18    SEASSPLKQYNGLRPLLGSKQMASCAVRKPNGSFPSVPSLKSLRIRAVASPTVAAPKREK  77

Query  325   DPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSE  504
             DPKKR+V+TG+GLVSVFGSD++TFYN LLEG+SGISLIDRFDAS +SVRF GQI  F+S+
Sbjct  78    DPKKRIVVTGIGLVSVFGSDIDTFYNKLLEGQSGISLIDRFDASSYSVRFGGQIRDFSSK  137

Query  505   GYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgn  684
             GYID KNDRRLD  WRYCLVAGK+AL+DANLG EVL +MD++RIG ++GSG GGL  F N
Sbjct  138   GYIDGKNDRRLDDCWRYCLVAGKRALDDANLGPEVLQSMDRSRIGVLVGSGMGGLTAFSN  197

Query  685   gvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANH  864
             GV  L+Q GYKKITPFFIPYSITN GSALLAIE GLMGP YSISTACATANYCFY+AANH
Sbjct  198   GVEALIQKGYKKITPFFIPYSITNTGSALLAIETGLMGPNYSISTACATANYCFYAAANH  257

Query  865   IRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCG  1044
             IR+GEADIM+ GGTEA I  TGVGGFIACRALSQRN EP++ASRPWDKDRDGFV+GEG G
Sbjct  258   IRRGEADIMVVGGTEAAILPTGVGGFIACRALSQRNDEPQKASRPWDKDRDGFVMGEGSG  317

Query  1045  VLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEE  1224
             VL+ME L+HA KRGA +IAEYLGGA TCDAHHMT+PR+DGLGVSSCI KSLEDAGVSPEE
Sbjct  318   VLIMESLEHARKRGAAIIAEYLGGAITCDAHHMTDPRSDGLGVSSCIVKSLEDAGVSPEE  377

Query  1225  VNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAI  1404
             VNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMNGTKS+IGH LGA+GGLEAIATIKAI
Sbjct  378   VNYVNAHATSTLAGDLAEVNAIKKVFKDTSEMKMNGTKSMIGHCLGAAGGLEAIATIKAI  437

Query  1405  TTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             TTGWLHPTINQ NLEP+VTIDTVPNVKK+H+VNVAISNSFGFGGHNSV+VF PF P
Sbjct  438   TTGWLHPTINQNNLEPDVTIDTVPNVKKKHEVNVAISNSFGFGGHNSVVVFAPFMP  493



>ref|XP_009803233.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Nicotiana sylvestris]
Length=485

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/481 (77%), Positives = 422/481 (88%), Gaps = 5/481 (1%)
 Frame = +1

Query  130   SSGLIFKSKESSKNGASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSA  309
             SSGLI K +E    G SL QY+GL+ +E M+     +++K +A K C RI+ M     SA
Sbjct  10    SSGLILKQRELGIKGNSLFQYNGLRTIENMKMPVGFISWKPKAVK-CGRIRAM----ASA  64

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             PKR+ DPKKR+V+TGMGLVSVFGSD++ FYN+LLEG+SGI+LIDRFDAS++SVRFAGQI 
Sbjct  65    PKREKDPKKRIVVTGMGLVSVFGSDIDNFYNSLLEGQSGITLIDRFDASNYSVRFAGQIR  124

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfggl  669
              F+S  YID KNDRRLD  WRYCLVAGKKAL+DANLG+EVL  MDKTRIG ++G+G GGL
Sbjct  125   DFSSVDYIDGKNDRRLDDCWRYCLVAGKKALDDANLGQEVLEAMDKTRIGVLVGTGMGGL  184

Query  670   gvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFY  849
               F +GV +LVQ GYKKI+PFFIPYSITNMGSALLAI  GLMGP YSISTACATANYCFY
Sbjct  185   TAFSSGVESLVQKGYKKISPFFIPYSITNMGSALLAIGTGLMGPNYSISTACATANYCFY  244

Query  850   SAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVI  1029
             +AANHIR+GEADIM+AGGTEA I  TGVGGFIACRALSQRN EP +ASRPWDK+RDGFV+
Sbjct  245   AAANHIRRGEADIMVAGGTEAAIVPTGVGGFIACRALSQRNDEPHKASRPWDKNRDGFVM  304

Query  1030  GEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAG  1209
             GEG GVLVME L+HA+KRGAN+IAEYLGGA TCDAHHMT+PR+DGLGVSSCITKSLED+G
Sbjct  305   GEGSGVLVMESLEHALKRGANIIAEYLGGAVTCDAHHMTDPRSDGLGVSSCITKSLEDSG  364

Query  1210  VSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIA  1389
             +SPEEVNYINAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLGA+GGLEAIA
Sbjct  365   ISPEEVNYINAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHGLGAAGGLEAIA  424

Query  1390  TIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             TIKAITTGWLHPTINQ +LEP+VTIDTVPNVKKQH+VNV ISNSFGFGGHNSV+VF P+ 
Sbjct  425   TIKAITTGWLHPTINQDDLEPQVTIDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAPYN  484

Query  1570  P  1572
             P
Sbjct  485   P  485



>ref|XP_008341776.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Malus domestica]
Length=493

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/493 (76%), Positives = 422/493 (86%), Gaps = 6/493 (1%)
 Frame = +1

Query  112   MASIAP--SSGLIFKSKES-SKNGASLLQYSGLKPVETMQ---NQPDSVAYKAQAAKKCR  273
             MA IA   SSGL+F+S+E+ S NGAS+ Q+ GL+ VETM    N   S      +A KCR
Sbjct  1     MAGIAGPCSSGLLFRSREAGSINGASMAQFDGLRQVETMHMPVNGNKSNGLGFTSAPKCR  60

Query  274   RIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDA  453
              IK M S  VSAPKR++D KKR VITGMGLVSVFGSD++TFYN LLEG SGI+LIDRFDA
Sbjct  61    IIKAMASSTVSAPKRETDSKKRTVITGMGLVSVFGSDIDTFYNKLLEGESGITLIDRFDA  120

Query  454   SDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTR  633
             S FSVRFAGQI  F+S+GYID KNDRRLD  WRY +VAGKKAL DANLG EVL  MD+TR
Sbjct  121   STFSVRFAGQIRDFSSKGYIDGKNDRRLDDCWRYGIVAGKKALEDANLGPEVLQTMDRTR  180

Query  634   igavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSI  813
             IG ++G+G GGL  F  GV +L+Q GYKKI+PFFIPYSITNMGSALLAI+ GLMGP YSI
Sbjct  181   IGVIVGTGMGGLTAFSAGVESLIQKGYKKISPFFIPYSITNMGSALLAIDTGLMGPNYSI  240

Query  814   STACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERAS  993
             STACATANYCFY+AANHIR+GEADIM+ GGTEA +  TGVGGFIACRALSQRN EP RAS
Sbjct  241   STACATANYCFYAAANHIRRGEADIMVVGGTEAAVMPTGVGGFIACRALSQRNDEPHRAS  300

Query  994   RPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGV  1173
             RPWDK+RDGFV+GEG GVLVME L+ A+KRGA +IAEYLGGA TCDAHHMT+PR+DGLGV
Sbjct  301   RPWDKNRDGFVMGEGAGVLVMESLESALKRGAPIIAEYLGGAVTCDAHHMTDPRSDGLGV  360

Query  1174  SSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGH  1353
             SSCITKSLEDAGVSPEEVNY+NAHATST+AGD+ E NAIKKVFKDTSE+K+NGTKS+IGH
Sbjct  361   SSCITKSLEDAGVSPEEVNYVNAHATSTLAGDLAEFNAIKKVFKDTSEMKINGTKSMIGH  420

Query  1354  GLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFG  1533
             GLGA+GGLEAIATIKAI TGWLHPTINQ +LEP VTIDTVPNVKKQH+VNVAISNSFGFG
Sbjct  421   GLGAAGGLEAIATIKAINTGWLHPTINQDDLEPAVTIDTVPNVKKQHEVNVAISNSFGFG  480

Query  1534  GHNSVIVFGPFKP  1572
             GHNSV+VF PF P
Sbjct  481   GHNSVVVFAPFSP  493



>ref|XP_008783167.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Phoenix dactylifera]
Length=493

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/493 (73%), Positives = 411/493 (83%), Gaps = 9/493 (2%)
 Frame = +1

Query  121   IAPSSGLIFKSKESSKNGAS---LLQYSGLKPVETMQNQPDSVAYKAQAAK------KCR  273
             +A S+ ++   KE    G +   L QYSGL+P+   +        K   +       K R
Sbjct  1     MAASASMVVGGKELGVMGEASSPLKQYSGLRPLLGSKQMASCAVRKPNGSSPFPPSLKSR  60

Query  274   RIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDA  453
             RI+ + SP V+AP R+ DPKKR+V+TGMGLVSVFGSD +TFY+ LLEG+SGISLIDRFDA
Sbjct  61    RIRAVASPTVAAPTREKDPKKRIVVTGMGLVSVFGSDADTFYSKLLEGQSGISLIDRFDA  120

Query  454   SDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTR  633
             S +SVRF GQI  F+S+GYID KNDRRLD  WRYCLVAGK+AL+DANLG EVL +MD++R
Sbjct  121   SSYSVRFGGQIRDFSSKGYIDGKNDRRLDDCWRYCLVAGKRALDDANLGPEVLQSMDRSR  180

Query  634   igavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSI  813
             IG ++GSG GGL  F  GV  L+Q GY KITPFFIPYSITNMGSALLAI+ GLMGP YSI
Sbjct  181   IGVLVGSGMGGLTAFSKGVEALIQKGYNKITPFFIPYSITNMGSALLAIDTGLMGPNYSI  240

Query  814   STACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERAS  993
             STACATANYCFY+AANHIR+GEADIM+ GGTEA I  TGVGGFIACRALSQRN EPE+AS
Sbjct  241   STACATANYCFYAAANHIRRGEADIMVVGGTEAAILPTGVGGFIACRALSQRNDEPEKAS  300

Query  994   RPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGV  1173
             RPWD+ RDGFV+GEG GVL+ME L+HA KRGA ++AEYLGGA TCDAHHMT+PR+DGLGV
Sbjct  301   RPWDRSRDGFVMGEGSGVLIMESLEHARKRGATIVAEYLGGAITCDAHHMTDPRSDGLGV  360

Query  1174  SSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGH  1353
             SSCI KSLEDAGVS EEVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMNGTKS+IGH
Sbjct  361   SSCIVKSLEDAGVSTEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSEMKMNGTKSMIGH  420

Query  1354  GLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFG  1533
              LGA+GGLEAIATIKAITTGWLHPTINQ NLEP+VTIDTVPNVKK+H+VNVAISNSFGFG
Sbjct  421   CLGAAGGLEAIATIKAITTGWLHPTINQNNLEPDVTIDTVPNVKKKHEVNVAISNSFGFG  480

Query  1534  GHNSVIVFGPFKP  1572
             GHNSV+VF PF P
Sbjct  481   GHNSVVVFAPFMP  493



>gb|ADZ05697.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Capsicum annuum]
Length=488

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/478 (77%), Positives = 416/478 (87%), Gaps = 1/478 (0%)
 Frame = +1

Query  139   LIFKSKESSKNGASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKR  318
             LI K KES  NG   LQY+  K +ET+Q    SVAYK +A K C R++ M SPAVSAPKR
Sbjct  12    LILKKKESRINGGFNLQYNEPKAIETVQMPASSVAYKPKAVK-CGRVRAMASPAVSAPKR  70

Query  319   QSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFT  498
              +DPKKR+VITGMGLVSVFGSD++ FYN LLEG+ GI+LIDRFDAS ++VRFAGQI  F+
Sbjct  71    ATDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGQRGITLIDRFDASSYAVRFAGQIRDFS  130

Query  499   SEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvf  678
             SEGYID KNDR LD  W+YCLVAGK+AL DANLG++VL+ MDKTRIG ++GSG GG  VF
Sbjct  131   SEGYIDGKNDRHLDDCWKYCLVAGKRALEDANLGQQVLDTMDKTRIGVLVGSGMGGSKVF  190

Query  679   gngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAA  858
              + V  LVQ GYKKI+PFF+PY+ITNMGSALLAI  GLMGP YSISTACATANYCFY+AA
Sbjct  191   TDAVEALVQRGYKKISPFFVPYTITNMGSALLAINTGLMGPCYSISTACATANYCFYAAA  250

Query  859   NHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEG  1038
             NHIR+GEADIM+AGGTEA I+  GVGGFIACRALSQRN E E+ASRPWDK+RDGFVIGEG
Sbjct  251   NHIRRGEADIMVAGGTEAFISAIGVGGFIACRALSQRNDEYEKASRPWDKNRDGFVIGEG  310

Query  1039  CGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSP  1218
              GVLVME L+HA+KRG+ +IAEYLGGA TCDAHHMT+PR DGLGVSSC+  SL DAGVSP
Sbjct  311   SGVLVMESLEHALKRGSPIIAEYLGGAVTCDAHHMTDPRADGLGVSSCMVMSLVDAGVSP  370

Query  1219  EEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIK  1398
             EEVNYINAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLGA+GGLEAIATIK
Sbjct  371   EEVNYINAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHGLGAAGGLEAIATIK  430

Query  1399  AITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             AIT GWLHPTINQ++LEP+VTIDTVPNVKKQH+VNV ISNSFGFGGHNSV+VF P+KP
Sbjct  431   AITAGWLHPTINQHDLEPQVTIDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAPYKP  488



>ref|XP_008239156.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Prunus mume]
Length=494

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/494 (76%), Positives = 422/494 (85%), Gaps = 7/494 (1%)
 Frame = +1

Query  112   MASIAP--SSGLIFKSKESSKN--GASLLQYSGLKPVETMQ---NQPDSVAYKAQAAKKC  270
             MA IA   SSG++F+++E+  N  GAS+ Q+ GL+ VE+M    N   S  +   +A KC
Sbjct  1     MAGIAGPCSSGVLFRAREAGGNINGASMAQFDGLRQVESMHMPVNGNKSNGFAFTSAPKC  60

Query  271   RRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFD  450
             R IK M SP VSAPKR+ DPKKR VITGMGLVSVFGSD++TFYN LLEG SGI+LIDRFD
Sbjct  61    RTIKAMASPTVSAPKREKDPKKRTVITGMGLVSVFGSDIDTFYNKLLEGESGITLIDRFD  120

Query  451   ASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKT  630
             AS+FSVRFAGQI  F+S+GYID KNDRRLD  WRY +VAGKKAL DANLG +VL  MD+T
Sbjct  121   ASNFSVRFAGQIRDFSSKGYIDGKNDRRLDDCWRYGIVAGKKALEDANLGPQVLETMDRT  180

Query  631   RigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYS  810
             RIG ++G+G GGL  F  GV +L+Q GYKKI+PFFIPYSITNMGSALLAI+ GLMGP YS
Sbjct  181   RIGVIVGTGMGGLTAFSAGVESLIQKGYKKISPFFIPYSITNMGSALLAIDTGLMGPNYS  240

Query  811   ISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERA  990
             ISTACATANYCFY+AANHIR+GEADIM+ GGTEA +  TGVGGFIACRALSQRN EP RA
Sbjct  241   ISTACATANYCFYAAANHIRRGEADIMVVGGTEAAVMPTGVGGFIACRALSQRNDEPHRA  300

Query  991   SRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLG  1170
             SRPWDKDRDGFV+GEG GVLVME L+ A+ RGA +IAEYLGGA TCDAHHMT+PR+DGLG
Sbjct  301   SRPWDKDRDGFVMGEGAGVLVMESLESALNRGAPIIAEYLGGAVTCDAHHMTDPRSDGLG  360

Query  1171  VSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIG  1350
             VSSCITKSLEDAGVS EEVNY+NAHATST+AGD+ E +AIKKVFKDTSEIK+NGTKS+IG
Sbjct  361   VSSCITKSLEDAGVSHEEVNYVNAHATSTLAGDLAEFSAIKKVFKDTSEIKINGTKSMIG  420

Query  1351  HGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGF  1530
             HGLGA+GGLEAIATIKAI TGWLHPTINQ NLEP VTIDTVPNVKKQH+VNVAISNSFGF
Sbjct  421   HGLGAAGGLEAIATIKAINTGWLHPTINQDNLEPAVTIDTVPNVKKQHEVNVAISNSFGF  480

Query  1531  GGHNSVIVFGPFKP  1572
             GGHNSV+VF PF P
Sbjct  481   GGHNSVVVFAPFSP  494



>ref|XP_007209938.1| hypothetical protein PRUPE_ppa004714mg [Prunus persica]
 gb|EMJ11137.1| hypothetical protein PRUPE_ppa004714mg [Prunus persica]
Length=494

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/494 (75%), Positives = 424/494 (86%), Gaps = 7/494 (1%)
 Frame = +1

Query  112   MASIAP--SSGLIFKSKES--SKNGASLLQYSGLKPVETMQ---NQPDSVAYKAQAAKKC  270
             MA IA   SSG++F+++E+  S NGAS+ Q+ GL+ VE+     +   S  + + +A KC
Sbjct  1     MAGIAGPCSSGVLFRAREAGGSINGASMAQFDGLRQVESTHMPVSGNKSNGFASSSAPKC  60

Query  271   RRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFD  450
             R IK M SP VSAPKR+ DPKKR VITGMGLVSVFGS+++TFYN LLEG SGI+LIDRFD
Sbjct  61    RTIKAMASPTVSAPKREKDPKKRTVITGMGLVSVFGSEIDTFYNKLLEGESGITLIDRFD  120

Query  451   ASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKT  630
             AS+FSV+FAGQI  F+S+GYID KNDRRLD  WRY +VAGKKAL DANLG +VL  MD+T
Sbjct  121   ASNFSVQFAGQIRDFSSKGYIDGKNDRRLDDCWRYGIVAGKKALEDANLGPQVLETMDRT  180

Query  631   RigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYS  810
             RIG ++G+G GGL  F  GV +L+Q GYKKI+PFFIPYSITNMGSALLAI+ GLMGP YS
Sbjct  181   RIGVIVGTGMGGLTAFSAGVESLIQKGYKKISPFFIPYSITNMGSALLAIDTGLMGPNYS  240

Query  811   ISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERA  990
             ISTACATANYCFY+AANHIR+GEADIM+ GGTEA +  TGVGGFIACRALSQRN EP RA
Sbjct  241   ISTACATANYCFYAAANHIRRGEADIMVVGGTEAAVMPTGVGGFIACRALSQRNDEPHRA  300

Query  991   SRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLG  1170
             SRPWDKDRDGFV+GEG GVLVME L+ A+ RGA +IAEYLGGA TCDAHHMT+PR+DGLG
Sbjct  301   SRPWDKDRDGFVMGEGAGVLVMESLESALNRGAPIIAEYLGGAVTCDAHHMTDPRSDGLG  360

Query  1171  VSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIG  1350
             VSSCITKSLEDAGVSPEEVNY+NAHATST+AGD+ E +AIKKVFKDTSEIK+NGTKS+IG
Sbjct  361   VSSCITKSLEDAGVSPEEVNYVNAHATSTLAGDLAEFSAIKKVFKDTSEIKINGTKSMIG  420

Query  1351  HGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGF  1530
             HGLGA+GGLEAIATIKAI TGWLHPTINQ NLEP VTIDTVPNVKKQH+VNVAISNSFGF
Sbjct  421   HGLGAAGGLEAIATIKAINTGWLHPTINQDNLEPAVTIDTVPNVKKQHEVNVAISNSFGF  480

Query  1531  GGHNSVIVFGPFKP  1572
             GGHNSV+VF PF P
Sbjct  481   GGHNSVVVFAPFSP  494



>ref|XP_009358636.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Pyrus x bretschneideri]
Length=493

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/495 (76%), Positives = 426/495 (86%), Gaps = 10/495 (2%)
 Frame = +1

Query  112   MASIAP--SSGLIFKSKES-SKNGASLLQYSGLKPVETMQ-----NQPDSVAYKAQAAKK  267
             MA IA   SSG++F+S+E+ S NGAS+ Q+ GL+ VETM      N  + +++   +A K
Sbjct  1     MAGIAGPCSSGVLFRSREAGSINGASMAQFDGLRQVETMHMPVNGNMSNGLSF--TSAPK  58

Query  268   CRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRF  447
             CR IK M S  VSAPKR++DPKKR VITGMGLVSVFGSD++TFYN LLEG SGI+LIDRF
Sbjct  59    CRTIKAMASSTVSAPKRETDPKKRTVITGMGLVSVFGSDIDTFYNRLLEGESGITLIDRF  118

Query  448   DASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDK  627
             DAS FSVRFAGQI  F+S+GYID KNDRRLD  WRY +VAGKKAL DANLG EVL  MD+
Sbjct  119   DASTFSVRFAGQIRDFSSKGYIDGKNDRRLDDCWRYGIVAGKKALEDANLGPEVLPTMDR  178

Query  628   TRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTY  807
             TRIG ++G+G GGL  F  GV +L+Q G+KKI+PFFIPYSITNMGSALLAI+ GLMGP Y
Sbjct  179   TRIGVIVGTGMGGLTAFSAGVESLIQKGFKKISPFFIPYSITNMGSALLAIDTGLMGPNY  238

Query  808   SISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPER  987
             SISTACATANYCFY+AANHIR+GEADIM+ GGTEA +  TGVGGFIACRALSQRN EP R
Sbjct  239   SISTACATANYCFYAAANHIRRGEADIMVVGGTEAAVMPTGVGGFIACRALSQRNDEPHR  298

Query  988   ASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGL  1167
             ASRPWDK+RDGFV+GEG GVLVME L+ A+KRGA +IAEYLGGA TCDAHHMT+PR+DGL
Sbjct  299   ASRPWDKNRDGFVMGEGAGVLVMESLESALKRGAPIIAEYLGGAVTCDAHHMTDPRSDGL  358

Query  1168  GVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLI  1347
             GVSSCITKSLEDAGVSPEEVNY+NAHATST+AGD+ E NAIKKVFK+TSE+K+NGTKS+I
Sbjct  359   GVSSCITKSLEDAGVSPEEVNYVNAHATSTLAGDLAEFNAIKKVFKNTSEMKINGTKSMI  418

Query  1348  GHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFG  1527
             GHGLGA+GGLEAIATIKAI TGWLHPTINQ +LEP VTIDTVPNVKKQH+VNVAISNSFG
Sbjct  419   GHGLGAAGGLEAIATIKAINTGWLHPTINQDDLEPAVTIDTVPNVKKQHEVNVAISNSFG  478

Query  1528  FGGHNSVIVFGPFKP  1572
             FGGHNSV+VF PF P
Sbjct  479   FGGHNSVVVFAPFSP  493



>ref|XP_006439308.1| hypothetical protein CICLE_v10019855mg [Citrus clementina]
 gb|ESR52548.1| hypothetical protein CICLE_v10019855mg [Citrus clementina]
Length=494

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/495 (75%), Positives = 415/495 (84%), Gaps = 12/495 (2%)
 Frame = +1

Query  112   MASIAPSSGLIFKSKESSKNGA-SLLQYSGLKPVETMQNQPDSVAYKAQ-------AAKK  267
               S A + G++F +K+   NGA SL QYSGL+P E  Q     +    +       +  K
Sbjct  4     FVSTASALGVVFGNKQVKSNGAASLAQYSGLRPAENFQFASAGITTTIKQSGLICSSGPK  63

Query  268   CRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRF  447
             CR I+ M     SAPKR+ DPKKR+VITGMGLVSVFGSD++ FYN LLEG SGIS IDRF
Sbjct  64    CRTIRVM----ASAPKREIDPKKRIVITGMGLVSVFGSDIDKFYNKLLEGESGISPIDRF  119

Query  448   DASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDK  627
             DAS FSVRF GQI  F+S+GYID KNDRRLD  WRYCLVAG++AL +A+L  +VL NMD+
Sbjct  120   DASSFSVRFGGQIRDFSSKGYIDGKNDRRLDDCWRYCLVAGRRALEEASLSPQVLENMDR  179

Query  628   TRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTY  807
             TRIG V+GSG GGL  F  GV  L+Q GYKKITPFFIPYSITNMGSALLAI+ GLMGP Y
Sbjct  180   TRIGVVVGSGMGGLTSFTTGVEALIQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNY  239

Query  808   SISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPER  987
             SISTACATANYCFY+AANHIR+GEADIM+AGGTEA I  TGVGGFIACRALSQRN  P+R
Sbjct  240   SISTACATANYCFYAAANHIRRGEADIMVAGGTEAAIIPTGVGGFIACRALSQRNEYPKR  299

Query  988   ASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGL  1167
             ASRPWDKDRDGFV+GEGCG+LVME L+HAMKRGAN+IAEYLGGA TCDAHHMT+PR+DGL
Sbjct  300   ASRPWDKDRDGFVMGEGCGILVMESLEHAMKRGANIIAEYLGGAVTCDAHHMTDPRSDGL  359

Query  1168  GVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLI  1347
             GVSSCI KSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMNGTKS+I
Sbjct  360   GVSSCIAKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSEMKMNGTKSMI  419

Query  1348  GHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFG  1527
             GHGLGA+GGLEAI TIKAITTGWLHPT+NQ NLEPEVTIDTVPNVKKQH VNVAISNSFG
Sbjct  420   GHGLGAAGGLEAITTIKAITTGWLHPTLNQDNLEPEVTIDTVPNVKKQHHVNVAISNSFG  479

Query  1528  FGGHNSVIVFGPFKP  1572
             FGGHNSV+VF PF P
Sbjct  480   FGGHNSVVVFAPFSP  494



>ref|XP_011082304.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=493

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/483 (76%), Positives = 417/483 (86%), Gaps = 4/483 (1%)
 Frame = +1

Query  136   GLIFKS--KESSKNGASLLQYSGLKPVETMQNQPDSVAYKA--QAAKKCRRIKCMISPAV  303
             GLI +   K S++NG S+ QY+GL+ VETM      +        + K  RIK M SP V
Sbjct  11    GLILEKSGKSSARNGVSMFQYNGLRAVETMHVGSTGIRTTGFISTSSKWGRIKAMASPTV  70

Query  304   SAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQ  483
             SAPKR++DPKKR+VITGMGLVSVFGSDV+TFYN LL+G SGI+ IDRFDAS++SVRF+GQ
Sbjct  71    SAPKRETDPKKRIVITGMGLVSVFGSDVDTFYNKLLDGVSGITPIDRFDASEYSVRFSGQ  130

Query  484   IHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfg  663
             I  FTS+GYID K+DRRLD  WRYCLV+GK+AL+DA+L K+VL  MDKTRIG ++GSG G
Sbjct  131   IRDFTSKGYIDGKSDRRLDDVWRYCLVSGKRALDDASLSKDVLEKMDKTRIGVLVGSGMG  190

Query  664   glgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYC  843
             G+  F NGV  LV  GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSISTACATANYC
Sbjct  191   GISAFSNGVEALVLKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSISTACATANYC  250

Query  844   FYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGF  1023
             F++AANHIR+G+ADIM+AGG E+ IT  GVGGFIACRALS RN  P+ ASRPWDK+RDGF
Sbjct  251   FFAAANHIRRGDADIMVAGGAESAITPAGVGGFIACRALSSRNDNPQEASRPWDKNRDGF  310

Query  1024  VIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLED  1203
             VIGEG GVL+ME L+HA+KRGAN+IAEYLGGA TCDAHHMT+PR DGLGVSSCI KSL+D
Sbjct  311   VIGEGAGVLIMESLEHAVKRGANIIAEYLGGAVTCDAHHMTDPRKDGLGVSSCIIKSLQD  370

Query  1204  AGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEA  1383
             AGV+PEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLGA+GGLEA
Sbjct  371   AGVAPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHGLGAAGGLEA  430

Query  1384  IATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGP  1563
             IATIKAITTGWLHPTINQY LEPEVTIDTVPNVKKQH+VNVAISNSFGFGGHNSV+VF P
Sbjct  431   IATIKAITTGWLHPTINQYELEPEVTIDTVPNVKKQHEVNVAISNSFGFGGHNSVVVFAP  490

Query  1564  FKP  1572
             FKP
Sbjct  491   FKP  493



>gb|EYU23310.1| hypothetical protein MIMGU_mgv1a005480mg [Erythranthe guttata]
Length=482

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/476 (77%), Positives = 420/476 (88%), Gaps = 7/476 (1%)
 Frame = +1

Query  145   FKSKESSKNGASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQS  324
              K K+S +   S+ QY+GLK VET+Q  P     K  A  KCR +K M S  +S+PKR++
Sbjct  14    LKLKQSKE---SMFQYNGLKAVETLQVGPP----KFHAKAKCRGVKTMASQTISSPKRET  66

Query  325   DPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSE  504
             DPKKR+VITGMGLVSVFG+D++TFYN LL+G SGI+ IDRFDAS++SVRF GQI  FTS+
Sbjct  67    DPKKRIVITGMGLVSVFGNDIDTFYNKLLDGVSGITPIDRFDASEYSVRFGGQIRDFTSK  126

Query  505   GYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgn  684
             GYID KNDRRLD  WRYCLVAG++AL+DA+LGKEVL+ MDKTRIG ++GSG GG+  F N
Sbjct  127   GYIDGKNDRRLDDCWRYCLVAGRRALDDASLGKEVLDTMDKTRIGVLVGSGMGGITSFSN  186

Query  685   gvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANH  864
             GV  L+Q GYKK++PFFIPYSITNMGSALLAI+ GLMGP YSISTACATANYCF SAANH
Sbjct  187   GVEALIQKGYKKMSPFFIPYSITNMGSALLAIDTGLMGPNYSISTACATANYCFSSAANH  246

Query  865   IRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCG  1044
             IR+G+ADIM+AGGTEA +T TGVGGFIACRALSQRN EP++ASRPWDK+RDGFVIGEG G
Sbjct  247   IRRGDADIMVAGGTEAAVTATGVGGFIACRALSQRNDEPQKASRPWDKNRDGFVIGEGAG  306

Query  1045  VLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEE  1224
             VL+ME L+HAMKRGAN++AEYLGGATTCDAHHMT+PR+DGLGVSSCI KSLEDAGVSPEE
Sbjct  307   VLIMESLEHAMKRGANIVAEYLGGATTCDAHHMTDPRSDGLGVSSCILKSLEDAGVSPEE  366

Query  1225  VNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAI  1404
             VNY+NAHATST+AGD+ EVNAIKKVFK+TSEIKMNGTKS+IGHGLGA+GGLEAIATIKAI
Sbjct  367   VNYVNAHATSTLAGDLAEVNAIKKVFKNTSEIKMNGTKSMIGHGLGAAGGLEAIATIKAI  426

Query  1405  TTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
              TGWLHPTINQY+LE +V IDTVPNVKKQH++NVAISNSFGFGGHNSV+VF PFKP
Sbjct  427   NTGWLHPTINQYDLETDVDIDTVPNVKKQHEINVAISNSFGFGGHNSVVVFAPFKP  482



>ref|XP_011082303.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=511

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/483 (76%), Positives = 417/483 (86%), Gaps = 4/483 (1%)
 Frame = +1

Query  136   GLIFKS--KESSKNGASLLQYSGLKPVETMQNQPDSVAYKA--QAAKKCRRIKCMISPAV  303
             GLI +   K S++NG S+ QY+GL+ VETM      +        + K  RIK M SP V
Sbjct  29    GLILEKSGKSSARNGVSMFQYNGLRAVETMHVGSTGIRTTGFISTSSKWGRIKAMASPTV  88

Query  304   SAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQ  483
             SAPKR++DPKKR+VITGMGLVSVFGSDV+TFYN LL+G SGI+ IDRFDAS++SVRF+GQ
Sbjct  89    SAPKRETDPKKRIVITGMGLVSVFGSDVDTFYNKLLDGVSGITPIDRFDASEYSVRFSGQ  148

Query  484   IHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfg  663
             I  FTS+GYID K+DRRLD  WRYCLV+GK+AL+DA+L K+VL  MDKTRIG ++GSG G
Sbjct  149   IRDFTSKGYIDGKSDRRLDDVWRYCLVSGKRALDDASLSKDVLEKMDKTRIGVLVGSGMG  208

Query  664   glgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYC  843
             G+  F NGV  LV  GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSISTACATANYC
Sbjct  209   GISAFSNGVEALVLKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSISTACATANYC  268

Query  844   FYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGF  1023
             F++AANHIR+G+ADIM+AGG E+ IT  GVGGFIACRALS RN  P+ ASRPWDK+RDGF
Sbjct  269   FFAAANHIRRGDADIMVAGGAESAITPAGVGGFIACRALSSRNDNPQEASRPWDKNRDGF  328

Query  1024  VIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLED  1203
             VIGEG GVL+ME L+HA+KRGAN+IAEYLGGA TCDAHHMT+PR DGLGVSSCI KSL+D
Sbjct  329   VIGEGAGVLIMESLEHAVKRGANIIAEYLGGAVTCDAHHMTDPRKDGLGVSSCIIKSLQD  388

Query  1204  AGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEA  1383
             AGV+PEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLGA+GGLEA
Sbjct  389   AGVAPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHGLGAAGGLEA  448

Query  1384  IATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGP  1563
             IATIKAITTGWLHPTINQY LEPEVTIDTVPNVKKQH+VNVAISNSFGFGGHNSV+VF P
Sbjct  449   IATIKAITTGWLHPTINQYELEPEVTIDTVPNVKKQHEVNVAISNSFGFGGHNSVVVFAP  508

Query  1564  FKP  1572
             FKP
Sbjct  509   FKP  511



>ref|XP_007160188.1| hypothetical protein PHAVU_002G300400g [Phaseolus vulgaris]
 gb|ESW32182.1| hypothetical protein PHAVU_002G300400g [Phaseolus vulgaris]
Length=495

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/496 (74%), Positives = 418/496 (84%), Gaps = 10/496 (2%)
 Frame = +1

Query  112   MASIA---PSSGLIFKSKESSKNGASLLQYSGLKPVETMQNQPDSVA------YKAQAAK  264
             MASIA   P   L+  S   +    S++ Y GL+  + MQ  P S+A        A ++ 
Sbjct  1     MASIAGTCPLGALLRNSVPENNRKMSVVHYEGLRLPQRMQ-IPSSLATNPSHYISASSSP  59

Query  265   KCRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDR  444
             +CR IK M SP V+AP R+ DPKKRVVITGMGLVSVFGSD++ FYN LLEG SGISLIDR
Sbjct  60    RCRTIKAMASPTVAAPNREKDPKKRVVITGMGLVSVFGSDIDAFYNKLLEGESGISLIDR  119

Query  445   FDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMD  624
             FDAS FSVRF GQI  F+SEGYID KNDRRLD  WRYC+VAGK+ALNDANLG++VL+ MD
Sbjct  120   FDASSFSVRFGGQIRDFSSEGYIDGKNDRRLDDCWRYCIVAGKRALNDANLGQQVLDTMD  179

Query  625   KTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPT  804
             KTRIG ++G+G GGL  F +GV  L+Q GYKKITPFFIPYSITNMGSALLAI+ GLMGP 
Sbjct  180   KTRIGVLVGTGMGGLTAFSSGVQALIQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPN  239

Query  805   YSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPE  984
             YSISTACATANYCFY+AANHIR+GEADIM+ GGTEA I  TGVGGFIACRALSQRN +P+
Sbjct  240   YSISTACATANYCFYAAANHIRRGEADIMVVGGTEAAIMPTGVGGFIACRALSQRNEDPK  299

Query  985   RASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDG  1164
             +ASRPWDKDRDGFV+GEG GVL+ME L+ A KRGA ++AEYLGGA TCDAHHMT+PR+DG
Sbjct  300   KASRPWDKDRDGFVMGEGSGVLIMESLESATKRGATIVAEYLGGAITCDAHHMTDPRSDG  359

Query  1165  LGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSL  1344
             LGVSSCITKSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMN TKS+
Sbjct  360   LGVSSCITKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSELKMNATKSM  419

Query  1345  IGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSF  1524
             IGHGLGA+GGLEAIATIKAITTGW+HPTINQ NLEP VTIDTVP VKKQH+VNV ISNSF
Sbjct  420   IGHGLGAAGGLEAIATIKAITTGWVHPTINQDNLEPSVTIDTVPYVKKQHEVNVGISNSF  479

Query  1525  GFGGHNSVIVFGPFKP  1572
             GFGGHNSV+VF PF+P
Sbjct  480   GFGGHNSVVVFAPFRP  495



>ref|XP_008352311.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X1 [Malus domestica]
Length=493

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/495 (75%), Positives = 424/495 (86%), Gaps = 10/495 (2%)
 Frame = +1

Query  112   MASIAPS--SGLIFKSKES-SKNGASLLQYSGLKPVETMQ-----NQPDSVAYKAQAAKK  267
             MA IA    SG++ +S+E+ S +GAS+ Q+ GL+ VETM      N  + +++   +A K
Sbjct  1     MAGIAGPCYSGVLXRSREAGSIBGASMAQFDGLRQVETMHMPVNGNMSNGLSF--TSAPK  58

Query  268   CRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRF  447
             CR IK M S  VSAPKR++DPKKR VITGMGLVSVFGSD++TFYN LLEG SGI+LIDRF
Sbjct  59    CRTIKAMASSTVSAPKRETDPKKRTVITGMGLVSVFGSDIDTFYNRLLEGESGITLIDRF  118

Query  448   DASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDK  627
             DAS FSVRFAGQI  F+S+GYID KNDRRLD  WRY +VAGKKAL DANLG EVL  MD+
Sbjct  119   DASTFSVRFAGQIRDFSSKGYIDGKNDRRLDDCWRYGIVAGKKALEDANLGPEVLPTMDR  178

Query  628   TRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTY  807
             TRIG ++G+G GGL  F  GV +L+Q G+KKI+PFFIPYSITNMGSALLAI+ GLMGP Y
Sbjct  179   TRIGVIVGTGMGGLTAFSAGVESLIQKGFKKISPFFIPYSITNMGSALLAIDTGLMGPNY  238

Query  808   SISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPER  987
             SISTAC+TANYCFY+AANHIR+GEADIM+ GGTEA +  TGVGGFIACRALSQRN EP R
Sbjct  239   SISTACSTANYCFYAAANHIRRGEADIMVVGGTEAAVMPTGVGGFIACRALSQRNDEPHR  298

Query  988   ASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGL  1167
             ASRPWDK+RDGFV+GEG GVLVME L+ A+KRGA +IAEYLGGA TCDAHHMT+PR+DGL
Sbjct  299   ASRPWDKNRDGFVMGEGAGVLVMESLESALKRGAPIIAEYLGGAVTCDAHHMTDPRSDGL  358

Query  1168  GVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLI  1347
             GVSSCITKSLEDAGVSPEEVNY+NAHATST+AGD+ E NAIKKVFK+TSE+K+NGTKS+I
Sbjct  359   GVSSCITKSLEDAGVSPEEVNYVNAHATSTLAGDLAEFNAIKKVFKNTSEMKINGTKSMI  418

Query  1348  GHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFG  1527
             GHGLGA+GGLEAIATIKAI TGWLHPTINQ +LEP VTIDTVPNVKKQH+VNVAISNSFG
Sbjct  419   GHGLGAAGGLEAIATIKAINTGWLHPTINQDDLEPAVTIDTVPNVKKQHEVNVAISNSFG  478

Query  1528  FGGHNSVIVFGPFKP  1572
             FGGHNSV+VF PF P
Sbjct  479   FGGHNSVVVFAPFSP  493



>ref|XP_006584770.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X3 [Glycine max]
Length=492

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/492 (75%), Positives = 417/492 (85%), Gaps = 5/492 (1%)
 Frame = +1

Query  112   MASIAPSS--GLIFKSKESSKNGA-SLLQYSGLKPVETMQNQPDS--VAYKAQAAKKCRR  276
             MA IA +   G + ++  S  NG  S++ Y GL+  + MQ    S  ++  + AA +CR 
Sbjct  1     MAGIAGTCPLGALLRNSVSENNGKISVVHYEGLRLQQRMQMPSPSQYISASSSAAPRCRT  60

Query  277   IKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDAS  456
             IK M SP V APKR+ DPKKRVVITGMGLVSVFGSDV+ FYN LLEG SGISLIDRFDAS
Sbjct  61    IKAMASPTVGAPKREKDPKKRVVITGMGLVSVFGSDVDAFYNKLLEGESGISLIDRFDAS  120

Query  457   DFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRi  636
             +FSVRF GQI  F+SEGYID KNDRRLD+ WRYC+VAGK+AL+DANLGK+VL+ MDKTRI
Sbjct  121   NFSVRFGGQIRDFSSEGYIDGKNDRRLDNCWRYCIVAGKRALDDANLGKQVLDTMDKTRI  180

Query  637   gavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSIS  816
             G ++GSG GG+  F NGV  LVQ GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSIS
Sbjct  181   GVLVGSGMGGITAFSNGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSIS  240

Query  817   TACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASR  996
             TACATANYCF +AANHIR+GEADIM+ GGTEA I  +G+GGFIACRALS RN +P++ASR
Sbjct  241   TACATANYCFCAAANHIRKGEADIMVVGGTEAAIMPSGLGGFIACRALSHRNEDPKKASR  300

Query  997   PWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVS  1176
             PWDKDRDGFV+GEG GVLVME L+ A KRGA +IAEYLGGA TCDAHHMT+PR DGLGVS
Sbjct  301   PWDKDRDGFVMGEGSGVLVMESLESATKRGAKIIAEYLGGAITCDAHHMTDPRADGLGVS  360

Query  1177  SCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHG  1356
             SCI+KSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMN TKS+IGHG
Sbjct  361   SCISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSELKMNATKSMIGHG  420

Query  1357  LGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGG  1536
             LGA+GGLEAIATIKAITTGWLHP+IN  NLE  VTIDTVPNVKK+H+VNV ISNSFGFGG
Sbjct  421   LGAAGGLEAIATIKAITTGWLHPSINLDNLEASVTIDTVPNVKKKHEVNVGISNSFGFGG  480

Query  1537  HNSVIVFGPFKP  1572
             HNSV+VF PF+P
Sbjct  481   HNSVVVFAPFRP  492



>ref|XP_003530435.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN16724.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Glycine 
soja]
Length=491

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/491 (75%), Positives = 415/491 (85%), Gaps = 4/491 (1%)
 Frame = +1

Query  112   MASIAPSS--GLIFKSKESSKNGA-SLLQYSGLKPVETMQN-QPDSVAYKAQAAKKCRRI  279
             MA IA +   G + ++  S  NG  S++ Y GL+  + MQ   P      + +A +CR I
Sbjct  1     MAGIAGTCPLGALLRNSVSENNGKISVVHYEGLRLQQRMQMPSPSQYISASSSAPRCRTI  60

Query  280   KCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASD  459
             K M SP V APKR+ DPKKRVVITGMGLVSVFGSDV+ FYN LLEG SGISLIDRFDAS+
Sbjct  61    KAMASPTVGAPKREKDPKKRVVITGMGLVSVFGSDVDAFYNKLLEGESGISLIDRFDASN  120

Query  460   FSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRig  639
             FSVRF GQI  F+SEGYID KNDRRLD+ WRYC+VAGK+AL+DANLGK+VL+ MDKTRIG
Sbjct  121   FSVRFGGQIRDFSSEGYIDGKNDRRLDNCWRYCIVAGKRALDDANLGKQVLDTMDKTRIG  180

Query  640   avigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSIST  819
              ++GSG GG+  F NGV  LVQ GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSIST
Sbjct  181   VLVGSGMGGITAFSNGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSIST  240

Query  820   ACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRP  999
             ACATANYCF +AANHIR+GEADIM+ GGTEA I  +G+GGFIACRALS RN +P++ASRP
Sbjct  241   ACATANYCFCAAANHIRKGEADIMVVGGTEAAIMPSGLGGFIACRALSHRNEDPKKASRP  300

Query  1000  WDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSS  1179
             WDKDRDGFV+GEG GVLVME L+ A KRGA +IAEYLGGA TCDAHHMT+PR DGLGVSS
Sbjct  301   WDKDRDGFVMGEGSGVLVMESLESATKRGAKIIAEYLGGAITCDAHHMTDPRADGLGVSS  360

Query  1180  CITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGL  1359
             CI+KSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMN TKS+IGHGL
Sbjct  361   CISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSELKMNATKSMIGHGL  420

Query  1360  GASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGH  1539
             GA+GGLEAIATIKAITTGWLHP+IN  NLE  VTIDTVPNVKK+H+VNV ISNSFGFGGH
Sbjct  421   GAAGGLEAIATIKAITTGWLHPSINLDNLEASVTIDTVPNVKKKHEVNVGISNSFGFGGH  480

Query  1540  NSVIVFGPFKP  1572
             NSV+VF PF+P
Sbjct  481   NSVVVFAPFRP  491



>ref|XP_006584769.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X2 [Glycine max]
Length=493

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/493 (74%), Positives = 417/493 (85%), Gaps = 6/493 (1%)
 Frame = +1

Query  112   MASIAPSS--GLIFKSKESSKNGA-SLLQYSGLKPVETMQNQPDS--VAYKAQAAKKCRR  276
             MA IA +   G + ++  S  NG  S++ Y GL+  + MQ    S  ++  + AA +CR 
Sbjct  1     MAGIAGTCPLGALLRNSVSENNGKISVVHYEGLRLQQRMQMPSPSQYISASSSAAPRCRT  60

Query  277   IKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDAS  456
             IK M SP V APKR+ DPKKRVVITGMGLVSVFGSDV+ FYN LLEG SGISLIDRFDAS
Sbjct  61    IKAMASPTVGAPKREKDPKKRVVITGMGLVSVFGSDVDAFYNKLLEGESGISLIDRFDAS  120

Query  457   DFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLN-NMDKTR  633
             +FSVRF GQI  F+SEGYID KNDRRLD+ WRYC+VAGK+AL+DANLGK+VL+  MDKTR
Sbjct  121   NFSVRFGGQIRDFSSEGYIDGKNDRRLDNCWRYCIVAGKRALDDANLGKQVLDTQMDKTR  180

Query  634   igavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSI  813
             IG ++GSG GG+  F NGV  LVQ GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSI
Sbjct  181   IGVLVGSGMGGITAFSNGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSI  240

Query  814   STACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERAS  993
             STACATANYCF +AANHIR+GEADIM+ GGTEA I  +G+GGFIACRALS RN +P++AS
Sbjct  241   STACATANYCFCAAANHIRKGEADIMVVGGTEAAIMPSGLGGFIACRALSHRNEDPKKAS  300

Query  994   RPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGV  1173
             RPWDKDRDGFV+GEG GVLVME L+ A KRGA +IAEYLGGA TCDAHHMT+PR DGLGV
Sbjct  301   RPWDKDRDGFVMGEGSGVLVMESLESATKRGAKIIAEYLGGAITCDAHHMTDPRADGLGV  360

Query  1174  SSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGH  1353
             SSCI+KSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMN TKS+IGH
Sbjct  361   SSCISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSELKMNATKSMIGH  420

Query  1354  GLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFG  1533
             GLGA+GGLEAIATIKAITTGWLHP+IN  NLE  VTIDTVPNVKK+H+VNV ISNSFGFG
Sbjct  421   GLGAAGGLEAIATIKAITTGWLHPSINLDNLEASVTIDTVPNVKKKHEVNVGISNSFGFG  480

Query  1534  GHNSVIVFGPFKP  1572
             GHNSV+VF PF+P
Sbjct  481   GHNSVVVFAPFRP  493



>ref|XP_010109776.1| hypothetical protein L484_003136 [Morus notabilis]
 gb|EXC24694.1| hypothetical protein L484_003136 [Morus notabilis]
Length=511

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/497 (73%), Positives = 417/497 (84%), Gaps = 20/497 (4%)
 Frame = +1

Query  142   IFKSKE-SSKNGASLLQYSGLKPVETMQ---NQPDSVAYKAQAAKKCRRIKCMISPAVSA  309
             +F+++E    NGA L  Y+GL+P+E +    +   S  + + +A+KCR IK M SP VS+
Sbjct  15    VFRAREVGGNNGAFLGHYNGLRPMENVHMVSSGTKSSGFVSTSARKCRTIKAMASPTVSS  74

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             PKR+ DPKKRVVITGMGLVSVFG+D++TFYN LLEG SGIS IDRFD S++SVRFAGQI 
Sbjct  75    PKREKDPKKRVVITGMGLVSVFGNDIDTFYNKLLEGESGISPIDRFDVSNYSVRFAGQIR  134

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfggl  669
              F+S+GYID KNDRRLD  WRY LV GK+AL DANLG EVL+ MDK+RIG ++G+G GGL
Sbjct  135   DFSSKGYIDGKNDRRLDDCWRYGLVGGKRALEDANLGHEVLDTMDKSRIGVLVGTGMGGL  194

Query  670   gvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFY  849
               F  GV  L+  GYKKI+PFFIPYSITNMGSALLAI+ GLMGP YSISTACATANYCF+
Sbjct  195   TAFTTGVENLILKGYKKISPFFIPYSITNMGSALLAIDTGLMGPNYSISTACATANYCFF  254

Query  850   SAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVI  1029
             +AANHIR+GEADIM+ GG+EA I  TGVGGFIACRALSQRN EP++ASRPWDKDRDGFVI
Sbjct  255   AAANHIRRGEADIMVVGGSEAPILPTGVGGFIACRALSQRNEEPQKASRPWDKDRDGFVI  314

Query  1030  GEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAG  1209
             GEGCGVL+ME L+ AMKRGA +IAEYLGGA TCDAHHMT+PR DGLGVSSCITKSL+DAG
Sbjct  315   GEGCGVLIMESLESAMKRGAKIIAEYLGGAITCDAHHMTDPRPDGLGVSSCITKSLQDAG  374

Query  1210  VSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTK----------------S  1341
             VSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMNGTK                S
Sbjct  375   VSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSELKMNGTKARKPKRLKNDIIPLDFS  434

Query  1342  LIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNS  1521
             +IGHGLGA+GGLEA+ATIKAITTGWLHPTINQ NLEP+VTIDTVPNVKK+H+VNVAISNS
Sbjct  435   MIGHGLGAAGGLEAVATIKAITTGWLHPTINQDNLEPDVTIDTVPNVKKKHEVNVAISNS  494

Query  1522  FGFGGHNSVIVFGPFKP  1572
             FGFGGHNSV+VF PF P
Sbjct  495   FGFGGHNSVVVFAPFSP  511



>ref|XP_006584772.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X5 [Glycine max]
Length=491

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/491 (75%), Positives = 415/491 (85%), Gaps = 4/491 (1%)
 Frame = +1

Query  112   MASIAPSS--GLIFKSKESSKNGA-SLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIK  282
             MA IA +   G + ++  S  NG  S++ Y GL+  + MQ    S    A ++ +CR IK
Sbjct  1     MAGIAGTCPLGALLRNSVSENNGKISVVHYEGLRLQQRMQMPSPSQYISASSSPRCRTIK  60

Query  283   CMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDF  462
              M SP V APKR+ DPKKRVVITGMGLVSVFGSDV+ FYN LLEG SGISLIDRFDAS+F
Sbjct  61    AMASPTVGAPKREKDPKKRVVITGMGLVSVFGSDVDAFYNKLLEGESGISLIDRFDASNF  120

Query  463   SVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLN-NMDKTRig  639
             SVRF GQI  F+SEGYID KNDRRLD+ WRYC+VAGK+AL+DANLGK+VL+  MDKTRIG
Sbjct  121   SVRFGGQIRDFSSEGYIDGKNDRRLDNCWRYCIVAGKRALDDANLGKQVLDTQMDKTRIG  180

Query  640   avigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSIST  819
              ++GSG GG+  F NGV  LVQ GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSIST
Sbjct  181   VLVGSGMGGITAFSNGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSIST  240

Query  820   ACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRP  999
             ACATANYCF +AANHIR+GEADIM+ GGTEA I  +G+GGFIACRALS RN +P++ASRP
Sbjct  241   ACATANYCFCAAANHIRKGEADIMVVGGTEAAIMPSGLGGFIACRALSHRNEDPKKASRP  300

Query  1000  WDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSS  1179
             WDKDRDGFV+GEG GVLVME L+ A KRGA +IAEYLGGA TCDAHHMT+PR DGLGVSS
Sbjct  301   WDKDRDGFVMGEGSGVLVMESLESATKRGAKIIAEYLGGAITCDAHHMTDPRADGLGVSS  360

Query  1180  CITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGL  1359
             CI+KSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMN TKS+IGHGL
Sbjct  361   CISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSELKMNATKSMIGHGL  420

Query  1360  GASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGH  1539
             GA+GGLEAIATIKAITTGWLHP+IN  NLE  VTIDTVPNVKK+H+VNV ISNSFGFGGH
Sbjct  421   GAAGGLEAIATIKAITTGWLHPSINLDNLEASVTIDTVPNVKKKHEVNVGISNSFGFGGH  480

Query  1540  NSVIVFGPFKP  1572
             NSV+VF PF+P
Sbjct  481   NSVVVFAPFRP  491



>ref|XP_006584771.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X4 [Glycine max]
Length=492

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/492 (74%), Positives = 415/492 (84%), Gaps = 5/492 (1%)
 Frame = +1

Query  112   MASIAPSS--GLIFKSKESSKNGA-SLLQYSGLKPVETMQN-QPDSVAYKAQAAKKCRRI  279
             MA IA +   G + ++  S  NG  S++ Y GL+  + MQ   P      + +A +CR I
Sbjct  1     MAGIAGTCPLGALLRNSVSENNGKISVVHYEGLRLQQRMQMPSPSQYISASSSAPRCRTI  60

Query  280   KCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASD  459
             K M SP V APKR+ DPKKRVVITGMGLVSVFGSDV+ FYN LLEG SGISLIDRFDAS+
Sbjct  61    KAMASPTVGAPKREKDPKKRVVITGMGLVSVFGSDVDAFYNKLLEGESGISLIDRFDASN  120

Query  460   FSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLN-NMDKTRi  636
             FSVRF GQI  F+SEGYID KNDRRLD+ WRYC+VAGK+AL+DANLGK+VL+  MDKTRI
Sbjct  121   FSVRFGGQIRDFSSEGYIDGKNDRRLDNCWRYCIVAGKRALDDANLGKQVLDTQMDKTRI  180

Query  637   gavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSIS  816
             G ++GSG GG+  F NGV  LVQ GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSIS
Sbjct  181   GVLVGSGMGGITAFSNGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSIS  240

Query  817   TACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASR  996
             TACATANYCF +AANHIR+GEADIM+ GGTEA I  +G+GGFIACRALS RN +P++ASR
Sbjct  241   TACATANYCFCAAANHIRKGEADIMVVGGTEAAIMPSGLGGFIACRALSHRNEDPKKASR  300

Query  997   PWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVS  1176
             PWDKDRDGFV+GEG GVLVME L+ A KRGA +IAEYLGGA TCDAHHMT+PR DGLGVS
Sbjct  301   PWDKDRDGFVMGEGSGVLVMESLESATKRGAKIIAEYLGGAITCDAHHMTDPRADGLGVS  360

Query  1177  SCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHG  1356
             SCI+KSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMN TKS+IGHG
Sbjct  361   SCISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSELKMNATKSMIGHG  420

Query  1357  LGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGG  1536
             LGA+GGLEAIATIKAITTGWLHP+IN  NLE  VTIDTVPNVKK+H+VNV ISNSFGFGG
Sbjct  421   LGAAGGLEAIATIKAITTGWLHPSINLDNLEASVTIDTVPNVKKKHEVNVGISNSFGFGG  480

Query  1537  HNSVIVFGPFKP  1572
             HNSV+VF PF+P
Sbjct  481   HNSVVVFAPFRP  492



>ref|XP_004301818.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=489

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/490 (74%), Positives = 417/490 (85%), Gaps = 7/490 (1%)
 Frame = +1

Query  115   ASIAPSSGLIFKSKESSKNGASLLQYSGLKPVETMQ---NQPDSVAYKAQAAKKCRRIKC  285
             A+ + SSG++F ++E   NGA L Q+ GL+ VE M        S    + +A KCR IK 
Sbjct  3     AATSCSSGVLFGARE---NGAFLGQFDGLRQVEKMHMPLAPTKSHGLVSTSAPKCRTIKA  59

Query  286   MISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFS  465
             M SPA+SAPKR++DPKKR VITG GLVSVFGSD++TFYN LLEG SGI+LIDRFDAS FS
Sbjct  60    MASPALSAPKRETDPKKRTVITGQGLVSVFGSDIDTFYNRLLEGESGITLIDRFDASSFS  119

Query  466   VRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigav  645
             VRFAGQI  F+S+GYID KNDRRLD  WRY +VAGK+AL DANLG E L +MDKTRIG +
Sbjct  120   VRFAGQIRDFSSKGYIDGKNDRRLDDCWRYGIVAGKRALEDANLGPEALKSMDKTRIGVI  179

Query  646   igsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTAC  825
             +G+G GGL  F  GV +LVQ G+KKI+PFFIPYSITNMGSALLAI+ GLMGP YSISTAC
Sbjct  180   VGTGMGGLTAFSAGVESLVQKGFKKISPFFIPYSITNMGSALLAIDTGLMGPNYSISTAC  239

Query  826   ATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWD  1005
             ATANYCFY+AANHIR+GEADIM+ GGTEA +   GVGGFIACRALSQRN EP RASRPWD
Sbjct  240   ATANYCFYAAANHIRRGEADIMVVGGTEAAVMPVGVGGFIACRALSQRNDEPHRASRPWD  299

Query  1006  KDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCI  1185
             K+RDGFV+GEG GVLVME L+ A+KRGA +IAEYLGGA TCDAHHMT+PR+DGLGVSSCI
Sbjct  300   KNRDGFVMGEGAGVLVMESLESALKRGAPIIAEYLGGAVTCDAHHMTDPRSDGLGVSSCI  359

Query  1186  TKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVF-KDTSEIKMNGTKSLIGHGLG  1362
             TKSLEDAGVSPEEVNY+NAHATST+AGD+ E NAIKKVF K+TSE+K+NGTKS+IGHGLG
Sbjct  360   TKSLEDAGVSPEEVNYVNAHATSTLAGDLAEFNAIKKVFGKNTSEMKINGTKSMIGHGLG  419

Query  1363  ASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHN  1542
             A+GGLEAIATIKAI TGWLHPTINQ +LEP VTIDTVPNVKK+H+VNVAISNSFGFGGHN
Sbjct  420   AAGGLEAIATIKAINTGWLHPTINQDDLEPAVTIDTVPNVKKKHEVNVAISNSFGFGGHN  479

Query  1543  SVIVFGPFKP  1572
             SV+VF P+ P
Sbjct  480   SVVVFAPYNP  489



>ref|NP_001241906.1| uncharacterized protein LOC100808453 [Glycine max]
 gb|ACU19800.1| unknown [Glycine max]
Length=490

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/490 (73%), Positives = 411/490 (84%), Gaps = 3/490 (1%)
 Frame = +1

Query  112   MASIAPSS--GLIFKSKESSKNGASLLQYSGLKPVETMQ-NQPDSVAYKAQAAKKCRRIK  282
             MASIA +   G + ++   +    S++ Y GL+  + +Q + P      + +A +CR IK
Sbjct  1     MASIAGTCPLGALLRNISENNGKISVVHYEGLRLQQRLQMHSPSHYISASSSAPRCRTIK  60

Query  283   CMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDF  462
              M SP V+APKR+ DPKKRVVITGMGLVSVFGSD++ FYN LLEG SGISLIDRFDAS+F
Sbjct  61    VMASPTVAAPKREKDPKKRVVITGMGLVSVFGSDIDGFYNKLLEGESGISLIDRFDASNF  120

Query  463   SVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRiga  642
              VRF GQI  F+SEGYID  NDRRLD  WRYC+VAGK+AL+DANLG++VL+ MDKTR+G 
Sbjct  121   PVRFGGQIRDFSSEGYIDGMNDRRLDDCWRYCIVAGKRALDDANLGQQVLDTMDKTRVGV  180

Query  643   vigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTA  822
             ++GSG GG+  F  GV  LVQ GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSISTA
Sbjct  181   LVGSGMGGITAFSTGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSISTA  240

Query  823   CATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPW  1002
             CATANYCF SAANHIR+GEADIM+ GGTEA I  +G+GGFIACRALS RN  P++ASRPW
Sbjct  241   CATANYCFCSAANHIRKGEADIMVVGGTEAAIMPSGLGGFIACRALSHRNEGPKKASRPW  300

Query  1003  DKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSC  1182
             DKDRDGFV+GEG GVLVME L+ A KRGA +IAEYLGGA TCD HHMT+PR DGLGVSSC
Sbjct  301   DKDRDGFVMGEGSGVLVMESLESATKRGARIIAEYLGGAITCDDHHMTDPRADGLGVSSC  360

Query  1183  ITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLG  1362
             I+KSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMN TKS+IGHGLG
Sbjct  361   ISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSELKMNATKSMIGHGLG  420

Query  1363  ASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHN  1542
             A+GGLEAIATIKAITTGWLHPTINQ NLE  VTIDTVPNVKK+H+VNV ISNSFGFGGHN
Sbjct  421   AAGGLEAIATIKAITTGWLHPTINQDNLEASVTIDTVPNVKKKHEVNVGISNSFGFGGHN  480

Query  1543  SVIVFGPFKP  1572
             SV+VF PF+P
Sbjct  481   SVVVFAPFRP  490



>ref|XP_010053160.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Eucalyptus grandis]
 ref|XP_010053161.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW77416.1| hypothetical protein EUGRSUZ_D01763 [Eucalyptus grandis]
Length=429

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/429 (82%), Positives = 390/429 (91%), Gaps = 0/429 (0%)
 Frame = +1

Query  286   MISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFS  465
             M SP VSAPKR+ DPKKRVVITGMGLVSVFG+DV+ FY+ LLEG SGISLIDRFDAS FS
Sbjct  1     MASPTVSAPKREKDPKKRVVITGMGLVSVFGNDVDNFYSKLLEGESGISLIDRFDASSFS  60

Query  466   VRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigav  645
             VRFAGQI  F+S+GYI  KNDRRLD  WRYC+VAGK+AL DANLG  VL+ MDKTRIG +
Sbjct  61    VRFAGQIRNFSSDGYIVGKNDRRLDDCWRYCIVAGKRALEDANLGSMVLDTMDKTRIGVL  120

Query  646   igsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTAC  825
             +G+G GG+ VF NGV  LVQ GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSISTAC
Sbjct  121   VGTGMGGISVFSNGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSISTAC  180

Query  826   ATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWD  1005
             ATANYCFY+AANHIR+GEADIM+ GGTEA +  TGVGGFIACRALSQRN +P+RASRPWD
Sbjct  181   ATANYCFYAAANHIRRGEADIMVVGGTEAAVMPTGVGGFIACRALSQRNEDPKRASRPWD  240

Query  1006  KDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCI  1185
             KDRDGFV+GEG GVL+ME L+HA+KRGAN+IAEYLGGA TCDAHHMT+PR+DGLGVSSCI
Sbjct  241   KDRDGFVMGEGAGVLIMESLEHALKRGANIIAEYLGGAVTCDAHHMTDPRSDGLGVSSCI  300

Query  1186  TKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGA  1365
             +KSLEDA VSPEEVNYINAHATST+AGD+ EVNAIKKVFKDTSEIKMNGTKS+IGHGLGA
Sbjct  301   SKSLEDASVSPEEVNYINAHATSTLAGDLAEVNAIKKVFKDTSEIKMNGTKSMIGHGLGA  360

Query  1366  SGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNS  1545
             +GGLEAIATIKAITTGWLHPTINQ N+EP+VTIDTVPNVKKQH+VNVAISNSFGFGGHNS
Sbjct  361   AGGLEAIATIKAITTGWLHPTINQDNIEPDVTIDTVPNVKKQHEVNVAISNSFGFGGHNS  420

Query  1546  VIVFGPFKP  1572
             V+VF P+ P
Sbjct  421   VVVFAPYTP  429



>ref|XP_006579442.1| PREDICTED: uncharacterized protein LOC100808453 isoform X1 [Glycine 
max]
Length=491

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/491 (74%), Positives = 412/491 (84%), Gaps = 4/491 (1%)
 Frame = +1

Query  112   MASIAPSS--GLIFKSKESSKNGASLLQYSGLKPVETMQ-NQPDSVAYKAQAAKKCRRIK  282
             MASIA +   G + ++   +    S++ Y GL+  + +Q + P      + +A +CR IK
Sbjct  1     MASIAGTCPLGALLRNISENNGKISVVHYEGLRLQQRLQMHSPSHYISASSSAPRCRTIK  60

Query  283   CMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDF  462
              M SP V+APKR+ DPKKRVVITGMGLVSVFGSD++ FYN LLEG SGISLIDRFDAS+F
Sbjct  61    VMASPTVAAPKREKDPKKRVVITGMGLVSVFGSDIDGFYNKLLEGESGISLIDRFDASNF  120

Query  463   SVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLN-NMDKTRig  639
              VRF GQI  F+SEGYID KNDRRLD  WRYC+VAGK+AL+DANLG++VL+  MDKTRIG
Sbjct  121   PVRFGGQIRDFSSEGYIDGKNDRRLDDCWRYCIVAGKRALDDANLGQQVLDTQMDKTRIG  180

Query  640   avigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSIST  819
              ++GSG GG+  F  GV  LVQ GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSIST
Sbjct  181   VLVGSGMGGITAFSTGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSIST  240

Query  820   ACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRP  999
             ACATANYCF SAANHIR+GEADIM+ GGTEA I  +G+GGFIACRALS RN  P++ASRP
Sbjct  241   ACATANYCFCSAANHIRKGEADIMVVGGTEAAIMPSGLGGFIACRALSHRNEGPKKASRP  300

Query  1000  WDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSS  1179
             WDKDRDGFV+GEG GVLVME L+ A KRGA +IAEYLGGA TCD HHMT+PR DGLGVSS
Sbjct  301   WDKDRDGFVMGEGSGVLVMESLESATKRGARIIAEYLGGAITCDDHHMTDPRADGLGVSS  360

Query  1180  CITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGL  1359
             CI+KSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMN TKS+IGHGL
Sbjct  361   CISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSELKMNATKSMIGHGL  420

Query  1360  GASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGH  1539
             GA+GGLEAIATIKAITTGWLHPTINQ NLE  VTIDTVPNVKK+H+VNV ISNSFGFGGH
Sbjct  421   GAAGGLEAIATIKAITTGWLHPTINQDNLEASVTIDTVPNVKKKHEVNVGISNSFGFGGH  480

Query  1540  NSVIVFGPFKP  1572
             NSV+VF PF+P
Sbjct  481   NSVVVFAPFRP  491



>ref|XP_008352312.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X2 [Malus domestica]
Length=453

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/439 (80%), Positives = 391/439 (89%), Gaps = 0/439 (0%)
 Frame = +1

Query  256   AAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISL  435
             +A KCR IK M S  VSAPKR++DPKKR VITGMGLVSVFGSD++TFYN LLEG SGI+L
Sbjct  15    SAPKCRTIKAMASSTVSAPKRETDPKKRTVITGMGLVSVFGSDIDTFYNRLLEGESGITL  74

Query  436   IDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLN  615
             IDRFDAS FSVRFAGQI  F+S+GYID KNDRRLD  WRY +VAGKKAL DANLG EVL 
Sbjct  75    IDRFDASTFSVRFAGQIRDFSSKGYIDGKNDRRLDDCWRYGIVAGKKALEDANLGPEVLP  134

Query  616   NMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLM  795
              MD+TRIG ++G+G GGL  F  GV +L+Q G+KKI+PFFIPYSITNMGSALLAI+ GLM
Sbjct  135   TMDRTRIGVIVGTGMGGLTAFSAGVESLIQKGFKKISPFFIPYSITNMGSALLAIDTGLM  194

Query  796   GPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNH  975
             GP YSISTAC+TANYCFY+AANHIR+GEADIM+ GGTEA +  TGVGGFIACRALSQRN 
Sbjct  195   GPNYSISTACSTANYCFYAAANHIRRGEADIMVVGGTEAAVMPTGVGGFIACRALSQRND  254

Query  976   EPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPR  1155
             EP RASRPWDK+RDGFV+GEG GVLVME L+ A+KRGA +IAEYLGGA TCDAHHMT+PR
Sbjct  255   EPHRASRPWDKNRDGFVMGEGAGVLVMESLESALKRGAPIIAEYLGGAVTCDAHHMTDPR  314

Query  1156  TDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGT  1335
             +DGLGVSSCITKSLEDAGVSPEEVNY+NAHATST+AGD+ E NAIKKVFK+TSE+K+NGT
Sbjct  315   SDGLGVSSCITKSLEDAGVSPEEVNYVNAHATSTLAGDLAEFNAIKKVFKNTSEMKINGT  374

Query  1336  KSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAIS  1515
             KS+IGHGLGA+GGLEAIATIKAI TGWLHPTINQ +LEP VTIDTVPNVKKQH+VNVAIS
Sbjct  375   KSMIGHGLGAAGGLEAIATIKAINTGWLHPTINQDDLEPAVTIDTVPNVKKQHEVNVAIS  434

Query  1516  NSFGFGGHNSVIVFGPFKP  1572
             NSFGFGGHNSV+VF PF P
Sbjct  435   NSFGFGGHNSVVVFAPFSP  453



>gb|KEH21260.1| 3-oxoacyl-(acyl carrier) synthase II [Medicago truncatula]
Length=482

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/468 (72%), Positives = 387/468 (83%), Gaps = 3/468 (1%)
 Frame = +1

Query  178   SLLQYSGLKPVETMQNQPDSVAYKAQ---AAKKCRRIKCMISPAVSAPKRQSDPKKRVVI  348
             SL+QY GL+  + MQ    +   K     +AKKC+ IK M SP V+APKR+ DPKKRVVI
Sbjct  15    SLVQYEGLRMTQKMQMFSAACMPKRNILASAKKCKTIKAMASPTVTAPKREKDPKKRVVI  74

Query  349   TGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKND  528
             TGMGLVSVFGSD++TFY  LLEG SGISLID+FDAS F VRF GQI  F+S+GYID K D
Sbjct  75    TGMGLVSVFGSDIDTFYTKLLEGESGISLIDKFDASSFPVRFGGQIRDFSSKGYIDGKTD  134

Query  529   RRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQS  708
             R LD   +YCLVAGK+AL DANLG E LNNMDKTRIG ++GSG GG+  F N V  L + 
Sbjct  135   RCLDDCMKYCLVAGKRALEDANLGYETLNNMDKTRIGVLVGSGMGGVSTFNNAVDALTRK  194

Query  709   GYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADI  888
             G++KI+PFFIPY+I N  SALLAIE GLMGP YSISTACATANYCF +A++HIR GE DI
Sbjct  195   GHRKISPFFIPYTIPNSSSALLAIETGLMGPNYSISTACATANYCFCAASHHIRSGEVDI  254

Query  889   MiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLD  1068
             M+ GGTEA +  +GVG FIACRALSQRN EP++ASRPWDK RDGFV+GEG GVL+ME L+
Sbjct  255   MVVGGTEASLIPSGVGAFIACRALSQRNEEPKKASRPWDKHRDGFVLGEGSGVLIMESLE  314

Query  1069  HAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHA  1248
              A KRGA +IAEYLGGA TCDAHHMT+PR+DGLGVSSCI K LEDAGVSPEEVNY+NAHA
Sbjct  315   SATKRGARIIAEYLGGAITCDAHHMTDPRSDGLGVSSCINKGLEDAGVSPEEVNYVNAHA  374

Query  1249  TSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPT  1428
             TST+AGD+ EVNAIK+VFKDTSE+KMNGTKS+IGH +GA+G LEAI TIKAITTGWLHPT
Sbjct  375   TSTLAGDLAEVNAIKQVFKDTSELKMNGTKSMIGHCIGAAGALEAITTIKAITTGWLHPT  434

Query  1429  INQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             INQ NLE +VTIDTVPN KK+H+VNV ISNSFGFGGHNSV+VF PF P
Sbjct  435   INQDNLEEDVTIDTVPNFKKKHEVNVVISNSFGFGGHNSVVVFAPFTP  482



>gb|ADE76842.1| unknown [Picea sitchensis]
Length=481

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/471 (72%), Positives = 391/471 (83%), Gaps = 4/471 (1%)
 Frame = +1

Query  160   SSKNGASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKR  339
             SS   +S   Y GL+ +E   +    V +K +A  +  + +  ++   S PKR+ DPKKR
Sbjct  15    SSFTRSSFASYEGLRRIEPATHS-RRVFHKLRAGGRNGKTRATMA---SVPKREKDPKKR  70

Query  340   VVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDA  519
             +VITGMGLVSVFGSDV++FY+ LLEG+SGI  IDRFDAS +SVRFAGQI GF++ GYID 
Sbjct  71    IVITGMGLVSVFGSDVDSFYDKLLEGQSGIGFIDRFDASSYSVRFAGQIRGFSANGYIDG  130

Query  520   KNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttl  699
             KNDRRLD  WRYCLV+GK AL +A+LGKE L  +DK+RIG ++GSG GGL  + +G+  L
Sbjct  131   KNDRRLDDCWRYCLVSGKMALENADLGKEKLEKLDKSRIGVLVGSGIGGLTAYSDGIKAL  190

Query  700   vQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGE  879
             +Q GYK+ITPFFIPY+I+NMGSALLAI+ GLMGP YSISTACATANYC Y+AANHIR+GE
Sbjct  191   LQKGYKRITPFFIPYTISNMGSALLAIDTGLMGPNYSISTACATANYCLYAAANHIRRGE  250

Query  880   ADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVME  1059
             ADIM+AGGTEAGI    VGGFIA RALS RN +P+ ASRPWDKDRDGFV+GEG GVLVME
Sbjct  251   ADIMLAGGTEAGIVPVSVGGFIALRALSHRNDDPQTASRPWDKDRDGFVMGEGAGVLVME  310

Query  1060  RLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYIN  1239
              L+HAMKRGA +IAEYLGGA TCDAHHMT+PR+DGLGVS CI KSLEDAGVSPEEVNYIN
Sbjct  311   SLEHAMKRGAPIIAEYLGGAVTCDAHHMTDPRSDGLGVSMCIRKSLEDAGVSPEEVNYIN  370

Query  1240  AHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWL  1419
             AHATST AGD+ EVNAIKKVF +TS IKMNGTKS+IGH  GA+G LEAIATIKAITTGWL
Sbjct  371   AHATSTRAGDLAEVNAIKKVFTNTSSIKMNGTKSMIGHSFGAAGALEAIATIKAITTGWL  430

Query  1420  HPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             HPTINQ+N EP+VTIDTVPNVKKQH+V+V ISNSFGFGGHNSV+ F PF P
Sbjct  431   HPTINQFNTEPDVTIDTVPNVKKQHEVHVGISNSFGFGGHNSVVTFAPFNP  481



>ref|XP_006579443.1| PREDICTED: uncharacterized protein LOC100808453 isoform X2 [Glycine 
max]
 ref|XP_006579444.1| PREDICTED: uncharacterized protein LOC100808453 isoform X3 [Glycine 
max]
Length=430

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/430 (80%), Positives = 381/430 (89%), Gaps = 1/430 (0%)
 Frame = +1

Query  286   MISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFS  465
             M SP V+APKR+ DPKKRVVITGMGLVSVFGSD++ FYN LLEG SGISLIDRFDAS+F 
Sbjct  1     MASPTVAAPKREKDPKKRVVITGMGLVSVFGSDIDGFYNKLLEGESGISLIDRFDASNFP  60

Query  466   VRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLN-NMDKTRiga  642
             VRF GQI  F+SEGYID KNDRRLD  WRYC+VAGK+AL+DANLG++VL+  MDKTRIG 
Sbjct  61    VRFGGQIRDFSSEGYIDGKNDRRLDDCWRYCIVAGKRALDDANLGQQVLDTQMDKTRIGV  120

Query  643   vigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTA  822
             ++GSG GG+  F  GV  LVQ GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSISTA
Sbjct  121   LVGSGMGGITAFSTGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSISTA  180

Query  823   CATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPW  1002
             CATANYCF SAANHIR+GEADIM+ GGTEA I  +G+GGFIACRALS RN  P++ASRPW
Sbjct  181   CATANYCFCSAANHIRKGEADIMVVGGTEAAIMPSGLGGFIACRALSHRNEGPKKASRPW  240

Query  1003  DKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSC  1182
             DKDRDGFV+GEG GVLVME L+ A KRGA +IAEYLGGA TCD HHMT+PR DGLGVSSC
Sbjct  241   DKDRDGFVMGEGSGVLVMESLESATKRGARIIAEYLGGAITCDDHHMTDPRADGLGVSSC  300

Query  1183  ITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLG  1362
             I+KSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMN TKS+IGHGLG
Sbjct  301   ISKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSELKMNATKSMIGHGLG  360

Query  1363  ASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHN  1542
             A+GGLEAIATIKAITTGWLHPTINQ NLE  VTIDTVPNVKK+H+VNV ISNSFGFGGHN
Sbjct  361   AAGGLEAIATIKAITTGWLHPTINQDNLEASVTIDTVPNVKKKHEVNVGISNSFGFGGHN  420

Query  1543  SVIVFGPFKP  1572
             SV+VF PF+P
Sbjct  421   SVVVFAPFRP  430



>gb|EYU26414.1| hypothetical protein MIMGU_mgv1a024999mg, partial [Erythranthe 
guttata]
Length=452

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/452 (72%), Positives = 380/452 (84%), Gaps = 16/452 (4%)
 Frame = +1

Query  265   KCRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDR  444
             K R++K M SP VSAPK+++DP+KRVVITGMGLVSVFGSD++T+YN LL+G SGI+ IDR
Sbjct  1     KFRKVKAMASPTVSAPKKETDPRKRVVITGMGLVSVFGSDIDTYYNKLLDGVSGIAPIDR  60

Query  445   FDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMD  624
             FDAS++SVRFAGQI  F+SEGYID KNDRRLD +WRYCLVAGK+AL+DA+LGK+VL NMD
Sbjct  61    FDASEYSVRFAGQIRDFSSEGYIDGKNDRRLDDTWRYCLVAGKRALDDASLGKQVLQNMD  120

Query  625   KTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPT  804
             K R+G ++GSG GG   F   +  L+ SGYKK++PFF+PY ITNMGSA+LAI+ G  GP 
Sbjct  121   KMRMGVLVGSGLGGATTFSKAMEALITSGYKKLSPFFVPYIITNMGSAVLAIDTGFRGPA  180

Query  805   YSISTACATANYCFYSAANHIRQGEADIMiaggteagit----------------ttgvg  936
             YSI TACATAN+CF++AANHIR+G+AD+M+AGG EA I                    VG
Sbjct  181   YSIGTACATANHCFFAAANHIRKGDADVMVAGGAEAAIQWRGQKPLGGLAPAAIVPAIVG  240

Query  937   gFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGG  1116
             GFIACRALSQRN EP++ASRPWD++RDGFV+GEG GVLVME L+HA KRGAN+IAEYLGG
Sbjct  241   GFIACRALSQRNDEPDKASRPWDRNRDGFVMGEGAGVLVMESLEHASKRGANIIAEYLGG  300

Query  1117  ATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKK  1296
             A   DAHH+T+P +DGLGVSSC+ K LE + VSPEEVNYINAHATST AGD+ EVNAIKK
Sbjct  301   AVNSDAHHITDPCSDGLGVSSCLIKGLEYSRVSPEEVNYINAHATSTPAGDLAEVNAIKK  360

Query  1297  VFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVP  1476
             VFK+TSEIKMN TKS+IGHGLGASGGLEAIATIKAI TGWLHPTINQY+LE +VTIDTVP
Sbjct  361   VFKNTSEIKMNATKSMIGHGLGASGGLEAIATIKAINTGWLHPTINQYDLESDVTIDTVP  420

Query  1477  NVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             NVKKQHQVNVAISNSFGFGGHNSV VF  F+P
Sbjct  421   NVKKQHQVNVAISNSFGFGGHNSVAVFASFRP  452



>gb|EYU26415.1| hypothetical protein MIMGU_mgv1a006855mg [Erythranthe guttata]
Length=429

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/429 (77%), Positives = 378/429 (88%), Gaps = 0/429 (0%)
 Frame = +1

Query  286   MISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFS  465
             M  P VSAPKR++DPKKRVVITGMGLVSVFGSDV+ +YN LL+G SGI+ IDRFD SD+S
Sbjct  1     MAPPTVSAPKRETDPKKRVVITGMGLVSVFGSDVDAYYNQLLDGVSGITPIDRFDVSDYS  60

Query  466   VRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigav  645
             VRFAGQI  F+SEGYID K+DRRLD  WRYCLVAG KAL+DA+LGK VL+NMDKTR+G +
Sbjct  61    VRFAGQIRNFSSEGYIDGKSDRRLDDCWRYCLVAGLKALDDASLGKRVLDNMDKTRMGVL  120

Query  646   igsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTAC  825
             +GS  GG+  F  G+  LV+ G+KK++PFFIPYSITNMGSALLAIE G MGP YSISTAC
Sbjct  121   VGSAMGGVTAFSGGIEALVRKGHKKVSPFFIPYSITNMGSALLAIETGFMGPVYSISTAC  180

Query  826   ATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWD  1005
             ATAN+C  +AANHIR+G+AD+M+AGG E+G+   GVGGFIACRALSQRN EP +ASRPWD
Sbjct  181   ATANHCLCAAANHIRRGDADVMVAGGAESGVNPVGVGGFIACRALSQRNDEPHKASRPWD  240

Query  1006  KDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCI  1185
             K+RDGFVIGEG GVL+ME L+HAMKRGA ++AE+LGGA TCDAHH+T PR DGLGVSSCI
Sbjct  241   KNRDGFVIGEGAGVLIMESLEHAMKRGAKIVAEFLGGAATCDAHHLTTPRLDGLGVSSCI  300

Query  1186  TKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGA  1365
              K+L DAGVSPEEVNY+NAHATST AGD+ E+NAIK VFK+TSEIKMNGTKS+ GHGLGA
Sbjct  301   IKALYDAGVSPEEVNYVNAHATSTPAGDLAEINAIKNVFKNTSEIKMNGTKSMTGHGLGA  360

Query  1366  SGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNS  1545
             +GGLEAIATIKAI TGWLHPTINQY+LEP VTIDTVPNVKKQHQVNVAISNSFGFGGHNS
Sbjct  361   AGGLEAIATIKAINTGWLHPTINQYDLEPAVTIDTVPNVKKQHQVNVAISNSFGFGGHNS  420

Query  1546  VIVFGPFKP  1572
             V+VF PFKP
Sbjct  421   VVVFAPFKP  429



>ref|XP_010241300.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Nelumbo nucifera]
Length=471

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/463 (71%), Positives = 381/463 (82%), Gaps = 0/463 (0%)
 Frame = +1

Query  184   LQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGL  363
             L+ S L P+     Q  ++       K    + C ++P  SAPKR++DPKKRVVITGMGL
Sbjct  9     LRVSPLDPLRKQSPQLTNIKPTTTTKKNPSTLICAVAPTTSAPKRETDPKKRVVITGMGL  68

Query  364   VSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDH  543
             VSVFG+DV+T+Y+ LL G SGISLIDRFDAS F  RFAGQI GFTS+GYID KNDRRLD 
Sbjct  69    VSVFGNDVDTYYDRLLAGESGISLIDRFDASKFPTRFAGQIRGFTSQGYIDGKNDRRLDD  128

Query  544   SWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKI  723
               RYCLV+GKKAL +A LG + L+ +DK R G ++G+G GGL VF +GV  L++ G++KI
Sbjct  129   CLRYCLVSGKKALENAGLGGDNLSKIDKERAGVLVGTGMGGLTVFSDGVKALIEKGHRKI  188

Query  724   TPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiagg  903
             TPFFIPY+ITNMGSALLAIE G MGP YSISTACAT+NYCFY+AANHIR+GEAD+MIAGG
Sbjct  189   TPFFIPYAITNMGSALLAIELGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMIAGG  248

Query  904   teagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKR  1083
             TEA I   G+GGF+ACRALSQRN +P+ ASRPWDK+RDGFV+GEG GVLVME L+HAMKR
Sbjct  249   TEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKERDGFVMGEGAGVLVMESLEHAMKR  308

Query  1084  GANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVA  1263
              A +IAEYLGGA  CDA+HMT+PR DGLGVSSCI  SLEDAGVSPEEVNYINAHATST+A
Sbjct  309   DAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIESSLEDAGVSPEEVNYINAHATSTIA  368

Query  1264  GDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYN  1443
             GD+ EVNAIKKVFK T EIK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLHP+INQ+N
Sbjct  369   GDLAEVNAIKKVFKSTKEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFN  428

Query  1444  LEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
              EP V  DTV N KKQH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  429   PEPSVEFDTVANKKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  471



>gb|KHG12491.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Gossypium 
arboreum]
Length=473

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/469 (71%), Positives = 391/469 (83%), Gaps = 4/469 (1%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQ---NQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVV  345
             AS L+ S LKP++  +   + P++     +A KK   I    SP VSAPKR+ DPKKRVV
Sbjct  6     ASSLRASPLKPLQKPKFNIHFPNASRLVPRATKKFSSITAS-SPTVSAPKREKDPKKRVV  64

Query  346   ITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKN  525
             ITGMGLVSVFG+DV+ +Y+ LL G SGI LIDRFDAS F  RFAGQI GF+S+GYID KN
Sbjct  65    ITGMGLVSVFGNDVDAYYDKLLAGESGIGLIDRFDASKFPTRFAGQIRGFSSQGYIDGKN  124

Query  526   DRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQ  705
             DRRLD   RYC+VAGKKAL DA+LG + L+ +DK R G ++G+G GGL VF +GV  L++
Sbjct  125   DRRLDDCLRYCIVAGKKALEDADLGGDKLSKIDKERAGVLVGTGMGGLTVFSDGVQNLIE  184

Query  706   SGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEAD  885
              GY+KITPFFIPY+ITNM SALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEA+
Sbjct  185   KGYRKITPFFIPYAITNMSSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEAE  244

Query  886   IMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERL  1065
             +MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L
Sbjct  245   MMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESL  304

Query  1066  DHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAH  1245
             +HAMKRGA +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI +SLEDAGVSPEEVNYINAH
Sbjct  305   EHAMKRGAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIERSLEDAGVSPEEVNYINAH  364

Query  1246  ATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHP  1425
             ATST+AGD+ E+NAIKKVFK+TS IK+N TKS+IGH LGA+GGLEAIA++KAITTGWLHP
Sbjct  365   ATSTLAGDLAEINAIKKVFKNTSGIKINATKSMIGHCLGAAGGLEAIASVKAITTGWLHP  424

Query  1426  TINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             +INQ+N EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  425   SINQFNPEPSVEFDTVANKKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  473



>ref|XP_007158937.1| hypothetical protein PHAVU_002G194300g [Phaseolus vulgaris]
 gb|ESW30931.1| hypothetical protein PHAVU_002G194300g [Phaseolus vulgaris]
Length=467

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/463 (71%), Positives = 382/463 (83%), Gaps = 4/463 (1%)
 Frame = +1

Query  184   LQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGL  363
             L+ S L+P+      P++ A +  AAK+   +    +P VSAP+RQ DPKKRVVITGMGL
Sbjct  9     LRASPLEPLRA----PNNAANRRTAAKRVFFVSATAAPKVSAPQRQKDPKKRVVITGMGL  64

Query  364   VSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDH  543
              SVFG+DVE +Y  LL G+SGI+ IDRFDAS F  RF GQI GF++EGYID KNDRRLD 
Sbjct  65    ASVFGNDVEGYYEKLLSGQSGITAIDRFDASKFPTRFGGQIRGFSAEGYIDGKNDRRLDD  124

Query  544   SWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKI  723
               RYC+VAGKKAL  A+L  + L  +DK R G ++GSG GGL VF +GV  L++ G++KI
Sbjct  125   CLRYCIVAGKKALESADLAADNLTKLDKERAGVLVGSGMGGLTVFSDGVQALIEKGHRKI  184

Query  724   TPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiagg  903
             TPFFIPY+ITNMGSALL I+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+MIAGG
Sbjct  185   TPFFIPYAITNMGSALLGIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMIAGG  244

Query  904   teagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKR  1083
             TEA I   G+GGF+ACRALSQRN +P+ ASRPWDK+RDGFV+GEG GVLVME L+HAMKR
Sbjct  245   TEAAIIPIGLGGFVACRALSQRNDDPKTASRPWDKERDGFVMGEGAGVLVMESLEHAMKR  304

Query  1084  GANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVA  1263
             GA +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI  SLEDAGVSPEEVNYINAHATST+A
Sbjct  305   GAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIQSSLEDAGVSPEEVNYINAHATSTLA  364

Query  1264  GDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYN  1443
             GD+ E+NAIKKVFKDTS IK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLHPTINQ+N
Sbjct  365   GDLAEINAIKKVFKDTSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFN  424

Query  1444  LEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
              EP V  DTV NVK+QH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  425   PEPAVDFDTVANVKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  467



>gb|AGH32916.1| ketoacyl-ACP synthase I [Camellia chekiangoleosa]
Length=469

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/467 (71%), Positives = 387/467 (83%), Gaps = 5/467 (1%)
 Frame = +1

Query  175   ASLLQYSGLKPV-ETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVIT  351
             +SLL+ S L P+ ++  N P +   K  +    +R    IS   SAPKR+SDPKKRVVIT
Sbjct  7     SSLLRPSPLNPLLKSSPNLPTNA--KPSSTSTPKRTLPFIS--ASAPKRESDPKKRVVIT  62

Query  352   GMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDR  531
             GMGLVSVFG++V+ +Y+ LL G SGI LIDRFDAS F  RFAGQI GF S+GYID KNDR
Sbjct  63    GMGLVSVFGNEVDAYYDKLLAGESGIRLIDRFDASKFPTRFAGQIRGFNSQGYIDGKNDR  122

Query  532   RLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSG  711
             RLD   RYC+VAGKKAL DA+LG + L  +DK R G ++G+G GGL VF +GV  L++ G
Sbjct  123   RLDDCLRYCIVAGKKALEDADLGGDRLGKIDKERAGVLVGTGMGGLTVFSDGVQALIERG  182

Query  712   YKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIM  891
             Y+KITPFFIPY+ITNMGSA+LAIE G MGP YSISTACAT+NYCFY+AANHIR+GEAD+M
Sbjct  183   YRKITPFFIPYAITNMGSAVLAIELGFMGPNYSISTACATSNYCFYAAANHIRRGEADLM  242

Query  892   iaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDH  1071
             IAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK+RDGFV+GEG GVLV+E L+H
Sbjct  243   IAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKERDGFVMGEGSGVLVLESLEH  302

Query  1072  AMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHAT  1251
             AMKRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI +SLEDAGVSPEEVNYINAHAT
Sbjct  303   AMKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNYINAHAT  362

Query  1252  STVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTI  1431
             ST AGD+ EVNAIKKVFK+TSEIKMN TKS+IGH LGA+GGLEAIA++KAI TGWLHPTI
Sbjct  363   STPAGDVAEVNAIKKVFKNTSEIKMNSTKSMIGHCLGAAGGLEAIASVKAINTGWLHPTI  422

Query  1432  NQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             NQ+NLEP V  DTV N K+QH+VNVAISNSFGFGGHNSV+VF  FKP
Sbjct  423   NQFNLEPSVEFDTVANKKQQHEVNVAISNSFGFGGHNSVVVFSGFKP  469



>ref|XP_001776124.1| predicted protein [Physcomitrella patens]
 gb|EDQ59035.1| predicted protein [Physcomitrella patens]
Length=470

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/468 (71%), Positives = 387/468 (83%), Gaps = 6/468 (1%)
 Frame = +1

Query  178   SLLQYSGLKPVE--TMQNQ-PDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVI  348
             +L QY GL+     T+Q Q P      +       R++C    A SAPKR++DPKKRVVI
Sbjct  6     ALPQYHGLRAASKSTVQAQRPSQFPASSNGNVGASRVRC---SAQSAPKRETDPKKRVVI  62

Query  349   TGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKND  528
             TGMGLVSVFG+DV TFY+ LLEG SGI +IDRFD S F  +FAGQI GF+++GYID KND
Sbjct  63    TGMGLVSVFGNDVNTFYDKLLEGTSGIDIIDRFDISKFPTKFAGQIRGFSAKGYIDGKND  122

Query  529   RRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQS  708
             RRLD S RYCLV+GK+AL DA LG E LN +DK ++G ++G+G GGL VF +GV  LV+ 
Sbjct  123   RRLDDSLRYCLVSGKRALEDAGLGGENLNQVDKQKVGVLVGTGMGGLTVFSDGVQALVEK  182

Query  709   GYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADI  888
             G+K+ITPFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEAD+
Sbjct  183   GHKRITPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEADM  242

Query  889   MiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLD  1068
             MIAGGTEA I   G+GGF+ACRALS RN  P+ ASRPWDK+R+GFV+GEG GVLVME L+
Sbjct  243   MIAGGTEAAILPIGLGGFVACRALSTRNDSPQTASRPWDKEREGFVMGEGAGVLVMESLE  302

Query  1069  HAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHA  1248
             HA+KRGA ++AEYLGGA TCDA+HMT+PR DGLGVS+CI KSL DAGV+ EEVNYINAHA
Sbjct  303   HALKRGAPIVAEYLGGAVTCDAYHMTDPRADGLGVSTCIEKSLADAGVATEEVNYINAHA  362

Query  1249  TSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPT  1428
             TSTV GD+ EVNAIKKVFK+TSEIKMN TKS+IGH LGA+GGLEAIATIKAI TGWLHP+
Sbjct  363   TSTVVGDLAEVNAIKKVFKNTSEIKMNATKSMIGHCLGAAGGLEAIATIKAIETGWLHPS  422

Query  1429  INQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             INQ+N E  VT DTVPNVKKQH+VNVAISNSFGFGGHNS +VF P++P
Sbjct  423   INQFNPEESVTFDTVPNVKKQHEVNVAISNSFGFGGHNSCVVFAPYRP  470



>ref|XP_010275024.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Nelumbo nucifera]
Length=471

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/463 (71%), Positives = 379/463 (82%), Gaps = 0/463 (0%)
 Frame = +1

Query  184   LQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGL  363
             L+ S L+P+     Q  +V            I   +S   SAPKR++DPKKRVVITGMGL
Sbjct  9     LRISPLEPLRKQSPQLTNVKPITTKKNASTPICAAVSTTTSAPKRETDPKKRVVITGMGL  68

Query  364   VSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDH  543
             VSVFG+DV+T+Y+ LL G SGI+ IDRFDAS F  RFAGQI GFTS+GYID KNDRRLD 
Sbjct  69    VSVFGNDVDTYYDRLLAGESGIAPIDRFDASKFPTRFAGQIRGFTSQGYIDGKNDRRLDD  128

Query  544   SWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKI  723
               RYCLV+GK AL +A L  + L+ +DK R G ++G+G GGL VF NGV  L++ G++KI
Sbjct  129   CLRYCLVSGKMALENAGLRGDNLSKIDKERAGVLVGTGMGGLTVFSNGVQALIEKGHRKI  188

Query  724   TPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiagg  903
             TPFFIPY+ITNMGSALLAIE G MGP YSISTACAT+NYCFY+AANHIR+GEAD+MIAGG
Sbjct  189   TPFFIPYAITNMGSALLAIELGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMIAGG  248

Query  904   teagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKR  1083
             TEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+HAMKR
Sbjct  249   TEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKR  308

Query  1084  GANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVA  1263
             GA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI  SLEDAGVSPEEVNYINAHATST+A
Sbjct  309   GAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIESSLEDAGVSPEEVNYINAHATSTIA  368

Query  1264  GDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYN  1443
             GD+ EVNAIKKVFK+T EIKMN TKS+IGH LGA+GGLEAIAT+KAITTGWLHPTINQ+N
Sbjct  369   GDLAEVNAIKKVFKNTKEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFN  428

Query  1444  LEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
              EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+VF  FKP
Sbjct  429   PEPSVEFDTVANKKQQHEVNVAISNSFGFGGHNSVVVFSAFKP  471



>ref|XP_001762048.1| predicted protein [Physcomitrella patens]
 gb|EDQ73152.1| predicted protein [Physcomitrella patens]
Length=431

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/431 (75%), Positives = 376/431 (87%), Gaps = 1/431 (0%)
 Frame = +1

Query  277   IKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDAS  456
             ++C  S + SAPKR++DPKKRVVITGMGLVSVFG+DV+TFY+ LLEG SGI +IDRFD S
Sbjct  1     VRCAASVS-SAPKRETDPKKRVVITGMGLVSVFGNDVDTFYDKLLEGTSGIDIIDRFDTS  59

Query  457   DFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRi  636
              F  +FAGQI GF+++GYID KNDRRLD S RYCLV+GK+AL DA LG E LN +DK ++
Sbjct  60    KFPTKFAGQIRGFSAKGYIDGKNDRRLDDSLRYCLVSGKRALEDAGLGGENLNQVDKQKV  119

Query  637   gavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSIS  816
             G ++G+G GGL VF +GV  LV+ G+K+ITPFFIPY+ITNMGSALLAI+ GLMGP YSIS
Sbjct  120   GVLVGTGMGGLTVFSDGVQALVEKGHKRITPFFIPYAITNMGSALLAIDLGLMGPNYSIS  179

Query  817   TACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASR  996
             TACAT+NYCFY+AANHIR+GEADIMIAGGTEA I   G+GGF+ACRALS RN  P+ ASR
Sbjct  180   TACATSNYCFYAAANHIRRGEADIMIAGGTEAAILPIGLGGFVACRALSTRNDSPQTASR  239

Query  997   PWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVS  1176
             PWDKDR+GFV+GEG GVLVME L+HA+KRGA ++AEYLGGA TCDA+HMT+PR+DGLGVS
Sbjct  240   PWDKDREGFVMGEGAGVLVMESLEHALKRGAPIVAEYLGGAVTCDAYHMTDPRSDGLGVS  299

Query  1177  SCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHG  1356
             +CI KSLEDAGV+ EEVNYINAHATST+ GD+ EVNAIKKVFKDTSEIKMN TKS+IGH 
Sbjct  300   TCIEKSLEDAGVATEEVNYINAHATSTLVGDLAEVNAIKKVFKDTSEIKMNATKSMIGHC  359

Query  1357  LGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGG  1536
             LGA+GGLEAIATIKAI TGWLHP+INQ+N E  VT DTVPNVKKQH+VNVAISNSFGFGG
Sbjct  360   LGAAGGLEAIATIKAIQTGWLHPSINQFNPEESVTFDTVPNVKKQHEVNVAISNSFGFGG  419

Query  1537  HNSVIVFGPFK  1569
             HNS +VF P++
Sbjct  420   HNSCVVFAPYR  430



>gb|KHG12107.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic -like 
protein [Gossypium arboreum]
Length=474

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/448 (73%), Positives = 373/448 (83%), Gaps = 1/448 (0%)
 Frame = +1

Query  229   PDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNL  408
             P+      + AKK   I    SP VSAPKR+ DPKKRVVITGMGLVSVFG+DV+ +Y  L
Sbjct  28    PNVSTLPPRPAKKFSSITAS-SPTVSAPKREKDPKKRVVITGMGLVSVFGNDVDAYYEKL  86

Query  409   LEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALND  588
             L G SGI LIDRFDAS F  RFAGQI GFTSEGYID KNDRRLD   RYC+VAGKKAL D
Sbjct  87    LAGESGIGLIDRFDASKFPTRFAGQIRGFTSEGYIDGKNDRRLDDCLRYCIVAGKKALED  146

Query  589   ANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSA  768
             A+LG + L+ +DK R G ++G+G GGL VF +GV  L++ GY+KITPFFIPYSITNM SA
Sbjct  147   ADLGADNLSKIDKERTGVLVGTGMGGLTVFSDGVQNLIEKGYRKITPFFIPYSITNMSSA  206

Query  769   LLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIA  948
             LLAIE G MGP YSISTACAT+NYCFY+AANHIR+GEA++MIAGGTEA I   G+GGF+A
Sbjct  207   LLAIELGFMGPNYSISTACATSNYCFYAAANHIRRGEAELMIAGGTEAAIIPIGLGGFVA  266

Query  949   CRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTC  1128
             CRALSQRN +P  ASRPWDKDRDGFV+GEG GVLVME L+HAMKRGA +IAEYLGGA  C
Sbjct  267   CRALSQRNDDPRTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGAVNC  326

Query  1129  DAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKD  1308
             DAHHMT+PR DG GVSSCI +SLEDAGVS EEVNYINAHATST+AGD+ E+NAIKKVFK+
Sbjct  327   DAHHMTDPRADGFGVSSCIERSLEDAGVSHEEVNYINAHATSTLAGDLAEINAIKKVFKN  386

Query  1309  TSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKK  1488
             TS+IK+N TKS+IGH LGASGGLEAIAT+KAITTGWLHP+INQ+N EP V  DTV N KK
Sbjct  387   TSDIKINATKSMIGHCLGASGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVANQKK  446

Query  1489  QHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             QH+VNVAISNSFGFGGHNSV+ F  F+P
Sbjct  447   QHEVNVAISNSFGFGGHNSVVAFSAFEP  474



>emb|CAN70157.1| hypothetical protein VITISV_030014 [Vitis vinifera]
Length=441

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/437 (74%), Positives = 369/437 (84%), Gaps = 0/437 (0%)
 Frame = +1

Query  262   KKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLID  441
             KK   I    SP V+APKR+ DPKKRVVITGMGLVSVFG+DV+ +Y  LL G SGIS ID
Sbjct  5     KKVSFILSAASPTVAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYEKLLAGESGISPID  64

Query  442   RFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNM  621
             RFDAS F  RF GQI GF S+GYID KNDRRLD   RYC+VAGKKAL DA+LG   ++ +
Sbjct  65    RFDASKFPTRFGGQIRGFDSQGYIDGKNDRRLDDCLRYCIVAGKKALEDADLGGADISKI  124

Query  622   DKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGP  801
             DK R G ++G+G GGL VF +GV  L++ G++KITPFFIPY+ITNMGSALLAI+ G MGP
Sbjct  125   DKERAGVLVGTGMGGLTVFSDGVQALIERGHRKITPFFIPYAITNMGSALLAIDLGFMGP  184

Query  802   TYSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEP  981
              YSISTACAT+NYCFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P
Sbjct  185   NYSISTACATSNYCFYAAANHIRRGEADLMIAGGTEAAIIPIGLGGFVACRALSQRNDDP  244

Query  982   ERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTD  1161
             + ASRPWDKDRDGFV+GEG GVLVME L+HAMKRGA +IAEY+GGA  CDA+HMT+PR+D
Sbjct  245   QTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYMGGAVNCDAYHMTDPRSD  304

Query  1162  GLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKS  1341
             GLGVSSCI  SLEDAGVSPEEVNYINAHATST+ GD+ EVNAIKKVFK TSEIKMN TKS
Sbjct  305   GLGVSSCIESSLEDAGVSPEEVNYINAHATSTIVGDLAEVNAIKKVFKSTSEIKMNATKS  364

Query  1342  LIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNS  1521
             +IGH LGA+GGLEAIAT+KAITTGWLHPTINQ+N EP V  DTV N K+QH+VNVAISNS
Sbjct  365   MIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVANKKQQHEVNVAISNS  424

Query  1522  FGFGGHNSVIVFGPFKP  1572
             FGFGGHNSV+VF  FKP
Sbjct  425   FGFGGHNSVVVFSAFKP  441



>ref|XP_002272874.2| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Vitis vinifera]
Length=463

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/440 (74%), Positives = 370/440 (84%), Gaps = 0/440 (0%)
 Frame = +1

Query  253   QAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGIS  432
             Q  KK   I    SP V+APKR+ DPKKRVVITGMGLVSVFG+DV+ +Y  LL G SGIS
Sbjct  24    QPRKKVSFILSAASPTVAAPKREKDPKKRVVITGMGLVSVFGNDVDAYYEKLLAGESGIS  83

Query  433   LIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVL  612
              IDRFDAS F  RF GQI GF S+GYID KNDRRLD   RYC+VAGKKAL DA+LG   +
Sbjct  84    PIDRFDASKFPTRFGGQIRGFDSQGYIDGKNDRRLDDCLRYCIVAGKKALEDADLGGADI  143

Query  613   NNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGL  792
             + +DK R G ++G+G GGL VF +GV  L++ G++KITPFFIPY+ITNMGSALLAI+ G 
Sbjct  144   SKIDKERAGVLVGTGMGGLTVFSDGVQALIERGHRKITPFFIPYAITNMGSALLAIDLGF  203

Query  793   MGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRN  972
             MGP YSISTACAT+NYCFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN
Sbjct  204   MGPNYSISTACATSNYCFYAAANHIRRGEADLMIAGGTEAAIIPIGLGGFVACRALSQRN  263

Query  973   HEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEP  1152
              +P+ ASRPWDKDRDGFV+GEG GVLVME L+HAMKRGA +IAEY+GGA  CDA+HMT+P
Sbjct  264   DDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYMGGAVNCDAYHMTDP  323

Query  1153  RTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNG  1332
             R+DGLGVSSCI  SLEDAGVSPEEVNYINAHATST+ GD+ EVNAIKKVFK TSEIKMN 
Sbjct  324   RSDGLGVSSCIESSLEDAGVSPEEVNYINAHATSTIVGDLAEVNAIKKVFKSTSEIKMNA  383

Query  1333  TKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAI  1512
             TKS+IGH LGA+GGLEAIAT+KAITTGWLHPTINQ+N EP V  DTV N K+QH+VNVAI
Sbjct  384   TKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVANKKQQHEVNVAI  443

Query  1513  SNSFGFGGHNSVIVFGPFKP  1572
             SNSFGFGGHNSV+VF  FKP
Sbjct  444   SNSFGFGGHNSVVVFSAFKP  463



>gb|KHG22354.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic -like 
protein [Gossypium arboreum]
Length=473

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/468 (70%), Positives = 382/468 (82%), Gaps = 2/468 (0%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMI--SPAVSAPKRQSDPKKRVVI  348
             A  L+ S L P++     P          +  +R   +   S  VSAPKR+ DPKKRVV+
Sbjct  6     APTLRASPLNPLKKPNPNPHFRYVFTLPHRPTKRFTSITASSTTVSAPKREKDPKKRVVV  65

Query  349   TGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKND  528
             TGMGLVSVFG+DV+ +Y+ LL G SGI LIDRFDAS F  RFAGQI GFTSEGYID KND
Sbjct  66    TGMGLVSVFGNDVDVYYDKLLSGESGIGLIDRFDASKFPTRFAGQIRGFTSEGYIDGKND  125

Query  529   RRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQS  708
             RRLD   RYC+VAGKKAL DA+LG + L+ +DK R G ++G+G GGL VF +GV  L++ 
Sbjct  126   RRLDDCLRYCMVAGKKALEDADLGGDKLSMIDKERTGVLVGTGMGGLTVFSDGVQNLIEK  185

Query  709   GYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADI  888
             G++KITPFFIPY+ITNMGSALLAIE G MGP YSISTACAT+NYCFY+AANHIR+GEAD+
Sbjct  186   GHRKITPFFIPYAITNMGSALLAIELGFMGPNYSISTACATSNYCFYAAANHIRRGEADL  245

Query  889   MiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLD  1068
             MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK+RDGFV+GEG GVLVME L+
Sbjct  246   MIAGGTEAAIIPIGLGGFVACRALSQRNEDPQTASRPWDKERDGFVMGEGAGVLVMESLE  305

Query  1069  HAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHA  1248
             HAMKRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI +SLEDAGVSPEEVNYINAHA
Sbjct  306   HAMKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNYINAHA  365

Query  1249  TSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPT  1428
             TST+AGD+ E+NAIKKVFK+TSEIK+N TKS+IGH LGA+GGLEAIAT+KAITTGW+HPT
Sbjct  366   TSTLAGDLAEINAIKKVFKNTSEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWVHPT  425

Query  1429  INQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             INQ+N EP V  D V N K+QH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  426   INQFNPEPSVEFDPVANEKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  473



>ref|XP_001762687.1| predicted protein [Physcomitrella patens]
 gb|EDQ72486.1| predicted protein [Physcomitrella patens]
Length=460

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/431 (74%), Positives = 372/431 (86%), Gaps = 0/431 (0%)
 Frame = +1

Query  277   IKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDAS  456
             ++C +S A SAPKR++DPKKRVVITGMGLVSVFG+DV TFY+ LLEG SGI  IDRFD S
Sbjct  29    VRCAVSQAQSAPKRETDPKKRVVITGMGLVSVFGNDVNTFYDKLLEGASGIDTIDRFDIS  88

Query  457   DFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRi  636
              F  +FAGQI GF+S+GYID KNDRRLD + RYCLV+GK+AL DA LG E LN +DK ++
Sbjct  89    KFPTKFAGQIKGFSSQGYIDGKNDRRLDDTLRYCLVSGKRALEDAGLGGENLNQVDKKKV  148

Query  637   gavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSIS  816
             G +IG+G GGL VF +GV  LV+ G+K+ITPFFIPY+ITNMGSALLAI+ GLMGP YSIS
Sbjct  149   GVLIGTGMGGLSVFSDGVQALVEKGHKRITPFFIPYTITNMGSALLAIDLGLMGPNYSIS  208

Query  817   TACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASR  996
             TACAT+NYCFY+AANHIR+GEA+IM+AGGTEA I   G+GGF+ACRALS RN  P+ ASR
Sbjct  209   TACATSNYCFYAAANHIRRGEAEIMVAGGTEAAILPIGLGGFVACRALSTRNDSPQTASR  268

Query  997   PWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVS  1176
             PWDK+R+GFV+GEG GVLVME L+HA+KRGA ++AEYLGG  TCDA+HMT+PR DGLGVS
Sbjct  269   PWDKEREGFVMGEGAGVLVMESLEHALKRGAPIVAEYLGGGVTCDAYHMTDPRADGLGVS  328

Query  1177  SCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHG  1356
             SCI  SLEDAGV+ EEVNYINAHATST+ GD+ EVNA+K VFKDTSEIKMN TKS+IGH 
Sbjct  329   SCIEMSLEDAGVAAEEVNYINAHATSTIVGDLAEVNALKNVFKDTSEIKMNATKSMIGHC  388

Query  1357  LGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGG  1536
             LGA+GGLEAIATIKAI TGWLHP+INQ+N E +VT DTVPNVKKQH+VNVAISNSFGFGG
Sbjct  389   LGAAGGLEAIATIKAIETGWLHPSINQFNAEEQVTFDTVPNVKKQHEVNVAISNSFGFGG  448

Query  1537  HNSVIVFGPFK  1569
             HNS +VF P++
Sbjct  449   HNSCVVFAPYR  459



>gb|ACZ06069.1| beta-ketoacyl-ACP synthetase I [Arachis hypogaea]
Length=470

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/470 (70%), Positives = 380/470 (81%), Gaps = 15/470 (3%)
 Frame = +1

Query  184   LQYSGLKPVETMQNQPDS-------VAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRV  342
             L+ S L P+    N P S       V++   AA         +SP VSAP+RQ DPKKRV
Sbjct  9     LRVSPLDPLRKSTNAPISTRRASKRVSFTVSAAA--------VSPKVSAPQRQKDPKKRV  60

Query  343   VITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAK  522
             VITGMGL SVFG+DV+TFY+ LL G SGI+ IDRFDAS F  RF GQI GF+SEGYID K
Sbjct  61    VITGMGLASVFGNDVDTFYDRLLAGESGITTIDRFDASKFPTRFGGQIRGFSSEGYIDGK  120

Query  523   NDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlv  702
             NDRRLD   RYC+VAGKKAL +A+LG E LN +DK + G ++GSG GGL VF +GV  L+
Sbjct  121   NDRRLDDCLRYCIVAGKKALENADLGGEKLNKLDKEKAGVLVGSGMGGLTVFSDGVQALI  180

Query  703   QSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEA  882
             + G++KITPFFIPY+ITNMGSALL I+ G MGP YSISTACAT+NYCFY+AANHIR+GEA
Sbjct  181   EKGHRKITPFFIPYAITNMGSALLGIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEA  240

Query  883   DIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMER  1062
             D+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME 
Sbjct  241   DLMIAGGTEAAIIPIGLGGFVACRALSQRNDDPKTASRPWDKDRDGFVMGEGSGVLVMES  300

Query  1063  LDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINA  1242
             L+HAM+RGA +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI  SLEDAGVSPEEVNYIN 
Sbjct  301   LEHAMRRGAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIQSSLEDAGVSPEEVNYINC  360

Query  1243  HATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLH  1422
             HATST+AGD+ E+NAIKK+FK T  IK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLH
Sbjct  361   HATSTLAGDLAEINAIKKIFKKTDGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLH  420

Query  1423  PTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             P+INQ+N EP V  DTV NVKKQH++NV ISNSFGFGGHNSV+ F  FKP
Sbjct  421   PSINQFNPEPAVDFDTVANVKKQHEINVGISNSFGFGGHNSVVAFSAFKP  470



>gb|ACJ07141.1| beta-ketoacyl-ACP synthase I-2 [Arachis hypogaea]
Length=470

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/470 (70%), Positives = 380/470 (81%), Gaps = 15/470 (3%)
 Frame = +1

Query  184   LQYSGLKPVETMQNQPDS-------VAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRV  342
             L+ S L P+    N P S       V++   AA         +SP VSAP+RQ DPKKRV
Sbjct  9     LRVSPLDPLRKSTNAPISTRRASKRVSFTVSAAA--------VSPKVSAPQRQKDPKKRV  60

Query  343   VITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAK  522
             VITGMGL SVFG+DV+TFY+ LL G SGI+ IDRFDAS F  RF GQI GF+SEGYID K
Sbjct  61    VITGMGLASVFGNDVDTFYDRLLAGESGITTIDRFDASKFPTRFGGQIRGFSSEGYIDGK  120

Query  523   NDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlv  702
             NDRRLD   RYC+VAGKKAL +A+LG E LN +DK + G ++GSG GGL VF +GV  L+
Sbjct  121   NDRRLDDCLRYCIVAGKKALENADLGGEKLNKLDKEKAGVLVGSGMGGLTVFSDGVQALI  180

Query  703   QSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEA  882
             + G++KITPFFIPY+ITNMGSALL I+ G MGP YSISTACAT+NYCFY+AANHIR+GEA
Sbjct  181   EKGHRKITPFFIPYAITNMGSALLGIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEA  240

Query  883   DIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMER  1062
             D+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME 
Sbjct  241   DLMIAGGTEAAIIPIGLGGFVACRALSQRNDDPKTASRPWDKDRDGFVMGEGSGVLVMES  300

Query  1063  LDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINA  1242
             L+HAM+RGA +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI  SLEDAGVSPEEVNYIN 
Sbjct  301   LEHAMRRGAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIQSSLEDAGVSPEEVNYINC  360

Query  1243  HATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLH  1422
             HATST+AGD+ E+NAIKK+FK T  IK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLH
Sbjct  361   HATSTLAGDLAEINAIKKIFKKTDGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLH  420

Query  1423  PTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             P+INQ+N EP V  DTV NVKKQH++NV ISNSFGFGGHNSV+ F  FKP
Sbjct  421   PSINQFNPEPAVDFDTVANVKKQHEINVGISNSFGFGGHNSVVAFSAFKP  470



>ref|XP_010529153.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Tarenaya hassleriana]
Length=469

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/463 (71%), Positives = 381/463 (82%), Gaps = 2/463 (0%)
 Frame = +1

Query  184   LQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGL  363
             L+ S   P+    N+       A+  +K   I    S AVSAPKR++DPKKRVVITG GL
Sbjct  9     LRASPPNPLRKHSNRQSHQIANARPTRKQAFIAA--SAAVSAPKRETDPKKRVVITGTGL  66

Query  364   VSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDH  543
             VSVFG+DV+ +Y  LL G+SGIS IDRFDAS F  RF GQI GF+SEGYID KNDRRLD 
Sbjct  67    VSVFGNDVDAYYEKLLAGKSGISNIDRFDASKFPTRFGGQIRGFSSEGYIDGKNDRRLDD  126

Query  544   SWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKI  723
               +YC+VAGKKAL +A+LG + LN +DK R G ++G+G GGL VF +GV  L++ G+++I
Sbjct  127   CLKYCIVAGKKALENADLGGDKLNKIDKLRAGVLVGTGMGGLTVFSDGVQALIEKGHRRI  186

Query  724   TPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiagg  903
             TPFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEAD+M+AGG
Sbjct  187   TPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEADMMLAGG  246

Query  904   teagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKR  1083
             TEA I   G+GGF+ACRALSQRN +PE ASRPWDKDRDGFV+GEG GVLVME L+HAMKR
Sbjct  247   TEAAIIPIGLGGFVACRALSQRNDDPETASRPWDKDRDGFVMGEGAGVLVMESLEHAMKR  306

Query  1084  GANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVA  1263
             GA +IAEYLGGA  CDAHHMT+PR+DGLGVSSCI + LEDAGVS EEVNYINAHATST+ 
Sbjct  307   GAPIIAEYLGGAVNCDAHHMTDPRSDGLGVSSCIERCLEDAGVSHEEVNYINAHATSTLV  366

Query  1264  GDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYN  1443
             GD+ E+NAIKKVFK+TSEIK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLHPTINQ+N
Sbjct  367   GDLAEINAIKKVFKNTSEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFN  426

Query  1444  LEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
              EP V  DTVPN KKQH VNVAISNSFGFGGHNSV+ F  F+P
Sbjct  427   PEPAVDFDTVPNQKKQHDVNVAISNSFGFGGHNSVVAFSAFRP  469



>gb|ACJ07140.1| beta-ketoacyl-ACP synthase I-1 [Arachis hypogaea]
Length=470

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/470 (70%), Positives = 380/470 (81%), Gaps = 15/470 (3%)
 Frame = +1

Query  184   LQYSGLKPVETMQNQPDS-------VAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRV  342
             L+ S L P+    N P S       V++   AA         +SP VSAP+RQ DPKKRV
Sbjct  9     LRVSPLDPLRKSTNPPISTRRASKRVSFTVSAAA--------VSPKVSAPQRQKDPKKRV  60

Query  343   VITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAK  522
             VITGMGL SVFG+DV+TFY+ LL G SGI+ IDRFDAS F  RF GQI GF+SEGYID K
Sbjct  61    VITGMGLASVFGNDVDTFYDRLLAGESGITTIDRFDASKFPTRFGGQIRGFSSEGYIDGK  120

Query  523   NDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlv  702
             NDRRLD   RYC+VAGKKAL +A+LG E LN +DK + G ++GSG GGL VF +GV  L+
Sbjct  121   NDRRLDDCLRYCIVAGKKALENADLGGEKLNKLDKEKAGVLVGSGMGGLTVFSDGVQALI  180

Query  703   QSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEA  882
             + G++KITPFFIPY+ITNMGSALL I+ G MGP YSISTACAT+NYCFY+AANHIR+GEA
Sbjct  181   EKGHRKITPFFIPYAITNMGSALLGIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEA  240

Query  883   DIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMER  1062
             D+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME 
Sbjct  241   DLMIAGGTEAAIIPIGLGGFVACRALSQRNDDPKTASRPWDKDRDGFVMGEGSGVLVMES  300

Query  1063  LDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINA  1242
             L+HAM+RGA +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI  SLEDAGVSPEEVNYIN 
Sbjct  301   LEHAMRRGAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIQSSLEDAGVSPEEVNYINC  360

Query  1243  HATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLH  1422
             HATST+AGD+ E+NAIKK+FK T  IK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLH
Sbjct  361   HATSTLAGDLAEINAIKKIFKKTDGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLH  420

Query  1423  PTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             P+INQ+N EP V  DTV NVKKQH++NV ISNSFGFGGHNSV+ F  FKP
Sbjct  421   PSINQFNPEPAVDFDTVANVKKQHEINVGISNSFGFGGHNSVVAFSAFKP  470



>ref|XP_006365563.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Solanum tuberosum]
Length=469

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/460 (70%), Positives = 376/460 (82%), Gaps = 2/460 (0%)
 Frame = +1

Query  193   SGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSV  372
             S L P+   +N P     ++  AK+   I    +  VSAPKR+ DPKKRVVITG GLVSV
Sbjct  12    SPLDPLR--KNMPQFTNVRSLGAKRVPFIISASASTVSAPKREKDPKKRVVITGTGLVSV  69

Query  373   FGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWR  552
             FG+DV+T+Y  LL G SGISLIDRFDAS F  RF GQI GFTSEGYID KNDRRLD   R
Sbjct  70    FGNDVDTYYERLLAGESGISLIDRFDASKFPTRFGGQIRGFTSEGYIDGKNDRRLDDCLR  129

Query  553   YCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPF  732
             Y +VAGKKAL +A+LG + L  +DK R G ++G+G GGL VF +GV  L++ G++KITPF
Sbjct  130   YAIVAGKKALENADLGGDRLEKIDKERAGVLVGTGMGGLTVFSDGVQNLIEKGHRKITPF  189

Query  733   FIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggtea  912
             FIPY+ITNMGSALL I+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+M+AGGTEA
Sbjct  190   FIPYAITNMGSALLGIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMLAGGTEA  249

Query  913   gitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGAN  1092
              +   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG G+LVME L+HAMKRGA 
Sbjct  250   AMIPIGLGGFVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGILVMESLEHAMKRGAP  309

Query  1093  VIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDI  1272
             +IAEYLGGA  CDA+HMT+PR DGLGVSSCI  SLEDAGVSPEEVNYINAHATST+ GD+
Sbjct  310   IIAEYLGGAVNCDAYHMTDPRADGLGVSSCILSSLEDAGVSPEEVNYINAHATSTIVGDL  369

Query  1273  VEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEP  1452
              E+NA+KKVFK TS IKMN TKS+IGH LGA+GGLEAIATIKAITTGW+HP+INQ+N EP
Sbjct  370   AEINAVKKVFKTTSGIKMNATKSMIGHCLGAAGGLEAIATIKAITTGWVHPSINQFNPEP  429

Query  1453  EVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
              V  DTVPN K+QH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  430   SVEFDTVPNKKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  469



>ref|XP_006467495.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Citrus sinensis]
 gb|KDO78133.1| hypothetical protein CISIN_1g012221mg [Citrus sinensis]
Length=468

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/467 (69%), Positives = 382/467 (82%), Gaps = 5/467 (1%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAV-SAPKRQSDPKKRVVIT  351
             +S L  S L P+ +  N          A    RR+  + + +  SAPKR+ DPKKRVVIT
Sbjct  6     SSSLHASPLNPLRSKSN----FNLPNNARPTARRVSFITASSTKSAPKREKDPKKRVVIT  61

Query  352   GMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDR  531
             GMGLVSVFG+DV+ +YN LL+G SGI++IDRFDAS F  RF GQI GF++EGYID KNDR
Sbjct  62    GMGLVSVFGNDVDAYYNKLLDGESGITMIDRFDASKFPTRFGGQIRGFSAEGYIDGKNDR  121

Query  532   RLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSG  711
             RLD   RYC+VAGKKAL DA+LG ++   +DK R G ++G+G GGL VF +GV  L++ G
Sbjct  122   RLDDCLRYCIVAGKKALEDADLGADISKKIDKERAGVLVGTGMGGLTVFSDGVQALIEKG  181

Query  712   YKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIM  891
             ++KITPFFIPY+ITNMGSALLAI+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+M
Sbjct  182   HRKITPFFIPYAITNMGSALLAIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEADLM  241

Query  892   iaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDH  1071
             +AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+H
Sbjct  242   LAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEH  301

Query  1072  AMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHAT  1251
             AMKRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI  SLEDAGVSPEEVNYINAHAT
Sbjct  302   AMKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIESSLEDAGVSPEEVNYINAHAT  361

Query  1252  STVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTI  1431
             ST+AGD+ E+NAIKKVFK+T+ IK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLHP+I
Sbjct  362   STLAGDLAEINAIKKVFKNTTGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSI  421

Query  1432  NQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             NQ+N EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  422   NQFNPEPSVEFDTVANKKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  468



>ref|XP_009101526.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Brassica rapa]
Length=470

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/466 (70%), Positives = 379/466 (81%), Gaps = 1/466 (0%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITG  354
             +S L+ S   P+ T  N+  S      A    RR     S +VSAPKR++DPKKRVVITG
Sbjct  6     SSSLRASPPNPLRTPSNR-QSHQITTNARPTTRRSFISASASVSAPKRETDPKKRVVITG  64

Query  355   MGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRR  534
             MGLVSVFG+DV+ +Y  LL G SGISLIDRFDAS F  RF GQI GF+SEGYID KN+RR
Sbjct  65    MGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGKNERR  124

Query  535   LDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGY  714
             LD   +YC+VAGKKAL  ANLG + LN +DK + G ++G+G GGL VF +GV  LV+ G+
Sbjct  125   LDDCLKYCIVAGKKALESANLGGDKLNTIDKQKAGVLVGTGMGGLTVFSDGVQALVEKGH  184

Query  715   KKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMi  894
             ++I+PFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEAD+M+
Sbjct  185   RRISPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEADMMV  244

Query  895   aggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHA  1074
             AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK RDGFV+GEG GVLVME L+HA
Sbjct  245   AGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKQRDGFVMGEGAGVLVMESLEHA  304

Query  1075  MKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATS  1254
             MKRGA ++AEYLGGA  CDAHHMT+PR DGLGVSSCI   LEDAGVSPEEVNYINAHATS
Sbjct  305   MKRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSSCIESCLEDAGVSPEEVNYINAHATS  364

Query  1255  TVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTIN  1434
             T+AGD+ E+NAIKKVFK TS IK+N TKS+IGH LGA+GGLEAIAT+KAI TGWLHP+IN
Sbjct  365   TLAGDLAEINAIKKVFKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSIN  424

Query  1435  QYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             Q+N EP V  DTV N KKQH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  425   QFNPEPAVDFDTVANEKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  470



>ref|XP_002316735.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Populus trichocarpa]
 gb|EEE97347.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Populus trichocarpa]
Length=466

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/432 (74%), Positives = 369/432 (85%), Gaps = 0/432 (0%)
 Frame = +1

Query  277   IKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDAS  456
             IK   S  VSAPKR+ DPKKRVVITGMGLVSVFG+DV+ +Y+ LL G SGI  IDRFDAS
Sbjct  35    IKASSSSTVSAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGIGTIDRFDAS  94

Query  457   DFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRi  636
              F  RFAGQI GF ++GYID KNDRRLD+  RYC+VAGKKAL DA+LG   L+ +DK + 
Sbjct  95    KFPTRFAGQIRGFNAQGYIDGKNDRRLDNCLRYCIVAGKKALEDADLGGNNLSKIDKEKA  154

Query  637   gavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSIS  816
             G ++G+G GGL VF +GV +L++ G++KITPFFIPY+ITNMGSALL IE G MGP YSIS
Sbjct  155   GVLVGTGMGGLTVFSDGVQSLIEKGHRKITPFFIPYAITNMGSALLGIELGFMGPNYSIS  214

Query  817   TACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASR  996
             TACAT+NYCFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASR
Sbjct  215   TACATSNYCFYAAANHIRRGEADMMIAGGTEAAIIPIGLGGFVACRALSQRNDDPKTASR  274

Query  997   PWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVS  1176
             PWD+DRDGFV+GEG GVLVME L+HAMKRGA +IAEYLGGA  CDA+HMT+PR DGLGVS
Sbjct  275   PWDRDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVS  334

Query  1177  SCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHG  1356
             SCI +SLEDAGVSPEEVNYINAHATST+AGD+ E+NAIKKVFK+TSEIK+N TKS+IGH 
Sbjct  335   SCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKNTSEIKINATKSMIGHC  394

Query  1357  LGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGG  1536
             LGASGGLEAIAT+KAITTGWLHP+INQ+N EP V  DTV N K+QH VNVAISNSFGFGG
Sbjct  395   LGASGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVANKKQQHAVNVAISNSFGFGG  454

Query  1537  HNSVIVFGPFKP  1572
             HNSV+ F  FKP
Sbjct  455   HNSVVAFSAFKP  466



>gb|ABM53471.1| plastid 3-keto-acyl-ACP synthase I [Helianthus annuus]
Length=462

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/467 (69%), Positives = 379/467 (81%), Gaps = 11/467 (2%)
 Frame = +1

Query  178   SLLQYSGLK--PVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVIT  351
             +LLQ   L+  P++ ++ +P    +K          +  +  + +APKR+ DPKKRVVIT
Sbjct  5     ALLQSPHLRVSPLDPLRTRPKPTNFKP---------RTTVIASATAPKREKDPKKRVVIT  55

Query  352   GMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDR  531
             GMGLVSVFG+DV+T+Y  LL G SGI LIDRFDAS F  RF GQI GF S+GYID KNDR
Sbjct  56    GMGLVSVFGNDVDTYYEKLLAGESGIGLIDRFDASKFPTRFGGQIRGFKSDGYIDGKNDR  115

Query  532   RLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSG  711
             RLD   RYC+VAGKKAL DA+LG + L+ +DK R G ++G+G GGL VF +GV  L++ G
Sbjct  116   RLDDCLRYCIVAGKKALEDADLGGDKLSKIDKERAGVLVGTGMGGLTVFSDGVQNLIEKG  175

Query  712   YKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIM  891
             Y+KITPFFIPY+ITNMGSALLAI+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+M
Sbjct  176   YRKITPFFIPYAITNMGSALLAIDVGFMGPNYSISTACATSNYCFYAAANHIRRGEADMM  235

Query  892   iaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDH  1071
             IAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+H
Sbjct  236   IAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEH  295

Query  1072  AMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHAT  1251
             AMKRGA +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI  SLEDAGVSPEEVNYINAHAT
Sbjct  296   AMKRGAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIQSSLEDAGVSPEEVNYINAHAT  355

Query  1252  STVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTI  1431
             ST+ GD+ EVNA+KKVFK T  IKMN TKS+IGH LGA+GGLEAIAT+KAI TGWLHPTI
Sbjct  356   STLVGDLAEVNAVKKVFKSTDGIKMNSTKSMIGHCLGAAGGLEAIATVKAIQTGWLHPTI  415

Query  1432  NQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             NQ+N EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  416   NQFNPEPAVEFDTVANQKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  462



>ref|XP_007025113.1| 3-ketoacyl-acyl carrier protein synthase I isoform 1 [Theobroma 
cacao]
 gb|EOY27735.1| 3-ketoacyl-acyl carrier protein synthase I isoform 1 [Theobroma 
cacao]
Length=548

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/468 (69%), Positives = 381/468 (81%), Gaps = 2/468 (0%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMI--SPAVSAPKRQSDPKKRVVI  348
             A  L+ S L P++     P          +  +R   +   SP VSAPKR+ DPKKRVVI
Sbjct  81    APSLRGSPLNPLQKPNPNPHFSNVSRLRPRPTKRFSSITASSPTVSAPKREKDPKKRVVI  140

Query  349   TGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKND  528
             TGMGLVSVFG+DV+ +Y+ LL G SGI  IDRFDAS F  RF GQI GFTS+GYID KND
Sbjct  141   TGMGLVSVFGNDVDAYYDKLLAGESGIGPIDRFDASKFPTRFGGQIRGFTSQGYIDGKND  200

Query  529   RRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQS  708
             RRLD   RYC+VAGKKAL DA+LG + L+ +DK R G ++G+G GGL VF +GV  L++ 
Sbjct  201   RRLDDCLRYCIVAGKKALEDADLGGDKLSKIDKERTGVLVGTGMGGLTVFSDGVQNLIEK  260

Query  709   GYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADI  888
             GY+KITPFFIPY+ITNM SALL IE G MGP YSISTACAT+NYCFY+AANHIR+GEA++
Sbjct  261   GYRKITPFFIPYAITNMASALLGIELGFMGPNYSISTACATSNYCFYAAANHIRRGEAEL  320

Query  889   MiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLD  1068
             M+AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+
Sbjct  321   MLAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKDRDGFVMGEGSGVLVMESLE  380

Query  1069  HAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHA  1248
             HAMKRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI +SLEDAGVSPEEVN+INAHA
Sbjct  381   HAMKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNHINAHA  440

Query  1249  TSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPT  1428
             TST+AGD+ E+NAIKKVFK+TS+IK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLHP+
Sbjct  441   TSTLAGDLAEINAIKKVFKNTSDIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPS  500

Query  1429  INQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             INQ+N EP V  DTV NVK+QH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  501   INQFNPEPSVEFDTVANVKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  548



>ref|NP_001238610.1| beta-ketoacyl-ACP synthetase I [Glycine max]
 gb|AAF61730.1|AF243182_1 beta-ketoacyl-ACP synthetase I [Glycine max]
Length=469

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/463 (70%), Positives = 381/463 (82%), Gaps = 2/463 (0%)
 Frame = +1

Query  184   LQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGL  363
             L+ S L P+    N   +   ++ +AK+   +   ++P VSAP+RQ DPKKRVVITGMGL
Sbjct  9     LRASPLDPLRGPNNA--AANRRSSSAKRVFFVSATVAPKVSAPQRQKDPKKRVVITGMGL  66

Query  364   VSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDH  543
              SVFG+DVE +Y  LL G SGI+ IDRFDAS F  RF GQI GF++EGYID KNDRRLD 
Sbjct  67    ASVFGNDVEGYYEKLLAGESGITAIDRFDASKFPTRFGGQIRGFSAEGYIDGKNDRRLDD  126

Query  544   SWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKI  723
               RYC+VAGKKAL +A+L  +  + +DK R G ++GSG GGL VF +GV  L++ G++KI
Sbjct  127   CLRYCIVAGKKALENADLAPDNHSKIDKERAGVLVGSGMGGLTVFSDGVQALIEKGHRKI  186

Query  724   TPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiagg  903
             TPFFIPY+ITNMGSALL I+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+MIAGG
Sbjct  187   TPFFIPYAITNMGSALLGIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMIAGG  246

Query  904   teagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKR  1083
             TEA I   G+GGF+ACRALSQRN +P+ ASRPWDK+RDGFV+GEG GVLVME L+HAMKR
Sbjct  247   TEAAIIPIGLGGFVACRALSQRNDDPKTASRPWDKERDGFVMGEGAGVLVMESLEHAMKR  306

Query  1084  GANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVA  1263
             GA +IAEYLGGA  CDA+HMT+PR+DGLGVS+CI  SLEDAGVSPEEVNYINAHATST+A
Sbjct  307   GAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSTCIQSSLEDAGVSPEEVNYINAHATSTLA  366

Query  1264  GDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYN  1443
             GD+ E+NAIKKVFKDTS IK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLHPTINQ+N
Sbjct  367   GDLAEINAIKKVFKDTSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFN  426

Query  1444  LEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
              EP V  DTV NVK+QH++NVAISNSFGFGGHNSV+ F  FKP
Sbjct  427   PEPAVDFDTVANVKQQHEINVAISNSFGFGGHNSVVAFSAFKP  469



>ref|XP_006366097.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Solanum tuberosum]
Length=468

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/466 (70%), Positives = 378/466 (81%), Gaps = 4/466 (1%)
 Frame = +1

Query  184   LQYSGLKPVET---MQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITG  354
             +Q S L+P      ++  P     K    K+   I    S  VSAP R+ DPKKRVVITG
Sbjct  4     IQSSSLRPSPVDPFLKTIPQFTNVKPLRPKRTPFISAS-STTVSAPTREKDPKKRVVITG  62

Query  355   MGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRR  534
             MGLVSVFG+DV+ +Y+ LL G SG++LIDRFDAS F  RF GQI GF ++GYID KNDRR
Sbjct  63    MGLVSVFGNDVDAYYDKLLAGESGVTLIDRFDASKFPTRFGGQIRGFKADGYIDGKNDRR  122

Query  535   LDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGY  714
             LD   RYC+VAGKKAL +A+LG +    +DK R G ++G+G GGL VF +GV  L++ G+
Sbjct  123   LDDCLRYCIVAGKKALENADLGIDRDKKIDKERAGVLVGTGMGGLTVFSDGVQALIEKGH  182

Query  715   KKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMi  894
             +KITPFFIPY+ITNMGSALLAI+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+MI
Sbjct  183   RKITPFFIPYAITNMGSALLAIDVGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMI  242

Query  895   aggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHA  1074
             AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+HA
Sbjct  243   AGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHA  302

Query  1075  MKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATS  1254
             MKRGA +IAEYLGGA  CDAHHMT+PR DGLGVSSCI  SLEDAGVSPEEVNYINAHATS
Sbjct  303   MKRGAPIIAEYLGGAVNCDAHHMTDPRADGLGVSSCILSSLEDAGVSPEEVNYINAHATS  362

Query  1255  TVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTIN  1434
             T+ GD+ EVNAIKKVFK+TSEIKMN TKS+IGH LGA+GGLEAIAT+KAI TGWLHP+IN
Sbjct  363   TIVGDLAEVNAIKKVFKNTSEIKMNATKSMIGHCLGAAGGLEAIATVKAIKTGWLHPSIN  422

Query  1435  QYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             Q+N EP V  DTVPN K+QH++NVAISNSFGFGGHNSV+VF  FKP
Sbjct  423   QFNTEPSVEFDTVPNKKQQHEINVAISNSFGFGGHNSVVVFSDFKP  468



>emb|CDX77646.1| BnaC07g19000D [Brassica napus]
Length=469

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/466 (70%), Positives = 379/466 (81%), Gaps = 2/466 (0%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITG  354
             +S L+ S   P+ T  N+       A+     RR     S +VSAPKR++DPKKRVVITG
Sbjct  6     SSSLRASPPNPLRTPSNRQSHQITNAR--PTMRRSFISASASVSAPKRETDPKKRVVITG  63

Query  355   MGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRR  534
             MGLVSVFG+DV+ +Y  LL G SGISLIDRFDAS F  RF GQI GF+SEGYID KN+RR
Sbjct  64    MGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGKNERR  123

Query  535   LDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGY  714
             LD   +YC+VAGKKAL  ANLG + LN +DK R G ++G+G GGL VF +GV  LV+ G+
Sbjct  124   LDDCLKYCIVAGKKALESANLGGDKLNTIDKQRAGVLVGTGMGGLTVFSDGVQALVEKGH  183

Query  715   KKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMi  894
             ++I+PFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEAD+M+
Sbjct  184   RRISPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEADMMV  243

Query  895   aggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHA  1074
             AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK RDGFV+GEG GVLVME L+HA
Sbjct  244   AGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKQRDGFVMGEGAGVLVMESLEHA  303

Query  1075  MKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATS  1254
             MKRGA ++AEYLGGA  CDAHHMT+PR DGLGVSSCI   LEDAGVSPEEVNYINAHATS
Sbjct  304   MKRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSSCIESCLEDAGVSPEEVNYINAHATS  363

Query  1255  TVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTIN  1434
             T+AGD+ E+NA+KKVFK TS IK+N TKS+IGH LGA+GGLEAIAT+KAI TGWLHP+IN
Sbjct  364   TLAGDLAEINAVKKVFKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSIN  423

Query  1435  QYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             Q+N EP V  DTV N KKQH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  424   QFNPEPAVDFDTVANEKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  469



>ref|XP_009401483.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=463

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/439 (72%), Positives = 371/439 (85%), Gaps = 2/439 (0%)
 Frame = +1

Query  262   KKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLID  441
             ++  R    +  + + P+R++DPKKRVVITGMGLVSVFG+DV+ +Y+ LL+G  GI LID
Sbjct  25    RRSPRPLTAVRASAAPPRRETDPKKRVVITGMGLVSVFGNDVDAYYDKLLQGECGIGLID  84

Query  442   RFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLG--KEVLN  615
             RFDAS F  RFAGQI GF+SEGYID KNDRRLD   RYCLV+GKKAL  A LG   + LN
Sbjct  85    RFDASKFPTRFAGQIRGFSSEGYIDGKNDRRLDGCLRYCLVSGKKALESAGLGVGSQTLN  144

Query  616   NMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLM  795
              +DK R G ++G+G GGL +F +GV  L++ G++KITPFFIPY+ITNMGSALLA++ G M
Sbjct  145   KIDKVRAGVLVGTGMGGLSIFSDGVQALIEKGHRKITPFFIPYAITNMGSALLAMDIGFM  204

Query  796   GPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNH  975
             GP YSISTACAT+NYCFY+AANHIR+GEADIMIAGGTEA I   GVGGF+ACRALSQRN 
Sbjct  205   GPNYSISTACATSNYCFYAAANHIRRGEADIMIAGGTEAAIIPIGVGGFVACRALSQRND  264

Query  976   EPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPR  1155
             +P+ ASRPWDKDRDGFV+GEG GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT+PR
Sbjct  265   DPKTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPR  324

Query  1156  TDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGT  1335
              DGLGVSSC+ KSLEDAGV+PEEVNYINAHATST+AGD+ EVNAIK+VFKD S +KMN T
Sbjct  325   ADGLGVSSCVQKSLEDAGVAPEEVNYINAHATSTLAGDLAEVNAIKQVFKDPSAVKMNAT  384

Query  1336  KSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAIS  1515
             KS+IGH LGA+GGLEAIAT+KAITTGWLHPTINQ+NLEP V  DTV N K+QH+VNVAIS
Sbjct  385   KSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNLEPAVEFDTVANEKQQHEVNVAIS  444

Query  1516  NSFGFGGHNSVIVFGPFKP  1572
             NSFGFGGHNSV+VF PFKP
Sbjct  445   NSFGFGGHNSVVVFAPFKP  463



>emb|CDY33467.1| BnaA06g36060D [Brassica napus]
Length=469

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/466 (70%), Positives = 379/466 (81%), Gaps = 2/466 (0%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITG  354
             +S L+ S   P+ T  N+       A+     RR     S +VSAPKR++DPKKRVVITG
Sbjct  6     SSSLRASPPNPLRTPSNRQSHQITNAR--PTTRRSFISASASVSAPKRETDPKKRVVITG  63

Query  355   MGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRR  534
             MGLVSVFG+DV+ +Y  LL G SGISLIDRFDAS F  RF GQI GF+SEGYID KN+RR
Sbjct  64    MGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGKNERR  123

Query  535   LDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGY  714
             LD   +YC+VAGKKAL  ANLG + LN +DK + G ++G+G GGL VF +GV  LV+ G+
Sbjct  124   LDDCLKYCIVAGKKALESANLGGDKLNTIDKQKAGVLVGTGMGGLTVFSDGVQALVEKGH  183

Query  715   KKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMi  894
             ++I+PFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEAD+M+
Sbjct  184   RRISPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEADMMV  243

Query  895   aggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHA  1074
             AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK RDGFV+GEG GVLVME L+HA
Sbjct  244   AGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKQRDGFVMGEGAGVLVMESLEHA  303

Query  1075  MKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATS  1254
             MKRGA ++AEYLGGA  CDAHHMT+PR DGLGVSSCI   LEDAGVSPEEVNYINAHATS
Sbjct  304   MKRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSSCIESCLEDAGVSPEEVNYINAHATS  363

Query  1255  TVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTIN  1434
             T+AGD+ E+NAIKKVFK TS IK+N TKS+IGH LGA+GGLEAIAT+KAI TGWLHP+IN
Sbjct  364   TLAGDLAEINAIKKVFKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSIN  423

Query  1435  QYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             Q+N EP V  DTV N KKQH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  424   QFNPEPAVDFDTVANEKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  469



>ref|XP_011011532.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Populus euphratica]
Length=466

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/432 (74%), Positives = 369/432 (85%), Gaps = 0/432 (0%)
 Frame = +1

Query  277   IKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDAS  456
             IK   S  VSAPKR+ DPKKRVVITGMGLVSVFG+DV+ +Y+ LL G SGI  IDRFDAS
Sbjct  35    IKASSSSTVSAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGIGTIDRFDAS  94

Query  457   DFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRi  636
              F  RFAGQI GF ++GYID KNDRRLD+  RYC+VAGKKAL DA+LG   L+ +DK + 
Sbjct  95    KFPTRFAGQIRGFNAQGYIDGKNDRRLDNCLRYCIVAGKKALEDADLGGNNLSKIDKEKA  154

Query  637   gavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSIS  816
             G ++G+G GGL VF +GV +L++ G++KITPFFIPY+ITNM SALL IE G MGP YSIS
Sbjct  155   GVLVGTGMGGLTVFSDGVQSLIEKGHRKITPFFIPYAITNMASALLGIELGFMGPNYSIS  214

Query  817   TACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASR  996
             TACAT+NYCFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASR
Sbjct  215   TACATSNYCFYAAANHIRRGEADMMIAGGTEAAIIPIGLGGFVACRALSQRNDDPKTASR  274

Query  997   PWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVS  1176
             PWDKDRDGFV+GEG GVLVME L+HAM+RGA +IAEYLGGA  CDA+HMT+PR DGLGVS
Sbjct  275   PWDKDRDGFVMGEGAGVLVMESLEHAMRRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVS  334

Query  1177  SCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHG  1356
             SCI +SLEDAGVSPEEVNYINAHATST+AGD+ E+NAIKKVFK+TSEIK+N TKS+IGH 
Sbjct  335   SCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKNTSEIKINATKSMIGHC  394

Query  1357  LGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGG  1536
             LGASGGLEAIAT+KAITTGWLHP+INQ+N EP V  DTV N K+QH+VNVAISNSFGFGG
Sbjct  395   LGASGGLEAIATVKAITTGWLHPSINQFNPEPSVEFDTVANKKQQHEVNVAISNSFGFGG  454

Query  1537  HNSVIVFGPFKP  1572
             HNSV+ F  FKP
Sbjct  455   HNSVVAFSAFKP  466



>ref|XP_009801210.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Nicotiana sylvestris]
Length=469

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/424 (75%), Positives = 364/424 (86%), Gaps = 0/424 (0%)
 Frame = +1

Query  301   VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAG  480
             VSAPKR+ DPKKRVVITGMGLVSVFG+DV+T+Y+ LL G SGISLIDRFDAS F  RF G
Sbjct  46    VSAPKREKDPKKRVVITGMGLVSVFGNDVDTYYDRLLAGESGISLIDRFDASKFPTRFGG  105

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgf  660
             QI GFTS+GYID KNDRRLD   RY +VAGKKAL +A+LG + L  +DK R G ++G+G 
Sbjct  106   QIRGFTSDGYIDGKNDRRLDDCLRYAIVAGKKALENADLGGDRLGKIDKERAGVLVGTGM  165

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GGL VF +GV  L++ G++KITPFFIPY+ITNMGSALL I+ G MGP YSISTACAT+NY
Sbjct  166   GGLTVFSDGVQNLIEKGHRKITPFFIPYAITNMGSALLGIDLGFMGPNYSISTACATSNY  225

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
             CFY+AANHIR+GEAD+M+AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK+RDG
Sbjct  226   CFYAAANHIRRGEADLMLAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKERDG  285

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVLVME L+HAMKRGA +IAEYLGGA  CDAHHMT+PR DGLGVSSCI  SLE
Sbjct  286   FVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGAVNCDAHHMTDPRADGLGVSSCIQSSLE  345

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
             DAGVSPEEVNYINAHATST+ GDI EVNAIKKVFK+TS IKMN TKS+IGH LGA+GG+E
Sbjct  346   DAGVSPEEVNYINAHATSTIVGDIAEVNAIKKVFKNTSGIKMNATKSMIGHCLGAAGGME  405

Query  1381  AIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFG  1560
             AIAT+KAITTGW+HP+INQ+N EP V  DTVPN K+QH+VNV ISNSFGFGGHNSV+ F 
Sbjct  406   AIATVKAITTGWVHPSINQFNPEPSVEFDTVPNKKQQHEVNVGISNSFGFGGHNSVVAFS  465

Query  1561  PFKP  1572
              FKP
Sbjct  466   AFKP  469



>gb|ABR18442.1| unknown [Picea sitchensis]
Length=545

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/544 (63%), Positives = 419/544 (77%), Gaps = 25/544 (5%)
 Frame = +1

Query  1     KLISLDTQS-ELWLCITFPILYSCH*IF--FSEN*RNY------RKMASIA---PSSGLI  144
             KL+ L   S  +W C+    +Y+C  ++     N  N       R+MA+ A    ++ L 
Sbjct  7     KLLDLHLHSGWVWFCVG---IYTCLGVWNALPCNKSNNSQASPDREMANSAIAGMAASLS  63

Query  145   FKSKESSKNGAS--LLQYSGLKPVETMQNQPD-SVAYKAQAAKKCRR-----IKCMISPA  300
                 E S+  AS  + ++ GL+  E   + PD S+ +  +  +  R      I+ M+ P+
Sbjct  64    IAGFEPSRGAASRSISRFDGLRAAEA--DLPDVSLLWGVRPNRLPRAGPRTGIRAMLIPS  121

Query  301   VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAG  480
             V+A +R+ DPKKRVVITGMGLVSVFG++V+T+Y  LLEG+SGI+ IDRFDAS F  RF G
Sbjct  122   VNALQREKDPKKRVVITGMGLVSVFGNNVDTYYERLLEGQSGIAPIDRFDASKFPTRFGG  181

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgf  660
             QI GF+SE YID KNDRRLD   RYCLV+G+KAL DA+LGK+ +N +DK R G ++GSG 
Sbjct  182   QIRGFSSEDYIDPKNDRRLDDCIRYCLVSGQKALEDADLGKDKINKIDKERAGVLVGSGM  241

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GGL VF +GV  L+  GY+KITPFFIPY+ITNMGSALL IE G MGP YSISTACAT+NY
Sbjct  242   GGLKVFSDGVQALLDKGYRKITPFFIPYAITNMGSALLGIEVGFMGPNYSISTACATSNY  301

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
             CFYSAANHIR+GEADIM+AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWD+DRDG
Sbjct  302   CFYSAANHIRRGEADIMLAGGTEAAIIPIGLGGFVACRALSQRNDDPQSASRPWDRDRDG  361

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVLVME L+HA KRGA ++AEYLGGA  CDA+HMT+PR DGLGVSSCI +SL 
Sbjct  362   FVMGEGAGVLVMESLEHAKKRGAPILAEYLGGAINCDAYHMTDPRADGLGVSSCIERSLI  421

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
             DAGVSPEEVNYINAHATST+AGD+ EVNAIK VFK+TSEIK+N TKS+IGH LGA+GGLE
Sbjct  422   DAGVSPEEVNYINAHATSTLAGDLAEVNAIKNVFKNTSEIKINATKSMIGHCLGAAGGLE  481

Query  1381  AIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFG  1560
             AIAT+KAI TGWLHPTINQ+N EP V  DTV NVKKQH+++VAISNSFGFGGHNSV+VF 
Sbjct  482   AIATVKAINTGWLHPTINQFNPEPSVEFDTVRNVKKQHEIHVAISNSFGFGGHNSVVVFA  541

Query  1561  PFKP  1572
             P++P
Sbjct  542   PYRP  545



>ref|XP_006449664.1| hypothetical protein CICLE_v10015139mg [Citrus clementina]
 gb|ESR62904.1| hypothetical protein CICLE_v10015139mg [Citrus clementina]
Length=468

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/467 (69%), Positives = 380/467 (81%), Gaps = 5/467 (1%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAV-SAPKRQSDPKKRVVIT  351
             +S L  S L P+ +  N          A    RR+  + + +  SAPKR+ DPKKRVVIT
Sbjct  6     SSSLHASPLNPLRSKSN----FNLPNNARPTARRVSFITASSTKSAPKREKDPKKRVVIT  61

Query  352   GMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDR  531
             GMGLVSVFG+DV+ +YN LL+G SGI++IDRFDAS F  RF GQI GF++EGYID KNDR
Sbjct  62    GMGLVSVFGNDVDAYYNKLLDGESGITMIDRFDASKFPTRFGGQIRGFSAEGYIDGKNDR  121

Query  532   RLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSG  711
             RLD   RY +VAGKKAL DA+LG ++   +DK R G ++G+G GGL VF +GV  L++ G
Sbjct  122   RLDDCLRYSIVAGKKALEDADLGADISKKIDKERAGVLVGTGMGGLTVFSDGVQALIEKG  181

Query  712   YKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIM  891
             ++KITPFFIPY+ITNMGSALLAI+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+M
Sbjct  182   HRKITPFFIPYAITNMGSALLAIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEADLM  241

Query  892   iaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDH  1071
             +AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+H
Sbjct  242   LAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEH  301

Query  1072  AMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHAT  1251
             AMKRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI  SLEDAGVSPEEVNYINAHAT
Sbjct  302   AMKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIESSLEDAGVSPEEVNYINAHAT  361

Query  1252  STVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTI  1431
             ST+AGD+ E+NAIKKVFK T+ IK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLHP+I
Sbjct  362   STLAGDLAEINAIKKVFKSTAGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSI  421

Query  1432  NQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             NQ+N EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  422   NQFNPEPSVEFDTVANKKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  468



>ref|XP_011096538.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Sesamum indicum]
Length=472

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/469 (70%), Positives = 382/469 (81%), Gaps = 5/469 (1%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPA---VSAPKRQSDPKKRVV  345
             ++ L+ S L P+   Q  P S+     A    +R+   IS +   VS+PKR++DPKKRVV
Sbjct  6     SAALRPSPLDPLRKPQ-YPTSLPSN-NAKPPVKRLPFTISASASTVSSPKRETDPKKRVV  63

Query  346   ITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKN  525
             ITGMGLVSVFG+DV+ +Y  LL G SGI+ IDRFDAS F  RF GQI GF SEGYID KN
Sbjct  64    ITGMGLVSVFGNDVDAYYEKLLAGESGITPIDRFDASKFPTRFGGQIRGFKSEGYIDGKN  123

Query  526   DRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQ  705
             DRRLD   RYC+VAGKKAL DA+LG + L  +DK R G ++G+G GGL VF +GV  L++
Sbjct  124   DRRLDDCLRYCIVAGKKALEDADLGGDRLGKIDKIRAGVLVGTGMGGLTVFSDGVQALIE  183

Query  706   SGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEAD  885
              GY+KITPFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEAD
Sbjct  184   KGYRKITPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEAD  243

Query  886   IMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERL  1065
             +MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L
Sbjct  244   LMIAGGTEAAIIPIGLGGFVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESL  303

Query  1066  DHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAH  1245
             +HAMKR A +IAEYLGGA  CDA+HMT+PR DGLGVSSCI  +LEDAGVSPEEVNYINAH
Sbjct  304   EHAMKRDAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIQSALEDAGVSPEEVNYINAH  363

Query  1246  ATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHP  1425
             ATSTV GD+ EVNAIKKVFK+TS IK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLHP
Sbjct  364   ATSTVVGDLAEVNAIKKVFKNTSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHP  423

Query  1426  TINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             TINQ+N EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  424   TINQFNPEPSVEFDTVANKKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  472



>ref|XP_009596105.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Nicotiana tomentosiformis]
Length=469

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/424 (75%), Positives = 364/424 (86%), Gaps = 0/424 (0%)
 Frame = +1

Query  301   VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAG  480
             VSAPKR+ DPKKRVVITGMGLVSVFG+DV+T+Y+ LL G SGISLIDRFDAS F  RF G
Sbjct  46    VSAPKREKDPKKRVVITGMGLVSVFGNDVDTYYDRLLAGESGISLIDRFDASKFPTRFGG  105

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgf  660
             QI GFTS+GYID KNDRRLD   RY +VAGKKAL +A+LG + L  +DK R G ++G+G 
Sbjct  106   QIRGFTSDGYIDGKNDRRLDDCLRYAIVAGKKALENADLGGDRLGKIDKERAGILVGTGM  165

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GGL VF +GV  L++ G++KITPFFIPY+ITNMGSALL I+ G MGP YSISTACAT+NY
Sbjct  166   GGLTVFSDGVQNLIEKGHRKITPFFIPYAITNMGSALLGIDLGFMGPNYSISTACATSNY  225

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
             CFY+AANHIR+GEAD+M+AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK+RDG
Sbjct  226   CFYAAANHIRRGEADLMLAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKERDG  285

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVLVME L+HAMKRGA +IAEYLGGA  CDAHHMT+PR DGLGVSSCI  SLE
Sbjct  286   FVMGEGSGVLVMESLEHAMKRGAPIIAEYLGGAVNCDAHHMTDPRADGLGVSSCIQSSLE  345

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
             DAGVSPEEVNYINAHATST+ GDI EVNAIKKVFK+TS IKMN TKS+IGH LGA+GG+E
Sbjct  346   DAGVSPEEVNYINAHATSTIVGDIAEVNAIKKVFKNTSGIKMNATKSMIGHCLGAAGGME  405

Query  1381  AIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFG  1560
             AIAT+KAITTGW+HP+INQ+N EP V  DTVPN K+QH+VNV ISNSFGFGGHNSV+ F 
Sbjct  406   AIATVKAITTGWVHPSINQFNPEPSVEFDTVPNKKQQHEVNVGISNSFGFGGHNSVVAFS  465

Query  1561  PFKP  1572
              FKP
Sbjct  466   AFKP  469



>ref|XP_004244796.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Solanum lycopersicum]
Length=468

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/466 (70%), Positives = 377/466 (81%), Gaps = 4/466 (1%)
 Frame = +1

Query  184   LQYSGLKPVET---MQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITG  354
             +Q S L+P      ++  P     K    K+   I    S  VSAP R+ DPKKRVVITG
Sbjct  4     IQSSSLRPSPVDPFLKTIPQFTNVKPLKPKRTPFISAS-STTVSAPTREKDPKKRVVITG  62

Query  355   MGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRR  534
             MGLVSVFG+DV+ +Y+ LL G SG++LIDRFDAS F  RF GQI GF ++GYID KNDRR
Sbjct  63    MGLVSVFGNDVDAYYDKLLAGESGVTLIDRFDASKFPTRFGGQIRGFKADGYIDGKNDRR  122

Query  535   LDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGY  714
             LD   RYC+VAGKKAL +A+LG +    +DK R G ++G+G GGL VF +GV  L++ G+
Sbjct  123   LDDCLRYCIVAGKKALENADLGSDRDKKIDKERAGVLVGTGMGGLTVFSDGVQALIEKGH  182

Query  715   KKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMi  894
             +KITPFFIPY+ITNMGSALLAI+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+MI
Sbjct  183   RKITPFFIPYAITNMGSALLAIDVGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMI  242

Query  895   aggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHA  1074
             AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+HA
Sbjct  243   AGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHA  302

Query  1075  MKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATS  1254
             MKRGA +IAEYLGGA  CDAHHMT+PR DGLGVSSCI  SLEDAGVSPEEVNYINAHATS
Sbjct  303   MKRGAPIIAEYLGGAVNCDAHHMTDPRADGLGVSSCILSSLEDAGVSPEEVNYINAHATS  362

Query  1255  TVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTIN  1434
             T+ GD+ EVNAIKKVFK+TSEIKMN TKS+IGH LGA+GGLEAIAT+KAI TGWLHP+IN
Sbjct  363   TIVGDLAEVNAIKKVFKNTSEIKMNATKSMIGHCLGAAGGLEAIATVKAIKTGWLHPSIN  422

Query  1435  QYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             Q+N EP V  DTV N K+QH++NVAISNSFGFGGHNSV+VF  FKP
Sbjct  423   QFNTEPSVEFDTVANKKQQHEINVAISNSFGFGGHNSVVVFSDFKP  468



>ref|XP_006280411.1| hypothetical protein CARUB_v10026344mg [Capsella rubella]
 gb|EOA13309.1| hypothetical protein CARUB_v10026344mg [Capsella rubella]
Length=471

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/468 (69%), Positives = 382/468 (82%), Gaps = 5/468 (1%)
 Frame = +1

Query  184   LQYSGLK--PVETMQNQPDSVAYKAQAAKKCRRIKCMISPA---VSAPKRQSDPKKRVVI  348
             LQ S L+  P   ++   +  +++   A+  RR +  IS +   VSAPKR++DPKKRVVI
Sbjct  4     LQSSSLRASPPNPLRLPSNRQSHQIANARPVRRQRSFISASASTVSAPKRETDPKKRVVI  63

Query  349   TGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKND  528
             TGMGLVSVFG+DV+ +Y  LL G SGISLIDRFDAS F  RF GQI GF+SEGYID KN+
Sbjct  64    TGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGKNE  123

Query  529   RRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQS  708
             RRLD   +YC+VAGKKAL  ANLG + LN +DK + G ++G+G GGL VF  GV  L++ 
Sbjct  124   RRLDDCLKYCIVAGKKALESANLGGDKLNTIDKRKAGVLVGTGMGGLTVFSEGVQNLIEK  183

Query  709   GYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADI  888
             G+++I+PFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEAD+
Sbjct  184   GHRRISPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEADM  243

Query  889   MiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLD  1068
             MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK RDGFV+GEG GVLVME L+
Sbjct  244   MIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKARDGFVMGEGAGVLVMESLE  303

Query  1069  HAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHA  1248
             HAM RGA ++AEYLGGA  CDAHHMT+PR DGLGVSSCI + LEDAGVSPEEVNYINAHA
Sbjct  304   HAMNRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSSCIERCLEDAGVSPEEVNYINAHA  363

Query  1249  TSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPT  1428
             TST+AGD+ E+NAIKKVFK TS IK+N TKS+IGH LGA+GGLEAIAT+KAI TGWLHP+
Sbjct  364   TSTLAGDLAEINAIKKVFKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPS  423

Query  1429  INQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             INQ+N E  V  DTVPN KKQH+V+VAISNSFGFGGHNSV+ F  FKP
Sbjct  424   INQFNPEQAVDFDTVPNEKKQHEVDVAISNSFGFGGHNSVVAFSAFKP  471



>gb|KFK31480.1| hypothetical protein AALP_AA6G117600 [Arabis alpina]
Length=472

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/467 (69%), Positives = 381/467 (82%), Gaps = 3/467 (1%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQN-QPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVIT  351
             +S L+ S   P+    N Q + +   A+  +  RR     S +VSAPKR++DPKKRVVIT
Sbjct  8     SSSLRASPPNPLRRPSNLQSNQICTNARPMR--RRSYISASASVSAPKRETDPKKRVVIT  65

Query  352   GMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDR  531
             GMGLVSVFG+DV+ +Y  LL G SGISLIDRFDAS F  RF GQI GF+SEGYID KN+R
Sbjct  66    GMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGKNER  125

Query  532   RLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSG  711
             RLD   +YC+VAGKKAL  +NLG + LN +DK R G ++G+G GGL VF +GV  L++ G
Sbjct  126   RLDDCLKYCIVAGKKALESSNLGGDKLNTIDKQRAGVLVGTGMGGLTVFSDGVQALLEKG  185

Query  712   YKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIM  891
             +++I+PFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEADIM
Sbjct  186   HRRISPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEADIM  245

Query  892   iaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDH  1071
             +AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK RDGFV+GEG GVLVME L+H
Sbjct  246   VAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKQRDGFVMGEGAGVLVMESLEH  305

Query  1072  AMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHAT  1251
             A+KRGA ++AEYLGGA  CDAHHMT+PR DGLGVSSCI   LEDAGVSPEEVNYINAHAT
Sbjct  306   ALKRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSSCIESCLEDAGVSPEEVNYINAHAT  365

Query  1252  STVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTI  1431
             ST+AGD+ E+NAIKKVFK TS IK+N TKS+IGH LGA+GGLEAIAT+KAI TGWLHP+I
Sbjct  366   STLAGDLAEINAIKKVFKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSI  425

Query  1432  NQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             NQ+N EP V  DTV N KKQH+VNVAISNSFGFGGHNSV+ F  +KP
Sbjct  426   NQFNPEPAVDFDTVANEKKQHEVNVAISNSFGFGGHNSVVAFSAYKP  472



>ref|XP_006398324.1| hypothetical protein EUTSA_v10000874mg [Eutrema salsugineum]
 gb|ESQ39777.1| hypothetical protein EUTSA_v10000874mg [Eutrema salsugineum]
Length=469

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/466 (69%), Positives = 381/466 (82%), Gaps = 3/466 (1%)
 Frame = +1

Query  184   LQYSGLK--PVETMQNQPDSVAYKAQAAKKCRRIKCM-ISPAVSAPKRQSDPKKRVVITG  354
             LQ S L+  P   +    +  +++   A+  RR   +  S AVSAPKR++DPKKRVVITG
Sbjct  4     LQSSSLRASPPNPLLRPSNRQSHQITNARPTRRRSFISASAAVSAPKRETDPKKRVVITG  63

Query  355   MGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRR  534
             MGLVSVFG+DV+ +Y  LL G SGISLIDRFDAS F  RF GQI GF+SEGYID KN+RR
Sbjct  64    MGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGKNERR  123

Query  535   LDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGY  714
             LD   +YC+VAGKKAL  ANLG + LN +DK + G ++G+G GGL VF +GV  L++ G+
Sbjct  124   LDDCLKYCIVAGKKALESANLGGDKLNTIDKQKAGVLVGTGMGGLTVFSDGVQALIEKGH  183

Query  715   KKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMi  894
             ++I+PFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEAD+MI
Sbjct  184   RRISPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEADMMI  243

Query  895   aggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHA  1074
             AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK RDGFV+GEG GVLVME L+HA
Sbjct  244   AGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKQRDGFVMGEGAGVLVMESLEHA  303

Query  1075  MKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATS  1254
             MKRGA ++AEYLGGA  CDAHHMT+PR DGLGVS+CI   L+DAGVSPEEVNYINAHATS
Sbjct  304   MKRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSTCIESCLQDAGVSPEEVNYINAHATS  363

Query  1255  TVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTIN  1434
             T+AGD+ E+NAIKKVFK TS IK+N TKS+IGH LGA+GGLEAIAT+KAI TGWLHP+IN
Sbjct  364   TLAGDLAEINAIKKVFKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSIN  423

Query  1435  QYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             Q+N EP V  DTV N KKQH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  424   QFNPEPAVDFDTVANEKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  469



>emb|CDY03228.1| BnaC09g19280D [Brassica napus]
Length=470

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/467 (69%), Positives = 381/467 (82%), Gaps = 4/467 (1%)
 Frame = +1

Query  184   LQYSGLK--PVETMQNQPDSVAYKAQAAKKCRRIKCMISP--AVSAPKRQSDPKKRVVIT  351
             LQ S L+  P   +    +  +++   A++  R +  IS   AVSAPKR++DPKKRVVIT
Sbjct  4     LQSSSLRASPPNPLIKPSNRQSHQITNARQPTRRRTFISASAAVSAPKRETDPKKRVVIT  63

Query  352   GMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDR  531
             GMGLVSVFG+DV+ +Y  LL G SGISLIDRFDAS F  RF GQI GF+SEGYID KN+R
Sbjct  64    GMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGKNER  123

Query  532   RLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSG  711
             RLD   +YC+VAGKKAL  ANLG + LN +DK R G ++G+G GGL VF +GV  L++ G
Sbjct  124   RLDDCLKYCIVAGKKALESANLGGDKLNTIDKQRAGVLVGTGMGGLTVFSDGVQALIEKG  183

Query  712   YKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIM  891
             +++I+PFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEAD+M
Sbjct  184   HRRISPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEADMM  243

Query  892   iaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDH  1071
             IAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK RDGFV+GEG GVLVME L+H
Sbjct  244   IAGGTEAAIIPIGLGGFVACRALSQRNDDPKTASRPWDKQRDGFVMGEGAGVLVMESLEH  303

Query  1072  AMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHAT  1251
             AMKRGA ++AEYLGGA  CDAHHMT+PR DGLGVSSCI   LEDAGVSPEEVNYINAHAT
Sbjct  304   AMKRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSSCIESCLEDAGVSPEEVNYINAHAT  363

Query  1252  STVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTI  1431
             ST+AGD+ E+NAIKKVFK T+ IK+N TKS+IGH LGA+GGLEAIAT+KAI TGWLHP+I
Sbjct  364   STLAGDLAEINAIKKVFKSTAGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSI  423

Query  1432  NQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             NQ+N EP V  DTV N KKQH+VNVAISNSFGFGGHNSV+ F  F P
Sbjct  424   NQFNPEPAVDFDTVANEKKQHEVNVAISNSFGFGGHNSVVAFSAFTP  470



>emb|CDY35156.1| BnaA09g17930D [Brassica napus]
Length=470

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/434 (73%), Positives = 366/434 (84%), Gaps = 0/434 (0%)
 Frame = +1

Query  271   RRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFD  450
             RR     S AVSAPKR++DPKKRVVITGMGLVSVFG+DV+ +Y  LL G SGISLIDRFD
Sbjct  37    RRTFISASAAVSAPKRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFD  96

Query  451   ASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKT  630
             AS F  RF GQI GF+SEGYID KN+RRLD   +YC+VAGKKAL  ANLG + LN +DK 
Sbjct  97    ASKFPTRFGGQIRGFSSEGYIDGKNERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKQ  156

Query  631   RigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYS  810
             R G ++G+G GGL VF +GV  L++ G+++I+PFFIPY+ITNMGSALLAI+ GLMGP YS
Sbjct  157   RAGVLVGTGMGGLTVFSDGVQALIEKGHRRISPFFIPYAITNMGSALLAIDLGLMGPNYS  216

Query  811   ISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERA  990
             ISTACAT+NYCFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ A
Sbjct  217   ISTACATSNYCFYAAANHIRRGEADMMIAGGTEAAIIPIGLGGFVACRALSQRNDDPKTA  276

Query  991   SRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLG  1170
             SRPWDK RDGFV+GEG GVLVME L+HAMKRGA ++AEYLGGA  CDAHHMT+PR DGLG
Sbjct  277   SRPWDKQRDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGAVNCDAHHMTDPRADGLG  336

Query  1171  VSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIG  1350
             VSSCI   LEDAGVSPEEVNYINAHATST+AGD+ E+NAIKKVFK T+ IK+N TKS+IG
Sbjct  337   VSSCIESCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKSTAGIKINATKSMIG  396

Query  1351  HGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGF  1530
             H LGA+GGLEAIAT+KAI TGWLHP+INQ+N EP V  DTV N KKQH+VNVAISNSFGF
Sbjct  397   HCLGAAGGLEAIATVKAINTGWLHPSINQFNPEPAVDFDTVANEKKQHEVNVAISNSFGF  456

Query  1531  GGHNSVIVFGPFKP  1572
             GGHNSV+ F  F P
Sbjct  457   GGHNSVVAFSAFTP  470



>ref|XP_009763087.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Nicotiana sylvestris]
Length=467

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/465 (70%), Positives = 379/465 (82%), Gaps = 3/465 (1%)
 Frame = +1

Query  184   LQYSGLKPVETMQN--QPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGM  357
             LQ S L+P        +P +  +      K +++   IS A SAP R+ DPKKRVVITGM
Sbjct  4     LQSSSLRPSPPTHPFLKPTTHQFTNVKPLKPKKLTPFIS-ASSAPTREKDPKKRVVITGM  62

Query  358   GLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRL  537
             GLVSVFG+DV+ +Y+ LL G SGISLIDRFDAS F  RF GQI GF +EGYID KNDRRL
Sbjct  63    GLVSVFGNDVDAYYDKLLAGESGISLIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRRL  122

Query  538   DHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYK  717
             D   RYC+VAGKKAL +A+LG +    ++K R G ++G+G GGL VF +GV  L++ G++
Sbjct  123   DDCLRYCIVAGKKALENADLGTDRDKKINKERAGVLVGTGMGGLTVFSDGVQALIEKGHR  182

Query  718   KITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMia  897
             KITPFFIPY+ITNMGSALLAI+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+MIA
Sbjct  183   KITPFFIPYAITNMGSALLAIDVGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMIA  242

Query  898   ggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAM  1077
             GGTEA +   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+HAM
Sbjct  243   GGTEAAMIPIGLGGFVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAM  302

Query  1078  KRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATST  1257
             KRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI  SLEDAGVSPEEVNYINAHATST
Sbjct  303   KRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCILSSLEDAGVSPEEVNYINAHATST  362

Query  1258  VAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQ  1437
             + GD+ EVNA+KKVFK+ SEIKMN TKS+IGH LGA+GGLEAIAT+KAITTGWLHP+INQ
Sbjct  363   IVGDLAEVNAVKKVFKNPSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQ  422

Query  1438  YNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             +N EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+VF  FKP
Sbjct  423   FNPEPSVEFDTVANKKQQHEVNVAISNSFGFGGHNSVVVFSAFKP  467



>ref|XP_002863412.1| kas I [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39671.1| kas I [Arabidopsis lyrata subsp. lyrata]
Length=473

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/441 (72%), Positives = 372/441 (84%), Gaps = 3/441 (1%)
 Frame = +1

Query  259   AKKCRRIKCMISPA---VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGI  429
             A+  RR +  IS +   VSAPKR++DPKKRVVITGMGLVSVFG+DV+ +Y+ LL G SGI
Sbjct  33    ARPLRRHRSFISASASTVSAPKRETDPKKRVVITGMGLVSVFGNDVDAYYDKLLSGESGI  92

Query  430   SLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEV  609
             SLIDRFDAS F  RF GQI GF+SEGYID KN+RRLD   +YC+VAGKKAL  ANLG + 
Sbjct  93    SLIDRFDASKFPTRFGGQIRGFSSEGYIDGKNERRLDDCLKYCIVAGKKALESANLGGDK  152

Query  610   LNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAG  789
             LN +DK + G ++G+G GGL VF  GV  L++ G+++I+PFFIPY+ITNMGSALLAI+ G
Sbjct  153   LNTIDKRKAGVLVGTGMGGLTVFSEGVQNLIEKGHRRISPFFIPYAITNMGSALLAIDLG  212

Query  790   LMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQR  969
             LMGP YSISTACAT+NYCFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQR
Sbjct  213   LMGPNYSISTACATSNYCFYAAANHIRRGEADMMIAGGTEAAIIPIGLGGFVACRALSQR  272

Query  970   NHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTE  1149
             N +P+ ASRPWDK RDGFV+GEG GVLVME L+HAMKRGA ++AEYLGGA  CDAHHMT+
Sbjct  273   NDDPQTASRPWDKARDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGAVNCDAHHMTD  332

Query  1150  PRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMN  1329
             PR DGLGVSSCI + LEDAGVSPEEVNYINAHATST+AGD+ E+NAIKKVFK TS IK+N
Sbjct  333   PRADGLGVSSCIERCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKSTSGIKIN  392

Query  1330  GTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVA  1509
              TKS+IGH LGA+GGLEAIAT+KAI TGWLHP+INQ+N E  V  DTVPN KKQH+V+VA
Sbjct  393   ATKSMIGHCLGAAGGLEAIATVKAINTGWLHPSINQFNPEQAVDFDTVPNQKKQHEVDVA  452

Query  1510  ISNSFGFGGHNSVIVFGPFKP  1572
             ISNSFGFGGHNSV+ F  FKP
Sbjct  453   ISNSFGFGGHNSVVAFSAFKP  473



>ref|XP_004233105.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Solanum lycopersicum]
Length=469

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/457 (70%), Positives = 375/457 (82%), Gaps = 1/457 (0%)
 Frame = +1

Query  205   PVETM-QNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGS  381
             P+E + +N P     ++  AK+        +  VSAPKR+ DPKKRVVITG GLVSVFG+
Sbjct  13    PLEPLRKNIPQFTNVRSLGAKRVPLTVTASASTVSAPKREKDPKKRVVITGTGLVSVFGN  72

Query  382   DVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCL  561
             D +T+Y+ LL G SGISLIDRFDAS F  RF GQI GFTSEGYID KNDRRLD   RY +
Sbjct  73    DADTYYDRLLAGESGISLIDRFDASKFPTRFGGQIRGFTSEGYIDGKNDRRLDDCLRYAI  132

Query  562   VAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIP  741
             VAGKKAL +A+LG + L  +DK R G ++G+G GGL VF +GV  L++ G++KITPFF+P
Sbjct  133   VAGKKALENADLGGDRLEKIDKERAGVLVGTGMGGLTVFSDGVQNLIEKGHRKITPFFVP  192

Query  742   YSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagit  921
             Y+ITNMGSALL I+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+M+AGGTEA I 
Sbjct  193   YAITNMGSALLGIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMLAGGTEAAII  252

Query  922   ttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIA  1101
               G+GGF+ACRALSQRN +P+ ASRPWDK+RDGFV+GEG G+LVME L+HAMKRGA +IA
Sbjct  253   PIGLGGFVACRALSQRNDDPQTASRPWDKERDGFVMGEGAGILVMESLEHAMKRGAPIIA  312

Query  1102  EYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEV  1281
             EYLGGA  CDA+HMT+PR DGLGVSSCI  SLEDAGVSPEEVNYINAHATST+ GD+ E+
Sbjct  313   EYLGGAVNCDAYHMTDPRADGLGVSSCILSSLEDAGVSPEEVNYINAHATSTIVGDLAEI  372

Query  1282  NAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVT  1461
             NA+KKVFK T+ IKMN TKS+IGH LGA+GGLEAIATIKAITTGW+HP+INQ+N EP V 
Sbjct  373   NAVKKVFKTTTGIKMNATKSMIGHCLGAAGGLEAIATIKAITTGWVHPSINQFNPEPSVE  432

Query  1462  IDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
              DTVPN K+QH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  433   FDTVPNKKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  469



>ref|XP_002519707.1| 50 kDa ketoavyl-ACP synthase [Ricinus communis]
 gb|AAA33873.1| chloroplast beta-ketoacyl-ACP synthase precursor [Ricinus communis]
 gb|ABR12416.1| plastid 3-keto-acyl-ACP synthase I [Ricinus communis]
 gb|EEF42680.1| 50 kDa ketoavyl-ACP synthase [Ricinus communis]
 dbj|BAM75183.1| ketoacyl-acyl carrier protein synthase [Ricinus communis]
Length=469

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/424 (75%), Positives = 366/424 (86%), Gaps = 0/424 (0%)
 Frame = +1

Query  301   VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAG  480
             +SAPKR+ DP+KRVVITG GLVSVFG+DV+T+Y+ LL G SGI LIDRFDAS F  RF G
Sbjct  46    ISAPKREKDPRKRVVITGTGLVSVFGNDVDTYYDKLLAGESGIGLIDRFDASKFPTRFGG  105

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgf  660
             QI GF S+GYID KNDRRLD   RYC+VAGKKAL  A+LG + L+ +DK R G ++G+G 
Sbjct  106   QIRGFNSQGYIDGKNDRRLDDCLRYCIVAGKKALEHADLGGDKLSKIDKERAGVLVGTGM  165

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GGL VF +GV  L++ G++KITPFFIPY+ITNMGSALLAIE GLMGP YSISTACAT+NY
Sbjct  166   GGLTVFSDGVQALIEKGHRKITPFFIPYAITNMGSALLAIELGLMGPNYSISTACATSNY  225

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
             CFY+AANHIR+GEA++MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDG
Sbjct  226   CFYAAANHIRRGEAELMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKDRDG  285

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVLVME L+HAMKRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI +SLE
Sbjct  286   FVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIERSLE  345

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
             DAGVSPEEVNYINAHATST+AGD+ E+NAIKKVFK+TS+IK+N TKS+IGH LGA+GGLE
Sbjct  346   DAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKNTSDIKINATKSMIGHCLGAAGGLE  405

Query  1381  AIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFG  1560
             AIA +KAITTGWLHPTINQ+N EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+ F 
Sbjct  406   AIACVKAITTGWLHPTINQFNPEPSVEFDTVANKKQQHEVNVAISNSFGFGGHNSVVAFS  465

Query  1561  PFKP  1572
              FKP
Sbjct  466   AFKP  469



>ref|XP_008444105.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Cucumis melo]
Length=471

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/421 (75%), Positives = 364/421 (86%), Gaps = 0/421 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             PKR+ DPKKRVVITGMGLVSVFG+DV+T+Y+ LL G SG++LIDRFDAS F  RF GQI 
Sbjct  51    PKREKDPKKRVVITGMGLVSVFGNDVDTYYDKLLSGESGVTLIDRFDASKFPTRFGGQIR  110

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfggl  669
             GF S+GYID KNDRRLD   RYC+VAGKKAL DA+LG +  + +DK R G ++G+G GGL
Sbjct  111   GFASQGYIDGKNDRRLDDCLRYCIVAGKKALEDADLGGDKRSKIDKERAGVLVGTGMGGL  170

Query  670   gvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFY  849
              VF +GV  L++ G++KITPFFIPY+ITNMGSALLAI+ G MGP YSISTACAT+NYCFY
Sbjct  171   TVFSDGVQALIEKGHRKITPFFIPYAITNMGSALLAIDIGFMGPNYSISTACATSNYCFY  230

Query  850   SAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVI  1029
             +AANHIR+GEAD+M+AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+
Sbjct  231   AAANHIRRGEADMMLAGGTEAAIIPIGLGGFVACRALSQRNDDPKTASRPWDKDRDGFVM  290

Query  1030  GEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAG  1209
             GEG G+LVME L+HAMKRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI  SLEDAG
Sbjct  291   GEGAGILVMESLEHAMKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCILSSLEDAG  350

Query  1210  VSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIA  1389
             VSPEEVNYINAHATST+AGDI E+NAIKKVFK+TSEIK+N TKS+IGH LGA+GGLEAIA
Sbjct  351   VSPEEVNYINAHATSTLAGDIAEINAIKKVFKNTSEIKINATKSMIGHCLGAAGGLEAIA  410

Query  1390  TIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             T+KAI TGWLHP+INQ+N EP V  DTV NVK+QH+VNVAISNSFGFGGHNSV+ F  FK
Sbjct  411   TVKAIETGWLHPSINQFNPEPSVDFDTVANVKQQHEVNVAISNSFGFGGHNSVVAFSAFK  470

Query  1570  P  1572
             P
Sbjct  471   P  471



>gb|ABA07910.1| plastid 3-ketoacyl-ACP synthase I [Cuphea avigera var. pulcherrima]
Length=465

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/427 (74%), Positives = 366/427 (86%), Gaps = 0/427 (0%)
 Frame = +1

Query  292   SPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVR  471
             SP VSAPKR++DPKKRVVITGMGLVSVFGSDV+ +Y+ LL G SGI  IDRFDAS F  R
Sbjct  39    SPTVSAPKRETDPKKRVVITGMGLVSVFGSDVDAYYDKLLSGESGIGPIDRFDASKFPTR  98

Query  472   FAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavig  651
             F GQI GF S GYID KNDRRLD   RYC+VAGKK+L DA+LG + L+ +DK R G ++G
Sbjct  99    FGGQIRGFNSMGYIDGKNDRRLDDCLRYCIVAGKKSLEDADLGADRLSKIDKERAGVLVG  158

Query  652   sgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACAT  831
             +G GGL VF +GV +L++ G++KITPFFIPY+ITNMGSALLAIE GLMGP YSISTACAT
Sbjct  159   TGMGGLTVFSDGVQSLIEKGHRKITPFFIPYAITNMGSALLAIELGLMGPNYSISTACAT  218

Query  832   ANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKD  1011
             +NYCF++AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKD
Sbjct  219   SNYCFHAAANHIRRGEADLMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKD  278

Query  1012  RDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITK  1191
             RDGFV+GEG GVLV+E L+HAMKRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI  
Sbjct  279   RDGFVMGEGAGVLVLESLEHAMKRGAPIIAEYLGGAINCDAYHMTDPRADGLGVSSCIES  338

Query  1192  SLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASG  1371
             SLEDAGVSPEEVNYINAHATST+AGD+ E+NAIKKVFK+T +IK+N TKS+IGH LGASG
Sbjct  339   SLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKNTKDIKINATKSMIGHCLGASG  398

Query  1372  GLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVI  1551
             GLEAIATIK I TGWLHP+INQ+N EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+
Sbjct  399   GLEAIATIKGINTGWLHPSINQFNPEPSVEFDTVANKKQQHEVNVAISNSFGFGGHNSVV  458

Query  1552  VFGPFKP  1572
              F  FKP
Sbjct  459   AFSAFKP  465



>gb|KEH43811.1| 3-oxoacyl-(acyl carrier) synthase II [Medicago truncatula]
Length=472

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/456 (70%), Positives = 374/456 (82%), Gaps = 1/456 (0%)
 Frame = +1

Query  205   PVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSD  384
             P+E ++ +  + A      K+  RI   ++   +AP+R+ DPKKRVVITGMGL SVFG+D
Sbjct  18    PLEPLRRKSSNAATATAKTKRVTRISAAVT-TTTAPQREKDPKKRVVITGMGLASVFGND  76

Query  385   VETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLV  564
             V+ +Y+ LL G SGI+ IDRFDAS F  RFAGQI  F+SEGYID KNDRRLD   RYC+V
Sbjct  77    VDAYYDKLLAGESGITSIDRFDASKFPTRFAGQIRDFSSEGYIDGKNDRRLDDCLRYCIV  136

Query  565   AGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPY  744
             AGKKAL  ANLG   L+ +DK R G ++GSG GGL VF  GV  L++ GY+KITPFFIPY
Sbjct  137   AGKKALEHANLGAANLSKIDKERAGVLVGSGMGGLTVFSEGVKNLIEKGYRKITPFFIPY  196

Query  745   SITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitt  924
             +ITNMGSALL I+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+MIAGGTEA I  
Sbjct  197   AITNMGSALLGIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMIAGGTEAAIIP  256

Query  925   tgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAE  1104
              G+GGF+ACRALSQRN +P+ ASRPWDK RDGFV+GEG GVLV+E L+HAMKRGA +IAE
Sbjct  257   IGLGGFVACRALSQRNDDPKTASRPWDKARDGFVMGEGSGVLVLESLEHAMKRGAPIIAE  316

Query  1105  YLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVN  1284
             YLGGA  CDA+HMT+PR+DGLGVS+CI  SLEDAGVSPEEVNYINAHATST+AGD+ E+N
Sbjct  317   YLGGAVNCDAYHMTDPRSDGLGVSTCIQSSLEDAGVSPEEVNYINAHATSTLAGDLAEIN  376

Query  1285  AIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTI  1464
             AIKKVFKDTS IK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLHP+INQ+N EP V  
Sbjct  377   AIKKVFKDTSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPAVDF  436

Query  1465  DTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             DTV NVK+QH++NV ISNSFGFGGHNSV+ F  F+P
Sbjct  437   DTVANVKQQHEINVGISNSFGFGGHNSVVAFSAFRP  472



>ref|XP_004147414.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Cucumis sativus]
 gb|KGN65557.1| hypothetical protein Csa_1G447400 [Cucumis sativus]
Length=471

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/421 (74%), Positives = 364/421 (86%), Gaps = 0/421 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             PKR+ DPKKRVVITGMGLVSVFG+DV+T+Y+ LL G SG++LIDRFDAS F  RF GQI 
Sbjct  51    PKREKDPKKRVVITGMGLVSVFGNDVDTYYDKLLSGESGVTLIDRFDASKFPTRFGGQIR  110

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfggl  669
             GF S+GYID KNDRRLD   RYC+VAGKKAL DA+LG +  + +DK R G ++G+G GGL
Sbjct  111   GFASQGYIDGKNDRRLDDCLRYCIVAGKKALEDADLGGDKRSKIDKERAGVLVGTGMGGL  170

Query  670   gvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFY  849
              VF +GV  L++ G++KITPFFIPY+ITNMGSALLAI+ G MGP YSISTACAT+NYCFY
Sbjct  171   TVFSDGVQALIEKGHRKITPFFIPYAITNMGSALLAIDIGFMGPNYSISTACATSNYCFY  230

Query  850   SAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVI  1029
             +AANHIR+GEAD+M+AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+
Sbjct  231   AAANHIRRGEADMMLAGGTEAAIIPIGLGGFVACRALSQRNDDPKTASRPWDKDRDGFVM  290

Query  1030  GEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAG  1209
             GEG G+LVME L+HAMKRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI  SLEDAG
Sbjct  291   GEGAGILVMESLEHAMKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCILSSLEDAG  350

Query  1210  VSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIA  1389
             VSPEEVNYINAHATST+AGD+ E+NAIKKVFK+TSEIK+N TKS+IGH LGA+GGLEAIA
Sbjct  351   VSPEEVNYINAHATSTLAGDLAEINAIKKVFKNTSEIKINATKSMIGHCLGAAGGLEAIA  410

Query  1390  TIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             T+KAI TGWLHP+INQ+N EP V  DTV NVK+QH+VNVAISNSFGFGGHNSV+ F  FK
Sbjct  411   TVKAIETGWLHPSINQFNPEPSVDFDTVANVKQQHEVNVAISNSFGFGGHNSVVAFSAFK  470

Query  1570  P  1572
             P
Sbjct  471   P  471



>ref|XP_004161144.1| PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[acyl-carrier-protein] 
synthase I, chloroplastic-like [Cucumis sativus]
Length=471

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/421 (74%), Positives = 363/421 (86%), Gaps = 0/421 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             PKR+ DPKKRVVITGMGLVSVFG+DV+T+Y+ LL G SG++LIDRFDAS F  RF GQI 
Sbjct  51    PKREKDPKKRVVITGMGLVSVFGNDVDTYYDKLLSGESGVTLIDRFDASKFPTRFGGQIR  110

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfggl  669
             GF S+GYID KNDRRLD   RYC+VAGKKAL DA+LG +  + +DK R G ++G+G GGL
Sbjct  111   GFASQGYIDGKNDRRLDDCLRYCIVAGKKALEDADLGGDKRSKIDKERAGVLVGTGMGGL  170

Query  670   gvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFY  849
              VF +GV  L++ G++KITPFFIPY+ITNMGSALLAI+ G MGP YSISTACAT+NYCFY
Sbjct  171   TVFSDGVQALIEKGHRKITPFFIPYAITNMGSALLAIDIGFMGPNYSISTACATSNYCFY  230

Query  850   SAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVI  1029
             +AANHIR+GEAD+M+AGGTEA I   G GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+
Sbjct  231   AAANHIRRGEADMMLAGGTEAAIIPIGXGGFVACRALSQRNDDPKTASRPWDKDRDGFVM  290

Query  1030  GEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAG  1209
             GEG G+LVME L+HAMKRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI  SLEDAG
Sbjct  291   GEGAGILVMESLEHAMKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCILSSLEDAG  350

Query  1210  VSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIA  1389
             VSPEEVNYINAHATST+AGD+ E+NAIKKVFK+TSEIK+N TKS+IGH LGA+GGLEAIA
Sbjct  351   VSPEEVNYINAHATSTLAGDLAEINAIKKVFKNTSEIKINATKSMIGHCLGAAGGLEAIA  410

Query  1390  TIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             T+KAI TGWLHP+INQ+N EP V  DTV NVK+QH+VNVAISNSFGFGGHNSV+ F  FK
Sbjct  411   TVKAIETGWLHPSINQFNPEPSVDFDTVANVKQQHEVNVAISNSFGFGGHNSVVAFSAFK  470

Query  1570  P  1572
             P
Sbjct  471   P  471



>ref|XP_010538529.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Tarenaya hassleriana]
Length=469

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/463 (70%), Positives = 379/463 (82%), Gaps = 2/463 (0%)
 Frame = +1

Query  184   LQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGL  363
             L+ S   P+    N+       A+  +K   I    S AVSAPKR++DP KRVVITG GL
Sbjct  9     LRASPPNPLRKHSNRQSHQIANARPTRKQHFIAA--SAAVSAPKRETDPNKRVVITGTGL  66

Query  364   VSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDH  543
             VSVFG+DV+ +Y  LL G SGIS IDRFDAS F  RF GQI GF+SEGYID KNDRR D 
Sbjct  67    VSVFGNDVDAYYEKLLAGESGISNIDRFDASKFPTRFGGQIRGFSSEGYIDGKNDRRQDD  126

Query  544   SWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKI  723
               +YC+VAGKKAL  A+LG + LN +DK R G ++G+G GGL VF +GV  L++ G+++I
Sbjct  127   CLKYCIVAGKKALESADLGGDKLNKIDKIRAGVLVGTGMGGLTVFSDGVQALIEKGHRRI  186

Query  724   TPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiagg  903
             TPFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEAD+M+AGG
Sbjct  187   TPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEADMMLAGG  246

Query  904   teagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKR  1083
             TEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+HA+KR
Sbjct  247   TEAAIIPIGLGGFVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHALKR  306

Query  1084  GANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVA  1263
             GA +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI + LEDAGVSPEEVNYINAHATST+A
Sbjct  307   GAPIIAEYLGGAINCDAYHMTDPRSDGLGVSSCIERCLEDAGVSPEEVNYINAHATSTLA  366

Query  1264  GDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYN  1443
             GD+ E+NAIKKVFK+TSEIK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLHP+INQ+N
Sbjct  367   GDLAEINAIKKVFKNTSEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQFN  426

Query  1444  LEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
              EP V  DTV NVKKQH+VNVAISNSFGFGGHNSV+ F  F P
Sbjct  427   PEPAVDFDTVANVKKQHEVNVAISNSFGFGGHNSVVAFSAFTP  469



>gb|KHM99882.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Glycine 
soja]
Length=406

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/406 (81%), Positives = 362/406 (89%), Gaps = 0/406 (0%)
 Frame = +1

Query  355   MGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRR  534
             MGLVSVFGSD++ FYN LLEG SGISLIDRFDAS+F VRF GQI  F+SEGYID KNDRR
Sbjct  1     MGLVSVFGSDIDGFYNKLLEGESGISLIDRFDASNFPVRFGGQIRDFSSEGYIDGKNDRR  60

Query  535   LDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGY  714
             LD  WRYC+VAGK+AL+DANLG++VL+ MDKTRIG ++GSG GG+  F  GV  LVQ GY
Sbjct  61    LDDCWRYCIVAGKRALDDANLGQQVLDTMDKTRIGVLVGSGMGGITAFSTGVEALVQKGY  120

Query  715   KKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMi  894
             KKITPFFIPYSITNMGSALLAI+ GLMGP YSISTACATANYCF SAANHIR+GEADIM+
Sbjct  121   KKITPFFIPYSITNMGSALLAIDTGLMGPNYSISTACATANYCFCSAANHIRKGEADIMV  180

Query  895   aggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHA  1074
              GGTEA I  +G+GGFIACRALS RN  P++ASRPWDKDRDGFV+GEG GVLVME L+ A
Sbjct  181   VGGTEAAIMPSGLGGFIACRALSHRNEGPKKASRPWDKDRDGFVMGEGSGVLVMESLESA  240

Query  1075  MKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATS  1254
              KRGA +IAEYLGGA TCDAHHMT+PR DGLGVSSCI+KSLEDAGVSPEEVNY+NAHATS
Sbjct  241   TKRGARIIAEYLGGAITCDAHHMTDPRADGLGVSSCISKSLEDAGVSPEEVNYVNAHATS  300

Query  1255  TVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTIN  1434
             T+AGD+ EVNAIKKVFKDTSE+KMN TKS+IGHGLGA+GGLEAIATIKAITTGWLHPTIN
Sbjct  301   TLAGDLAEVNAIKKVFKDTSELKMNATKSMIGHGLGAAGGLEAIATIKAITTGWLHPTIN  360

Query  1435  QYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             Q NLE  VTIDTVPNVKK+H+VNV ISNSFGFGGHNSV+VF PF+P
Sbjct  361   QDNLEASVTIDTVPNVKKKHEVNVGISNSFGFGGHNSVVVFAPFRP  406



>ref|XP_009114364.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Brassica rapa]
Length=470

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/434 (73%), Positives = 366/434 (84%), Gaps = 0/434 (0%)
 Frame = +1

Query  271   RRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFD  450
             RR     S AVSAPKR++DPKKRVVITGMGLVSVFG+DV+ +Y  LL G SGISLIDRFD
Sbjct  37    RRTFISASAAVSAPKRETDPKKRVVITGMGLVSVFGNDVDAYYETLLSGESGISLIDRFD  96

Query  451   ASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKT  630
             AS F  RF GQI GF+SEGYID KN+RRLD   +YC+VAGKKAL  ANLG + LN +DK 
Sbjct  97    ASKFPTRFGGQIRGFSSEGYIDGKNERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKQ  156

Query  631   RigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYS  810
             R G ++G+G GGL VF +GV  L++ G+++I+PFFIPY+ITNMGSALLAI+ GLMGP YS
Sbjct  157   RAGVLVGTGMGGLTVFSDGVQALIEKGHRRISPFFIPYAITNMGSALLAIDLGLMGPNYS  216

Query  811   ISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERA  990
             ISTACAT+NYCFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN++P+ A
Sbjct  217   ISTACATSNYCFYAAANHIRRGEADMMIAGGTEAAIIPIGLGGFVACRALSQRNNDPKTA  276

Query  991   SRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLG  1170
             SRPWDK RDGFV+GEG GVLVME L+HAMKRGA ++AEYLGGA  CDAHHMT+PR DGLG
Sbjct  277   SRPWDKQRDGFVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGAVNCDAHHMTDPRADGLG  336

Query  1171  VSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIG  1350
             VSSCI   LEDAGVSPEEVNYINAHATST+AGD+ E+NAIKKVFK T+ IK+N TKS+IG
Sbjct  337   VSSCIESCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKSTAGIKINATKSMIG  396

Query  1351  HGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGF  1530
             H LGA+GGLEAIAT+KAI TGWLHP+INQ+N EP V  DTV N KK H+VNVAISNSFGF
Sbjct  397   HCLGAAGGLEAIATVKAINTGWLHPSINQFNPEPAVDFDTVANEKKPHEVNVAISNSFGF  456

Query  1531  GGHNSVIVFGPFKP  1572
             GGHNSV+ F  F P
Sbjct  457   GGHNSVVAFSAFTP  470



>gb|ABJ90468.1| beta-ketoacyl-ACP synthase I [Jatropha curcas]
Length=468

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/427 (74%), Positives = 365/427 (85%), Gaps = 0/427 (0%)
 Frame = +1

Query  292   SPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVR  471
             S  V+APKR+ DPKKRVVITGMGLVSVFG+DV+ +Y+ LL G SGI  IDRFDAS F  R
Sbjct  42    SSTVTAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGIGPIDRFDASKFPTR  101

Query  472   FAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavig  651
             FAGQI GF +EGYID KNDRRLD   RYC+VAGKK+L  A+LG + L+ +DK R G ++G
Sbjct  102   FAGQIRGFGAEGYIDGKNDRRLDDCLRYCIVAGKKSLEHADLGGDNLSKVDKERAGVLVG  161

Query  652   sgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACAT  831
             +G GGL VF +GV  L++ G++KITPFFIPY+ITNMGSALLA+E G MGP YSISTACAT
Sbjct  162   TGMGGLTVFSDGVQALIEKGHRKITPFFIPYAITNMGSALLAMEIGFMGPNYSISTACAT  221

Query  832   ANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKD  1011
             +NYCFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWD+D
Sbjct  222   SNYCFYAAANHIRRGEADLMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDRD  281

Query  1012  RDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITK  1191
             RDGFV+GEG GVLVME L+HAMKRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI +
Sbjct  282   RDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIER  341

Query  1192  SLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASG  1371
             SLEDAGVSPEEVNYINAHATST+AGD+ E+NAIKKVFKDTSEIK+N TKS+IGH LGA+G
Sbjct  342   SLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKDTSEIKINATKSMIGHCLGAAG  401

Query  1372  GLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVI  1551
             GLEAIA  KAITTGWLHPTINQ+N EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+
Sbjct  402   GLEAIACAKAITTGWLHPTINQFNPEPSVEFDTVANKKQQHEVNVAISNSFGFGGHNSVV  461

Query  1552  VFGPFKP  1572
              F  FKP
Sbjct  462   AFSAFKP  468



>ref|XP_010666593.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010666594.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=472

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/464 (69%), Positives = 379/464 (82%), Gaps = 1/464 (0%)
 Frame = +1

Query  184   LQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVS-APKRQSDPKKRVVITGMG  360
             L+ S L P+ T  N   S + K +   K        S  V+ APKR++DPKKRVVITGMG
Sbjct  9     LRPSSLSPLHTKPNSLSSNSPKCKPPNKAFFFTPRASSQVAVAPKRETDPKKRVVITGMG  68

Query  361   LVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLD  540
             LVSVFG+D + FY  LL+G SGI  IDRFDAS F  RFAGQIH F+SEGYID KNDRRLD
Sbjct  69    LVSVFGNDPDVFYEKLLDGVSGIGPIDRFDASKFPTRFAGQIHNFSSEGYIDGKNDRRLD  128

Query  541   HSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKK  720
                RYC+VAGKKAL  A+L  + L+ +DK R G ++G+G GGL VF +GV  L++ G+++
Sbjct  129   DCLRYCIVAGKKALESADLAADKLSKIDKVRAGVLVGTGMGGLTVFSDGVQALIEKGHRR  188

Query  721   ITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiag  900
             ITPFFIPY+ITNM SALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEAD+M+AG
Sbjct  189   ITPFFIPYAITNMASALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEADLMVAG  248

Query  901   gteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMK  1080
             GTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK RDGFV+GEG GVLVME L+HAMK
Sbjct  249   GTEAAILPIGLGGFVACRALSQRNDDPQTASRPWDKARDGFVMGEGSGVLVMESLEHAMK  308

Query  1081  RGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTV  1260
             RGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI +SLEDAGVSPEEVNYINAHATST+
Sbjct  309   RGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNYINAHATSTI  368

Query  1261  AGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQY  1440
              GD+ EVNAIKKVFK+TSEIK+N TKS+IGH LGA+GG+EAIA++KA TTGWLHPTINQ+
Sbjct  369   VGDLAEVNAIKKVFKNTSEIKINATKSMIGHCLGAAGGMEAIASVKACTTGWLHPTINQF  428

Query  1441  NLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             + EP V  +TVPN K+QH+VNVAISNSFGFGGHNSV+VF  FKP
Sbjct  429   DPEPSVEFNTVPNKKQQHEVNVAISNSFGFGGHNSVVVFSAFKP  472



>ref|XP_008383499.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Malus domestica]
Length=472

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/467 (71%), Positives = 383/467 (82%), Gaps = 1/467 (0%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQNQPDSVAYK-AQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVIT  351
             +S L+ + L P+        SV  K A ++ +   I    +PAVSAPKR++DPKKRVVIT
Sbjct  6     SSTLRPAPLDPIRKRTPHFPSVTTKTATSSGRISFISASSAPAVSAPKRETDPKKRVVIT  65

Query  352   GMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDR  531
             GMGLVSVFG+DV TFY+ LL G SG+  +DRFDAS FS RF GQI GF+SEGYID KNDR
Sbjct  66    GMGLVSVFGNDVNTFYDKLLAGESGVXPLDRFDASKFSTRFGGQIRGFSSEGYIDGKNDR  125

Query  532   RLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSG  711
             RLD   RY LVAGKKAL DA LG +  + +DK+R G ++GSG GGL VF +GV  L++ G
Sbjct  126   RLDDCLRYSLVAGKKALEDAGLGADNRSKLDKSRAGVLVGSGMGGLTVFSDGVHALIEKG  185

Query  712   YKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIM  891
             ++KITPFFIPY+ITNMGSALLAI+ G MGP YSISTACAT+NYCFYSAANHIR+GEAD+M
Sbjct  186   HRKITPFFIPYAITNMGSALLAIDLGFMGPNYSISTACATSNYCFYSAANHIRRGEADLM  245

Query  892   iaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDH  1071
             IAGGTEA I   GVGGFIACRALSQRN +P+ ASRPWD+DRDGFVIGEG GVLVME L+H
Sbjct  246   IAGGTEAAIIPVGVGGFIACRALSQRNDDPKTASRPWDRDRDGFVIGEGAGVLVMESLEH  305

Query  1072  AMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHAT  1251
             A KRGA +IAEYLGG   CDA+HMT+PR DGLGVS+CI K LEDAGVSPEEVNYINAHAT
Sbjct  306   ATKRGATIIAEYLGGGINCDAYHMTDPRADGLGVSTCIQKCLEDAGVSPEEVNYINAHAT  365

Query  1252  STVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTI  1431
             ST+AGD+ E+NAIKKVF +T +IK+N TKS+IGH LGASGGLEAIA IKAITTGWLHP+I
Sbjct  366   STLAGDLAEINAIKKVFTNTKDIKINATKSMIGHCLGASGGLEAIAVIKAITTGWLHPSI  425

Query  1432  NQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             NQ+N EP V  DTVPNVK+QH+VNVAISNSFGFGGHNSV+ F PFKP
Sbjct  426   NQFNPEPSVEFDTVPNVKQQHEVNVAISNSFGFGGHNSVVAFSPFKP  472



>ref|NP_199441.1| beta-ketoacyl-[acyl carrier protein] synthase I  [Arabidopsis 
thaliana]
 sp|P52410.2|KASC1_ARATH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic; 
AltName: Full=Beta-ketoacyl-ACP synthase I; Short=KAS 
I; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB11084.1| 3-oxoacyl-[acyl-carrier-protein] synthase I precursor [Arabidopsis 
thaliana]
 gb|AAK59862.1| AT5g46290/MPL12_7 [Arabidopsis thaliana]
 gb|AAM16266.1| AT5g46290/MPL12_7 [Arabidopsis thaliana]
 gb|AAM65396.1| 3-oxoacyl-(acyl-carrier-protein) synthase I precursor (beta-ketoacyl-acp 
synthase I) (KAS I) [Arabidopsis thaliana]
 gb|AAM74493.1| AT5g46290/MPL12_7 [Arabidopsis thaliana]
 gb|AED95363.1| beta-ketoacyl-[acyl carrier protein] synthase I [Arabidopsis 
thaliana]
Length=473

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/424 (74%), Positives = 363/424 (86%), Gaps = 0/424 (0%)
 Frame = +1

Query  301   VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAG  480
             VSAPKR++DPKKRVVITGMGLVSVFG+DV+ +Y  LL G SGISLIDRFDAS F  RF G
Sbjct  50    VSAPKRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGG  109

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgf  660
             QI GF+SEGYID KN+RRLD   +YC+VAGKKAL  ANLG + LN +DK + G ++G+G 
Sbjct  110   QIRGFSSEGYIDGKNERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKRKAGVLVGTGM  169

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GGL VF  GV  L++ G+++I+PFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NY
Sbjct  170   GGLTVFSEGVQNLIEKGHRRISPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNY  229

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
             CFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK RDG
Sbjct  230   CFYAAANHIRRGEADMMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKARDG  289

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVLVME L+HAMKRGA ++AEYLGGA  CDAHHMT+PR DGLGVSSCI + LE
Sbjct  290   FVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSSCIERCLE  349

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
             DAGVSPEEVNYINAHATST+AGD+ E+NAIKKVFK TS IK+N TKS+IGH LGA+GGLE
Sbjct  350   DAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKSTSGIKINATKSMIGHCLGAAGGLE  409

Query  1381  AIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFG  1560
             AIAT+KAI TGWLHP+INQ+N E  V  DTVPN KKQH+V+VAISNSFGFGGHNSV+ F 
Sbjct  410   AIATVKAINTGWLHPSINQFNPEQAVDFDTVPNEKKQHEVDVAISNSFGFGGHNSVVAFS  469

Query  1561  PFKP  1572
              FKP
Sbjct  470   AFKP  473



>ref|XP_008349175.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Malus domestica]
Length=472

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/467 (71%), Positives = 383/467 (82%), Gaps = 1/467 (0%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQNQPDSVAYK-AQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVIT  351
             +S L+ + L P+        SV  K A ++ +   I    +PAVSAPKR++DPKKRVVIT
Sbjct  6     SSTLRPAPLDPIRKRTPHFXSVTTKTATSSGRISFISASSAPAVSAPKRETDPKKRVVIT  65

Query  352   GMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDR  531
             GMGLVSVFG+DV TFY+ LL G SG+  +DRFDAS FS RF GQI GF+SEGYID KNDR
Sbjct  66    GMGLVSVFGNDVNTFYDKLLAGESGVXPLDRFDASKFSTRFGGQIRGFSSEGYIDGKNDR  125

Query  532   RLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSG  711
             RLD   RY LVAGKKAL DA LG +  + +DK+R G ++GSG GGL VF +GV  L++ G
Sbjct  126   RLDDCLRYSLVAGKKALEDAGLGADNRSKLDKSRAGVLVGSGMGGLTVFSDGVHALIEKG  185

Query  712   YKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIM  891
             ++KITPFFIPY+ITNMGSALLAI+ G MGP YSISTACAT+NYCFYSAANHIR+GEAD+M
Sbjct  186   HRKITPFFIPYAITNMGSALLAIDLGFMGPNYSISTACATSNYCFYSAANHIRRGEADLM  245

Query  892   iaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDH  1071
             IAGGTEA I   GVGGFIACRALSQRN +P+ ASRPWD+DRDGFVIGEG GVLVME L+H
Sbjct  246   IAGGTEAAIIPVGVGGFIACRALSQRNDDPKTASRPWDRDRDGFVIGEGAGVLVMESLEH  305

Query  1072  AMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHAT  1251
             A KRGA +IAEYLGG   CDA+HMT+PR DGLGVS+CI K LEDAGVSPEEVNYINAHAT
Sbjct  306   ATKRGATIIAEYLGGGINCDAYHMTDPRADGLGVSTCIQKCLEDAGVSPEEVNYINAHAT  365

Query  1252  STVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTI  1431
             ST+AGD+ E+NAIKKVF +T +IK+N TKS+IGH LGASGGLEAIA IKAITTGWLHP+I
Sbjct  366   STLAGDLAEINAIKKVFTNTKDIKINATKSMIGHCLGASGGLEAIAVIKAITTGWLHPSI  425

Query  1432  NQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             NQ+N EP V  DTVPNVK+QH+VNVAISNSFGFGGHNSV+ F PFKP
Sbjct  426   NQFNPEPSVEFDTVPNVKQQHEVNVAISNSFGFGGHNSVVAFSPFKP  472



>ref|XP_008371590.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Malus domestica]
Length=472

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/467 (69%), Positives = 378/467 (81%), Gaps = 1/467 (0%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQNQ-PDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVIT  351
             +S L+ + L P+       P+     A ++++   I     PAVSAPKR+ DPKKRVVIT
Sbjct  6     SSTLRPAPLDPIRKRTPHFPNVTTRTANSSRRISFISASSVPAVSAPKREMDPKKRVVIT  65

Query  352   GMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDR  531
             GMGLVSVFG+DV T+Y+ LL G SG+  IDRFDAS F  RF GQI GF+SEGYID KNDR
Sbjct  66    GMGLVSVFGNDVNTYYDKLLAGESGVGPIDRFDASKFPTRFGGQIRGFSSEGYIDGKNDR  125

Query  532   RLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSG  711
             RLD   RY +VAGKKAL DA+LG +  + +DK+R G ++GSG GGL VF +GV  L++ G
Sbjct  126   RLDDCLRYSIVAGKKALEDADLGADQRSKLDKSRTGVLVGSGMGGLTVFSDGVHALIEKG  185

Query  712   YKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIM  891
             ++KITPFFIPY+ITNMGSALLAI+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+M
Sbjct  186   HRKITPFFIPYAITNMGSALLAIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEADLM  245

Query  892   iaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDH  1071
             IAGGTEA I   GVGG  ACRALSQRN +P+ ASRPWD+DRDGFV+GEG GVLVME L+H
Sbjct  246   IAGGTEAAIIPVGVGGXXACRALSQRNDDPKTASRPWDRDRDGFVMGEGAGVLVMESLEH  305

Query  1072  AMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHAT  1251
             A KRGA +IAEYLGG   CDA+HMT+PR DGLGVS+CI + LEDAGVSPEEVNYINAHAT
Sbjct  306   ATKRGATIIAEYLGGGINCDAYHMTDPRADGLGVSTCIQRCLEDAGVSPEEVNYINAHAT  365

Query  1252  STVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTI  1431
             ST+AGD+ E+NAIKKVF +T +IK+N TKS+IGH LGASGGLEAIA IKAITTGWLHP+I
Sbjct  366   STLAGDLAEINAIKKVFTNTKDIKINATKSMIGHCLGASGGLEAIAVIKAITTGWLHPSI  425

Query  1432  NQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             NQ+N EP V  DTVPNVK+QH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  426   NQFNPEPSVEFDTVPNVKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  472



>ref|XP_009627828.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=467

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/465 (69%), Positives = 379/465 (82%), Gaps = 3/465 (1%)
 Frame = +1

Query  184   LQYSGLKPVETMQN--QPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGM  357
             LQ S L+P        +P++  +      K +++   IS A SAP R+ DPKKRVVITGM
Sbjct  4     LQSSSLRPSPPTHPFLKPNTHQFTNVKPLKPKKLTPFIS-ASSAPTREKDPKKRVVITGM  62

Query  358   GLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRL  537
             GLVSVFG+DV+ +Y+ LL G SGISLIDRFDAS F  RF GQI GF +EGYID KNDRRL
Sbjct  63    GLVSVFGNDVDAYYDKLLAGESGISLIDRFDASKFPTRFGGQIRGFKAEGYIDGKNDRRL  122

Query  538   DHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYK  717
             D   RY +VAGKKAL +A+LG +    ++K R G ++G+G GGL VF +GV  L++ G++
Sbjct  123   DDCLRYGIVAGKKALENADLGTDRDKKINKERAGVLVGTGMGGLTVFSDGVQALIEKGHR  182

Query  718   KITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMia  897
             KI+PFFIPY+ITNMGSALLAI+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+MIA
Sbjct  183   KISPFFIPYAITNMGSALLAIDVGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMIA  242

Query  898   ggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAM  1077
             GGTEA +   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+HAM
Sbjct  243   GGTEAAMIPIGLGGFVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAM  302

Query  1078  KRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATST  1257
             KRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI  SLEDAGVSPEEVNYINAHATST
Sbjct  303   KRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCILSSLEDAGVSPEEVNYINAHATST  362

Query  1258  VAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQ  1437
             + GD+ EVNA+KKVFK+ SEIKMN TKS+IGH LGA+GGLEAIAT+KAITTGWLHP+INQ
Sbjct  363   IVGDLAEVNAVKKVFKNPSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPSINQ  422

Query  1438  YNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             +N EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+VF  FKP
Sbjct  423   FNPEPSVEFDTVANKKQQHEVNVAISNSFGFGGHNSVVVFSAFKP  467



>gb|KDP37953.1| hypothetical protein JCGZ_04596 [Jatropha curcas]
Length=468

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/424 (74%), Positives = 364/424 (86%), Gaps = 0/424 (0%)
 Frame = +1

Query  301   VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAG  480
             V+APKR+ DPKKRVVITGMGLVSVFG+DV+ +Y+ LL G SGI  IDRFDAS F  RFAG
Sbjct  45    VTAPKREKDPKKRVVITGMGLVSVFGNDVDAYYDKLLAGESGIGPIDRFDASKFPTRFAG  104

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgf  660
             QI GF ++GYID KNDRRLD   RYC+VAGKK+L  A+LG + L+ +DK R G ++G+G 
Sbjct  105   QIRGFGAQGYIDGKNDRRLDDCLRYCIVAGKKSLEHADLGGDNLSKVDKERAGVLVGTGM  164

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GGL VF +GV  L++ G++KITPFFIPY+ITNMGSALLA+E G MGP YSISTACAT+NY
Sbjct  165   GGLTVFSDGVQALIEKGHRKITPFFIPYAITNMGSALLAMEIGFMGPNYSISTACATSNY  224

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
             CFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWD+DRDG
Sbjct  225   CFYAAANHIRRGEADLMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDRDRDG  284

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVLVME L+HAMKRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI +SLE
Sbjct  285   FVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIERSLE  344

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
             DAGVSPEEVNYINAHATST+AGD+ E+NAIKKVFKDTSEIK+N TKS+IGH LGA+GGLE
Sbjct  345   DAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKDTSEIKINATKSMIGHCLGAAGGLE  404

Query  1381  AIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFG  1560
             AIA  KAITTGWLHPTINQ+N EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+ F 
Sbjct  405   AIACAKAITTGWLHPTINQFNPEPSVEFDTVANKKQQHEVNVAISNSFGFGGHNSVVAFS  464

Query  1561  PFKP  1572
              FKP
Sbjct  465   AFKP  468



>ref|XP_008784346.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Phoenix dactylifera]
Length=469

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/424 (75%), Positives = 364/424 (86%), Gaps = 2/424 (0%)
 Frame = +1

Query  307   APKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQI  486
             AP+R++DPKKRVVITGMGLVSVFG+DV+ +Y  LLEG SGI  IDRFDAS F  RFAGQI
Sbjct  46    APRRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLEGESGIGPIDRFDASKFPTRFAGQI  105

Query  487   HGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLG--KEVLNNMDKTRigavigsgf  660
              GF+SEG+ID KNDRRLD   RYCLV+GKKAL    LG   + L+ +DK R G ++G+G 
Sbjct  106   RGFSSEGFIDGKNDRRLDDCLRYCLVSGKKALESTGLGVGSKALSKIDKVRAGVLVGTGM  165

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GGL VF +GV  L++ G++KITPFFIPY+ITNMGSALLA++ G MG  YSISTACAT+NY
Sbjct  166   GGLTVFSDGVQALIEKGHRKITPFFIPYAITNMGSALLAMDIGFMGANYSISTACATSNY  225

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
             CFY+AANHIR+GEAD+MIAGGTEA I   GVGGF+ACRALSQRN +P+ ASRPWDKDRDG
Sbjct  226   CFYAAANHIRRGEADVMIAGGTEAAIIPIGVGGFVACRALSQRNDDPKTASRPWDKDRDG  285

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT+PR DGLGVSSCI KSLE
Sbjct  286   FVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIRKSLE  345

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
             DAGV+PEEVNYINAHATST+AGD+ EVNAIK+VFK+ SEIKMN TKS+IGH LGASGGLE
Sbjct  346   DAGVAPEEVNYINAHATSTLAGDLAEVNAIKQVFKNPSEIKMNATKSIIGHCLGASGGLE  405

Query  1381  AIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFG  1560
             AIAT+KAITTGWLHP+INQ+N EP V IDTV N KKQH+VNVAISNSFGFGGHNSV+VF 
Sbjct  406   AIATVKAITTGWLHPSINQFNPEPAVEIDTVANKKKQHEVNVAISNSFGFGGHNSVVVFA  465

Query  1561  PFKP  1572
             PFKP
Sbjct  466   PFKP  469



>ref|XP_011085258.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Sesamum indicum]
Length=471

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/432 (73%), Positives = 366/432 (85%), Gaps = 0/432 (0%)
 Frame = +1

Query  277   IKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDAS  456
              K   S   +APKR++DPKKRVVITGMGLVSVFG+DV+ +Y  LL G SGI+LIDRFDAS
Sbjct  40    FKVSSSAVTAAPKRETDPKKRVVITGMGLVSVFGNDVDVYYEKLLSGESGITLIDRFDAS  99

Query  457   DFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRi  636
              F  RF GQI GF +EGYID KNDRRLD   RYC+VAGKKAL  A+LG + L+ +DK R 
Sbjct  100   KFPTRFGGQIRGFKAEGYIDGKNDRRLDDCLRYCIVAGKKALEGADLGGDKLDKIDKIRA  159

Query  637   gavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSIS  816
             G +IG+G GGL VF +GV  L++ G++KITPFFIPY+ITNM SALLAI+ G MGP YSIS
Sbjct  160   GVLIGTGMGGLTVFSDGVQALIEKGHRKITPFFIPYAITNMASALLAIDLGFMGPNYSIS  219

Query  817   TACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASR  996
             TACAT+NYCFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASR
Sbjct  220   TACATSNYCFYAAANHIRRGEADLMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASR  279

Query  997   PWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVS  1176
             PWDKDRDGFV+GEG GVLV+E L+HAMKRGA +IAEYLGGA  CDA+HMT+PR+DGLGVS
Sbjct  280   PWDKDRDGFVMGEGAGVLVLESLEHAMKRGAPIIAEYLGGAVNCDAYHMTDPRSDGLGVS  339

Query  1177  SCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHG  1356
             SCI  +LEDAGVSPEEVNYINAHATST+ GD+ EVNAIKKVFK+TSEIK+N TKS+IGH 
Sbjct  340   SCIQSALEDAGVSPEEVNYINAHATSTIVGDLAEVNAIKKVFKNTSEIKINATKSMIGHC  399

Query  1357  LGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGG  1536
             LGA+GGLEAIAT+KAITTGWLHPTINQ++ EP V  DTV N K++H+VNVAISNSFGFGG
Sbjct  400   LGAAGGLEAIATVKAITTGWLHPTINQFSAEPSVEFDTVANKKQEHEVNVAISNSFGFGG  459

Query  1537  HNSVIVFGPFKP  1572
             HNSV+ F  FKP
Sbjct  460   HNSVVAFSAFKP  471



>ref|XP_004504688.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Cicer arietinum]
Length=472

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/465 (69%), Positives = 377/465 (81%), Gaps = 3/465 (1%)
 Frame = +1

Query  178   SLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGM  357
             S L+ S L P+    +   +   K   +K+   I   ++   +AP+R+ DPKKRVVITGM
Sbjct  11    STLRPSPLDPLRRKTSNAAATKIK-PTSKRLSHISAAVT--TTAPQREKDPKKRVVITGM  67

Query  358   GLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRL  537
             GL SVFG+DV+ FY+ LL G SGI+ IDRFDAS F  RFAGQI  F SEGYID KNDRRL
Sbjct  68    GLASVFGNDVDGFYDKLLAGESGITSIDRFDASKFPTRFAGQIRDFNSEGYIDGKNDRRL  127

Query  538   DHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYK  717
             D   RYC+VAGKKAL +A+LG   L+ +DK R G ++GSG GGL VF  GV  L++ G++
Sbjct  128   DDCLRYCIVAGKKALENADLGAGNLSKIDKERAGVLVGSGMGGLTVFSEGVKNLIEKGHR  187

Query  718   KITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMia  897
             KITPFFIPY+ITNMGSALL I+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+MIA
Sbjct  188   KITPFFIPYAITNMGSALLGIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMIA  247

Query  898   ggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAM  1077
             GGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+HAM
Sbjct  248   GGTEAAIIPIGLGGFVACRALSQRNDDPKTASRPWDKDRDGFVMGEGSGVLVMESLEHAM  307

Query  1078  KRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATST  1257
             KRGA +IAEYLGGA  CDAHHMT+PR+DGLGVS+CI  SL DAGVSPEEVNYINAHATST
Sbjct  308   KRGAPIIAEYLGGAVNCDAHHMTDPRSDGLGVSTCIQSSLIDAGVSPEEVNYINAHATST  367

Query  1258  VAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQ  1437
             +AGD+ E+NAIKKVFK+TS IK+N TKS+IGH LGASGGLEAIAT+KAITTGWLHP+INQ
Sbjct  368   LAGDLAEINAIKKVFKNTSGIKINATKSMIGHCLGASGGLEAIATVKAITTGWLHPSINQ  427

Query  1438  YNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             +N EP V  DTVPNVKKQH++NV ISNSFGFGGHNSV+ F  F+P
Sbjct  428   FNPEPAVDFDTVPNVKKQHEINVGISNSFGFGGHNSVVAFSAFRP  472



>gb|EYU43272.1| hypothetical protein MIMGU_mgv1a005817mg [Erythranthe guttata]
Length=469

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/457 (70%), Positives = 372/457 (81%), Gaps = 1/457 (0%)
 Frame = +1

Query  205   PVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAP-KRQSDPKKRVVITGMGLVSVFGS  381
             P+E ++    S    A+   K    K   S   +AP KR++DPKKRVVITGMGLVSVFG+
Sbjct  13    PLEPLRKPQISTGNNAKTPAKRLPFKVSASAVTAAPPKRETDPKKRVVITGMGLVSVFGN  72

Query  382   DVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCL  561
             DV+ +Y  LL G SGI+ IDRFD S F  RF GQI GF SEGYID KNDRRLD   RYC+
Sbjct  73    DVDAYYEKLLSGVSGITPIDRFDVSKFPTRFGGQIRGFKSEGYIDGKNDRRLDDCLRYCI  132

Query  562   VAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIP  741
             VAGKKA+ DA+LG + LN +DKTR G ++G+G GGL VF +GV  L++ G++KITPFFIP
Sbjct  133   VAGKKAIEDADLGGDKLNTIDKTRAGVLVGTGMGGLTVFSDGVQALIEKGHRKITPFFIP  192

Query  742   YSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagit  921
             Y+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEAD+M+AGGTEA I 
Sbjct  193   YAITNMGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEADLMVAGGTEAAII  252

Query  922   ttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIA  1101
               G+GGF+ACRALSQRN +P+ ASRPWDK+RDGFV+GEG GVLVME L+HAMKRGA +IA
Sbjct  253   PIGLGGFVACRALSQRNDDPQTASRPWDKERDGFVMGEGAGVLVMESLEHAMKRGAPIIA  312

Query  1102  EYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEV  1281
             EYLGGA  CDA+HMT+PR DGLGVSSCI  +LEDAGVSPEEVNYINAHATST+ GD+ E+
Sbjct  313   EYLGGAINCDAYHMTDPRADGLGVSSCIHAALEDAGVSPEEVNYINAHATSTIVGDLAEL  372

Query  1282  NAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVT  1461
             NAIKKVFK   EIK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLHPTINQ+N EP V 
Sbjct  373   NAIKKVFKSPKEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVE  432

Query  1462  IDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
              DTV N K+QH++NV ISNSFGFGGHNSV+ F  FKP
Sbjct  433   FDTVANTKQQHEINVGISNSFGFGGHNSVVAFSAFKP  469



>ref|NP_001237654.1| beta-ketoacyl-ACP synthetase I-2 [Glycine max]
 gb|AAF61731.1|AF243183_1 beta-ketoacyl-ACP synthetase I-2 [Glycine max]
Length=469

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/432 (73%), Positives = 366/432 (85%), Gaps = 0/432 (0%)
 Frame = +1

Query  277   IKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDAS  456
             +   ++P VSAP+RQ D KKRVVITGMGL SVFG+DVE +Y  LL G SGI+ IDRFDAS
Sbjct  38    VSATVAPKVSAPQRQKDSKKRVVITGMGLASVFGNDVEGYYEKLLAGESGITPIDRFDAS  97

Query  457   DFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRi  636
              F  RF GQI GF++EGYID KNDRRLD   RYC+VAGKKAL +A+L  +  + +DK R 
Sbjct  98    KFPTRFGGQIRGFSAEGYIDGKNDRRLDDCLRYCIVAGKKALENADLAPDNHSKIDKERA  157

Query  637   gavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSIS  816
             G ++GSG GGL VF +GV  L++ G++KITPFFIPY+ITNMGSALL I+ G MGP YSIS
Sbjct  158   GVLVGSGMGGLTVFSDGVQALIEKGHRKITPFFIPYAITNMGSALLGIDLGFMGPNYSIS  217

Query  817   TACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASR  996
             TACAT+NYCFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASR
Sbjct  218   TACATSNYCFYAAANHIRRGEADLMIAGGTEAAIIPIGLGGFVACRALSQRNDDPKTASR  277

Query  997   PWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVS  1176
             PWDKDRDGFV+GEG GVLVME L+HAMKRGA +IAEYLGGA  CDA+HMT+PR+DGLGVS
Sbjct  278   PWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIAEYLGGAVNCDAYHMTDPRSDGLGVS  337

Query  1177  SCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHG  1356
             +CI  SLEDAGVSPEEVNYINAHATST+AGD+ E+NAIKKVFKDTS IK+N TKS+IGH 
Sbjct  338   TCIQSSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKDTSGIKINATKSMIGHC  397

Query  1357  LGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGG  1536
             LGA+GGLEAIAT+KAITTGWLHPTINQ+N EP V  DTV NVK+QH++NVAISNSFGFGG
Sbjct  398   LGAAGGLEAIATVKAITTGWLHPTINQFNPEPAVDFDTVANVKQQHEINVAISNSFGFGG  457

Query  1537  HNSVIVFGPFKP  1572
             HNSV+ F  F+P
Sbjct  458   HNSVVAFSAFRP  469



>ref|XP_002305334.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Populus trichocarpa]
 gb|EEE85845.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Populus trichocarpa]
Length=471

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/422 (74%), Positives = 366/422 (87%), Gaps = 0/422 (0%)
 Frame = +1

Query  307   APKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQI  486
             APKR+ DPKKR+VITGMGLVSVFG++V+ +Y+ LL G SGI  IDRFDAS F  RF GQI
Sbjct  50    APKREKDPKKRIVITGMGLVSVFGNEVDAYYDKLLAGESGIGTIDRFDASKFPTRFGGQI  109

Query  487   HGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgg  666
              GF+++GYID KNDRRLD   RYC+VAGKKAL DA+LG + L+ +DK + G ++G+G GG
Sbjct  110   RGFSAQGYIDGKNDRRLDDCLRYCIVAGKKALEDADLGGDNLSKIDKEKAGVLVGTGMGG  169

Query  667   lgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCF  846
             L VF +GV +L++ G++KITPFFIPY+ITNMGSALLAIE G MGP YSISTACAT+NYCF
Sbjct  170   LTVFSDGVQSLIEKGHRKITPFFIPYAITNMGSALLAIELGFMGPNYSISTACATSNYCF  229

Query  847   YSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFV  1026
             Y+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV
Sbjct  230   YAAANHIRRGEADMMIAGGTEAAIIPIGLGGFVACRALSQRNDDPKTASRPWDKDRDGFV  289

Query  1027  IGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDA  1206
             +GEG GVLVME L+HAM+RGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI +SLEDA
Sbjct  290   MGEGAGVLVMESLEHAMRRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIERSLEDA  349

Query  1207  GVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAI  1386
             GVSPEEVNYINAHATST+AGD+ E+NAIKKVFK+TS IK+N TKS+IGH LGA+GGLEAI
Sbjct  350   GVSPEEVNYINAHATSTIAGDLAEINAIKKVFKNTSGIKINATKSMIGHCLGAAGGLEAI  409

Query  1387  ATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPF  1566
             A++KAITTGWLHP+INQ+N EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+VF  F
Sbjct  410   ASVKAITTGWLHPSINQFNPEPSVEFDTVANKKQQHEVNVAISNSFGFGGHNSVVVFSAF  469

Query  1567  KP  1572
             KP
Sbjct  470   KP  471



>ref|XP_010441599.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Camelina sativa]
Length=472

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/469 (69%), Positives = 383/469 (82%), Gaps = 6/469 (1%)
 Frame = +1

Query  184   LQYSGLK--PVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSA----PKRQSDPKKRVV  345
             LQ S L+  P   ++   +  +++   A+  RR +  IS + SA    PKR++DPKKRVV
Sbjct  4     LQSSSLRASPPNPLRLPSNRQSHQITNARPVRRQRSFISASASATVSAPKRETDPKKRVV  63

Query  346   ITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKN  525
             ITGMGLVSVFG+DV+ +Y  LL G SGISLIDRFDAS F  RF GQI GF+SEGYID KN
Sbjct  64    ITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGKN  123

Query  526   DRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQ  705
             +RRLD   +YC+VAGKKAL  ANLG + LN++DK + G ++G+G GGL VF  GV  L++
Sbjct  124   ERRLDDCLKYCIVAGKKALESANLGGDKLNSIDKRKAGVLVGTGMGGLTVFSEGVQNLIE  183

Query  706   SGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEAD  885
              G+++I+PFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEAD
Sbjct  184   KGHRRISPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEAD  243

Query  886   IMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERL  1065
             +MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK RDGFV+GEG GVLVME L
Sbjct  244   MMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKARDGFVMGEGAGVLVMESL  303

Query  1066  DHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAH  1245
             +HAMKRGA ++AEYLGGA  CDAHHMT+PR DGLGVSSCI + LEDAGVSPEEVNYINAH
Sbjct  304   EHAMKRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSSCIERCLEDAGVSPEEVNYINAH  363

Query  1246  ATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHP  1425
             ATST+AGD+ E+NAIKKVFK TS IK+N TKS+IGH LGA+GGLEAIAT+KAI TGWLHP
Sbjct  364   ATSTLAGDLAEINAIKKVFKSTSGIKINATKSMIGHCLGAAGGLEAIATVKAINTGWLHP  423

Query  1426  TINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             +INQ+N E  V  DTVPN KKQH+V+VAISNSFGFGGHNSV+ F  FKP
Sbjct  424   SINQFNPEQAVDFDTVPNQKKQHEVDVAISNSFGFGGHNSVVAFSAFKP  472



>ref|XP_009128853.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Brassica rapa]
Length=472

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/421 (74%), Positives = 360/421 (86%), Gaps = 0/421 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             PKR++DPKKRVVITGMGLVSVFG+DV+ +Y  LL G SGISLIDRFDAS F  RF GQI 
Sbjct  52    PKRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIR  111

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfggl  669
             GF+SEGYID KN+RRLD   +YC+VAGKKAL  ANLG + LN +DK R G ++G+G GGL
Sbjct  112   GFSSEGYIDGKNERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKQRAGVLVGTGMGGL  171

Query  670   gvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFY  849
              VF +GV  L++ G+++I+PFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY
Sbjct  172   TVFSDGVQALIEKGHRRISPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFY  231

Query  850   SAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVI  1029
             +AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK RDGFV+
Sbjct  232   AAANHIRRGEADMMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKQRDGFVM  291

Query  1030  GEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAG  1209
             GEG GVLVME L+HAMKRGA ++AEYLGGA  CDAHHMT+PR DGLGVSSCI   LEDAG
Sbjct  292   GEGAGVLVMESLEHAMKRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSSCIESCLEDAG  351

Query  1210  VSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIA  1389
             VSPEEVNYINAHATST+AGD+ E+NAIKKVFK TS IK+N TKS+IGH LGA+GGLEAIA
Sbjct  352   VSPEEVNYINAHATSTLAGDLAEINAIKKVFKSTSGIKINATKSMIGHCLGAAGGLEAIA  411

Query  1390  TIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             T+KAI TGWLHP+INQ+N EP V  DTV N KKQH+VNVAISNSFGFGGHNSV+ F  FK
Sbjct  412   TVKAINTGWLHPSINQFNPEPAVDFDTVANEKKQHEVNVAISNSFGFGGHNSVVAFSAFK  471

Query  1570  P  1572
             P
Sbjct  472   P  472



>ref|XP_007211401.1| hypothetical protein PRUPE_ppa005228mg [Prunus persica]
 gb|EMJ12600.1| hypothetical protein PRUPE_ppa005228mg [Prunus persica]
Length=471

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/466 (70%), Positives = 383/466 (82%), Gaps = 0/466 (0%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITG  354
             +S L+ + L P+        SV  +  ++++   I    +PAVSAPKR+ DPKKRVVITG
Sbjct  6     SSSLRPAPLDPIRKRTPHFPSVTPRPTSSRRVSFISASSAPAVSAPKREKDPKKRVVITG  65

Query  355   MGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRR  534
             MGLVSVFG+DV  +Y+ LL G SG+  IDRFDAS F  RF GQIHGF+SEGYID KNDRR
Sbjct  66    MGLVSVFGNDVNAYYDKLLAGESGVGPIDRFDASKFPTRFGGQIHGFSSEGYIDGKNDRR  125

Query  535   LDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGY  714
             LD   RY +VAGKKAL DA+LG +  + +DK+R G ++GSG GGL VF +GV  L++ G+
Sbjct  126   LDDCLRYSIVAGKKALEDADLGGDKRSKLDKSRAGVLVGSGMGGLTVFSDGVHALIEKGH  185

Query  715   KKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMi  894
             +KITPFFIPY+ITNMGSALL I+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+MI
Sbjct  186   RKITPFFIPYAITNMGSALLGIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMI  245

Query  895   aggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHA  1074
             AGGTEA +   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+HA
Sbjct  246   AGGTEAALIPVGLGGFVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHA  305

Query  1075  MKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATS  1254
              KRGA +IAEYLGGA  CDA+HMT+PR DGLGVS+CI +SLEDAGVSPEEVNYINAHATS
Sbjct  306   TKRGAPIIAEYLGGAINCDAYHMTDPRADGLGVSTCIERSLEDAGVSPEEVNYINAHATS  365

Query  1255  TVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTIN  1434
             T+AGD+ E+NAIKKVFK+T +IK+N TKS+IGH LGASGGLEAIAT+KAITTGWLHP+IN
Sbjct  366   TLAGDLAEINAIKKVFKNTRDIKINATKSMIGHCLGASGGLEAIATVKAITTGWLHPSIN  425

Query  1435  QYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             Q+N EP V  DTV NVKKQH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  426   QFNPEPSVEFDTVANVKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  471



>gb|AAC04691.1| beta-ketoacyl-ACP synthase I [Perilla frutescens]
Length=474

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/421 (74%), Positives = 361/421 (86%), Gaps = 0/421 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             PKR++DPKKRVVITGMGLVSVFG+DV+ +Y  LL G SGI+LIDRFDAS F  RF GQI 
Sbjct  54    PKRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLSGESGITLIDRFDASKFPTRFGGQIR  113

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfggl  669
             GF +EGYID KNDRRLD   RYC+VAGKKAL  A+LG E LN +DK R G ++G+G GGL
Sbjct  114   GFKAEGYIDGKNDRRLDDCLRYCIVAGKKALEGADLGGEKLNKIDKIRAGVLVGTGMGGL  173

Query  670   gvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFY  849
              VF +GV  L++ G++KITPFFIPY+ITNM SALLAI+ GLMGP YSISTACAT+NYCFY
Sbjct  174   TVFSDGVKALIEKGHRKITPFFIPYAITNMASALLAIDLGLMGPNYSISTACATSNYCFY  233

Query  850   SAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVI  1029
             +AANHIR+GEAD+MIAGGTEA +   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+
Sbjct  234   AAANHIRRGEADLMIAGGTEAAMIPIGLGGFVACRALSQRNDDPQTASRPWDKDRDGFVM  293

Query  1030  GEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAG  1209
             GEG GVLVME L+HAMKRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI  +LED+G
Sbjct  294   GEGSGVLVMESLEHAMKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIQSALEDSG  353

Query  1210  VSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIA  1389
             VSPEEVNYINAHATST+ GD+ +VNAIKKVFK+TS IK+N TKS+IGH LGA+GGLEAIA
Sbjct  354   VSPEEVNYINAHATSTIVGDLADVNAIKKVFKNTSGIKINATKSMIGHCLGAAGGLEAIA  413

Query  1390  TIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             ++KAITTGWLHPTINQ+N EP +  DTV N K+QH+VNVAISNSFGFGGHNSV+ F  FK
Sbjct  414   SVKAITTGWLHPTINQFNPEPSIGFDTVANEKQQHEVNVAISNSFGFGGHNSVVAFSAFK  473

Query  1570  P  1572
             P
Sbjct  474   P  474



>ref|XP_010917436.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Elaeis guineensis]
Length=469

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/425 (74%), Positives = 363/425 (85%), Gaps = 2/425 (0%)
 Frame = +1

Query  304   SAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQ  483
             +AP+R++DP+KRVVITGMGLVSVFG+DV+ +Y  LLEG SGI  IDRFDAS F  RFAGQ
Sbjct  45    AAPRRETDPRKRVVITGMGLVSVFGNDVDVYYEKLLEGESGIGPIDRFDASKFPTRFAGQ  104

Query  484   IHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTRigavigsg  657
             I GF+SEGYID KNDRRLD   RYCLV+GKKAL    L  G + L+ +DK R G ++G+G
Sbjct  105   IRGFSSEGYIDGKNDRRLDDCLRYCLVSGKKALESTGLEVGSKALSKIDKVRAGVLVGTG  164

Query  658   fgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATAN  837
              GGL VF +GV  L++ GY+KITPFFIPY+ITNMGSALLA++ G MG  YSISTACAT+N
Sbjct  165   MGGLTVFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAMDIGFMGANYSISTACATSN  224

Query  838   YCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRD  1017
             YCFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN EP+ ASRPWDK RD
Sbjct  225   YCFYAAANHIRRGEADVMIAGGTEAAIIPIGIGGFVACRALSQRNDEPKTASRPWDKGRD  284

Query  1018  GFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSL  1197
             GFV+GEG GVLV+E L+HAMKRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI KSL
Sbjct  285   GFVMGEGAGVLVLESLEHAMKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIQKSL  344

Query  1198  EDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGL  1377
             EDAGV+PEEVNYINAHATST+AGD+ EVNAIK+VFK+ S IK+N TKS+IGH LGA+GGL
Sbjct  345   EDAGVAPEEVNYINAHATSTLAGDLAEVNAIKQVFKNPSHIKINATKSMIGHCLGAAGGL  404

Query  1378  EAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVF  1557
             EAIAT+KAITTGWLHPTINQ+N EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+VF
Sbjct  405   EAIATVKAITTGWLHPTINQFNPEPAVEFDTVANKKQQHEVNVAISNSFGFGGHNSVVVF  464

Query  1558  GPFKP  1572
              PFKP
Sbjct  465   APFKP  469



>ref|XP_002438009.1| hypothetical protein SORBIDRAFT_10g006430 [Sorghum bicolor]
 gb|EER89376.1| hypothetical protein SORBIDRAFT_10g006430 [Sorghum bicolor]
Length=461

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/423 (75%), Positives = 362/423 (86%), Gaps = 2/423 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             P+R++DPKKRVVITGMGLVSVFG+DV+ +Y+ LL G SGI  IDRFDAS F  RFAGQI 
Sbjct  39    PRRETDPKKRVVITGMGLVSVFGNDVDAYYDRLLAGESGIGPIDRFDASKFPTRFAGQIR  98

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDAN--LGKEVLNNMDKTRigavigsgfg  663
             GF+SEGYID KNDRRLD   RYC+V+GKKAL  A   LG + +  +DKTR G ++G+G G
Sbjct  99    GFSSEGYIDGKNDRRLDDCLRYCIVSGKKALEAAGIGLGSKPMEKIDKTRAGVLVGTGMG  158

Query  664   glgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYC  843
             GL VF +GV  L++ GY+KITPFFIPY+ITNMGSALL ++ G MGP YSISTACAT+NYC
Sbjct  159   GLTVFQDGVQNLIEKGYRKITPFFIPYAITNMGSALLGMDIGFMGPNYSISTACATSNYC  218

Query  844   FYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGF  1023
             FY+AANHIR+GEADIMIAGGTEA I   GVGGF+ACRALSQRN +P+ ASRPWDKDRDGF
Sbjct  219   FYAAANHIRRGEADIMIAGGTEAAIIPIGVGGFVACRALSQRNDDPKTASRPWDKDRDGF  278

Query  1024  VIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLED  1203
             V+GEG GVLVME LDHAMKR A +IAEYLGGA  CDA+HMT+PR DGLGVSSCI +SLED
Sbjct  279   VMGEGAGVLVMESLDHAMKRDAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIKQSLED  338

Query  1204  AGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEA  1383
             AGV+PEEVNYINAHATST+AGD+ EVNAIK+VFKD S IK+N TKS+IGH LGA+GGLEA
Sbjct  339   AGVAPEEVNYINAHATSTLAGDLAEVNAIKQVFKDPSGIKINATKSMIGHCLGAAGGLEA  398

Query  1384  IATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGP  1563
             IATIKAITTGW+HP+INQ+N E  V  DTVPNVKKQH+VNV ISNSFGFGGHNSV+VF P
Sbjct  399   IATIKAITTGWVHPSINQFNPEEAVEFDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAP  458

Query  1564  FKP  1572
             FKP
Sbjct  459   FKP  461



>ref|XP_008225453.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Prunus mume]
Length=471

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/466 (69%), Positives = 383/466 (82%), Gaps = 0/466 (0%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITG  354
             +S L+ + L P+         V+ +  ++++   I    +PAVSAPKR+ DPKKRVVITG
Sbjct  6     SSSLRPAPLDPIRKRTPHFPIVSPRPTSSRRVSFISASSAPAVSAPKREKDPKKRVVITG  65

Query  355   MGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRR  534
             MGLVSVFG+DV  +Y+ LL G SG+  IDRFDAS F  RF GQIHGF+SEGYID KNDRR
Sbjct  66    MGLVSVFGNDVNAYYDKLLAGESGVGPIDRFDASKFPTRFGGQIHGFSSEGYIDGKNDRR  125

Query  535   LDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGY  714
             LD   RY +VAGKKAL DA+LG +  + +DK+R G ++GSG GGL VF +GV  L++ G+
Sbjct  126   LDDCLRYSIVAGKKALEDADLGGDKRSTLDKSRAGVLVGSGMGGLTVFSDGVHALIEKGH  185

Query  715   KKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMi  894
             +KITPFFIPY+ITNMGSALL I+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+MI
Sbjct  186   RKITPFFIPYAITNMGSALLGIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMI  245

Query  895   aggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHA  1074
             AGGTEA +   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+HA
Sbjct  246   AGGTEAALIPVGLGGFVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHA  305

Query  1075  MKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATS  1254
              KRGA +IAEYLGGA  CDA+HMT+PR DGLGVS+CI +SLEDAGVSPEEVNYINAHATS
Sbjct  306   TKRGAQIIAEYLGGAINCDAYHMTDPRADGLGVSTCIERSLEDAGVSPEEVNYINAHATS  365

Query  1255  TVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTIN  1434
             T+AGD+ E+NAIKKVFK+T +IK+N TKS+IGH LGASGGLEAIAT+KAITTGWLHP+IN
Sbjct  366   TLAGDLAEINAIKKVFKNTRDIKINATKSMIGHCLGASGGLEAIATVKAITTGWLHPSIN  425

Query  1435  QYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             Q+N EP V  DTV NVKKQH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  426   QFNPEPSVEFDTVANVKKQHEVNVAISNSFGFGGHNSVVAFSAFKP  471



>ref|XP_009360871.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Pyrus x bretschneideri]
Length=472

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/420 (75%), Positives = 360/420 (86%), Gaps = 0/420 (0%)
 Frame = +1

Query  313   KRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHG  492
             KR++DPKKRVVITGMGLVSVFG+D+ TFY+ LL G SG+  +DRFDAS FS RF GQI G
Sbjct  53    KRETDPKKRVVITGMGLVSVFGNDINTFYDKLLAGESGVGPLDRFDASKFSTRFGGQIRG  112

Query  493   FTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglg  672
             F+SEGYID KNDRRLD   RY LVAGKKAL DA+LG +  + +DK+R G ++GSG GGL 
Sbjct  113   FSSEGYIDGKNDRRLDDCLRYSLVAGKKALEDADLGADNRSKLDKSRAGVLVGSGMGGLT  172

Query  673   vfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYS  852
             VF +GV  L++ G++KITPFFIPY+ITNMGSALLAI+ G MGP YSISTACAT+NYCFYS
Sbjct  173   VFSDGVHALIEKGHRKITPFFIPYAITNMGSALLAIDLGFMGPNYSISTACATSNYCFYS  232

Query  853   AANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIG  1032
             AANHIR+GEAD+MIAGGTEA I   GVGGFIACRALSQRN +P+ ASRPWD+DRDGFVIG
Sbjct  233   AANHIRRGEADLMIAGGTEAAIIPVGVGGFIACRALSQRNDDPKTASRPWDRDRDGFVIG  292

Query  1033  EGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGV  1212
             EG GVLVME L+HA KRGA +IAEYLGG   CDA+HMT+PR DGLGVS+CI   LEDAGV
Sbjct  293   EGAGVLVMESLEHATKRGATIIAEYLGGGINCDAYHMTDPRADGLGVSTCIQTCLEDAGV  352

Query  1213  SPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIAT  1392
             SPEEVNYINAHATST+AGD+ E+NAIKKVF +T +IK+N TKS+IGH LGASGGLEAIA 
Sbjct  353   SPEEVNYINAHATSTLAGDLAEINAIKKVFTNTKDIKINATKSMIGHCLGASGGLEAIAV  412

Query  1393  IKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             IKAITTGWLHP+INQ+N EP V  DTVPNVK+QH+VNVAISNSFGFGGHNSV+ F PFKP
Sbjct  413   IKAITTGWLHPSINQFNPEPSVEFDTVPNVKQQHEVNVAISNSFGFGGHNSVVAFSPFKP  472



>ref|XP_006845316.1| hypothetical protein AMTR_s00141p00029880 [Amborella trichopoda]
 gb|ERN06991.1| hypothetical protein AMTR_s00141p00029880 [Amborella trichopoda]
Length=468

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/449 (71%), Positives = 368/449 (82%), Gaps = 1/449 (0%)
 Frame = +1

Query  226   QPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNN  405
             QP    Y    +   RR+   +     APKR+ DPKKRVVITGMGLVSVFG+DV+ +Y  
Sbjct  21    QPLKKHYSPPLSNPGRRVSRNVV-RCEAPKREKDPKKRVVITGMGLVSVFGNDVDAYYGK  79

Query  406   LLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALN  585
             LLEG+SGI  IDRFDAS F  RF GQI GFT++GYID KNDRRLD   RYC+V+GKKAL 
Sbjct  80    LLEGQSGIGPIDRFDASKFPTRFGGQIRGFTADGYIDGKNDRRLDDCLRYCIVSGKKALE  139

Query  586   DANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGS  765
             +A L    L+ +DK R G ++G+G GGL VF  GV  L++ G ++ITPFFIPY+ITNMGS
Sbjct  140   NAGLPIVNLSKIDKERAGVLVGTGMGGLTVFSEGVQALIEKGPRRITPFFIPYAITNMGS  199

Query  766   ALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFI  945
             ALLAIE G MGP YSISTACAT+NYCFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+
Sbjct  200   ALLAIELGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMIAGGTEAAIIPIGLGGFV  259

Query  946   ACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATT  1125
             ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+HAMKR A +IAEYLGGA  
Sbjct  260   ACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGAVN  319

Query  1126  CDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFK  1305
             CDA+HMT+PR DGLGVS+CI +SLEDAGV+PEEVNYINAHATST+AGD+ EVNAIKKVFK
Sbjct  320   CDAYHMTDPRGDGLGVSTCIERSLEDAGVAPEEVNYINAHATSTLAGDLAEVNAIKKVFK  379

Query  1306  DTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVK  1485
             +TS IK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLHPTINQ+N EP V  DTV NVK
Sbjct  380   NTSRIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTINQFNPEPSVEFDTVANVK  439

Query  1486  KQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             KQH+VNV ISNSFGFGGHNSV+ F PFKP
Sbjct  440   KQHEVNVGISNSFGFGGHNSVVAFAPFKP  468



>ref|XP_010052073.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Eucalyptus grandis]
 gb|KCW75930.1| hypothetical protein EUGRSUZ_D00305 [Eucalyptus grandis]
Length=465

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/433 (72%), Positives = 367/433 (85%), Gaps = 4/433 (1%)
 Frame = +1

Query  274   RIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDA  453
             R   M +P    PKR++DP+KRVV+TG GLVSVFG+DV+ +Y  LL G SGI  IDRFDA
Sbjct  37    RAASMSAP----PKRETDPRKRVVVTGTGLVSVFGNDVDAYYEKLLAGESGIGPIDRFDA  92

Query  454   SDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTR  633
             S F  RFAGQI GF+S+GYID KNDRRLD   RYC+VAGKKAL  A+LG + L+ ++K R
Sbjct  93    SKFPTRFAGQIRGFSSQGYIDGKNDRRLDDCLRYCIVAGKKALEHADLGGDRLSKIEKER  152

Query  634   igavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSI  813
              G ++G+G GGL VF +GV  L++ G++KITPFFIPY+ITNMGSAL+AIE G MGP YSI
Sbjct  153   AGVLVGTGMGGLTVFSDGVKNLIEKGHRKITPFFIPYAITNMGSALIAIELGFMGPNYSI  212

Query  814   STACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERAS  993
             STACAT+NYCFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ AS
Sbjct  213   STACATSNYCFYAAANHIRRGEADLMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTAS  272

Query  994   RPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGV  1173
             RPWDKDRDGFV+GEG GVLV+E L+HAMKRGA +IAEYLGGA  CDA+HMT+PR DGLGV
Sbjct  273   RPWDKDRDGFVMGEGAGVLVLESLEHAMKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGV  332

Query  1174  SSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGH  1353
             SSCI +SLEDAGVSPEEVNYINAHATST+AGD+ E+NAIKKVFK+TSEIK+N TKS+IGH
Sbjct  333   SSCIERSLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKNTSEIKINATKSMIGH  392

Query  1354  GLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFG  1533
              LGA+GGLEAIAT+KAITTGWLHP+INQ+N EP V  DTV N K+QH+VNVAISNSFGFG
Sbjct  393   CLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVDFDTVANKKQQHEVNVAISNSFGFG  452

Query  1534  GHNSVIVFGPFKP  1572
             GHNSV+ F  FKP
Sbjct  453   GHNSVVAFSAFKP  465



>ref|XP_010932377.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Elaeis guineensis]
Length=470

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/424 (74%), Positives = 364/424 (86%), Gaps = 2/424 (0%)
 Frame = +1

Query  307   APKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQI  486
             AP+R++DPKKRVVITGMGLVSVFG+DV+ +Y  LLEG SGI LIDRFDAS F  +FAGQI
Sbjct  47    APRRETDPKKRVVITGMGLVSVFGNDVDVYYEKLLEGESGIGLIDRFDASKFPTKFAGQI  106

Query  487   HGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLG--KEVLNNMDKTRigavigsgf  660
              GF+SEGYID KNDRRLD   RYCLV+GKKAL  A LG   + L+ +DK R G ++G+G 
Sbjct  107   RGFSSEGYIDGKNDRRLDDCLRYCLVSGKKALESAGLGVGSKDLSKIDKVRAGVLVGTGM  166

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GGL VF +GV  L++ GY+KITPFFIPY+ITN GSALLA++ G MG  YSISTACAT+NY
Sbjct  167   GGLTVFSDGVQALIEKGYRKITPFFIPYAITNTGSALLAMDIGFMGANYSISTACATSNY  226

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
             CFY+AANHIR+GEAD+MIAGGTEA I   GVGGF+ACRALSQRN +P+ ASRPWD++RDG
Sbjct  227   CFYAAANHIRRGEADVMIAGGTEAAIIPIGVGGFVACRALSQRNDDPKTASRPWDRERDG  286

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT+PR DGLGVSSCI KSLE
Sbjct  287   FVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIEKSLE  346

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
             DAGV+PEEVNYINAHATST+AGD+ EVNA+K+VFK+ SEIKMN TKS+IGH LGA+GGLE
Sbjct  347   DAGVAPEEVNYINAHATSTLAGDLAEVNAVKQVFKNPSEIKMNATKSMIGHCLGAAGGLE  406

Query  1381  AIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFG  1560
             AIAT+KA+TTGWLHPTINQ+N EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+VF 
Sbjct  407   AIATVKAMTTGWLHPTINQFNPEPAVEFDTVANKKQQHEVNVAISNSFGFGGHNSVVVFA  466

Query  1561  PFKP  1572
             PFKP
Sbjct  467   PFKP  470



>gb|EPS68881.1| hypothetical protein M569_05881, partial [Genlisea aurea]
Length=494

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/452 (70%), Positives = 366/452 (81%), Gaps = 25/452 (6%)
 Frame = +1

Query  292   SPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVR  471
             +P VSAPKR++DPKKRVVITGMGLVSVFG+DV+ +YN LLEG SGI+L+DRFDAS F  R
Sbjct  43    APTVSAPKRETDPKKRVVITGMGLVSVFGNDVDAYYNKLLEGESGIALLDRFDASKFPTR  102

Query  472   FAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavig  651
             F GQI GF SEGYID KNDRRLD   RYC+VAGKKAL +A+LG+E L  +DK R G ++G
Sbjct  103   FGGQIRGFNSEGYIDGKNDRRLDDCLRYCIVAGKKALENADLGQEKLGAIDKVRAGVLVG  162

Query  652   sgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACAT  831
             +G GG+ VF +GV  L++ G++KITPFFIPY+ITNMGSALLAI+ G MGP YSISTACAT
Sbjct  163   TGMGGISVFSDGVQALIEKGHRKITPFFIPYAITNMGSALLAIDIGFMGPNYSISTACAT  222

Query  832   ANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKD  1011
             +NYCFY+AANHIR+GEAD+M+AGG EA I   G+GGF+ACRALSQRN +P  ASRPWDK+
Sbjct  223   SNYCFYAAANHIRRGEADLMLAGGCEAAIIPIGLGGFVACRALSQRNDDPRTASRPWDKE  282

Query  1012  RDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITK  1191
             RDGFV+GEG GVLVME L+HAMKRGA +IAEYLGGA +CDA+HMT+PR DGLGVSSCI  
Sbjct  283   RDGFVMGEGSGVLVMESLEHAMKRGAPIIAEYLGGAVSCDAYHMTDPRADGLGVSSCIQN  342

Query  1192  SLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASG  1371
             +LEDAGVS EEVNYINAHATSTV GD+ E+NAIKKVFKDTS IK+N TKS+IGH LGA+G
Sbjct  343   ALEDAGVSAEEVNYINAHATSTVVGDLAEINAIKKVFKDTSGIKINATKSMIGHCLGAAG  402

Query  1372  GLEAIATIKAITTGWLHPTINQY-------------------------NLEPEVTIDTVP  1476
             GLEAIATIKAITTGWLHPTINQ+                         N EP V  DTVP
Sbjct  403   GLEAIATIKAITTGWLHPTINQFVTFYLVDRSHFVHSPITLINGLLLQNPEPSVEFDTVP  462

Query  1477  NVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             N K+ HQVNVAISNSFGFGGHNSV+ F  F P
Sbjct  463   NQKQPHQVNVAISNSFGFGGHNSVVAFSGFNP  494



>ref|NP_001149639.1| 3-oxoacyl-synthase I [Zea mays]
 gb|ACG36200.1| 3-oxoacyl-synthase I [Zea mays]
 gb|AFW76633.1| 3-oxoacyl-synthase I [Zea mays]
Length=461

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/469 (69%), Positives = 380/469 (81%), Gaps = 17/469 (4%)
 Frame = +1

Query  181   LLQYSGLKPVET---MQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVIT  351
             LL  + + PV      +N P  ++ +A A              V+AP+R++DPKKRVVIT
Sbjct  5     LLPTAAVAPVAPPCGRRNLPGRLSVRASAT------------VVAAPRRETDPKKRVVIT  52

Query  352   GMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDR  531
             GMGLVSVFG+DV+ +Y+ LL G SGI  IDRFDAS F  RFAGQI GF+SEGYID KNDR
Sbjct  53    GMGLVSVFGNDVDAYYDRLLVGESGIGPIDRFDASKFPTRFAGQIRGFSSEGYIDGKNDR  112

Query  532   RLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTRigavigsgfgglgvfgngvttlvQ  705
             RLD   RYC+V+GKKAL  + +  G + +  +DKTR G ++G+G GGL VF +GV  L++
Sbjct  113   RLDDCLRYCIVSGKKALEASGIAHGSKPMEKIDKTRAGVLVGTGMGGLTVFSDGVQNLIE  172

Query  706   SGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEAD  885
              GY+KITPFFIPY+ITNMGSALL ++ G MGP YSISTACAT+NYCFY+AANHIR+GEAD
Sbjct  173   KGYRKITPFFIPYAITNMGSALLGMDIGFMGPNYSISTACATSNYCFYAAANHIRRGEAD  232

Query  886   IMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERL  1065
             IMIAGGTEA I   GVGGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L
Sbjct  233   IMIAGGTEAAIIPIGVGGFVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESL  292

Query  1066  DHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAH  1245
             +HAMKR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI +SL+DAGV+PEEVNYINAH
Sbjct  293   EHAMKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIKQSLKDAGVAPEEVNYINAH  352

Query  1246  ATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHP  1425
             ATST+AGD+ EVNAIK+VFKD S IK+N TKS+IGH LGA+GGLEAIATIKAITTGW+HP
Sbjct  353   ATSTLAGDLAEVNAIKQVFKDPSGIKINATKSMIGHCLGAAGGLEAIATIKAITTGWVHP  412

Query  1426  TINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             +INQ+N E  V  DTVPNVKKQH+VNV ISNSFGFGGHNSV+VF PFKP
Sbjct  413   SINQFNPEEAVEFDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAPFKP  461



>ref|XP_011012842.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Populus euphratica]
Length=471

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/422 (73%), Positives = 364/422 (86%), Gaps = 0/422 (0%)
 Frame = +1

Query  307   APKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQI  486
             APKR+ DPKKR+VITGMGLVSVFG++V+ +Y+ LL G SGI  IDRFDAS F  RF GQI
Sbjct  50    APKREKDPKKRIVITGMGLVSVFGNEVDAYYDKLLAGESGIGTIDRFDASKFPTRFGGQI  109

Query  487   HGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgg  666
              GF+++GYID KNDRRLD   RYC+VAGKKAL DANLG + L  +DK + G ++G+G GG
Sbjct  110   RGFSAQGYIDGKNDRRLDDCLRYCIVAGKKALEDANLGGDNLFKIDKEKAGVLVGTGMGG  169

Query  667   lgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCF  846
             L VF +GV +L++ G++KITPFFIPY+ITNMGSALLAIE G MGP YSISTACAT+NYCF
Sbjct  170   LTVFSDGVQSLIEKGHRKITPFFIPYAITNMGSALLAIEIGFMGPNYSISTACATSNYCF  229

Query  847   YSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFV  1026
             Y+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWD+DRDGFV
Sbjct  230   YAAANHIRRGEADMMIAGGTEAAIIPIGLGGFVACRALSQRNDDPKTASRPWDRDRDGFV  289

Query  1027  IGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDA  1206
             +GEG GVLVME L+HAM+RGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI +SLEDA
Sbjct  290   MGEGAGVLVMESLEHAMRRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIERSLEDA  349

Query  1207  GVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAI  1386
             GVSPEEVNYINAHA ST+AGD+ E+NAI+KVFK+TS IK+N TKS+IGH LGA+GGLEAI
Sbjct  350   GVSPEEVNYINAHAPSTIAGDLAEINAIRKVFKNTSGIKINATKSMIGHCLGAAGGLEAI  409

Query  1387  ATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPF  1566
             A++KAITTGWLHP+INQ+N EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+VF  F
Sbjct  410   ASVKAITTGWLHPSINQFNPEPSVEFDTVANKKQQHEVNVAISNSFGFGGHNSVVVFSAF  469

Query  1567  KP  1572
             KP
Sbjct  470   KP  471



>ref|XP_004293525.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=469

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/466 (68%), Positives = 375/466 (80%), Gaps = 2/466 (0%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITG  354
             +S L+ + L P+    + P+     A   ++   I    +  VSAP R+ DPKKRVVITG
Sbjct  6     SSTLRPAPLDPLRKRTHFPNLTPRPAP--RRVSFISASSATTVSAPTREKDPKKRVVITG  63

Query  355   MGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRR  534
             +G VSVFG+DV  +Y+ LL G SG+  IDRFDAS F  RF GQI GFTSEGYID KNDRR
Sbjct  64    LGCVSVFGNDVNAYYDKLLAGESGVGPIDRFDASKFPTRFGGQIRGFTSEGYIDGKNDRR  123

Query  535   LDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGY  714
             LD   RY +VAGKKAL DA+LG +    +DK+R G ++GSG GGL VF +GV  L+  G+
Sbjct  124   LDDCLRYAIVAGKKALEDADLGADNRPKLDKSRAGVLVGSGMGGLTVFSDGVHALIDKGH  183

Query  715   KKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMi  894
             +KITPFFIPY+ITNMGSALL I+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+MI
Sbjct  184   RKITPFFIPYAITNMGSALLGIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMI  243

Query  895   aggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHA  1074
             AGGTEA +   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG G+LVME L+HA
Sbjct  244   AGGTEAALIPIGLGGFVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGILVMESLEHA  303

Query  1075  MKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATS  1254
             MKRGA +IAEYLGGA  CDA+HMT+PR DGLGVS+CI +SLED+GVSPEEVNYINAHATS
Sbjct  304   MKRGAPIIAEYLGGAINCDAYHMTDPRADGLGVSTCIERSLEDSGVSPEEVNYINAHATS  363

Query  1255  TVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTIN  1434
             T+AGD+ EVNAIKKVFK+T EIK+N TKS+IGH LGASGGLEAIAT+KAI TGWLHP+IN
Sbjct  364   TLAGDLAEVNAIKKVFKNTKEIKINATKSMIGHCLGASGGLEAIATVKAIQTGWLHPSIN  423

Query  1435  QYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             Q+N EP V  DTV NVK+QH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  424   QFNPEPSVEFDTVANVKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  469



>ref|XP_010481467.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Camelina sativa]
Length=472

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/470 (68%), Positives = 381/470 (81%), Gaps = 6/470 (1%)
 Frame = +1

Query  181   LLQYSGLK--PVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSA----PKRQSDPKKRV  342
              LQ S L+  P   ++   +  +++   A+  RR +  IS + SA    PKR++DPKKRV
Sbjct  3     FLQSSSLRASPPNPLRLPSNRQSHQITNARPLRRQRSFISASASATVSAPKRETDPKKRV  62

Query  343   VITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAK  522
             VITGMGLVSVFG+DV+ +Y  LL G SGISLIDRFDAS F  RF GQI GF+SEGYID K
Sbjct  63    VITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGK  122

Query  523   NDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlv  702
             N+RRLD   +YC+VAGKKAL  ANLG + LN++DK + G ++G+G GGL VF  GV  L+
Sbjct  123   NERRLDDCLKYCIVAGKKALESANLGGDKLNSIDKRKAGVLVGTGMGGLTVFSEGVQNLI  182

Query  703   QSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEA  882
             + G+++I+PFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEA
Sbjct  183   EKGHRRISPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEA  242

Query  883   DIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMER  1062
             D+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK RDGFV+GEG GVLVME 
Sbjct  243   DMMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKARDGFVMGEGAGVLVMES  302

Query  1063  LDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINA  1242
             L+HAMKRGA ++AEYLGGA  CDAHHMT+PR DGLGVSSCI + LEDAGVSPEEVNYINA
Sbjct  303   LEHAMKRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSSCIERCLEDAGVSPEEVNYINA  362

Query  1243  HATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLH  1422
             HATST+AGD+ E+NAIKKVFK TS IK+N TKS+IGH LGA+GGLEAIA +KAI TGWLH
Sbjct  363   HATSTLAGDLAEINAIKKVFKSTSGIKINATKSMIGHCLGAAGGLEAIAVVKAINTGWLH  422

Query  1423  PTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             P+INQ+N E  V  DTV N KKQH+V+VAISNSFGFGGHNSV+ F  FKP
Sbjct  423   PSINQFNPEQAVDFDTVANQKKQHEVDVAISNSFGFGGHNSVVAFSAFKP  472



>emb|CDP06309.1| unnamed protein product [Coffea canephora]
Length=474

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/420 (75%), Positives = 357/420 (85%), Gaps = 0/420 (0%)
 Frame = +1

Query  313   KRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHG  492
             KR+ DPKKRVVITGMGLVSVFG+DV+ +Y  LL G SGI+ IDRFDAS F  RF GQI G
Sbjct  55    KREKDPKKRVVITGMGLVSVFGNDVDAYYEKLLAGESGITAIDRFDASKFPTRFGGQIRG  114

Query  493   FTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglg  672
             F SEGYID KNDRRLD   RYC+VAGKKAL +A+L  + +  +DK R G ++G+G GGL 
Sbjct  115   FKSEGYIDGKNDRRLDDCLRYCIVAGKKALENADLAPDRIGKIDKERAGVLVGTGMGGLT  174

Query  673   vfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYS  852
             VF +GV  L++ GY+KITPFFIPY+ITNMGSALLAI+ G MGP YSISTACAT+NYCFY+
Sbjct  175   VFSDGVQALIEKGYRKITPFFIPYAITNMGSALLAIDLGFMGPNYSISTACATSNYCFYA  234

Query  853   AANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIG  1032
             AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK RDGFV+G
Sbjct  235   AANHIRRGEADMMIAGGTEAAIIPIGLGGFVACRALSQRNDDPKTASRPWDKARDGFVMG  294

Query  1033  EGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGV  1212
             EG GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI  SLEDAGV
Sbjct  295   EGAGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIQSSLEDAGV  354

Query  1213  SPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIAT  1392
             SPEEVNYINAHATSTV GD+ EVNAIKKVFK+TS IKMN TKS+IGH LGA+GGLEAIAT
Sbjct  355   SPEEVNYINAHATSTVVGDLAEVNAIKKVFKNTSGIKMNATKSMIGHCLGAAGGLEAIAT  414

Query  1393  IKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             +KAITTGW+HPTINQ+N EP V  DTVPN K+QH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  415   VKAITTGWVHPTINQFNPEPAVEFDTVPNTKQQHEVNVAISNSFGFGGHNSVVAFSAFKP  474



>emb|CDY43962.1| BnaA02g24400D [Brassica napus]
Length=472

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/421 (74%), Positives = 359/421 (85%), Gaps = 0/421 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             PKR++DPKKRVVITGMGLVSVFG+DV+ +Y  LL G SGISLIDRFDAS F  RF GQI 
Sbjct  52    PKRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIR  111

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfggl  669
             GF+SEGYID KN+RRLD   +YC+VAGKKAL  A LG + LN +DK + G ++G+G GGL
Sbjct  112   GFSSEGYIDGKNERRLDDCLKYCIVAGKKALESAGLGGDKLNTIDKQKAGVLVGTGMGGL  171

Query  670   gvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFY  849
              VF +GV  L++ G+++I+PFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY
Sbjct  172   TVFSDGVQALIEKGHRRISPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFY  231

Query  850   SAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVI  1029
             +AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK RDGFV+
Sbjct  232   AAANHIRRGEADMMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKQRDGFVM  291

Query  1030  GEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAG  1209
             GEG GVLVME L+HAMKRGA ++AEYLGGA  CDAHHMT+PR DGLGVSSCI   LEDAG
Sbjct  292   GEGAGVLVMESLEHAMKRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSSCIESCLEDAG  351

Query  1210  VSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIA  1389
             VSPEEVNYINAHATST+AGD+ E+NAIKKVFK TS IK+N TKS+IGH LGA+GGLEAIA
Sbjct  352   VSPEEVNYINAHATSTLAGDLAEINAIKKVFKSTSGIKINATKSMIGHCLGAAGGLEAIA  411

Query  1390  TIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             T+KAI TGWLHP+INQ+N EP V  DTV N KKQH++NVAISNSFGFGGHNSV+ F  FK
Sbjct  412   TVKAINTGWLHPSINQFNPEPAVDFDTVANEKKQHEMNVAISNSFGFGGHNSVVAFSAFK  471

Query  1570  P  1572
             P
Sbjct  472   P  472



>ref|NP_001146139.1| uncharacterized protein LOC100279707 [Zea mays]
 gb|ACL53339.1| unknown [Zea mays]
Length=437

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/423 (74%), Positives = 363/423 (86%), Gaps = 2/423 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             P+R++DPKKRVVITGMGLVSVFG+DV+ +Y+ LL G SGI  IDRFDAS F  RFAGQI 
Sbjct  15    PRRETDPKKRVVITGMGLVSVFGNDVDAYYDRLLAGESGIGPIDRFDASKFPTRFAGQIR  74

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTRigavigsgfg  663
             GF+SEGYID KNDRRLD   RYC+V+GKKAL  A +  G + +  +DKTR G ++G+G G
Sbjct  75    GFSSEGYIDGKNDRRLDDCLRYCIVSGKKALEAAGIAHGSKPMEKIDKTRAGVLVGTGMG  134

Query  664   glgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYC  843
             GL VF +GV  L++ GY+KITPFFIPY+ITNMGSALL ++ G MGP YSISTACAT+NYC
Sbjct  135   GLTVFSDGVQNLIEKGYRKITPFFIPYAITNMGSALLGMDIGFMGPNYSISTACATSNYC  194

Query  844   FYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGF  1023
             FY+AANHIR+GEADIMIAGGTEA I   GVGGF+ACRALSQRN +P+ ASRPWDKDRDGF
Sbjct  195   FYAAANHIRRGEADIMIAGGTEAAIIPIGVGGFVACRALSQRNDDPKTASRPWDKDRDGF  254

Query  1024  VIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLED  1203
             V+GEG GVLVME L+HA+KR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI +SLED
Sbjct  255   VMGEGAGVLVMESLEHAIKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIKQSLED  314

Query  1204  AGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEA  1383
             AGV+PEEVNYINAHATST+AGD+ EVNAIK+VFKD S IK+N TKS+IGH LGA+GGLEA
Sbjct  315   AGVAPEEVNYINAHATSTLAGDLAEVNAIKQVFKDPSGIKINATKSMIGHCLGAAGGLEA  374

Query  1384  IATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGP  1563
             IAT+KAITTGW+HP+INQ+N E  V  DTVPNVKKQH+VNV ISNSFGFGGHNSV+VF P
Sbjct  375   IATVKAITTGWVHPSINQFNPEEAVEFDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAP  434

Query  1564  FKP  1572
             FKP
Sbjct  435   FKP  437



>gb|AFW85455.1| hypothetical protein ZEAMMB73_016804 [Zea mays]
Length=461

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/423 (74%), Positives = 363/423 (86%), Gaps = 2/423 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             P+R++DPKKRVVITGMGLVSVFG+DV+ +Y+ LL G SGI  IDRFDAS F  RFAGQI 
Sbjct  39    PRRETDPKKRVVITGMGLVSVFGNDVDAYYDRLLAGESGIGPIDRFDASKFPTRFAGQIR  98

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTRigavigsgfg  663
             GF+SEGYID KNDRRLD   RYC+V+GKKAL  A +  G + +  +DKTR G ++G+G G
Sbjct  99    GFSSEGYIDGKNDRRLDDCLRYCIVSGKKALEAAGIAHGSKPMEKIDKTRAGVLVGTGMG  158

Query  664   glgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYC  843
             GL VF +GV  L++ GY+KITPFFIPY+ITNMGSALL ++ G MGP YSISTACAT+NYC
Sbjct  159   GLTVFSDGVQNLIEKGYRKITPFFIPYAITNMGSALLGMDIGFMGPNYSISTACATSNYC  218

Query  844   FYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGF  1023
             FY+AANHIR+GEADIMIAGGTEA I   GVGGF+ACRALSQRN +P+ ASRPWDKDRDGF
Sbjct  219   FYAAANHIRRGEADIMIAGGTEAAIIPIGVGGFVACRALSQRNDDPKTASRPWDKDRDGF  278

Query  1024  VIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLED  1203
             V+GEG GVLVME L+HA+KR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI +SLED
Sbjct  279   VMGEGAGVLVMESLEHAIKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIKQSLED  338

Query  1204  AGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEA  1383
             AGV+PEEVNYINAHATST+AGD+ EVNAIK+VFKD S IK+N TKS+IGH LGA+GGLEA
Sbjct  339   AGVAPEEVNYINAHATSTLAGDLAEVNAIKQVFKDPSGIKINATKSMIGHCLGAAGGLEA  398

Query  1384  IATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGP  1563
             IAT+KAITTGW+HP+INQ+N E  V  DTVPNVKKQH+VNV ISNSFGFGGHNSV+VF P
Sbjct  399   IATVKAITTGWVHPSINQFNPEEAVEFDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAP  458

Query  1564  FKP  1572
             FKP
Sbjct  459   FKP  461



>ref|XP_004503596.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Cicer arietinum]
Length=468

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/435 (71%), Positives = 357/435 (82%), Gaps = 2/435 (0%)
 Frame = +1

Query  271   RRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFD  450
             R IK M +P   APKR+ DPKKR+VITGMG+VSVFG++++TFYN LLEG SGI+ IDRFD
Sbjct  35    RVIKSMSNPIKVAPKREKDPKKRIVITGMGVVSVFGNEIDTFYNKLLEGESGINFIDRFD  94

Query  451   ASDFSVRFAGQIHGFTSEGYIDAKNDR-RLDHSWRYCLVAGKKALNDANLGKEVLNNMDK  627
              S F VRFAGQI  F+SEGYID KN +  LD  WRY LVAGKKAL DA LG EVL  MDK
Sbjct  95    VSTFPVRFAGQIRNFSSEGYIDEKNGKMNLDDCWRYYLVAGKKALEDAKLGSEVLEKMDK  154

Query  628   TRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTY  807
             TRIG ++GSG GG       V  L++ G+KKIT +FIP+ + NMGSALLA+E GLMGP Y
Sbjct  155   TRIGVLVGSGMGGTSSMSKAVEALIEKGHKKITEYFIPFFLPNMGSALLAMERGLMGPNY  214

Query  808   SISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPER  987
             SIS+ACA+ANYCF++A+NHIR+GE DIM+ GGTE+ I  T  G FIACRALSQRN  P+ 
Sbjct  215   SISSACASANYCFHAASNHIRRGETDIMVVGGTESIIPATVGG-FIACRALSQRNQNPKM  273

Query  988   ASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGL  1167
             ASRPWD  RDGFV+GEG GVL+ME L+ A KRGA +IAEYLGGA TCDAHHMT+PR+DG 
Sbjct  274   ASRPWDIHRDGFVMGEGSGVLIMESLESATKRGAKIIAEYLGGAITCDAHHMTDPRSDGF  333

Query  1168  GVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLI  1347
             GV+SCI  SL DAGVSPEEVNY+NAHATST+AGD+ E+ AIKKVFKDTSE+KMN TKS+ 
Sbjct  334   GVASCIRNSLADAGVSPEEVNYLNAHATSTLAGDLAEICAIKKVFKDTSELKMNATKSMT  393

Query  1348  GHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFG  1527
             GHGLGA+G LEAI TIKAITTGWLHPTINQ NLE EVTIDTVP VKK+H+VNVAISNSFG
Sbjct  394   GHGLGAAGALEAIVTIKAITTGWLHPTINQDNLEEEVTIDTVPGVKKKHEVNVAISNSFG  453

Query  1528  FGGHNSVIVFGPFKP  1572
             FGGHNSV+VF PF P
Sbjct  454   FGGHNSVVVFAPFMP  468



>gb|AAC49118.1| 3-ketoacyl-acyl carrier protein synthase I [Arabidopsis thaliana]
Length=473

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/424 (73%), Positives = 360/424 (85%), Gaps = 0/424 (0%)
 Frame = +1

Query  301   VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAG  480
             VSAPKR++DPKKRVVITGMGLVSV G+DV+ +Y  LL G SGISLIDRFDAS F  RF G
Sbjct  50    VSAPKRETDPKKRVVITGMGLVSVCGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGG  109

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgf  660
             QI GF+SEGYID KN+RRLD   +YC+VAGKKAL  ANLG + LN +DK + G ++G+G 
Sbjct  110   QIRGFSSEGYIDGKNERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKRKAGVLVGTGM  169

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GGL VF  GV  L++ G+++I+PFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NY
Sbjct  170   GGLTVFSEGVQNLIEKGHRRISPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNY  229

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
             CFY+AANH  +GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK RDG
Sbjct  230   CFYAAANHNHRGEADMMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKARDG  289

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVLVME L+HAMKRGA ++AEYLGGA  CDAHHMT+PR DGLGVSSCI + LE
Sbjct  290   FVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSSCIERCLE  349

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
             DAGVSPEEVNYINAHATST+AGD+ E+NAIKKVFK TS IK+N TKS+IGH LGA+GGLE
Sbjct  350   DAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKSTSGIKINATKSMIGHCLGAAGGLE  409

Query  1381  AIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFG  1560
             AIAT+KAI TGWLHP+INQ+N E  V  DTVPN KKQH+V+VAISNSFGFGGHNSV+ F 
Sbjct  410   AIATVKAINTGWLHPSINQFNPEQAVDFDTVPNEKKQHEVDVAISNSFGFGGHNSVVAFS  469

Query  1561  PFKP  1572
              FKP
Sbjct  470   AFKP  473



>ref|NP_001190479.1| beta-ketoacyl-[acyl carrier protein] synthase I  [Arabidopsis 
thaliana]
 gb|AED95365.1| beta-ketoacyl-[acyl carrier protein] synthase I [Arabidopsis 
thaliana]
Length=489

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/440 (71%), Positives = 363/440 (83%), Gaps = 16/440 (4%)
 Frame = +1

Query  301   VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAG  480
             VSAPKR++DPKKRVVITGMGLVSVFG+DV+ +Y  LL G SGISLIDRFDAS F  RF G
Sbjct  50    VSAPKRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGG  109

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgf  660
             QI GF+SEGYID KN+RRLD   +YC+VAGKKAL  ANLG + LN +DK + G ++G+G 
Sbjct  110   QIRGFSSEGYIDGKNERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKRKAGVLVGTGM  169

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GGL VF  GV  L++ G+++I+PFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NY
Sbjct  170   GGLTVFSEGVQNLIEKGHRRISPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNY  229

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
             CFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK RDG
Sbjct  230   CFYAAANHIRRGEADMMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKARDG  289

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVLVME L+HAMKRGA ++AEYLGGA  CDAHHMT+PR DGLGVSSCI + LE
Sbjct  290   FVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSSCIERCLE  349

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
             DAGVSPEEVNYINAHATST+AGD+ E+NAIKKVFK TS IK+N TKS+IGH LGA+GGLE
Sbjct  350   DAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKSTSGIKINATKSMIGHCLGAAGGLE  409

Query  1381  AIATIKAITTGWLHPTINQY----------------NLEPEVTIDTVPNVKKQHQVNVAI  1512
             AIAT+KAI TGWLHP+INQ+                N E  V  DTVPN KKQH+V+VAI
Sbjct  410   AIATVKAINTGWLHPSINQFVRITGSQEKASLIPLSNPEQAVDFDTVPNEKKQHEVDVAI  469

Query  1513  SNSFGFGGHNSVIVFGPFKP  1572
             SNSFGFGGHNSV+ F  FKP
Sbjct  470   SNSFGFGGHNSVVAFSAFKP  489



>gb|EAY94286.1| hypothetical protein OsI_16057 [Oryza sativa Indica Group]
Length=462

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/425 (73%), Positives = 365/425 (86%), Gaps = 2/425 (0%)
 Frame = +1

Query  304   SAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQ  483
             SAP+R++DP+KRVVITGMGLVSVFG++V+ FY  LL G SG+  IDRFDA  F  RFAGQ
Sbjct  38    SAPRRETDPRKRVVITGMGLVSVFGNEVDAFYERLLAGESGVGAIDRFDAGGFPTRFAGQ  97

Query  484   IHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGK--EVLNNMDKTRigavigsg  657
             I GF+SEGYID KNDRRLD   RYC+V+GKKAL +A LGK  +    +DK R G ++G+G
Sbjct  98    IRGFSSEGYIDGKNDRRLDDCLRYCIVSGKKALENAGLGKGSDGHTKLDKVRAGVLVGTG  157

Query  658   fgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATAN  837
              GGL VF +GV  L++ GYKKI+PFFIPY+ITNMGSALLA++A  MGP YSISTACAT+N
Sbjct  158   MGGLTVFSDGVQNLIEKGYKKISPFFIPYAITNMGSALLAMDASFMGPNYSISTACATSN  217

Query  838   YCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRD  1017
             YCFY+AANHIR+GEAD+++AGGTEA I   G+GGF+ACRALSQRN +PE ASRPWDK+RD
Sbjct  218   YCFYAAANHIRRGEADVIVAGGTEAAIIPIGLGGFVACRALSQRNDDPETASRPWDKERD  277

Query  1018  GFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSL  1197
             GFV+GEG GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCIT+SL
Sbjct  278   GFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCITQSL  337

Query  1198  EDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGL  1377
             EDAGV+PEEVNYINAHATST+AGD+ EV AIK+VFK+ S+IK+N TKS+IGH LGA+GGL
Sbjct  338   EDAGVAPEEVNYINAHATSTLAGDLAEVRAIKQVFKNPSDIKINSTKSMIGHCLGAAGGL  397

Query  1378  EAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVF  1557
             EAIA IKAITTGW+HPTINQ+N EPEV  DTV N K+QH+VNVAISNSFGFGGHNSV+VF
Sbjct  398   EAIAAIKAITTGWVHPTINQFNPEPEVDFDTVANEKQQHEVNVAISNSFGFGGHNSVVVF  457

Query  1558  GPFKP  1572
              PFKP
Sbjct  458   APFKP  462



>gb|KCW75931.1| hypothetical protein EUGRSUZ_D00305 [Eucalyptus grandis]
Length=466

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/434 (72%), Positives = 367/434 (85%), Gaps = 5/434 (1%)
 Frame = +1

Query  274   RIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDA  453
             R   M +P    PKR++DP+KRVV+TG GLVSVFG+DV+ +Y  LL G SGI  IDRFDA
Sbjct  37    RAASMSAP----PKRETDPRKRVVVTGTGLVSVFGNDVDAYYEKLLAGESGIGPIDRFDA  92

Query  454   SDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTR  633
             S F  RFAGQI GF+S+GYID KNDRRLD   RYC+VAGKKAL  A+LG + L+ ++K R
Sbjct  93    SKFPTRFAGQIRGFSSQGYIDGKNDRRLDDCLRYCIVAGKKALEHADLGGDRLSKIEKER  152

Query  634   igavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSI  813
              G ++G+G GGL VF +GV  L++ G++KITPFFIPY+ITNMGSAL+AIE G MGP YSI
Sbjct  153   AGVLVGTGMGGLTVFSDGVKNLIEKGHRKITPFFIPYAITNMGSALIAIELGFMGPNYSI  212

Query  814   STACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERAS  993
             STACAT+NYCFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ AS
Sbjct  213   STACATSNYCFYAAANHIRRGEADLMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTAS  272

Query  994   RPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGV  1173
             RPWDKDRDGFV+GEG GVLV+E L+HAMKRGA +IAEYLGGA  CDA+HMT+PR DGLGV
Sbjct  273   RPWDKDRDGFVMGEGAGVLVLESLEHAMKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGV  332

Query  1174  SSCITKSLEDAGVSPEEV-NYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIG  1350
             SSCI +SLEDAGVSPEEV NYINAHATST+AGD+ E+NAIKKVFK+TSEIK+N TKS+IG
Sbjct  333   SSCIERSLEDAGVSPEEVVNYINAHATSTLAGDLAEINAIKKVFKNTSEIKINATKSMIG  392

Query  1351  HGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGF  1530
             H LGA+GGLEAIAT+KAITTGWLHP+INQ+N EP V  DTV N K+QH+VNVAISNSFGF
Sbjct  393   HCLGAAGGLEAIATVKAITTGWLHPSINQFNPEPSVDFDTVANKKQQHEVNVAISNSFGF  452

Query  1531  GGHNSVIVFGPFKP  1572
             GGHNSV+ F  FKP
Sbjct  453   GGHNSVVAFSAFKP  466



>ref|XP_002960175.1| hypothetical protein SELMODRAFT_229853 [Selaginella moellendorffii]
 ref|XP_002967530.1| hypothetical protein SELMODRAFT_231054 [Selaginella moellendorffii]
 gb|EFJ32129.1| hypothetical protein SELMODRAFT_231054 [Selaginella moellendorffii]
 gb|EFJ37714.1| hypothetical protein SELMODRAFT_229853 [Selaginella moellendorffii]
Length=430

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/421 (73%), Positives = 364/421 (86%), Gaps = 0/421 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             PKR++DPKKRVVITGMGLVSVFG+DV+T+Y+ LL+G+SG+ LIDRFDAS F  +FA QI 
Sbjct  10    PKRETDPKKRVVITGMGLVSVFGNDVDTYYDKLLDGQSGVGLIDRFDASQFPTKFAAQIR  69

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfggl  669
              F+++GYID KNDRRLD   RY +V GK+AL  A+LG + L+ +DK R+G +IGSG GGL
Sbjct  70    DFSAKGYIDGKNDRRLDDCLRYGIVGGKRALEHADLGGDKLDKVDKQRVGVLIGSGMGGL  129

Query  670   gvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFY  849
              VF +GV +L++ GY++ITPFFIPYSITNM SALLAIE GLMGP YSISTACAT+NYCFY
Sbjct  130   SVFSDGVQSLIEKGYRRITPFFIPYSITNMASALLAIELGLMGPNYSISTACATSNYCFY  189

Query  850   SAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVI  1029
             +AAN IR+GEAD+M+AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK R+GFV+
Sbjct  190   AAANSIRRGEADVMVAGGTEAAIIPVGLGGFVACRALSQRNSDPQTASRPWDKGREGFVM  249

Query  1030  GEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAG  1209
             GEG GVLVME L+HAMKRGA +  EYLGGA TCDAHHMT+PR DGLGVS+CI+KSLEDAG
Sbjct  250   GEGSGVLVMESLEHAMKRGAPIYGEYLGGAVTCDAHHMTDPRADGLGVSTCISKSLEDAG  309

Query  1210  VSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIA  1389
             VSPEEVNYINAHATSTV GD+ E+NAIKKVF ++S+IK+N TKS+IGH LGA+GGLEAIA
Sbjct  310   VSPEEVNYINAHATSTVVGDLAEINAIKKVFSESSDIKINATKSMIGHCLGAAGGLEAIA  369

Query  1390  TIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
              IKAITTGWLHP+INQ++ EP V  D V NVKKQH+VNVAISNSFGFGGHNSV+VF PFK
Sbjct  370   VIKAITTGWLHPSINQFDPEPSVPFDRVANVKKQHEVNVAISNSFGFGGHNSVVVFAPFK  429

Query  1570  P  1572
             P
Sbjct  430   P  430



>ref|XP_004964587.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Setaria italica]
Length=462

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/423 (74%), Positives = 362/423 (86%), Gaps = 2/423 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             P+R++DPKKRVVITGMGLVSVFG+DV+ +Y+ LL G SGI  IDRFDAS F  RFAGQI 
Sbjct  40    PRRETDPKKRVVITGMGLVSVFGNDVDAYYDRLLAGESGIGPIDRFDASKFPTRFAGQIR  99

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDAN--LGKEVLNNMDKTRigavigsgfg  663
             GF+SEGYID KNDRRLD   RYC+V+GKKAL  A   LG + +  +DK R G ++G+G G
Sbjct  100   GFSSEGYIDGKNDRRLDDCLRYCIVSGKKALESAGIALGSKPMEKIDKARAGVLVGTGMG  159

Query  664   glgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYC  843
             GL VF +GV  L++ GY+KITPFFIPY+ITNMGSALL ++ G MGP YSISTACAT+NYC
Sbjct  160   GLTVFSDGVQNLIEKGYRKITPFFIPYAITNMGSALLGMDIGFMGPNYSISTACATSNYC  219

Query  844   FYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGF  1023
             FY+AANHIR+GEADIMIAGGTEA I   GVGGF+ACRALSQRN +P+ ASRPWDK+RDGF
Sbjct  220   FYAAANHIRRGEADIMIAGGTEAAIIPIGVGGFVACRALSQRNDDPKTASRPWDKERDGF  279

Query  1024  VIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLED  1203
             V+GEG GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI +SLED
Sbjct  280   VMGEGAGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIKQSLED  339

Query  1204  AGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEA  1383
             AGV+PEEVNYINAHATST+AGD+ EVNAIK+VFKD S IK+N TKS+IGH LGA+GGLEA
Sbjct  340   AGVAPEEVNYINAHATSTLAGDLAEVNAIKQVFKDPSGIKINATKSMIGHCLGAAGGLEA  399

Query  1384  IATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGP  1563
             IATIKA+TTGW+HP+INQ+N E  V  DTVPNVKKQH+VNV ISNSFGFGGHNSV+VF P
Sbjct  400   IATIKAMTTGWVHPSINQFNPEEVVEFDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAP  459

Query  1564  FKP  1572
             FKP
Sbjct  460   FKP  462



>ref|XP_010495756.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Camelina sativa]
Length=569

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/421 (74%), Positives = 360/421 (86%), Gaps = 0/421 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             PKR++DPKKRVVITGMGLVSVFG+DV+ +Y  LL G SGISLIDRFDAS F  RF GQI 
Sbjct  149   PKRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIR  208

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfggl  669
             GF+SEGYID KN+RRLD   +YC+VAGKKAL  ANLG + LN++DK + G ++G+G GGL
Sbjct  209   GFSSEGYIDGKNERRLDDCLKYCIVAGKKALESANLGGDNLNSIDKRKAGVLVGTGMGGL  268

Query  670   gvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFY  849
              VF  GV  L++ G+++I+PFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY
Sbjct  269   TVFSEGVQNLIEKGHRRISPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFY  328

Query  850   SAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVI  1029
             +AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK RDGFV+
Sbjct  329   AAANHIRRGEADMMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKARDGFVM  388

Query  1030  GEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAG  1209
             GEG GVLVME L+HAMKRGA ++AEYLGGA  CDAHHMT+PR DGLGVSSCI + LEDAG
Sbjct  389   GEGAGVLVMESLEHAMKRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSSCIERCLEDAG  448

Query  1210  VSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIA  1389
             VSPEEVNYINAHATST+AGD+ E+NAIKKVFK TS IK+N TKS+IGH LGA+GGLEAIA
Sbjct  449   VSPEEVNYINAHATSTLAGDLAEINAIKKVFKSTSGIKINATKSMIGHCLGAAGGLEAIA  508

Query  1390  TIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
              +KAI TGWLHP+INQ+N E  V  DTVPN KKQH+V+VAISNSFGFGGHNSV+ F  FK
Sbjct  509   VVKAINTGWLHPSINQFNPEQAVDFDTVPNQKKQHEVDVAISNSFGFGGHNSVVAFSAFK  568

Query  1570  P  1572
             P
Sbjct  569   P  569


 Score =   131 bits (330),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 89/129 (69%), Gaps = 6/129 (5%)
 Frame = +1

Query  184  LQYSGLK--PVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSA----PKRQSDPKKRVV  345
            LQ S L+  P   ++   +  +++   A+  RR +  IS + SA    PKR++DPKKRVV
Sbjct  4    LQSSSLRASPPNPLRLPSNRQSHQITNARPIRRQRSFISASSSATVSAPKRETDPKKRVV  63

Query  346  ITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKN  525
            ITGMGLVSVFG+DV+ +Y  LL G SGISLIDRFDAS F  RF GQI GF+SEGYID KN
Sbjct  64   ITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGGQIRGFSSEGYIDGKN  123

Query  526  DRRLDHSWR  552
            +RRLD   +
Sbjct  124  ERRLDDCLK  132



>ref|XP_003564149.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
[Brachypodium distachyon]
Length=463

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/423 (73%), Positives = 360/423 (85%), Gaps = 2/423 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             P+R++DPKKRVVITGMGLVSVFG+DV+ +Y+ LL G SG+  IDRFDAS F  RFAGQI 
Sbjct  41    PRRETDPKKRVVITGMGLVSVFGNDVDAYYDRLLAGESGVGPIDRFDASKFPTRFAGQIR  100

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTRigavigsgfg  663
             GF+SEGYID KNDRRLD   RYC+V+GKKAL  A L  G E +  +DK R G ++G+G G
Sbjct  101   GFSSEGYIDGKNDRRLDDCLRYCIVSGKKALEAAGLPLGSEAMGKIDKARAGVLVGTGMG  160

Query  664   glgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYC  843
             GL VF +GV  L++ GY+KITPFFIPY+ITNMGSALL ++ G MGP YSISTACAT+NYC
Sbjct  161   GLQVFSDGVQNLIEKGYRKITPFFIPYAITNMGSALLGMDIGFMGPNYSISTACATSNYC  220

Query  844   FYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGF  1023
             FY+AANHIR+GEADIM+AGGTEA I   GVGGF+ACRALSQRN +P+ ASRPWDK+RDGF
Sbjct  221   FYAAANHIRRGEADIMVAGGTEAAIIPIGVGGFVACRALSQRNDDPQTASRPWDKERDGF  280

Query  1024  VIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLED  1203
             V+GEG GVLVME L+HAMKRGA ++AEYLGGA  CDA+HMT+PR DGLGVSSCI +SLED
Sbjct  281   VMGEGAGVLVMESLEHAMKRGAPIVAEYLGGAVNCDAYHMTDPRADGLGVSSCIRQSLED  340

Query  1204  AGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEA  1383
             AGV+PEEVNYINAHATST+AGD+ E+NAIK+VFKD S IK+N TKS+IGH LGA+GGLEA
Sbjct  341   AGVAPEEVNYINAHATSTLAGDLAEMNAIKQVFKDPSGIKVNATKSMIGHCLGAAGGLEA  400

Query  1384  IATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGP  1563
             IATIKAI TG +HP+INQ+N EP V  DTVPNVK +H+VNV ISNSFGFGGHNSV+VF P
Sbjct  401   IATIKAINTGLVHPSINQFNREPAVEFDTVPNVKAEHEVNVGISNSFGFGGHNSVVVFAP  460

Query  1564  FKP  1572
             FKP
Sbjct  461   FKP  463



>ref|NP_001052904.1| Os04g0445700 [Oryza sativa Japonica Group]
 dbj|BAF14818.1| Os04g0445700 [Oryza sativa Japonica Group]
Length=442

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/422 (73%), Positives = 363/422 (86%), Gaps = 2/422 (0%)
 Frame = +1

Query  313   KRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHG  492
             +R++DP+KRVVITGMGLVSVFG++V+ FY  LL G SG+  IDRFDA  F  RFAGQI G
Sbjct  21    RRETDPRKRVVITGMGLVSVFGNEVDAFYERLLAGESGVGAIDRFDAGGFPTRFAGQIRG  80

Query  493   FTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGK--EVLNNMDKTRigavigsgfgg  666
             F+SEGYID KNDRRLD   RYC+V+GKKAL +A LGK  +    +DK R G ++G+G GG
Sbjct  81    FSSEGYIDGKNDRRLDDCLRYCIVSGKKALENAGLGKGSDGHTKLDKVRAGVLVGTGMGG  140

Query  667   lgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCF  846
             L VF +GV  L++ GYKKI+PFFIPY+ITNMGSALLA++AG MGP YSISTACAT+NYCF
Sbjct  141   LTVFSDGVQNLIEKGYKKISPFFIPYAITNMGSALLAMDAGFMGPNYSISTACATSNYCF  200

Query  847   YSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFV  1026
             Y+AANHIR+GEAD+++AGGTEA I   G+GGF+ACRALSQRN +PE ASRPWDK+RDGFV
Sbjct  201   YAAANHIRRGEADVIVAGGTEAAIIPIGLGGFVACRALSQRNDDPETASRPWDKERDGFV  260

Query  1027  IGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDA  1206
             +GEG GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCIT+SLEDA
Sbjct  261   MGEGAGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCITQSLEDA  320

Query  1207  GVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAI  1386
             GV+PEEVNYINAHATST+AGD+ EV AIK+VFK+ S+IK+N TKS+IGH LGA+GGLEAI
Sbjct  321   GVAPEEVNYINAHATSTLAGDLAEVRAIKQVFKNPSDIKINSTKSMIGHCLGAAGGLEAI  380

Query  1387  ATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPF  1566
             A +KAITTGW+HPTINQ+N EPEV  DTV N K+QH+VNVAISNSFGFGGHNSV+VF PF
Sbjct  381   AVVKAITTGWVHPTINQFNPEPEVDFDTVANEKQQHEVNVAISNSFGFGGHNSVVVFAPF  440

Query  1567  KP  1572
             KP
Sbjct  441   KP  442



>ref|XP_006653452.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Oryza brachyantha]
Length=450

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/423 (73%), Positives = 362/423 (86%), Gaps = 2/423 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             P+R++DP+KRVVITGMGLVSVFG++V+ FY+ LL G SG+  IDRFDA  F  RFAGQI 
Sbjct  28    PRRETDPRKRVVITGMGLVSVFGNEVDAFYDRLLAGESGVGPIDRFDAGSFPTRFAGQIR  87

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGK--EVLNNMDKTRigavigsgfg  663
             GF+SEGYID KNDRRLD   RYC+V+GKKAL +A LGK  +  + +DK R G ++G+G G
Sbjct  88    GFSSEGYIDGKNDRRLDDCLRYCIVSGKKALENAGLGKGSDGHSKLDKVRAGVLVGTGMG  147

Query  664   glgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYC  843
             GL VF +GV  L++ GYKKI+PFFIPY+ITNMGSALLA++ G MGP YSISTACAT+NYC
Sbjct  148   GLTVFSDGVQNLIEKGYKKISPFFIPYAITNMGSALLAMDVGFMGPNYSISTACATSNYC  207

Query  844   FYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGF  1023
             FY+AANHIR+GEAD++IAGGTEA I   G+GGF+ACRALSQRN  PE ASRPWDK+RDGF
Sbjct  208   FYAAANHIRRGEADVIIAGGTEAAIIPIGLGGFVACRALSQRNENPETASRPWDKERDGF  267

Query  1024  VIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLED  1203
             V+GEG GVLVME L HAMKR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCIT SLED
Sbjct  268   VMGEGAGVLVMESLHHAMKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCITTSLED  327

Query  1204  AGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEA  1383
             AGV+PEEVNYINAHATST+AGD+ EV AIK+VFK+ S+IK+N TKS+IGH LGA+GGLEA
Sbjct  328   AGVAPEEVNYINAHATSTLAGDLAEVRAIKQVFKNPSDIKINSTKSMIGHCLGAAGGLEA  387

Query  1384  IATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGP  1563
             IA +KAITTGW+HPTINQ+N EPEV  DTV N KKQH+VNVAISNSFGFGGHNSV+VF P
Sbjct  388   IAAVKAITTGWVHPTINQFNPEPEVDFDTVANEKKQHEVNVAISNSFGFGGHNSVVVFAP  447

Query  1564  FKP  1572
             FKP
Sbjct  448   FKP  450



>ref|XP_010111005.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Morus notabilis]
 gb|EXC29391.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Morus notabilis]
Length=457

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/466 (68%), Positives = 371/466 (80%), Gaps = 14/466 (3%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITG  354
             A  L+ S L P+   +  P   + +  A KK        S  VSAPKR+ DPK+RVVITG
Sbjct  6     APTLRVSPLDPLRNRRRSPHFPSARPSATKKVPFFCRAASSTVSAPKREKDPKQRVVITG  65

Query  355   MGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRR  534
             MGLVSVFG++++ +Y+ LL G SGI+ IDRFDAS F  RF GQI GF+SEGYID KNDRR
Sbjct  66    MGLVSVFGNELDAYYDKLLSGESGIAPIDRFDASKFPTRFGGQIRGFSSEGYIDGKNDRR  125

Query  535   LDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGY  714
             LD   RYCLVAGKKAL DA+LG + L+ +DK R G ++G+G GGL VF +GV  L++ G+
Sbjct  126   LDDCLRYCLVAGKKALVDADLGGDKLSKIDKERAGVLVGTGMGGLTVFSDGVQALIEKGH  185

Query  715   KKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMi  894
             +KITPFFIPY+ITNMGSALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEAD+MI
Sbjct  186   RKITPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEADMMI  245

Query  895   aggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHA  1074
             AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+HA
Sbjct  246   AGGTEAAIIPIGLGGFVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHA  305

Query  1075  MKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATS  1254
             MKRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI  SLEDAGVSPEEVNYINAHATS
Sbjct  306   MKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIESSLEDAGVSPEEVNYINAHATS  365

Query  1255  TVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTIN  1434
             T+AGD+ E+NAIK              KS+IGH LGA+GGLEAIAT+KAITTGWLHPTIN
Sbjct  366   TLAGDLAEINAIK--------------KSMIGHCLGAAGGLEAIATVKAITTGWLHPTIN  411

Query  1435  QYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             Q+N EP V  DTV NVK+QH+VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  412   QFNPEPAVDFDTVANVKQQHEVNVAISNSFGFGGHNSVVAFSSFKP  457



>ref|NP_001057053.1| Os06g0196600 [Oryza sativa Japonica Group]
 dbj|BAD35225.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplast 
precursor [Oryza sativa Japonica Group]
 dbj|BAF18967.1| Os06g0196600 [Oryza sativa Japonica Group]
 dbj|BAG87476.1| unnamed protein product [Oryza sativa Japonica Group]
Length=465

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/420 (73%), Positives = 363/420 (86%), Gaps = 2/420 (0%)
 Frame = +1

Query  319   QSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFT  498
             ++DP+KRVVITGMGLVSVFG+DV+ +Y+ LL G SGI  IDRFDAS+F  RFAGQI GF+
Sbjct  46    ETDPRKRVVITGMGLVSVFGNDVDAYYDRLLAGESGIGPIDRFDASNFPTRFAGQIRGFS  105

Query  499   SEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTRigavigsgfgglg  672
             SEGYID KNDRRLD   RYC+V+GKKAL  A L  G + ++ ++KTR G ++G+G GGL 
Sbjct  106   SEGYIDGKNDRRLDDCLRYCIVSGKKALESAGLALGSKSMDKIEKTRAGVLVGTGMGGLT  165

Query  673   vfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYS  852
             VF +GV  L++ G++KITPFFIPY+ITNMGSALL ++ G MGP YSISTACAT+NYCFY+
Sbjct  166   VFSDGVQNLIEKGHRKITPFFIPYAITNMGSALLGMDIGFMGPNYSISTACATSNYCFYA  225

Query  853   AANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIG  1032
             AANHIR+GEAD+MIAGGTEA I   GVGGF+ACRALSQRN +P+ ASRPWD+DRDGFV+G
Sbjct  226   AANHIRRGEADVMIAGGTEAAIIPIGVGGFVACRALSQRNDDPKTASRPWDQDRDGFVMG  285

Query  1033  EGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGV  1212
             EG GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI +SL DAGV
Sbjct  286   EGAGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIKQSLADAGV  345

Query  1213  SPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIAT  1392
             +PEEVNYINAHATST+AGD+ EVNAI++VFKD SEIK+N TKS+IGH LGA+GGLEAIAT
Sbjct  346   APEEVNYINAHATSTLAGDLAEVNAIRQVFKDPSEIKINATKSMIGHCLGAAGGLEAIAT  405

Query  1393  IKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             +KAITTGW+HP+INQ+N EP V  DTVPNVKKQH+VNV ISNSFGFGGHNSV+VF PFKP
Sbjct  406   VKAITTGWVHPSINQFNPEPAVEFDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAPFKP  465



>ref|XP_006656734.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Oryza brachyantha]
Length=438

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/433 (72%), Positives = 369/433 (85%), Gaps = 6/433 (1%)
 Frame = +1

Query  292   SPAVSAP----KRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASD  459
             S AVSAP     R++DP+KRVVITGMGLVSVFG++V+ +Y+ LL G SG+  IDRFDAS+
Sbjct  6     SEAVSAPVVLLLRETDPRKRVVITGMGLVSVFGNEVDAYYDRLLAGESGVGPIDRFDASN  65

Query  460   FSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTR  633
             F  RFAGQI GF+SEGYID KNDRRLD   RYC+V+GKKAL  A+L  G + ++ ++KTR
Sbjct  66    FPTRFAGQIRGFSSEGYIDGKNDRRLDDCLRYCIVSGKKALESADLALGSKSMDKIEKTR  125

Query  634   igavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSI  813
              G ++G+G GGL VF +GV  L++ G++KITPFFIPY+ITNMGSALL ++ G MGP YSI
Sbjct  126   AGVLVGTGMGGLTVFSDGVQNLIEKGHRKITPFFIPYAITNMGSALLGMDIGFMGPNYSI  185

Query  814   STACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERAS  993
             STACAT+NYCFY+AANHIR+GEAD+MIAGGTEA I   GVGGF+ACRALSQRN +P+ AS
Sbjct  186   STACATSNYCFYAAANHIRRGEADVMIAGGTEAAIIPIGVGGFVACRALSQRNDDPKTAS  245

Query  994   RPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGV  1173
             RPWD+ RDGFV+GEG GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT+PR+DGLGV
Sbjct  246   RPWDQARDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGV  305

Query  1174  SSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGH  1353
             SSCI +SL DAGV+PEEVNYINAHATST+AGD+ EVNAI++VFKD S IK+N TKS+IGH
Sbjct  306   SSCIKQSLVDAGVAPEEVNYINAHATSTLAGDLAEVNAIRQVFKDPSGIKINATKSMIGH  365

Query  1354  GLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFG  1533
              LGA+GGLEAIAT+KAITTGW+HP+INQ+N EP V  DTVPNVKKQH+VNV ISNSFGFG
Sbjct  366   CLGAAGGLEAIATVKAITTGWVHPSINQFNPEPAVEFDTVPNVKKQHEVNVGISNSFGFG  425

Query  1534  GHNSVIVFGPFKP  1572
             GHNSV+VF PFKP
Sbjct  426   GHNSVVVFAPFKP  438



>ref|XP_009391220.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=468

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/425 (73%), Positives = 360/425 (85%), Gaps = 2/425 (0%)
 Frame = +1

Query  304   SAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQ  483
             +AP+R++DPKKRVVITGMGLVSVFG+DV+ +Y  LLEG SGI  IDRFDAS    RFAGQ
Sbjct  44    AAPRRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLEGESGIGPIDRFDASKLPTRFAGQ  103

Query  484   IHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLG--KEVLNNMDKTRigavigsg  657
             I GF+SEGYID KNDRRLD   RYCLV+GKKAL  A LG   + ++ +DK R G ++G+G
Sbjct  104   IRGFSSEGYIDGKNDRRLDDCLRYCLVSGKKALESAGLGVGSQAISKIDKVRAGVLVGTG  163

Query  658   fgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATAN  837
              GGL VF +GV  L++ G++KITPFFIPY+ITNMGSALLA++ G MG  YSISTACAT+N
Sbjct  164   MGGLTVFSDGVQALIEKGHRKITPFFIPYAITNMGSALLAMDIGFMGANYSISTACATSN  223

Query  838   YCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRD  1017
             YCFY+AANHIR+GEADIMIAGGTEA I   GVGGF+ACRALSQRN +P+ ASRPWD  RD
Sbjct  224   YCFYAAANHIRRGEADIMIAGGTEAAIIPIGVGGFVACRALSQRNDDPKTASRPWDTGRD  283

Query  1018  GFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSL  1197
             GFV+GEG GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT+PR DGLGVSSCI KSL
Sbjct  284   GFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIRKSL  343

Query  1198  EDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGL  1377
             EDAGV+PEEV+YINAHATST+AGD+ EVNAI +VFK+ S IKMN TKS+IGH LGA+GGL
Sbjct  344   EDAGVAPEEVSYINAHATSTLAGDLAEVNAINQVFKNPSGIKMNATKSMIGHCLGAAGGL  403

Query  1378  EAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVF  1557
             EAIAT+KAITTGWLHP+INQ+N EP V  DTV N K+QH+VN+AISNSFGFGGHNSV+VF
Sbjct  404   EAIATVKAITTGWLHPSINQFNPEPAVEFDTVANKKQQHEVNIAISNSFGFGGHNSVVVF  463

Query  1558  GPFKP  1572
              PFKP
Sbjct  464   APFKP  468



>ref|XP_003608492.1| Beta-ketoacyl-ACP synthase I [Medicago truncatula]
 gb|AES90689.1| 3-oxoacyl-(acyl carrier) synthase II [Medicago truncatula]
Length=470

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/457 (69%), Positives = 372/457 (81%), Gaps = 3/457 (1%)
 Frame = +1

Query  205   PVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSA-PKRQSDPKKRVVITGMGLVSVFGS  381
             P+E ++ +P + A    AA+  +R+  + S   +A P+R+ DPKKRVVITGMG V+V G+
Sbjct  16    PLEPLRKKPSNAA--TTAARTPKRLSVVSSSVTTAAPQREKDPKKRVVITGMGGVTVHGN  73

Query  382   DVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCL  561
             DV+ FY  LL G SGI+LIDRFDAS F  RFAGQI GF+SEGYID KNDRR D   RYC 
Sbjct  74    DVDIFYEKLLAGDSGITLIDRFDASKFPTRFAGQIRGFSSEGYIDGKNDRRQDDCLRYCN  133

Query  562   VAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIP  741
             VAGKKAL DA LG E L+ +DK R G ++GSG GGL VF +GV  L++ G++KI+PFFIP
Sbjct  134   VAGKKALEDAGLGAENLDKIDKERAGVLVGSGMGGLTVFSDGVKNLIEKGHRKISPFFIP  193

Query  742   YSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagit  921
             Y+ITNM SALL I+ G  GP YSISTACAT+NYCF +AANHIR+GEAD+MIAGGTEA I 
Sbjct  194   YAITNMASALLGIDLGFRGPNYSISTACATSNYCFVAAANHIRRGEADLMIAGGTEAAII  253

Query  922   ttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIA  1101
               G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+HAMKRGA +IA
Sbjct  254   PIGLGGFVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRGAPIIA  313

Query  1102  EYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEV  1281
             EYLGGA  CDA+HMT+PR+DGLGVSSCI  SL DAGVSPEEVNYINAHATST+ GD+ E+
Sbjct  314   EYLGGAVNCDAYHMTDPRSDGLGVSSCIQSSLVDAGVSPEEVNYINAHATSTLVGDLAEI  373

Query  1282  NAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVT  1461
             NAIKKVFK+ S IK+N TKS+IGH LGA+GGLEAIATIKAITTGWLHP+INQ+N EP V 
Sbjct  374   NAIKKVFKNPSGIKINATKSMIGHCLGAAGGLEAIATIKAITTGWLHPSINQFNPEPAVD  433

Query  1462  IDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
              DTV NVK+QH++NV ISNSFGFGGHNSV+ F  F+P
Sbjct  434   FDTVANVKQQHEINVGISNSFGFGGHNSVVAFSAFRP  470



>dbj|BAH00228.1| unnamed protein product [Oryza sativa Japonica Group]
Length=462

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/420 (73%), Positives = 361/420 (86%), Gaps = 2/420 (0%)
 Frame = +1

Query  319   QSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFT  498
             ++DP+KRVVITGMGLVSVFG++V+ FY  LL G SG+  IDRFDA  F  RFAGQI GF+
Sbjct  43    ETDPRKRVVITGMGLVSVFGNEVDAFYERLLAGESGVGAIDRFDAGGFPTRFAGQIRGFS  102

Query  499   SEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGK--EVLNNMDKTRigavigsgfgglg  672
             SEGYID KNDRRLD   RYC+V+GKKAL +A LGK  +    +DK R G ++G+G GGL 
Sbjct  103   SEGYIDGKNDRRLDDCLRYCIVSGKKALENAGLGKGSDGHTKLDKVRAGVLVGTGMGGLT  162

Query  673   vfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYS  852
             VF +GV  L++ GYKKI+PFFIPY+ITNMGSALLA++AG MGP YSISTACAT+NYCFY+
Sbjct  163   VFSDGVQNLIEKGYKKISPFFIPYAITNMGSALLAMDAGFMGPNYSISTACATSNYCFYA  222

Query  853   AANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIG  1032
             AANHIR+GEAD+++AGGTEA I   G+GGF+ACRALSQRN +PE ASRPWDK+RDGFV+G
Sbjct  223   AANHIRRGEADVIVAGGTEAAIIPIGLGGFVACRALSQRNDDPETASRPWDKERDGFVMG  282

Query  1033  EGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGV  1212
             EG GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCIT+SLEDAGV
Sbjct  283   EGAGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCITQSLEDAGV  342

Query  1213  SPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIAT  1392
             +PEEVNYINAHATST+AGD+ EV AIK+VFK+ S+IK+N TKS+IGH LGA+GGLEAIA 
Sbjct  343   APEEVNYINAHATSTLAGDLAEVRAIKQVFKNPSDIKINSTKSMIGHCLGAAGGLEAIAV  402

Query  1393  IKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             +KAITTGW+HPTINQ+N EPEV  DTV N K+QH+VNVAISNSFGFGGHNSV+VF PFKP
Sbjct  403   VKAITTGWVHPTINQFNPEPEVDFDTVANEKQQHEVNVAISNSFGFGGHNSVVVFAPFKP  462



>gb|AFK43304.1| unknown [Medicago truncatula]
Length=470

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/457 (69%), Positives = 372/457 (81%), Gaps = 3/457 (1%)
 Frame = +1

Query  205   PVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSA-PKRQSDPKKRVVITGMGLVSVFGS  381
             P+E ++ +P + A    AA+  +R+  + S   +A P+R+ DPKKRVVITGMG V+V G+
Sbjct  16    PLEPLRKKPSNAA--TTAARTPKRLSVVSSSVTTAAPQREKDPKKRVVITGMGGVTVHGN  73

Query  382   DVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCL  561
             DV+ FY  LL G SGI+LIDRFDAS F  RFAGQI GF+SEGYID KNDRR D   RYC 
Sbjct  74    DVDIFYEKLLAGDSGITLIDRFDASKFPTRFAGQIRGFSSEGYIDGKNDRRQDDCLRYCN  133

Query  562   VAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIP  741
             VAGKKAL DA LG E L+ +DK R G ++GSG GGL VF +GV  L++ G++KI+PFFIP
Sbjct  134   VAGKKALEDAGLGAENLDKIDKERAGVLVGSGMGGLTVFSDGVKNLIEKGHRKISPFFIP  193

Query  742   YSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagit  921
             Y+ITNM SALL I+ G  GP YSISTACAT+NYCF +AANHIR+GEAD+MIAGGTEA I 
Sbjct  194   YAITNMASALLGIDLGFRGPNYSISTACATSNYCFVAAANHIRRGEADLMIAGGTEAAII  253

Query  922   ttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIA  1101
               G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLV+E L+HAMKRGA +IA
Sbjct  254   PIGLGGFVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVVESLEHAMKRGAPIIA  313

Query  1102  EYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEV  1281
             EYLGGA  CDA+HMT+PR+DGLGVSSCI  SL DAGVSPEEVNYINAHATST+ GD+ E+
Sbjct  314   EYLGGAVNCDAYHMTDPRSDGLGVSSCIQSSLVDAGVSPEEVNYINAHATSTLVGDLAEI  373

Query  1282  NAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVT  1461
             NAIKKVFK+ S IK+N TKS+IGH LGA+GGLEAIATIKAITTGWLHP+INQ+N EP V 
Sbjct  374   NAIKKVFKNPSGIKINATKSMIGHCLGAAGGLEAIATIKAITTGWLHPSINQFNPEPAVD  433

Query  1462  IDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
              DTV NVK+QH++NV ISNSFGFGGHNSV+ F  F+P
Sbjct  434   FDTVANVKQQHEINVGISNSFGFGGHNSVVAFSAFRP  470



>dbj|BAJ86549.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/423 (72%), Positives = 360/423 (85%), Gaps = 2/423 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             P+R++DPKKRVVITGMGLVSVFG+DV+ +Y+ LL G SG+  IDRFDAS F  RFAGQI 
Sbjct  41    PRRETDPKKRVVITGMGLVSVFGNDVDAYYDRLLAGESGVGPIDRFDASKFPTRFAGQIR  100

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTRigavigsgfg  663
             GF+SEGYID KNDRRLD   RYC+V+GKKAL  A L  G + +  +DK R G ++G+G G
Sbjct  101   GFSSEGYIDGKNDRRLDDCLRYCIVSGKKALESAGLPLGSDAMAKIDKARAGVLVGTGMG  160

Query  664   glgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYC  843
             GL VF +GV  L++ GY+KITPFFIPY+ITNMGSALL ++ G MGP YSISTACAT+NYC
Sbjct  161   GLQVFSDGVQNLLEKGYRKITPFFIPYAITNMGSALLGMDIGFMGPNYSISTACATSNYC  220

Query  844   FYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGF  1023
             FY+AANHIR+GEAD+MIAGGTEA I   GVGGF+ACRALSQRN +P+ ASRPWDK+RDGF
Sbjct  221   FYAAANHIRKGEADMMIAGGTEAAIIPIGVGGFVACRALSQRNDDPKTASRPWDKERDGF  280

Query  1024  VIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLED  1203
             V+GEG GVLVME L+HAMKRGA ++AEYLGGA  CDA+HMT+PR DGLGVSSCI +SL+D
Sbjct  281   VMGEGAGVLVMESLEHAMKRGAPIVAEYLGGAVNCDAYHMTDPRADGLGVSSCIRQSLQD  340

Query  1204  AGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEA  1383
             AGV+PEEVNYINAHATST+AGD+ E+NAIK+VFKD S IK+N TKS+IGH LGA+GGLEA
Sbjct  341   AGVAPEEVNYINAHATSTLAGDLAEMNAIKQVFKDPSGIKVNATKSMIGHCLGAAGGLEA  400

Query  1384  IATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGP  1563
             IATIKAI TG +HP+INQ++ EP V  DTVPNVK +H++NV ISNSFGFGGHNSV+VF P
Sbjct  401   IATIKAINTGLVHPSINQFDREPAVEFDTVPNVKAEHEINVGISNSFGFGGHNSVVVFAP  460

Query  1564  FKP  1572
             FKP
Sbjct  461   FKP  463



>ref|XP_002969875.1| hypothetical protein SELMODRAFT_171238 [Selaginella moellendorffii]
 ref|XP_002985208.1| hypothetical protein SELMODRAFT_446227 [Selaginella moellendorffii]
 gb|EFJ13702.1| hypothetical protein SELMODRAFT_446227 [Selaginella moellendorffii]
 gb|EFJ28999.1| hypothetical protein SELMODRAFT_171238 [Selaginella moellendorffii]
Length=439

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/419 (73%), Positives = 358/419 (85%), Gaps = 4/419 (1%)
 Frame = +1

Query  313   KRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHG  492
             +R+ DPKKRVVITGMGLVSVFG+DV++FY+ LL+G SGI+LIDRFDAS F  RF GQI  
Sbjct  22    ERERDPKKRVVITGMGLVSVFGNDVDSFYDKLLQGESGITLIDRFDASKFPTRFGGQIRN  81

Query  493   FTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglg  672
             F+S+GYID KNDRRLD   RYCLV+GKKAL +A L     + +DK R+G V+GSG GGL 
Sbjct  82    FSSQGYIDGKNDRRLDDCLRYCLVSGKKALENAELDT---SKIDKERVGVVVGSGMGGLS  138

Query  673   vfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYS  852
             VF + V  L   G+++ITPFFIPY+ITNMGSAL+AIE G MGP YSISTACAT+NYCF +
Sbjct  139   VFSDAVQALGDKGHRRITPFFIPYTITNMGSALIAIELGFMGPNYSISTACATSNYCFCA  198

Query  853   AANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIG  1032
             AANHIR+GEAD+M+ GGTEA I   G+GGF+ACRALSQRN +P+ ASRPWD+DRDGFVIG
Sbjct  199   AANHIRRGEADVMLTGGTEAPIIPVGLGGFVACRALSQRNSDPQTASRPWDRDRDGFVIG  258

Query  1033  EGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGV  1212
             EG G+LVME LDHAM+R A ++AEYLGGA TCDA+HMT+PR DGLGVS+CIT++L+DAGV
Sbjct  259   EGAGILVMESLDHAMRRNAPILAEYLGGAVTCDAYHMTDPRADGLGVSTCITRALDDAGV  318

Query  1213  SPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIAT  1392
              PEEVN+INAHATST  GD+ EVNAIKKVFKDTSE+KMN TKS+IGH LGA GGLEAIAT
Sbjct  319   HPEEVNFINAHATSTPVGDMAEVNAIKKVFKDTSEMKMNATKSMIGHSLGACGGLEAIAT  378

Query  1393  IKAITTGWLHPTINQYNLEPEVT-IDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPF  1566
             IKAI TGW+HPTINQ+N++P VT  DTVPNVKKQH++NVAISNSFGFGGHNSV+VF PF
Sbjct  379   IKAIKTGWVHPTINQFNVDPLVTCFDTVPNVKKQHEINVAISNSFGFGGHNSVVVFAPF  437



>ref|XP_004975743.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X2 [Setaria italica]
Length=459

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/417 (73%), Positives = 357/417 (86%), Gaps = 0/417 (0%)
 Frame = +1

Query  319   QSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFT  498
             ++DP+KRVVITGMGLVSVFGSDV  FY+ LL+G SG+  IDRFDA  F  RFA QI  F+
Sbjct  42    ETDPRKRVVITGMGLVSVFGSDVGAFYDRLLQGESGVGPIDRFDAGSFPTRFAAQIRDFS  101

Query  499   SEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvf  678
             SEGYID KNDRRLD   RYC+V+GKKAL +A L K    ++DK R G ++G+G GGL VF
Sbjct  102   SEGYIDGKNDRRLDDCLRYCIVSGKKALENAGLAKGSDAHLDKVRAGVLVGTGMGGLTVF  161

Query  679   gngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAA  858
              +GV  L++ GY+KI+PFFIPY+ITNMGSALLA++ G MGP YSISTACAT+NYCFY+AA
Sbjct  162   SDGVQNLIEKGYRKISPFFIPYAITNMGSALLAMDVGFMGPNYSISTACATSNYCFYAAA  221

Query  859   NHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEG  1038
             NHIR+GEADI++AGGTEA I   G+GGF+ACRALSQRN +P  ASRPWDK+RDGFV+GEG
Sbjct  222   NHIRRGEADIIVAGGTEAAIIPIGLGGFVACRALSQRNDDPTTASRPWDKERDGFVMGEG  281

Query  1039  CGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSP  1218
              GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCITKSLEDAGV+P
Sbjct  282   AGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCITKSLEDAGVAP  341

Query  1219  EEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIK  1398
             EEVNYINAHATST+AGD+ EV AIK+VF +TSEIK+N TKS+IGH LGA+GGLEAIAT++
Sbjct  342   EEVNYINAHATSTLAGDLAEVRAIKQVFNNTSEIKINSTKSMIGHCLGAAGGLEAIATVE  401

Query  1399  AITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             AITTGW+HPTINQ+N EPEV  DTV N KKQH+VNVAISNSFGFGGHNSV+VF PFK
Sbjct  402   AITTGWVHPTINQFNPEPEVEFDTVANEKKQHEVNVAISNSFGFGGHNSVVVFAPFK  458



>sp|P23902.1|KASC1_HORVU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic; 
AltName: Full=Beta-ketoacyl-ACP synthase I; Short=KAS 
I; Flags: Precursor [Hordeum vulgare]
 gb|AAA32968.1| beta-ketoacyl-ACP synthase I [Hordeum vulgare]
 dbj|BAJ88844.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=462

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/423 (73%), Positives = 357/423 (84%), Gaps = 2/423 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             P+R++DP+KRVVITGMGL SVFGSDV+TFY+ LL G SG+  IDRFDAS F  RFAGQI 
Sbjct  40    PQRETDPRKRVVITGMGLASVFGSDVDTFYDRLLAGESGVGPIDRFDASSFPTRFAGQIR  99

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLG--KEVLNNMDKTRigavigsgfg  663
             GF+SEGYID KNDRRLD   RYC+++GKKAL  A LG   +    +D  R G ++G+G G
Sbjct  100   GFSSEGYIDGKNDRRLDDCIRYCILSGKKALESAGLGAGSDAHVKLDVGRAGVLVGTGMG  159

Query  664   glgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYC  843
             GL VF +GV  L++ GY+KI+PFFIPY+ITNMGSALLAI+ G MGP YSISTACAT+NYC
Sbjct  160   GLSVFSDGVQNLIEKGYRKISPFFIPYAITNMGSALLAIDVGFMGPNYSISTACATSNYC  219

Query  844   FYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGF  1023
             FY+AANHIR+GEADI++AGGTEA I   G+GGF+ACRALSQRN +P  A RPWDK+RDGF
Sbjct  220   FYAAANHIRRGEADIIVAGGTEAAIIPIGLGGFVACRALSQRNDDPITACRPWDKERDGF  279

Query  1024  VIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLED  1203
             V+GEG GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT+PR DGLGVSSCIT SL D
Sbjct  280   VMGEGAGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCITMSLRD  339

Query  1204  AGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEA  1383
             AGV+PEEVNYINAHATST+AGD+ EV AIK+VFK+ SEIK+N TKS+IGH LGA+GGLEA
Sbjct  340   AGVAPEEVNYINAHATSTLAGDLAEVRAIKQVFKNPSEIKINSTKSMIGHCLGAAGGLEA  399

Query  1384  IATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGP  1563
             IATIK+ITTGW+HPTINQ+N EPEV  DTV N KKQH+VNV ISNSFGFGGHNSV+VF P
Sbjct  400   IATIKSITTGWVHPTINQFNPEPEVDFDTVANEKKQHEVNVGISNSFGFGGHNSVVVFAP  459

Query  1564  FKP  1572
             FKP
Sbjct  460   FKP  462



>ref|XP_004975742.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
isoform X1 [Setaria italica]
Length=461

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/419 (73%), Positives = 357/419 (85%), Gaps = 2/419 (0%)
 Frame = +1

Query  319   QSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFT  498
             ++DP+KRVVITGMGLVSVFGSDV  FY+ LL+G SG+  IDRFDA  F  RFA QI  F+
Sbjct  42    ETDPRKRVVITGMGLVSVFGSDVGAFYDRLLQGESGVGPIDRFDAGSFPTRFAAQIRDFS  101

Query  499   SEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTRigavigsgfgglg  672
             SEGYID KNDRRLD   RYC+V+GKKAL +A L  G +    +DK R G ++G+G GGL 
Sbjct  102   SEGYIDGKNDRRLDDCLRYCIVSGKKALENAGLAKGSDAHVKLDKVRAGVLVGTGMGGLT  161

Query  673   vfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYS  852
             VF +GV  L++ GY+KI+PFFIPY+ITNMGSALLA++ G MGP YSISTACAT+NYCFY+
Sbjct  162   VFSDGVQNLIEKGYRKISPFFIPYAITNMGSALLAMDVGFMGPNYSISTACATSNYCFYA  221

Query  853   AANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIG  1032
             AANHIR+GEADI++AGGTEA I   G+GGF+ACRALSQRN +P  ASRPWDK+RDGFV+G
Sbjct  222   AANHIRRGEADIIVAGGTEAAIIPIGLGGFVACRALSQRNDDPTTASRPWDKERDGFVMG  281

Query  1033  EGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGV  1212
             EG GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCITKSLEDAGV
Sbjct  282   EGAGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCITKSLEDAGV  341

Query  1213  SPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIAT  1392
             +PEEVNYINAHATST+AGD+ EV AIK+VF +TSEIK+N TKS+IGH LGA+GGLEAIAT
Sbjct  342   APEEVNYINAHATSTLAGDLAEVRAIKQVFNNTSEIKINSTKSMIGHCLGAAGGLEAIAT  401

Query  1393  IKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             ++AITTGW+HPTINQ+N EPEV  DTV N KKQH+VNVAISNSFGFGGHNSV+VF PFK
Sbjct  402   VEAITTGWVHPTINQFNPEPEVEFDTVANEKKQHEVNVAISNSFGFGGHNSVVVFAPFK  460



>gb|KHG12490.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Gossypium 
arboreum]
Length=497

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/447 (70%), Positives = 372/447 (83%), Gaps = 4/447 (1%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQ---NQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVV  345
             AS L+ S LKP++  +   + P++     +A KK   I    SP VSAPKR+ DPKKRVV
Sbjct  6     ASSLRASPLKPLQKPKFNIHFPNASRLVPRATKKFSSITAS-SPTVSAPKREKDPKKRVV  64

Query  346   ITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKN  525
             ITGMGLVSVFG+DV+ +Y+ LL G SGI LIDRFDAS F  RFAGQI GF+S+GYID KN
Sbjct  65    ITGMGLVSVFGNDVDAYYDKLLAGESGIGLIDRFDASKFPTRFAGQIRGFSSQGYIDGKN  124

Query  526   DRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQ  705
             DRRLD   RYC+VAGKKAL DA+LG + L+ +DK R G ++G+G GGL VF +GV  L++
Sbjct  125   DRRLDDCLRYCIVAGKKALEDADLGGDKLSKIDKERAGVLVGTGMGGLTVFSDGVQNLIE  184

Query  706   SGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEAD  885
              GY+KITPFFIPY+ITNM SALLAI+ GLMGP YSISTACAT+NYCFY+AANHIR+GEA+
Sbjct  185   KGYRKITPFFIPYAITNMSSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEAE  244

Query  886   IMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERL  1065
             +MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L
Sbjct  245   MMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESL  304

Query  1066  DHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAH  1245
             +HAMKRGA +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI +SLEDAGVSPEEVNYINAH
Sbjct  305   EHAMKRGAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIERSLEDAGVSPEEVNYINAH  364

Query  1246  ATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHP  1425
             ATST+AGD+ E+NAIKKVFK+TS IK+N TKS+IGH LGA+GGLEAIA++KAITTGWLHP
Sbjct  365   ATSTLAGDLAEINAIKKVFKNTSGIKINATKSMIGHCLGAAGGLEAIASVKAITTGWLHP  424

Query  1426  TINQYNLEPEVTIDTVPNVKKQHQVNV  1506
             +INQ+N EP V  DTV N K+QH+VNV
Sbjct  425   SINQFNPEPSVEFDTVANKKQQHEVNV  451



>emb|CBI30851.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/406 (75%), Positives = 347/406 (85%), Gaps = 0/406 (0%)
 Frame = +1

Query  355   MGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRR  534
             MGLVSVFG+DV+ +Y  LL G SGIS IDRFDAS F  RF GQI GF S+GYID KNDRR
Sbjct  1     MGLVSVFGNDVDAYYEKLLAGESGISPIDRFDASKFPTRFGGQIRGFDSQGYIDGKNDRR  60

Query  535   LDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGY  714
             LD   RYC+VAGKKAL DA+LG   ++ +DK R G ++G+G GGL VF +GV  L++ G+
Sbjct  61    LDDCLRYCIVAGKKALEDADLGGADISKIDKERAGVLVGTGMGGLTVFSDGVQALIERGH  120

Query  715   KKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMi  894
             +KITPFFIPY+ITNMGSALLAI+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+MI
Sbjct  121   RKITPFFIPYAITNMGSALLAIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMI  180

Query  895   aggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHA  1074
             AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+HA
Sbjct  181   AGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKDRDGFVMGEGAGVLVMESLEHA  240

Query  1075  MKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATS  1254
             MKRGA +IAEY+GGA  CDA+HMT+PR+DGLGVSSCI  SLEDAGVSPEEVNYINAHATS
Sbjct  241   MKRGAPIIAEYMGGAVNCDAYHMTDPRSDGLGVSSCIESSLEDAGVSPEEVNYINAHATS  300

Query  1255  TVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTIN  1434
             T+ GD+ EVNAIKKVFK TSEIKMN TKS+IGH LGA+GGLEAIAT+KAITTGWLHPTIN
Sbjct  301   TIVGDLAEVNAIKKVFKSTSEIKMNATKSMIGHCLGAAGGLEAIATVKAITTGWLHPTIN  360

Query  1435  QYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             Q+N EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+VF  FKP
Sbjct  361   QFNPEPSVEFDTVANKKQQHEVNVAISNSFGFGGHNSVVVFSAFKP  406



>ref|XP_003579824.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
isoform X2 [Brachypodium distachyon]
Length=462

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/427 (71%), Positives = 360/427 (84%), Gaps = 2/427 (0%)
 Frame = +1

Query  298   AVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFA  477
             A  AP+R++DP+KRVVITG+GLVSVFGS+V+ FY+ LL G SG+  IDRFD   F  RFA
Sbjct  36    AAVAPQRETDPRKRVVITGLGLVSVFGSEVDGFYDRLLAGESGVRTIDRFDPGSFPTRFA  95

Query  478   GQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTRigavig  651
             GQI GF+SEGYIDAKNDRR+D   RYC+V+G+KAL  A L  G +    +D  R G ++G
Sbjct  96    GQIRGFSSEGYIDAKNDRRMDDCIRYCIVSGRKALESAGLDRGSDAHGKIDLGRAGVLVG  155

Query  652   sgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACAT  831
             +G GGL VF NGV  L++ GY+KI+PFFIPY+I+NMGSALLA + G MGP YSISTACAT
Sbjct  156   TGMGGLSVFSNGVQNLIEKGYRKISPFFIPYAISNMGSALLATDVGFMGPNYSISTACAT  215

Query  832   ANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKD  1011
             +NYCFY+AANHIR+GEAD+++AGGTEA I   G+GGF+ACRALSQRN +PE ASRPWDK+
Sbjct  216   SNYCFYAAANHIRRGEADVIVAGGTEAAIIPIGLGGFVACRALSQRNDDPETASRPWDKE  275

Query  1012  RDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITK  1191
             RDGFV+GEG GVLVME L+HA+KR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI K
Sbjct  276   RDGFVMGEGAGVLVMESLEHAIKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIAK  335

Query  1192  SLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASG  1371
             SLEDAGV+PEEVNYINAHATST+AGD+ EV AIK+VFK+ SE K+N TKS+IGH LGA+G
Sbjct  336   SLEDAGVAPEEVNYINAHATSTLAGDLAEVRAIKQVFKNLSETKINSTKSMIGHCLGAAG  395

Query  1372  GLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVI  1551
             GLEAIATIK+IT GW+HPTINQ+N EPEV  DTV N KKQH+VNVAISNSFGFGGHNSV+
Sbjct  396   GLEAIATIKSITNGWVHPTINQFNSEPEVDFDTVANEKKQHEVNVAISNSFGFGGHNSVV  455

Query  1552  VFGPFKP  1572
             VF PFKP
Sbjct  456   VFTPFKP  462



>emb|CDX87726.1| BnaC02g32230D [Brassica napus]
Length=462

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/431 (71%), Positives = 357/431 (83%), Gaps = 2/431 (0%)
 Frame = +1

Query  280   KCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASD  459
             +  IS + SAPKR++DPKKRVVITGMGLVSVFG+DV+ +Y  LL   S ISLIDRFDAS 
Sbjct  34    RSFISASTSAPKRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLSVESRISLIDRFDASK  93

Query  460   FSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRig  639
             F  RF GQ+ GF+SEGYID KN+R LD   +YC+VAGKKAL  ANLG + LN +DK R G
Sbjct  94    FPTRFGGQVCGFSSEGYIDGKNERSLDDCLKYCIVAGKKALESANLGGDKLNTIDKRRAG  153

Query  640   avigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSIST  819
              ++G+G G L VF +GV  L++ G+++I+ FFIPY+ITNMGSALLAI+ GLMGP YSIST
Sbjct  154   VLVGTGMGVLTVFSDGVQALIEKGHRRISLFFIPYAITNMGSALLAIDLGLMGPNYSIST  213

Query  820   ACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRP  999
             ACAT+NYCFY+AANHIR+GEAD+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRP
Sbjct  214   ACATSNYCFYAAANHIRRGEADMMIAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRP  273

Query  1000  WDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSS  1179
             WDK RDGFV+GEG  VL+ME L+HAMKRGA ++AEYLGGA  CDAHHMT+PR DGLGVSS
Sbjct  274   WDKQRDGFVMGEGASVLMMESLEHAMKRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSS  333

Query  1180  CITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGL  1359
             CI   LEDAGVSPEEVNYINAHATST+AGD+ E+NAIKKVFK TS IK+N TK  I H L
Sbjct  334   CIESCLEDAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKSTSGIKINATK--IRHCL  391

Query  1360  GASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGH  1539
             GA+GGLEAIAT+KAI TGWLHP+INQ+N EP V  DTV N KKQH+VNVAISNSFGFGGH
Sbjct  392   GAAGGLEAIATMKAINTGWLHPSINQFNPEPAVDFDTVANEKKQHEVNVAISNSFGFGGH  451

Query  1540  NSVIVFGPFKP  1572
             NSV+ F  FKP
Sbjct  452   NSVVAFSAFKP  462



>emb|CAH67240.1| OSIGBa0140O07.8 [Oryza sativa Indica Group]
Length=442

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/413 (73%), Positives = 354/413 (86%), Gaps = 2/413 (0%)
 Frame = +1

Query  340   VVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDA  519
             VVITGMGLVSVFG++V+ FY  LL G SG+  IDRFDA  F  RFAGQI GF+SEGYID 
Sbjct  30    VVITGMGLVSVFGNEVDAFYERLLAGESGVGAIDRFDAGGFPTRFAGQIRGFSSEGYIDG  89

Query  520   KNDRRLDHSWRYCLVAGKKALNDANLGK--EVLNNMDKTRigavigsgfgglgvfgngvt  693
             KNDRRLD   RYC+V+GKKAL +A LGK  +    +DK R G ++G+G GGL VF +GV 
Sbjct  90    KNDRRLDDCLRYCIVSGKKALENAGLGKGSDGHTKLDKVRAGVLVGTGMGGLTVFSDGVQ  149

Query  694   tlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQ  873
              L++ GYKKI+PFFIPY+ITNMGSALLA++AG MGP YSISTACAT+NYCFY+AANHIR+
Sbjct  150   NLIEKGYKKISPFFIPYAITNMGSALLAMDAGFMGPNYSISTACATSNYCFYAAANHIRR  209

Query  874   GEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLV  1053
             GEAD+++AGGTEA I   G+GGF+ACRALSQRN +PE ASRPWDK+RDGFV+GEG GVLV
Sbjct  210   GEADVIVAGGTEAAIIPIGLGGFVACRALSQRNDDPETASRPWDKERDGFVMGEGAGVLV  269

Query  1054  MERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNY  1233
             ME L+HAMKR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCIT+SLEDAGV+PEEVNY
Sbjct  270   MESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCITQSLEDAGVAPEEVNY  329

Query  1234  INAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTG  1413
             INAHATST+AGD+ EV AIK+VFK+ S+IK+N TKS+IGH LGA+GGLEAIA IKAITTG
Sbjct  330   INAHATSTLAGDLAEVRAIKQVFKNPSDIKINSTKSMIGHCLGAAGGLEAIAAIKAITTG  389

Query  1414  WLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             W+HPTINQ+N EPEV  DTV N K+QH+VNVAISNSFGFGGHNSV+VF PFKP
Sbjct  390   WVHPTINQFNPEPEVDFDTVANEKQQHEVNVAISNSFGFGGHNSVVVFAPFKP  442



>emb|CAD40964.2| OSJNBa0027P08.14 [Oryza sativa Japonica Group]
Length=442

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/413 (73%), Positives = 354/413 (86%), Gaps = 2/413 (0%)
 Frame = +1

Query  340   VVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDA  519
             VVITGMGLVSVFG++V+ FY  LL G SG+  IDRFDA  F  RFAGQI GF+SEGYID 
Sbjct  30    VVITGMGLVSVFGNEVDAFYERLLAGESGVGAIDRFDAGGFPTRFAGQIRGFSSEGYIDG  89

Query  520   KNDRRLDHSWRYCLVAGKKALNDANLGK--EVLNNMDKTRigavigsgfgglgvfgngvt  693
             KNDRRLD   RYC+V+GKKAL +A LGK  +    +DK R G ++G+G GGL VF +GV 
Sbjct  90    KNDRRLDDCLRYCIVSGKKALENAGLGKGSDGHTKLDKVRAGVLVGTGMGGLTVFSDGVQ  149

Query  694   tlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQ  873
              L++ GYKKI+PFFIPY+ITNMGSALLA++AG MGP YSISTACAT+NYCFY+AANHIR+
Sbjct  150   NLIEKGYKKISPFFIPYAITNMGSALLAMDAGFMGPNYSISTACATSNYCFYAAANHIRR  209

Query  874   GEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLV  1053
             GEAD+++AGGTEA I   G+GGF+ACRALSQRN +PE ASRPWDK+RDGFV+GEG GVLV
Sbjct  210   GEADVIVAGGTEAAIIPIGLGGFVACRALSQRNDDPETASRPWDKERDGFVMGEGAGVLV  269

Query  1054  MERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNY  1233
             ME L+HAMKR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCIT+SLEDAGV+PEEVNY
Sbjct  270   MESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCITQSLEDAGVAPEEVNY  329

Query  1234  INAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTG  1413
             INAHATST+AGD+ EV AIK+VFK+ S+IK+N TKS+IGH LGA+GGLEAIA +KAITTG
Sbjct  330   INAHATSTLAGDLAEVRAIKQVFKNPSDIKINSTKSMIGHCLGAAGGLEAIAVVKAITTG  389

Query  1414  WLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             W+HPTINQ+N EPEV  DTV N K+QH+VNVAISNSFGFGGHNSV+VF PFKP
Sbjct  390   WVHPTINQFNPEPEVDFDTVANEKQQHEVNVAISNSFGFGGHNSVVVFAPFKP  442



>ref|XP_007025114.1| 3-ketoacyl-acyl carrier protein synthase I isoform 2 [Theobroma 
cacao]
 gb|EOY27736.1| 3-ketoacyl-acyl carrier protein synthase I isoform 2 [Theobroma 
cacao]
Length=537

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/446 (69%), Positives = 362/446 (81%), Gaps = 2/446 (0%)
 Frame = +1

Query  175   ASLLQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMI--SPAVSAPKRQSDPKKRVVI  348
             A  L+ S L P++     P          +  +R   +   SP VSAPKR+ DPKKRVVI
Sbjct  81    APSLRGSPLNPLQKPNPNPHFSNVSRLRPRPTKRFSSITASSPTVSAPKREKDPKKRVVI  140

Query  349   TGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKND  528
             TGMGLVSVFG+DV+ +Y+ LL G SGI  IDRFDAS F  RF GQI GFTS+GYID KND
Sbjct  141   TGMGLVSVFGNDVDAYYDKLLAGESGIGPIDRFDASKFPTRFGGQIRGFTSQGYIDGKND  200

Query  529   RRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQS  708
             RRLD   RYC+VAGKKAL DA+LG + L+ +DK R G ++G+G GGL VF +GV  L++ 
Sbjct  201   RRLDDCLRYCIVAGKKALEDADLGGDKLSKIDKERTGVLVGTGMGGLTVFSDGVQNLIEK  260

Query  709   GYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADI  888
             GY+KITPFFIPY+ITNM SALL IE G MGP YSISTACAT+NYCFY+AANHIR+GEA++
Sbjct  261   GYRKITPFFIPYAITNMASALLGIELGFMGPNYSISTACATSNYCFYAAANHIRRGEAEL  320

Query  889   MiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLD  1068
             M+AGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME L+
Sbjct  321   MLAGGTEAAIIPIGLGGFVACRALSQRNDDPQTASRPWDKDRDGFVMGEGSGVLVMESLE  380

Query  1069  HAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHA  1248
             HAMKRGA +IAEYLGGA  CDA+HMT+PR DGLGVSSCI +SLEDAGVSPEEVN+INAHA
Sbjct  381   HAMKRGAPIIAEYLGGAVNCDAYHMTDPRADGLGVSSCIERSLEDAGVSPEEVNHINAHA  440

Query  1249  TSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPT  1428
             TST+AGD+ E+NAIKKVFK+TS+IK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLHP+
Sbjct  441   TSTLAGDLAEINAIKKVFKNTSDIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLHPS  500

Query  1429  INQYNLEPEVTIDTVPNVKKQHQVNV  1506
             INQ+N EP V  DTV NVK+QH+VNV
Sbjct  501   INQFNPEPSVEFDTVANVKQQHEVNV  526



>ref|XP_010917434.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Elaeis guineensis]
Length=477

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/418 (72%), Positives = 348/418 (83%), Gaps = 2/418 (0%)
 Frame = +1

Query  325   DPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSE  504
             DP+KRVVITGMGLVSVFG+DV+ +Y  LLEG SGI  IDRFDAS    RFAGQI GF+SE
Sbjct  60    DPRKRVVITGMGLVSVFGNDVDVYYQKLLEGESGIGPIDRFDASKLPTRFAGQIRGFSSE  119

Query  505   GYIDAKNDRRLDHSWRYCLVAGKKALNDANLG--KEVLNNMDKTRigavigsgfgglgvf  678
             GYID KN RRLD   RYCLV+GK+AL  A LG   + L  +DK R G ++G+G GG+ V 
Sbjct  120   GYIDGKNGRRLDDCLRYCLVSGKRALESAGLGVGSKALGKVDKARAGVLVGTGMGGVTVL  179

Query  679   gngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAA  858
              +G+ +L +S YKK+TPF IPY+ITNMGSALLA++ G MG  YSISTACAT+NYCFY+AA
Sbjct  180   CDGIWSLTESNYKKVTPFSIPYAITNMGSALLAMDIGFMGANYSISTACATSNYCFYAAA  239

Query  859   NHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEG  1038
             NHIR+GEAD+MIAGGTEA I   GVGGF+ACRALSQRN +P  ASRPWDKDRDGFV+GEG
Sbjct  240   NHIRRGEADVMIAGGTEAPIIPMGVGGFVACRALSQRNDDPTTASRPWDKDRDGFVMGEG  299

Query  1039  CGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSP  1218
              GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT PR DGLGVSSCI KSLE AGV+P
Sbjct  300   AGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTCPRADGLGVSSCIQKSLEHAGVAP  359

Query  1219  EEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIK  1398
             EEVNYINAHATST AGD+ EVNAIK+VFK+ S++K+N TKS+IGH LGA+GGLEAIAT+K
Sbjct  360   EEVNYINAHATSTPAGDLAEVNAIKQVFKNPSDVKINATKSMIGHCLGAAGGLEAIATVK  419

Query  1399  AITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             AI TGWLHPTINQ+N EP V  DTV N K+QH+VNVAISNSFGFGGHNSV+VF PFKP
Sbjct  420   AIATGWLHPTINQFNPEPAVEFDTVANKKQQHEVNVAISNSFGFGGHNSVVVFAPFKP  477



>gb|EAZ30871.1| hypothetical protein OsJ_14945 [Oryza sativa Japonica Group]
Length=408

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/408 (73%), Positives = 349/408 (86%), Gaps = 2/408 (0%)
 Frame = +1

Query  355   MGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRR  534
             MGLVSVFG++V+ FY  LL G SG+  IDRFDA  F  RFAGQI GF+SEGYID KNDRR
Sbjct  1     MGLVSVFGNEVDAFYERLLAGESGVGAIDRFDAGGFPTRFAGQIRGFSSEGYIDGKNDRR  60

Query  535   LDHSWRYCLVAGKKALNDANLGK--EVLNNMDKTRigavigsgfgglgvfgngvttlvQS  708
             LD   RYC+V+GKKAL +A LGK  +    +DK R G ++G+G GGL VF +GV  L++ 
Sbjct  61    LDDCLRYCIVSGKKALENAGLGKGSDGHTKLDKVRAGVLVGTGMGGLTVFSDGVQNLIEK  120

Query  709   GYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADI  888
             GYKKI+PFFIPY+ITNMGSALLA++AG MGP YSISTACAT+NYCFY+AANHIR+GEAD+
Sbjct  121   GYKKISPFFIPYAITNMGSALLAMDAGFMGPNYSISTACATSNYCFYAAANHIRRGEADV  180

Query  889   MiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLD  1068
             ++AGGTEA I   G+GGF+ACRALSQRN +PE ASRPWDK+RDGFV+GEG GVLVME L+
Sbjct  181   IVAGGTEAAIIPIGLGGFVACRALSQRNDDPETASRPWDKERDGFVMGEGAGVLVMESLE  240

Query  1069  HAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHA  1248
             HAMKR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCIT+SLEDAGV+PEEVNYINAHA
Sbjct  241   HAMKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCITQSLEDAGVAPEEVNYINAHA  300

Query  1249  TSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPT  1428
             TST+AGD+ EV AIK+VFK+ S+IK+N TKS+IGH LGA+GGLEAIA +KAITTGW+HPT
Sbjct  301   TSTLAGDLAEVRAIKQVFKNPSDIKINSTKSMIGHCLGAAGGLEAIAVVKAITTGWVHPT  360

Query  1429  INQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             INQ+N EPEV  DTV N K+QH+VNVAISNSFGFGGHNSV+VF PFKP
Sbjct  361   INQFNPEPEVDFDTVANEKQQHEVNVAISNSFGFGGHNSVVVFAPFKP  408



>ref|XP_002964698.1| hypothetical protein SELMODRAFT_230451 [Selaginella moellendorffii]
 gb|EFJ33536.1| hypothetical protein SELMODRAFT_230451 [Selaginella moellendorffii]
Length=406

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/406 (73%), Positives = 343/406 (84%), Gaps = 0/406 (0%)
 Frame = +1

Query  355   MGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRR  534
             MGLVSVFGSD + +Y+ LLEG SG++ IDRFDAS F  +FA QI  F+++GYID KNDRR
Sbjct  1     MGLVSVFGSDTDKYYDKLLEGVSGVAAIDRFDASQFPTKFAAQIRDFSAKGYIDGKNDRR  60

Query  535   LDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGY  714
             LD   RY +V GKKAL  A LG E L+ +DK R+G ++GSG GGL VF +GV +L++ GY
Sbjct  61    LDDCLRYGIVGGKKALEHAGLGGENLDKVDKQRVGVLVGSGMGGLSVFSDGVQSLIERGY  120

Query  715   KKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMi  894
             +KITPFFIPYSITNM SA+LAIE GLMGP YSISTACAT+NYCFY+A N IR+GEADIMI
Sbjct  121   RKITPFFIPYSITNMASAMLAIELGLMGPNYSISTACATSNYCFYAAGNSIRRGEADIMI  180

Query  895   aggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHA  1074
             AGGTEA I   G+GGF+ACRALSQRN EP+ ASRPWDK R+GFV+GEG GVLVME L+HA
Sbjct  181   AGGTEAAIIPVGLGGFVACRALSQRNDEPQTASRPWDKGREGFVMGEGAGVLVMESLEHA  240

Query  1075  MKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATS  1254
              KRGA++ AEYLGGA TCDAHHMT+PR DGLGVS+CI KSLEDAGVSPEEVNYINAHATS
Sbjct  241   KKRGAHIFAEYLGGAVTCDAHHMTDPRADGLGVSTCIEKSLEDAGVSPEEVNYINAHATS  300

Query  1255  TVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTIN  1434
             TV GD+ E+NAIKKVF ++S+IK+N TKS+IGH LGA+GG+EAIA IKAITTGWLHPTIN
Sbjct  301   TVVGDLAEINAIKKVFSESSDIKINATKSMIGHCLGAAGGMEAIAVIKAITTGWLHPTIN  360

Query  1435  QYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             Q++ EP V  D V NVKKQH+VNVAISNSFGFGGHNSV+VF P+ P
Sbjct  361   QFDPEPSVNFDRVANVKKQHEVNVAISNSFGFGGHNSVVVFAPYNP  406



>gb|AGV54408.1| beta-ketoacyl-ACP synthetase I [Phaseolus vulgaris]
Length=467

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/463 (65%), Positives = 360/463 (78%), Gaps = 4/463 (1%)
 Frame = +1

Query  184   LQYSGLKPVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGL  363
             L+ S L+P+      P++ A +  AAK+   +    +P VSAP+RQ DPKKRVVITGMGL
Sbjct  9     LRASPLEPLRA----PNNAANRRTAAKRVFFVSATAAPKVSAPQRQKDPKKRVVITGMGL  64

Query  364   VSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDH  543
              SVFG+DVE +Y  LL G+SGI+ IDRFDAS F  RF GQI GF++EGYID KNDRRLD 
Sbjct  65    ASVFGNDVEGYYEKLLSGQSGITAIDRFDASKFPTRFGGQIRGFSAEGYIDGKNDRRLDD  124

Query  544   SWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKI  723
               RYC+VAGKKAL  A+L  + L  +DK R G ++GSG GGL VF +GV  L++ G++K 
Sbjct  125   CLRYCIVAGKKALEHADLAADNLTKLDKERAGVLVGSGMGGLTVFSDGVQALIEKGHRKN  184

Query  724   TPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiagg  903
             TPFFIPY+ITNMGSALL +  G MGP YSI T CAT+NYCFY+AANHIR+GEAD++IAG 
Sbjct  185   TPFFIPYAITNMGSALLGMNLGFMGPNYSIFTGCATSNYCFYAAANHIRRGEADLVIAGC  244

Query  904   teagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKR  1083
             TEA I   G+GGF+A    SQRN +P+ A RPWDK+R+GFV+GEG GVLV E L+  MKR
Sbjct  245   TEAAIMPIGLGGFVAAGTHSQRNDDPKTACRPWDKEREGFVMGEGAGVLVRESLERGMKR  304

Query  1084  GANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVA  1263
             GA +IAE LGGA  C A+HMT+PR+DGLGVSSCI  SLEDAGVSPEEVNYINAHATST+A
Sbjct  305   GAPIIAEDLGGAVNCGAYHMTDPRSDGLGVSSCIQSSLEDAGVSPEEVNYINAHATSTLA  364

Query  1264  GDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYN  1443
             GD+ E+ AIKKVFK T  IK+N TK +IGH LGA GGLEAIAT+KAITTGW HPTINQ+N
Sbjct  365   GDLAEIKAIKKVFKGTFGIKINATKFMIGHCLGAGGGLEAIATVKAITTGWGHPTINQFN  424

Query  1444  LEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
              EP V  DTV NVK++ +VNVAISNSFGFGGHNSV+ F  FKP
Sbjct  425   PEPAVDFDTVANVKREQEVNVAISNSFGFGGHNSVVAFFAFKP  467



>gb|AFW85456.1| hypothetical protein ZEAMMB73_016804 [Zea mays]
Length=481

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/401 (73%), Positives = 343/401 (86%), Gaps = 2/401 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             P+R++DPKKRVVITGMGLVSVFG+DV+ +Y+ LL G SGI  IDRFDAS F  RFAGQI 
Sbjct  39    PRRETDPKKRVVITGMGLVSVFGNDVDAYYDRLLAGESGIGPIDRFDASKFPTRFAGQIR  98

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTRigavigsgfg  663
             GF+SEGYID KNDRRLD   RYC+V+GKKAL  A +  G + +  +DKTR G ++G+G G
Sbjct  99    GFSSEGYIDGKNDRRLDDCLRYCIVSGKKALEAAGIAHGSKPMEKIDKTRAGVLVGTGMG  158

Query  664   glgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYC  843
             GL VF +GV  L++ GY+KITPFFIPY+ITNMGSALL ++ G MGP YSISTACAT+NYC
Sbjct  159   GLTVFSDGVQNLIEKGYRKITPFFIPYAITNMGSALLGMDIGFMGPNYSISTACATSNYC  218

Query  844   FYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGF  1023
             FY+AANHIR+GEADIMIAGGTEA I   GVGGF+ACRALSQRN +P+ ASRPWDKDRDGF
Sbjct  219   FYAAANHIRRGEADIMIAGGTEAAIIPIGVGGFVACRALSQRNDDPKTASRPWDKDRDGF  278

Query  1024  VIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLED  1203
             V+GEG GVLVME L+HA+KR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI +SLED
Sbjct  279   VMGEGAGVLVMESLEHAIKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIKQSLED  338

Query  1204  AGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEA  1383
             AGV+PEEVNYINAHATST+AGD+ EVNAIK+VFKD S IK+N TKS+IGH LGA+GGLEA
Sbjct  339   AGVAPEEVNYINAHATSTLAGDLAEVNAIKQVFKDPSGIKINATKSMIGHCLGAAGGLEA  398

Query  1384  IATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNV  1506
             IAT+KAITTGW+HP+INQ+N E  V  DTVPNVKKQH+VNV
Sbjct  399   IATVKAITTGWVHPSINQFNPEEAVEFDTVPNVKKQHEVNV  439



>gb|AAK58535.1| beta-ketoacyl-ACP synthetase I [Coriandrum sativum]
Length=456

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/443 (66%), Positives = 348/443 (79%), Gaps = 9/443 (2%)
 Frame = +1

Query  262   KKCRRI-----KCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSG  426
             K C  I     K  +    ++PKR+ DPKKRVV+TG+G+VSVFG+DV+T+Y+ LL G SG
Sbjct  17    KPCHHIPRPPRKLSVFATSASPKREKDPKKRVVVTGLGVVSVFGNDVDTYYDKLLAGESG  76

Query  427   ISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKE  606
             +  IDRFDAS+F  RFA QI  F+SEGYID+KNDRRLD+  RY +VAGKKAL +A LG++
Sbjct  77    VDFIDRFDASEFPTRFAAQIRAFSSEGYIDSKNDRRLDNCLRYNIVAGKKALENAGLGED  136

Query  607   VLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEA  786
             + + +DK R G ++GSG GG+  F +GV  L+  GYKKI+PFFIPY+ITNMGSALLAI+ 
Sbjct  137   MRSKIDKERAGVLVGSGMGGITAFCDGVENLITKGYKKISPFFIPYTITNMGSALLAIDL  196

Query  787   GLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQ  966
             G MGP YSI  ACAT+NY FY+AANHIR GEAD+M+AGG EA I   G+GGF +CRA+SQ
Sbjct  197   GFMGPNYSIVAACATSNYAFYAAANHIRSGEADLMLAGGAEAAIVPVGLGGFTSCRAMSQ  256

Query  967   RNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMT  1146
             RN  P+ ASRPWDKDRDG V+GEG GVLVME L HAMKRGA +IAEYLGGA TCDAHHMT
Sbjct  257   RNDNPKAASRPWDKDRDGLVMGEGAGVLVMESLVHAMKRGAPIIAEYLGGAVTCDAHHMT  316

Query  1147  EPRTDGLGVSSCITKSLEDAG-VSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIK  1323
             +PR DG GVS CI   L++AG VSPEEVNYINAHATST+AGD+ EV AIK+V     +IK
Sbjct  317   DPRPDGGGVSMCIQSGLQEAGVVSPEEVNYINAHATSTLAGDLKEVTAIKQVL---GQIK  373

Query  1324  MNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVN  1503
              N TKS+  H LGA+ GLEA+AT+KAI TGWLHPTINQ NLEPEV  DTV N K+QH+VN
Sbjct  374   ANATKSMNAHCLGAASGLEAVATVKAIATGWLHPTINQVNLEPEVDFDTVANKKQQHEVN  433

Query  1504  VAISNSFGFGGHNSVIVFGPFKP  1572
             V ISNSFGFGGHNSV+VF  F P
Sbjct  434   VGISNSFGFGGHNSVVVFSAFNP  456



>ref|XP_010239948.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic 
isoform X1 [Brachypodium distachyon]
Length=493

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/405 (70%), Positives = 339/405 (84%), Gaps = 2/405 (0%)
 Frame = +1

Query  298   AVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFA  477
             A  AP+R++DP+KRVVITG+GLVSVFGS+V+ FY+ LL G SG+  IDRFD   F  RFA
Sbjct  36    AAVAPQRETDPRKRVVITGLGLVSVFGSEVDGFYDRLLAGESGVRTIDRFDPGSFPTRFA  95

Query  478   GQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTRigavig  651
             GQI GF+SEGYIDAKNDRR+D   RYC+V+G+KAL  A L  G +    +D  R G ++G
Sbjct  96    GQIRGFSSEGYIDAKNDRRMDDCIRYCIVSGRKALESAGLDRGSDAHGKIDLGRAGVLVG  155

Query  652   sgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACAT  831
             +G GGL VF NGV  L++ GY+KI+PFFIPY+I+NMGSALLA + G MGP YSISTACAT
Sbjct  156   TGMGGLSVFSNGVQNLIEKGYRKISPFFIPYAISNMGSALLATDVGFMGPNYSISTACAT  215

Query  832   ANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKD  1011
             +NYCFY+AANHIR+GEAD+++AGGTEA I   G+GGF+ACRALSQRN +PE ASRPWDK+
Sbjct  216   SNYCFYAAANHIRRGEADVIVAGGTEAAIIPIGLGGFVACRALSQRNDDPETASRPWDKE  275

Query  1012  RDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITK  1191
             RDGFV+GEG GVLVME L+HA+KR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI K
Sbjct  276   RDGFVMGEGAGVLVMESLEHAIKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIAK  335

Query  1192  SLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASG  1371
             SLEDAGV+PEEVNYINAHATST+AGD+ EV AIK+VFK+ SE K+N TKS+IGH LGA+G
Sbjct  336   SLEDAGVAPEEVNYINAHATSTLAGDLAEVRAIKQVFKNLSETKINSTKSMIGHCLGAAG  395

Query  1372  GLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNV  1506
             GLEAIATIK+IT GW+HPTINQ+N EPEV  DTV N KKQH+VNV
Sbjct  396   GLEAIATIKSITNGWVHPTINQFNSEPEVDFDTVANEKKQHEVNV  440



>gb|KEH21263.1| 3-oxoacyl-[acyl-carrier] synthase I [Medicago truncatula]
Length=394

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/445 (65%), Positives = 333/445 (75%), Gaps = 51/445 (11%)
 Frame = +1

Query  238   VAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEG  417
             +A+   AA+KC+ IK M SP VSAPKR+ DPKKRVVITGMGLVSVFGSD++TFYN LLEG
Sbjct  1     MAFIRIAARKCKTIKAMASPTVSAPKREKDPKKRVVITGMGLVSVFGSDIDTFYNKLLEG  60

Query  418   RSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL  597
              SGISLIDR                                    Y LVAGK+AL D NL
Sbjct  61    ESGISLIDR------------------------------------YSLVAGKRALEDVNL  84

Query  598   GKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLA  777
             G EVLN           GS  GGL      +   VQ G KK++P  IPY+ITNMG ALLA
Sbjct  85    GYEVLNK----------GSAIGGLTNLTTNIQNHVQKGVKKVSPLAIPYTITNMGGALLA  134

Query  778   IEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRA  957
             IE GLMGP YSISTAC+TANYCF +A+NHIR+GE DIM+ GGTEA I   GVGG IACRA
Sbjct  135   IETGLMGPNYSISTACSTANYCFCAASNHIRRGEVDIMVVGGTEASIIPMGVGGLIACRA  194

Query  958   LSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAH  1137
             LSQRN EP++ASRPWDK RDG+VI +     +ME L+ A+KRGA ++AEYLGGA TCDAH
Sbjct  195   LSQRNEEPKKASRPWDKHRDGYVIDK-----IMESLESAVKRGARILAEYLGGAITCDAH  249

Query  1138  HMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSE  1317
             HMT P  DGLG SSCI+KSL+DAGVSP+EVNY+NAHATS++ GD+ EVNAIK+VFKDTSE
Sbjct  250   HMTNPMPDGLGQSSCISKSLQDAGVSPQEVNYVNAHATSSLIGDLAEVNAIKQVFKDTSE  309

Query  1318  IKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQ  1497
             +KMNGTKS+IGH +GA+G LEAI TIKAITTGWLHPTINQ NLE +VTIDTVPNVKK+H+
Sbjct  310   LKMNGTKSIIGHCIGAAGALEAITTIKAITTGWLHPTINQDNLEDDVTIDTVPNVKKKHE  369

Query  1498  VNVAISNSFGFGGHNSVIVFGPFKP  1572
             VNVAISNSFGFGGHNSV+VF PF P
Sbjct  370   VNVAISNSFGFGGHNSVVVFAPFMP  394



>gb|KHN12535.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Glycine 
soja]
Length=381

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/383 (77%), Positives = 331/383 (86%), Gaps = 7/383 (2%)
 Frame = +1

Query  286   MISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFS  465
             M SP V APKR+ DPKKRVVITGMGLVSVFGSDV+ FYN LLEG SGISLIDRF+AS+FS
Sbjct  1     MASPTVGAPKREKDPKKRVVITGMGLVSVFGSDVDAFYNKLLEGESGISLIDRFNASNFS  60

Query  466   VRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigav  645
             VRF GQI  F SEGYID KNDRRLD+ WRYC+VAGK+AL+DANLGK+VL+ MDKTRIG +
Sbjct  61    VRFGGQIRDFCSEGYIDGKNDRRLDNCWRYCIVAGKRALDDANLGKQVLDTMDKTRIGVL  120

Query  646   igsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTAC  825
             +GSG GG+  F NGV  LVQ GYKKITPFFIPYSITNMGSALLAI+ GLMGP YSISTAC
Sbjct  121   VGSGMGGITAFSNGVEALVQKGYKKITPFFIPYSITNMGSALLAIDTGLMGPNYSISTAC  180

Query  826   ATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWD  1005
             A ANYCF +AANHIR+GEADIM+ GGTEA I  +G+GGFIACRALS RN +P++ASRPWD
Sbjct  181   AMANYCFCAAANHIRKGEADIMVVGGTEAAIMPSGLGGFIACRALSHRNEDPKKASRPWD  240

Query  1006  KDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCI  1185
             KDRDGFV+GEG GVL         K+G+   +   GGA TCDAHHMT+PR DGLGVSSCI
Sbjct  241   KDRDGFVMGEGSGVL-------CNKKGSQNNSRIFGGAITCDAHHMTDPRVDGLGVSSCI  293

Query  1186  TKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGA  1365
             +KSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIKKVFKDTSE+KMN TKS+IGHGLGA
Sbjct  294   SKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKKVFKDTSELKMNATKSMIGHGLGA  353

Query  1366  SGGLEAIATIKAITTGWLHPTIN  1434
             +GGLEAIATIKAITTGWLHP+IN
Sbjct  354   AGGLEAIATIKAITTGWLHPSIN  376



>ref|XP_001416469.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94762.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=422

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/419 (68%), Positives = 332/419 (79%), Gaps = 1/419 (0%)
 Frame = +1

Query  316   RQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGF  495
             R++DPKKRVVITGMGL SVFG+D   +Y+ LL G+SG++ IDRFD SDF  +FA QI  F
Sbjct  3     RETDPKKRVVITGMGLCSVFGNDYTAYYDKLLSGQSGVAPIDRFDTSDFPTKFAAQIRNF  62

Query  496   TSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgv  675
              SEGYID KNDRRLD   RY LV+G KAL DA L    L N+DK R+G ++GSG GGL V
Sbjct  63    DSEGYIDKKNDRRLDDCLRYALVSGNKALEDAGLDAAALENLDKQRVGVLVGSGMGGLTV  122

Query  676   fgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSA  855
             F +GV  LV+ G KKITPFFIPY+ITNMG A+LAIE G MGP YSISTACATANY F++A
Sbjct  123   FQDGVKALVEKGPKKITPFFIPYAITNMGGAMLAIEKGFMGPNYSISTACATANYAFHAA  182

Query  856   ANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGE  1035
             ANHIR G+A+IMIAGG+EA I   G+GGF+ACRALSQ N +PE ASRPWDK RDGFV+GE
Sbjct  183   ANHIRNGDAEIMIAGGSEAPIIPVGLGGFVACRALSQNNDDPEGASRPWDKSRDGFVMGE  242

Query  1036  GCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVS  1215
             G GVL+ME L+ A KRGA + AEYLGGA TCDAHHMT+PR DGLGVS+CI  S++DAG+S
Sbjct  243   GAGVLIMETLESAKKRGARIHAEYLGGAITCDAHHMTDPRADGLGVSTCIELSIKDAGIS  302

Query  1216  PEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATI  1395
               ++NYINAHATST+ GD+ EVNA++KVFKD   +KMN TKS+IGH LGA+GG+EAIA I
Sbjct  303   VSDINYINAHATSTLVGDVAEVNAVRKVFKDVQNVKMNATKSMIGHCLGAAGGMEAIACI  362

Query  1396  KAITTGWLHPTINQYNLEPEVT-IDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
              AI TG LHPT+NQ  LEP V  IDT  N KK H V  AISNSFGFGGHNS ++F PF+
Sbjct  363   MAIKTGMLHPTLNQNELEPIVEGIDTCANEKKAHTVTAAISNSFGFGGHNSCVIFAPFE  421



>dbj|BAK03950.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=462

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/462 (63%), Positives = 357/462 (77%), Gaps = 10/462 (2%)
 Frame = +1

Query  217   MQNQ--PDSVA--YKAQAAKKCRRIKCMISPAV-SAPKRQSDPKKRVVITGMGLVSVFGS  381
             MQN   P++ A  + AQ  ++  R+    S +  SAP+R++DP+KRVVITGMG+VSVFG+
Sbjct  1     MQNLLLPNAAAAPWCAQPRRRPSRLPVRASASSPSAPRRETDPRKRVVITGMGVVSVFGN  60

Query  382   DVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCL  561
             DV+ +Y  LL G SG+  IDRFDAS F  RFA QI GF+SEGY+D K DRRLD    Y L
Sbjct  61    DVDAYYARLLAGESGVGAIDRFDASGFPTRFAAQIRGFSSEGYVDGKLDRRLDDCHHYAL  120

Query  562   VAGKKALNDANL--GKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFF  735
             VA KKAL  A L  G  V+  +DK R G ++GSG GG+  F +GV  LV  GY+KI+PF 
Sbjct  121   VASKKALESACLAAGSSVMEKVDKERAGVIVGSGMGGITAFSDGVENLVTKGYRKISPFC  180

Query  736   IPYSITNMGSALLAIEA--GLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggte  909
             IP++ITN  SA++A++A  G  GP YSISTACAT+N+CF+ AA+ IR G AD+M+AGGTE
Sbjct  181   IPHAITNTSSAMIAMDAAVGFRGPNYSISTACATSNHCFHGAADQIRLGRADVMVAGGTE  240

Query  910   agitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGA  1089
             A I   G+GGF+ACRALSQRN +P  ASRPWDKDRDGFV+GEG G+LVME L+HAM+R A
Sbjct  241   AAIIPIGLGGFVACRALSQRNDDPGTASRPWDKDRDGFVMGEGAGILVMESLEHAMRRNA  300

Query  1090  NVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGD  1269
              ++AEYLGGA   DA+HMT PR DG GVS CI +SLEDAGV+PEEVNYINAHATST AGD
Sbjct  301   PILAEYLGGAVNSDAYHMTNPRPDGCGVSMCIRRSLEDAGVTPEEVNYINAHATSTPAGD  360

Query  1270  IVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLE  1449
             + EVNA+K+VF+D S IK+N TKS+IGH LGA+GGLEAIATIKAITTGW+HPTINQ+N E
Sbjct  361   LAEVNALKQVFRDLSRIKLNATKSMIGHSLGAAGGLEAIATIKAITTGWVHPTINQFNPE  420

Query  1450  PEV-TIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             P V   DTV +VK+QH+V+V ISNSFGFGG NSV+VF  FKP
Sbjct  421   PAVDQFDTVHSVKQQHEVHVGISNSFGFGGQNSVVVFASFKP  462



>emb|CEG00998.1| Beta-ketoacyl synthase, active site [Ostreococcus tauri]
Length=454

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/425 (66%), Positives = 337/425 (79%), Gaps = 1/425 (0%)
 Frame = +1

Query  298   AVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFA  477
             A  A  R++DPKKRVVITGMGL SVFG++ +T+Y+ LL G+SG++ IDRFD +DF  +FA
Sbjct  29    ATVAMARETDPKKRVVITGMGLCSVFGNNYDTYYDKLLSGQSGVAPIDRFDTTDFPTKFA  88

Query  478   GQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsg  657
              QI  F SEGYID KNDRRLD   RY LV+G KAL DA L    + N+DK RIG ++GSG
Sbjct  89    AQIRAFDSEGYIDKKNDRRLDDCLRYALVSGNKALEDAGLDAAAIENIDKQRIGVLVGSG  148

Query  658   fgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATAN  837
              GGL VF +GV  LV+ G KKITPFFIPY+ITNMG A+LAIE G MGP YSISTACATAN
Sbjct  149   MGGLTVFQDGVKALVEKGPKKITPFFIPYAITNMGGAMLAIEKGFMGPNYSISTACATAN  208

Query  838   YCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRD  1017
             Y F++AA+HIR+G+ADIM+AGG+EA I   G+GGF+ACRALSQ N +PE ASRPWDK RD
Sbjct  209   YAFHAAASHIRKGDADIMVAGGSEAPIIPVGLGGFVACRALSQNNDDPEGASRPWDKSRD  268

Query  1018  GFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSL  1197
             GFV+GEG GVL+ME L+ A KRGA + AEYLGGA TCDAHHMT+PR DGLGVS+CI  S+
Sbjct  269   GFVMGEGAGVLIMESLESARKRGARIHAEYLGGAITCDAHHMTDPRADGLGVSTCIELSI  328

Query  1198  EDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGL  1377
             +DAG++  ++NYINAHATST+ GD+ EVNAI+KVFKD   +KMN TKS+IGH LGA+GG+
Sbjct  329   KDAGITVSDINYINAHATSTLVGDVAEVNAIRKVFKDVENVKMNATKSMIGHCLGAAGGM  388

Query  1378  EAIATIKAITTGWLHPTINQYNLEPEVT-IDTVPNVKKQHQVNVAISNSFGFGGHNSVIV  1554
             EAIA I AI TG LHPT+NQ   EP V  IDT  N KK H+V  AISNSFGFGGHNS ++
Sbjct  389   EAIACIMAIKTGSLHPTLNQQEQEPIVNGIDTCANEKKAHKVTAAISNSFGFGGHNSCVI  448

Query  1555  FGPFK  1569
             F PF+
Sbjct  449   FAPFE  453



>ref|XP_003074998.1| beta-ketoacyl-ACP synthase (ISS) [Ostreococcus tauri]
Length=453

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/425 (66%), Positives = 337/425 (79%), Gaps = 1/425 (0%)
 Frame = +1

Query  298   AVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFA  477
             A  A  R++DPKKRVVITGMGL SVFG++ +T+Y+ LL G+SG++ IDRFD +DF  +FA
Sbjct  28    ATVAMARETDPKKRVVITGMGLCSVFGNNYDTYYDKLLSGQSGVAPIDRFDTTDFPTKFA  87

Query  478   GQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsg  657
              QI  F SEGYID KNDRRLD   RY LV+G KAL DA L    + N+DK RIG ++GSG
Sbjct  88    AQIRAFDSEGYIDKKNDRRLDDCLRYALVSGNKALEDAGLDAAAIENIDKQRIGVLVGSG  147

Query  658   fgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATAN  837
              GGL VF +GV  LV+ G KKITPFFIPY+ITNMG A+LAIE G MGP YSISTACATAN
Sbjct  148   MGGLTVFQDGVKALVEKGPKKITPFFIPYAITNMGGAMLAIEKGFMGPNYSISTACATAN  207

Query  838   YCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRD  1017
             Y F++AA+HIR+G+ADIM+AGG+EA I   G+GGF+ACRALSQ N +PE ASRPWDK RD
Sbjct  208   YAFHAAASHIRKGDADIMVAGGSEAPIIPVGLGGFVACRALSQNNDDPEGASRPWDKSRD  267

Query  1018  GFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSL  1197
             GFV+GEG GVL+ME L+ A KRGA + AEYLGGA TCDAHHMT+PR DGLGVS+CI  S+
Sbjct  268   GFVMGEGAGVLIMESLESARKRGARIHAEYLGGAITCDAHHMTDPRADGLGVSTCIELSI  327

Query  1198  EDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGL  1377
             +DAG++  ++NYINAHATST+ GD+ EVNAI+KVFKD   +KMN TKS+IGH LGA+GG+
Sbjct  328   KDAGITVSDINYINAHATSTLVGDVAEVNAIRKVFKDVENVKMNATKSMIGHCLGAAGGM  387

Query  1378  EAIATIKAITTGWLHPTINQYNLEPEVT-IDTVPNVKKQHQVNVAISNSFGFGGHNSVIV  1554
             EAIA I AI TG LHPT+NQ   EP V  IDT  N KK H+V  AISNSFGFGGHNS ++
Sbjct  388   EAIACIMAIKTGSLHPTLNQQEQEPIVNGIDTCANEKKAHKVTAAISNSFGFGGHNSCVI  447

Query  1555  FGPFK  1569
             F PF+
Sbjct  448   FAPFE  452



>ref|XP_005643461.1| 3-oxoacyl-synth [Coccomyxa subellipsoidea C-169]
 gb|EIE18917.1| 3-oxoacyl-synth [Coccomyxa subellipsoidea C-169]
Length=473

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/421 (68%), Positives = 332/421 (79%), Gaps = 5/421 (1%)
 Frame = +1

Query  322   SDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTS  501
             +DPK RVVITG G+ SVFG+DV TFYN LLEG+SG+  I RFDAS+F   FA QI  F +
Sbjct  52    ADPKTRVVITGQGIASVFGNDVNTFYNTLLEGKSGVKPITRFDASEFPTTFAAQIENFDN  111

Query  502   EGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTRigavigsgfgglgv  675
             EG ID KN RR D    Y LV+ KKAL DA L  G E    +DKTR G +IGSG GGL V
Sbjct  112   EGLIDKKNARRYDDCISYSLVSAKKALADAGLEKGSEAFEKLDKTRAGILIGSGMGGLTV  171

Query  676   fgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSA  855
             F +GV  LV+ GYKKITPFFIPY+ITNMG AL+ IE G MGP YSISTACATANY F +A
Sbjct  172   FQDGVKNLVEKGYKKITPFFIPYAITNMGGALVGIETGFMGPNYSISTACATANYAFVAA  231

Query  856   ANHIRQGEADIMiaggteagitttgvggFIACRALSQ--RNHEPERASRPWDKDRDGFVI  1029
             ANHIR+GE DIM+AGG+EA I   G+GGF+ACRALS      EP++ASRPWDKDRDGFV+
Sbjct  232   ANHIRKGEVDIMLAGGSEAPIIPVGLGGFVACRALSSGGLTGEPQKASRPWDKDRDGFVM  291

Query  1030  GEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAG  1209
             GEG GVLVME L+HA  RGAN++AEY+GG  TCDA+HMT+PR DGLGVS+CI  +L+DAG
Sbjct  292   GEGAGVLVMESLEHAQARGANILAEYMGGGITCDAYHMTDPRADGLGVSTCIEIALKDAG  351

Query  1210  VSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIA  1389
             +  E+VNYINAHATST+ GD+ EV AIKKVF   + IK+NGTKSLIGH LGA+GGLEA+A
Sbjct  352   IEREQVNYINAHATSTLVGDVAEVKAIKKVFPSMAGIKVNGTKSLIGHCLGAAGGLEAVA  411

Query  1390  TIKAITTGWLHPTINQYNLEPEVT-IDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPF  1566
             TI+AI TGWLHPT+NQ NL  EV  IDTVPNVK QH+V  AISNSFGFGGHNSV+VF P+
Sbjct  412   TIQAIRTGWLHPTLNQDNLVDEVADIDTVPNVKSQHEVTAAISNSFGFGGHNSVVVFAPY  471

Query  1567  K  1569
             K
Sbjct  472   K  472



>ref|XP_005843858.1| hypothetical protein CHLNCDRAFT_27559 [Chlorella variabilis]
 gb|EFN51756.1| hypothetical protein CHLNCDRAFT_27559 [Chlorella variabilis]
Length=464

 Score =   528 bits (1359),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 282/423 (67%), Positives = 330/423 (78%), Gaps = 4/423 (1%)
 Frame = +1

Query  304   SAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQ  483
             SA KR++DPKKR+VITGMG+ S FG+DV+TFYN LLEG SG+  I RFDAS+F  +FA Q
Sbjct  38    SAAKRETDPKKRIVITGMGIASCFGNDVDTFYNQLLEGVSGVDYISRFDASEFPTKFAAQ  97

Query  484   IHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGK----EVLNNMDKTRigavig  651
             I  F     +D KN RR D    Y +VA KKAL  A L K    +    +DK+R+G ++G
Sbjct  98    IKDFDVGNLVDKKNARRYDDCLSYTMVASKKALQAAGLEKGANPDGYGALDKSRVGVLVG  157

Query  652   sgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACAT  831
             SG GGL VF +GV  LV+ GYKKITPFFIPY+ITNMG ALLAI+ G MGP YSISTACAT
Sbjct  158   SGMGGLSVFQDGVKALVEKGYKKITPFFIPYAITNMGGALLAIDQGFMGPNYSISTACAT  217

Query  832   ANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKD  1011
             ANY F SAANHIR G+AD+M+AGG+EA I   G+GGF+ACRALSQRN EP+RASRPWD D
Sbjct  218   ANYAFVSAANHIRNGDADVMVAGGSEAPIIPVGLGGFVACRALSQRNDEPQRASRPWDTD  277

Query  1012  RDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITK  1191
             RDGFV+GEG GVL+ME L+HA KRGA +IAEYLGGA TCDAHHMT+P  +GLGVS+CI  
Sbjct  278   RDGFVMGEGAGVLIMESLEHAQKRGATIIAEYLGGAVTCDAHHMTDPHPEGLGVSTCIEL  337

Query  1192  SLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASG  1371
             +L+D+G+  +EVNYINAHATST+ GD  EV AIKKVF D S IKMN TKS+IGH LGA+G
Sbjct  338   ALKDSGIERDEVNYINAHATSTLVGDKAEVKAIKKVFSDLSHIKMNATKSMIGHCLGAAG  397

Query  1372  GLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVI  1551
             G+EAIATI+AI TGW+HPTIN   +E    ID VPN K+QH VNV ISNSFGFGGHNSV 
Sbjct  398   GMEAIATIQAIQTGWVHPTINHSPIEEVDGIDVVPNKKQQHTVNVGISNSFGFGGHNSVC  457

Query  1552  VFG  1560
              FG
Sbjct  458   AFG  460



>ref|XP_002956811.1| hypothetical protein VOLCADRAFT_83790 [Volvox carteri f. nagariensis]
 gb|EFJ42114.1| hypothetical protein VOLCADRAFT_83790 [Volvox carteri f. nagariensis]
Length=461

 Score =   524 bits (1350),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 286/437 (65%), Positives = 337/437 (77%), Gaps = 11/437 (3%)
 Frame = +1

Query  292   SPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVR  471
             S  V A     DPK+R+VITG+G+ SV G+D +TFY+ LL+G SG+  IDRFDAS+F  R
Sbjct  24    SVTVRAAAATRDPKQRIVITGIGICSVHGNDPDTFYSKLLDGVSGVGAIDRFDASEFPTR  83

Query  472   FAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEV----LNNMDKTRig  639
             FA QI  F  EG ID KN RR D   +Y +V+GKKAL  A L KE        +D TR+G
Sbjct  84    FAAQIKNFDDEGMIDKKNARRYDDCLKYTMVSGKKALVMAGLEKERCAAGYQQVDPTRVG  143

Query  640   avigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSIST  819
              ++G+G GGL VF +GV+ LVQ GYKKI+PFFIPY+ITNMG ALLAI+ G MGP YSIST
Sbjct  144   VLVGTGMGGLTVFQDGVSNLVQKGYKKISPFFIPYAITNMGGALLAIDQGFMGPNYSIST  203

Query  820   ACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRP  999
             ACATANY F +AANHIR G+AD+M+AGG+EA I   G+GGF+ACRALS RN EP RASRP
Sbjct  204   ACATANYAFVAAANHIRNGDADVMVAGGSEAPIIPVGLGGFVACRALSTRNDEPVRASRP  263

Query  1000  WDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSS  1179
             WD DRDGFV+GEG GVLVME L+HA KRGA + AEYLGGA TCDAHHMT+PR+DGLGVS+
Sbjct  264   WDCDRDGFVMGEGAGVLVMESLEHATKRGAKIYAEYLGGAVTCDAHHMTDPRSDGLGVST  323

Query  1180  CITKSLEDAGVSPEEVNYINAHATSTVA------GDIVEVNAIKKVFKDTSEIKMNGTKS  1341
             CI  +L+DA +  E+VNYINAHAT  VA      GDI EV AIKKVF DT  +KMNGTKS
Sbjct  324   CIELALKDARIEREQVNYINAHATRHVATRRTLVGDIAEVKAIKKVFHDTKHLKMNGTKS  383

Query  1342  LIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVT-IDTVPNVKKQHQVNVAISN  1518
             +IGH LGA+ G+EAIAT+KAI TGW+HPT+NQ+NL  EV  IDTVPN KKQH +  AISN
Sbjct  384   MIGHCLGAAAGVEAIATLKAIETGWVHPTLNQHNLIEEVVGIDTVPNEKKQHNITAAISN  443

Query  1519  SFGFGGHNSVIVFGPFK  1569
             SFGFGGHNSV+VF PF+
Sbjct  444   SFGFGGHNSVVVFAPFR  460



>ref|XP_002961627.1| hypothetical protein SELMODRAFT_230041 [Selaginella moellendorffii]
 gb|EFJ36887.1| hypothetical protein SELMODRAFT_230041 [Selaginella moellendorffii]
Length=384

 Score =   521 bits (1342),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 277/406 (68%), Positives = 324/406 (80%), Gaps = 22/406 (5%)
 Frame = +1

Query  355   MGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRR  534
             MGLVSVFGSD + +Y+ LLEG SG++ IDRFDAS F  +FA QI  F+++GYID KNDRR
Sbjct  1     MGLVSVFGSDTDKYYDKLLEGVSGVAPIDRFDASQFPTKFAAQIRDFSAKGYIDGKNDRR  60

Query  535   LDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGY  714
             LD   RY +V GKKAL  A LG E L+ +DK R+G ++GSG GGL VF +GV +L++ GY
Sbjct  61    LDDCLRYGIVGGKKALEHAGLGGENLDKVDKQRVGVLVGSGMGGLSVFSDGVQSLIERGY  120

Query  715   KKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMi  894
             +KITPFFIPYSITNM SA+LAIE GLMGP YSISTACAT+NYCFY+A N IR+GEADIMI
Sbjct  121   RKITPFFIPYSITNMASAMLAIELGLMGPNYSISTACATSNYCFYAAGNSIRRGEADIMI  180

Query  895   aggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHA  1074
             AGGTEA I   G+GGF+ACRALSQRN EP+  SRPWDK R+GFV+GEG GVLV+      
Sbjct  181   AGGTEAAIIPVGLGGFVACRALSQRNDEPQTVSRPWDKGREGFVMGEGAGVLVL------  234

Query  1075  MKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATS  1254
                             TCDAHHMT+PR DGLGVS+CI KSLEDAG+SPEEVNYINAHATS
Sbjct  235   ----------------TCDAHHMTDPRADGLGVSTCIEKSLEDAGLSPEEVNYINAHATS  278

Query  1255  TVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTIN  1434
             TV GD+ E+NAIKKVF ++S+IK+N TKS+IGH LGA+GG+EAIA IKAITTGWLHPTIN
Sbjct  279   TVVGDLAEINAIKKVFSESSDIKINATKSMIGHCLGAAGGMEAIAVIKAITTGWLHPTIN  338

Query  1435  QYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             Q++ EP V  D V NVKKQH+VNVAISNSFGFGGHNSV+VF P+ P
Sbjct  339   QFDPEPSVNFDRVANVKKQHEVNVAISNSFGFGGHNSVVVFAPYNP  384



>ref|XP_004959862.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Setaria italica]
Length=463

 Score =   524 bits (1349),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 280/427 (66%), Positives = 334/427 (78%), Gaps = 6/427 (1%)
 Frame = +1

Query  307   APKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQI  486
             AP+R+SDPKKRVVITGMG+VSVFG+D   FY+ LL G SG   IDRFD + F+ RFA QI
Sbjct  36    APRRESDPKKRVVITGMGVVSVFGNDAGAFYDRLLAGESGAGHIDRFDPTGFTTRFAAQI  95

Query  487   HGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTRigavigsgf  660
              GF+SEG+ID+K+DRRLD   RY LVA +KAL  A L  G   +  +D  R G V+GSG 
Sbjct  96    RGFSSEGHIDSKSDRRLDDCQRYALVAARKALESAGLALGSRAMGKIDLERAGVVVGSGI  155

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGL--MGPTYSISTACATA  834
             GG+  F  GV +LV  G  KI+PF +P +I NM SAL+AI+AG+  +GP YS+STACAT 
Sbjct  156   GGVKEFSAGVESLVTKGPSKISPFSVPLAIPNMASALVAIDAGIGFLGPNYSVSTACATG  215

Query  835   NYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDR  1014
             N+C +SAA+ IR G AD+M+AGG EA I    +GGF A  ALS+RN +P  ASRPWD+DR
Sbjct  216   NHCIHSAADQIRLGRADVMLAGGVEAAIAPVALGGFAALGALSRRNADPATASRPWDRDR  275

Query  1015  DGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKS  1194
             DGFV+GEG GVLVME L+HAM+RGA V+AEYLGGA TCDAHH+T PR DG  VS CI +S
Sbjct  276   DGFVMGEGAGVLVMESLEHAMRRGAPVLAEYLGGAATCDAHHVTNPRPDGRAVSLCIKRS  335

Query  1195  LEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGG  1374
             LEDAGVSPEEVNYINAHATS+ AGD+ E  A+K+VFKDTS+IKMN TKS+IGH LGA+GG
Sbjct  336   LEDAGVSPEEVNYINAHATSSRAGDLAEAKALKQVFKDTSQIKMNATKSMIGHCLGAAGG  395

Query  1375  LEAIATIKAITTGWLHPTINQYNLEPEV-TIDTVPNVKKQHQVNVAISNSFGFGGHNSVI  1551
             LEAIATIKAITTGW+HPTINQ+N +P V   DTV +VK+ H+VNV ISNSFGFGGHNSV+
Sbjct  396   LEAIATIKAITTGWVHPTINQFNPDPAVDQFDTVRDVKQWHEVNVGISNSFGFGGHNSVV  455

Query  1552  VFG-PFK  1569
             VF  PFK
Sbjct  456   VFAPPFK  462



>ref|XP_004987019.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic-like 
[Setaria italica]
Length=454

 Score =   520 bits (1339),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 279/427 (65%), Positives = 333/427 (78%), Gaps = 6/427 (1%)
 Frame = +1

Query  307   APKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQI  486
             AP+R+SDPKKRVVITGMG+VSVFG+D   FY+ LL G SG   IDRFD + F+ RFA QI
Sbjct  27    APRRESDPKKRVVITGMGVVSVFGNDAGAFYDRLLAGESGAGHIDRFDPTGFTTRFAAQI  86

Query  487   HGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTRigavigsgf  660
              GF+SEG+ID+K+DRRLD   RY LVA +KAL  A L  G   +  +D  R G V+GSG 
Sbjct  87    RGFSSEGHIDSKSDRRLDDCQRYALVAARKALESAGLALGSRAMGKIDLERAGVVVGSGI  146

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGL--MGPTYSISTACATA  834
             GG+  F  GV +LV  G  KI+PF +P +I NM SAL+AI+AG+  +GP YS+STACAT 
Sbjct  147   GGVKEFSAGVESLVTKGPSKISPFSVPLAIPNMASALVAIDAGIGFLGPNYSVSTACATG  206

Query  835   NYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDR  1014
             N+C +SAA+ IR G AD+M+AGG EA I    +GGF A  ALS+RN +P  ASRPWD+DR
Sbjct  207   NHCIHSAADQIRLGRADVMLAGGVEAAIAPIALGGFAALGALSRRNADPATASRPWDRDR  266

Query  1015  DGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKS  1194
             DGFV+GEG GVLVME L+HAM+RGA V+AEYLGGA TCDAHH+T  R DG  VS CI +S
Sbjct  267   DGFVMGEGAGVLVMESLEHAMRRGAPVLAEYLGGAATCDAHHVTNQRPDGRAVSLCIKRS  326

Query  1195  LEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGG  1374
             LEDAGVSPEEVNYINAHATS+ AGD+ EV A+K+VFKDTS+IKMN TKS+IGH LGA+GG
Sbjct  327   LEDAGVSPEEVNYINAHATSSRAGDLAEVKALKQVFKDTSQIKMNATKSMIGHCLGAAGG  386

Query  1375  LEAIATIKAITTGWLHPTINQYNLEPEV-TIDTVPNVKKQHQVNVAISNSFGFGGHNSVI  1551
             LEAIATIKAITTGW+HPTINQ+N +P V   DTV +VK+ H+VNV ISNSFGFGGHNSV+
Sbjct  387   LEAIATIKAITTGWVHPTINQFNPDPAVDQFDTVRDVKQWHEVNVGISNSFGFGGHNSVV  446

Query  1552  VFG-PFK  1569
              F  PFK
Sbjct  447   AFAPPFK  453



>ref|XP_007509323.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19780.1| predicted protein [Bathycoccus prasinos]
Length=464

 Score =   519 bits (1336),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 281/423 (66%), Positives = 340/423 (80%), Gaps = 1/423 (0%)
 Frame = +1

Query  304   SAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQ  483
             SA  R++DPKKR+VITGMGL SVFG+D  +FY+ LLEG SG++ IDRFD SDF  +FA Q
Sbjct  41    SAMARETDPKKRIVITGMGLCSVFGNDYNSFYDKLLEGTSGVAPIDRFDTSDFPTKFAAQ  100

Query  484   IHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfg  663
             I  F +EGYID KNDRRLD   RY LV+G KAL DA L  E L  +DK R+G + GSG G
Sbjct  101   IRNFDNEGYIDKKNDRRLDDCLRYALVSGNKALEDAGLAGEALAKVDKQRVGVLCGSGMG  160

Query  664   glgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYC  843
             GL VF +GV  LV+ G KKITPFFIPY+ITNMG A+LAIE G MGP YSISTACATANY 
Sbjct  161   GLTVFQDGVKALVEKGPKKITPFFIPYAITNMGGAMLAIEKGFMGPNYSISTACATANYA  220

Query  844   FYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGF  1023
             +++AANHIR G+ADI+IAGG+EA I   G+GGF+ACRALSQ N +PE ASRPWDK RDGF
Sbjct  221   YHAAANHIRSGDADIIIAGGSEAPIIPVGLGGFVACRALSQNNIDPEGASRPWDKARDGF  280

Query  1024  VIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLED  1203
             V+GEG G+LVME L+HA+ RGA + AEY+GGA TCDAHHMT+PR DGLGVS+CI  +++D
Sbjct  281   VMGEGAGLLVMESLEHALARGARIHAEYMGGAITCDAHHMTDPRADGLGVSTCIELAIKD  340

Query  1204  AGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEA  1383
             AG+S E++NYINAHATST+ GD+ E+ A++KVFKD + +KMN TKS+IGH LGA+GG+EA
Sbjct  341   AGISVEDINYINAHATSTLVGDVAEIAAVRKVFKDMTNVKMNATKSMIGHCLGAAGGMEA  400

Query  1384  IATIKAITTGWLHPTINQYNLEPEVT-IDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFG  1560
             IA+I AI TGWLHP+INQ   E  VT IDT  NVKK+H+V  AISNSFGFGGHNS ++F 
Sbjct  401   IASIMAIKTGWLHPSINQNECEEVVTGIDTCANVKKEHKVTAAISNSFGFGGHNSCVIFA  460

Query  1561  PFK  1569
             P++
Sbjct  461   PYE  463



>gb|KFM25387.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Auxenochlorella 
protothecoides]
Length=446

 Score =   512 bits (1319),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 275/431 (64%), Positives = 329/431 (76%), Gaps = 5/431 (1%)
 Frame = +1

Query  292   SPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVR  471
             SP ++  +  +DPK RVVITG GL SVFG+DV+TFY+ LLEG+SG+  I RFD ++F  +
Sbjct  14    SPVLAVKRDAADPKSRVVITGQGLASVFGNDVDTFYDCLLEGKSGVDTITRFDITEFPTK  73

Query  472   FAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEV----LNNMDKTRig  639
             FAGQI  F  EG +D KN RR D +  Y +VA KKAL  A L KE        +DKTR+G
Sbjct  74    FAGQIKSFDVEGLVDKKNARRYDDALSYAMVASKKALRQAGLEKEACPEGYEKLDKTRVG  133

Query  640   avigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSIST  819
              ++GSG GGL VF +GV  LV+ G+KKITPFFIPY+ITNMGSAL+ I+ G MGP YSIST
Sbjct  134   VLVGSGMGGLTVFQDGVKALVEKGHKKITPFFIPYAITNMGSALVGIDQGFMGPNYSIST  193

Query  820   ACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRP  999
             ACATANY F +AANHIR G+AD+M+AGG+EA I   G+GGF+ACRALS RN EP RASRP
Sbjct  194   ACATANYAFVNAANHIRNGDADVMVAGGSEASIVPVGLGGFVACRALSTRNFEPWRASRP  253

Query  1000  WDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSS  1179
             WD  RDGFV+GEG GVLV+E L+HA  RGA ++AEYLGGA TCDAHHMT+P  +GLGVS+
Sbjct  254   WDAGRDGFVMGEGAGVLVLESLEHAQARGATILAEYLGGAFTCDAHHMTDPHPEGLGVST  313

Query  1180  CITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGL  1359
             CI  +L DAGV  +EVNYINAHATST+ GD  E+ A++ VF D    KMN TKS+IGH L
Sbjct  314   CIRLALADAGVDRDEVNYINAHATSTLVGDKAEIKAVRGVFGDMRGTKMNATKSMIGHCL  373

Query  1360  GASGGLEAIATIKAITTGWLHPTINQYNLEPEVT-IDTVPNVKKQHQVNVAISNSFGFGG  1536
             GA+GGLEAIATI+AI TGW+HPTIN  +  PEV  ID VPNVK +H V V ISNSFGFGG
Sbjct  374   GAAGGLEAIATIQAIRTGWVHPTINHDDPIPEVEGIDIVPNVKARHDVRVGISNSFGFGG  433

Query  1537  HNSVIVFGPFK  1569
             HNS + FGP+K
Sbjct  434   HNSAVAFGPYK  444



>ref|NP_001032018.1| beta-ketoacyl-[acyl carrier protein] synthase I  [Arabidopsis 
thaliana]
 gb|AED95364.1| beta-ketoacyl-[acyl carrier protein] synthase I [Arabidopsis 
thaliana]
Length=418

 Score =   511 bits (1315),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 267/424 (63%), Positives = 312/424 (74%), Gaps = 55/424 (13%)
 Frame = +1

Query  301   VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAG  480
             VSAPKR++DPKKRVVITGMGLVSVFG+DV+ +Y  LL G SGISLIDRFDAS F  RF G
Sbjct  50    VSAPKRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLSGESGISLIDRFDASKFPTRFGG  109

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgf  660
             QI GF+SEGYID KN+RRLD   +YC+VAGKKAL  ANLG + LN +DK + G ++G+G 
Sbjct  110   QIRGFSSEGYIDGKNERRLDDCLKYCIVAGKKALESANLGGDKLNTIDKRKAGVLVGTGM  169

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GGL VF  GV  L++ G+++I+PFFIPY+      A++ I  GL G              
Sbjct  170   GGLTVFSEGVQNLIEKGHRRISPFFIPYA------AIIPI--GLGG--------------  207

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
                                              F+ACRALSQRN +P+ ASRPWDK RDG
Sbjct  208   ---------------------------------FVACRALSQRNDDPQTASRPWDKARDG  234

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVLVME L+HAMKRGA ++AEYLGGA  CDAHHMT+PR DGLGVSSCI + LE
Sbjct  235   FVMGEGAGVLVMESLEHAMKRGAPIVAEYLGGAVNCDAHHMTDPRADGLGVSSCIERCLE  294

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
             DAGVSPEEVNYINAHATST+AGD+ E+NAIKKVFK TS IK+N TKS+IGH LGA+GGLE
Sbjct  295   DAGVSPEEVNYINAHATSTLAGDLAEINAIKKVFKSTSGIKINATKSMIGHCLGAAGGLE  354

Query  1381  AIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFG  1560
             AIAT+KAI TGWLHP+INQ+N E  V  DTVPN KKQH+V+VAISNSFGFGGHNSV+ F 
Sbjct  355   AIATVKAINTGWLHPSINQFNPEQAVDFDTVPNEKKQHEVDVAISNSFGFGGHNSVVAFS  414

Query  1561  PFKP  1572
              FKP
Sbjct  415   AFKP  418



>gb|AEF13159.1| beta-ketoacyl acyl carrier protein synthase [Haematococcus pluvialis]
Length=462

 Score =   512 bits (1319),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 277/450 (62%), Positives = 336/450 (75%), Gaps = 6/450 (1%)
 Frame = +1

Query  238   VAYKAQAAKKCRRIKCMISPAVSAPK-RQSDPKKRVVITGMGLVSVFGSDVETFYNNLLE  414
             +A  AQA    RR+  + +  + A   +Q DP +RVV+TG+GL SVFG+D + FY+ LL 
Sbjct  12    LAGPAQAEPGMRRVGRIGAARIQASALKQRDPSQRVVVTGIGLCSVFGNDPDEFYSKLLA  71

Query  415   GRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDAN  594
             G SG++ IDRFDA DF  RF  QI  F  E  IDAKN RR D   +Y +V+ KKAL  A 
Sbjct  72    GTSGVTTIDRFDAKDFPTRFGAQIRNFDDEKLIDAKNSRRYDDCLKYTVVSSKKALRMAG  131

Query  595   LGKEV----LNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMG  762
             L KE        +D TR+  ++G+G GGL VF +GVT LV  G++KI+PFFIPY+ITNMG
Sbjct  132   LEKEANAQGYGQLDLTRVRVLVGTGMGGLSVFQDGVTNLVTKGHRKISPFFIPYAITNMG  191

Query  763   SALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggF  942
              ALLAI+ G MGP YSISTACAT+NY F +AANHIRQG+ D+++AGG+EA I   G+GGF
Sbjct  192   GALLAIDQGFMGPNYSISTACATSNYAFVAAANHIRQGDCDVVVAGGSEAPIIPVGLGGF  251

Query  943   IACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGAT  1122
             +ACRALS RN  P +ASRPWD DRDGFV+GEG GVLV+E L+HA KRGA +IAEY+GGA 
Sbjct  252   VACRALSTRNDSPAKASRPWDVDRDGFVMGEGAGVLVLESLEHATKRGAKIIAEYMGGAV  311

Query  1123  TCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVF  1302
             TCDAHHMT+PR DGLGVS+CI  +L+D+ +  E+VNYINAHATST+ GD+ EV A++KVF
Sbjct  312   TCDAHHMTDPRADGLGVSTCIELALKDSRMEKEQVNYINAHATSTLVGDVAEVKAVRKVF  371

Query  1303  KDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVT-IDTVPN  1479
              D   IKMN TKS+IGH LGA+GGLEAIA IKAI TGW+HPT+NQ NL  EV  IDTV N
Sbjct  372   TDFGHIKMNSTKSMIGHCLGAAGGLEAIAVIKAIETGWVHPTLNQDNLVEEVAGIDTVAN  431

Query  1480  VKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
              KKQH +   ISNSFGFGGHNSV VF PFK
Sbjct  432   EKKQHAITAGISNSFGFGGHNSVCVFAPFK  461



>ref|XP_002463312.1| hypothetical protein SORBIDRAFT_02g041620 [Sorghum bicolor]
 gb|EER99833.1| hypothetical protein SORBIDRAFT_02g041620 [Sorghum bicolor]
Length=471

 Score =   511 bits (1315),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 268/431 (62%), Positives = 334/431 (77%), Gaps = 9/431 (2%)
 Frame = +1

Query  307   APKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQI  486
             AP+R+SDPKKRVVITGMG+VSVFG+DV  +Y+ LL G SG+ LIDRFDAS FS RFA QI
Sbjct  38    APRRESDPKKRVVITGMGVVSVFGNDVGAYYDRLLAGSSGVGLIDRFDASGFSTRFAAQI  97

Query  487   HGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVL----NNMDKTRigavi  648
              GF+ EG+ID ++DRRLD   RY LVA +KAL  A L  G   +      +DK R G V+
Sbjct  98    RGFSCEGHIDDESDRRLDDCQRYALVAARKALASAGLAIGSRAMYKRPPQIDKERAGVVV  157

Query  649   gsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGL--MGPTYSISTA  822
             GSG GG   F  G   L++ G + I+P  IP+++ N  SAL++I+AG+  +GP YSISTA
Sbjct  158   GSGIGGATAFTAGAEDLMRKGPRGISPCTIPFAMPNAASALVSIDAGIGFLGPNYSISTA  217

Query  823   CATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPW  1002
             CAT+N+C +SAA+ IR G AD+M+AGG EA +    +GGF A RALS+RN +P  ASRPW
Sbjct  218   CATSNHCLHSAADQIRLGRADVMVAGGAEAAVAPVCLGGFAALRALSRRNEDPGAASRPW  277

Query  1003  DKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSC  1182
             D+DRDGFV+GEG G+LVME L+HA +RGA + AEYLGG+ TCDAHH+ + R DG G ++C
Sbjct  278   DRDRDGFVLGEGAGILVMESLEHARRRGAPIFAEYLGGSATCDAHHLMDARPDGRGAAAC  337

Query  1183  ITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLG  1362
             I +SLEDAGV+PEEVNY+NAHATS++AGD+ EV A+K+VFK+ S+IKMN TKS+IGH LG
Sbjct  338   IRRSLEDAGVAPEEVNYVNAHATSSLAGDLAEVKALKQVFKNPSQIKMNATKSMIGHCLG  397

Query  1363  ASGGLEAIATIKAITTGWLHPTINQYNLEPEV-TIDTVPNVKKQHQVNVAISNSFGFGGH  1539
             A+GGLEAIAT+KAITTGW+HPTINQ+N EP V   DTV  VK+ H+V+V ISNSFGFGGH
Sbjct  398   AAGGLEAIATVKAITTGWVHPTINQFNPEPAVGEFDTVRGVKQLHEVHVGISNSFGFGGH  457

Query  1540  NSVIVFGPFKP  1572
             NSV VF PFKP
Sbjct  458   NSVAVFAPFKP  468



>gb|EAZ36138.1| hypothetical protein OsJ_20447 [Oryza sativa Japonica Group]
Length=426

 Score =   508 bits (1308),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 274/420 (65%), Positives = 325/420 (77%), Gaps = 41/420 (10%)
 Frame = +1

Query  319   QSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFT  498
             ++DP+KRVVITGMGLVSVFG+DV+ +Y+ LL G SGI  IDRFDAS+F  RFAGQI GF+
Sbjct  46    ETDPRKRVVITGMGLVSVFGNDVDAYYDRLLAGESGIGPIDRFDASNFPTRFAGQIRGFS  105

Query  499   SEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTRigavigsgfgglg  672
             SEGYID KNDRRLD   RYC+V+GKKAL  A L  G + ++ ++KTR G ++G+G GGL 
Sbjct  106   SEGYIDGKNDRRLDDCLRYCIVSGKKALESAGLALGSKSMDKIEKTRAGVLVGTGMGGLT  165

Query  673   vfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYS  852
             VF +GV  L++ G++KITP   P                                     
Sbjct  166   VFSDGVQNLIEKGHRKITPSSFP-------------------------------------  188

Query  853   AANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIG  1032
               NHIR+GEAD+MIAGGTEA I   GVGGF+ACRALSQRN +P+ ASRPWD+DRDGFV+G
Sbjct  189   --NHIRRGEADVMIAGGTEAAIIPIGVGGFVACRALSQRNDDPKTASRPWDQDRDGFVMG  246

Query  1033  EGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGV  1212
             EG GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI +SL DAGV
Sbjct  247   EGAGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIKQSLADAGV  306

Query  1213  SPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIAT  1392
             +PEEVNYINAHATST+AGD+ EVNAI++VFKD SEIK+N TKS+IGH LGA+GGLEAIAT
Sbjct  307   APEEVNYINAHATSTLAGDLAEVNAIRQVFKDPSEIKINATKSMIGHCLGAAGGLEAIAT  366

Query  1393  IKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             +KAITTGW+HP+INQ+N EP V  DTVPNVKKQH+VNV ISNSFGFGGHNSV+VF PFKP
Sbjct  367   VKAITTGWVHPSINQFNPEPAVEFDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAPFKP  426



>gb|EMT20383.1| 3-oxoacyl-(acyl-carrier-protein) synthase I, chloroplastic [Aegilops 
tauschii]
Length=450

 Score =   503 bits (1294),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 270/404 (67%), Positives = 320/404 (79%), Gaps = 5/404 (1%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             P+R++DP+KRVVITGMGLVSVFG+DV+ +Y  LL G SG+  IDRFDAS F  RFA QI 
Sbjct  37    PRRETDPRKRVVITGMGLVSVFGNDVDVYYERLLAGESGVGAIDRFDASGFPTRFAAQIR  96

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTRigavigsgfg  663
             GF+SEGY+D K DRRLD   RY LVA KKAL  A+L  G   +  +DK R G V+GSG G
Sbjct  97    GFSSEGYVDGKLDRRLDDIHRYALVATKKALECASLAPGTSAMRKVDKERAGVVVGSGMG  156

Query  664   glgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEA--GLMGPTYSISTACATAN  837
             G+    +G+ +LV  G  KI+P  IP++ITN+ SAL+ + A  G  GP YSISTACAT+N
Sbjct  157   GITALSDGIASLVTKGCGKISPLCIPHAITNISSALVTMGAADGFRGPNYSISTACATSN  216

Query  838   YCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRD  1017
             +CF SAA+ IR G AD+MIAGGTEAGI    +G F ACRALSQRN +P  ASRPWDKDRD
Sbjct  217   HCFNSAADQIRLGRADVMIAGGTEAGIIPIALGAFFACRALSQRNVDPGTASRPWDKDRD  276

Query  1018  GFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSL  1197
             GFV+GEG GVLVME L+HAM+RGA ++AEYLGGA   DAHHMT+PR DGLGVSSCI +SL
Sbjct  277   GFVLGEGAGVLVMESLEHAMRRGAPILAEYLGGAVNSDAHHMTDPRPDGLGVSSCIRRSL  336

Query  1198  EDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGL  1377
             E+AGV+ EEVNYINAHATST+AGD+ EV A+K+VFKD S+IK+N TKS+IGH LGA+G L
Sbjct  337   ENAGVALEEVNYINAHATSTLAGDLAEVKALKQVFKDPSQIKLNATKSMIGHSLGAAGAL  396

Query  1378  EAIATIKAITTGWLHPTINQYNLEPEV-TIDTVPNVKKQHQVNV  1506
             EAIATIKAITTGWLHPTINQ+N EP V   DTVPNVK+QH+VNV
Sbjct  397   EAIATIKAITTGWLHPTINQFNPEPAVDRFDTVPNVKQQHEVNV  440



>ref|XP_002504288.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65546.1| predicted protein [Micromonas sp. RCC299]
Length=514

 Score =   504 bits (1299),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 277/425 (65%), Positives = 336/425 (79%), Gaps = 2/425 (0%)
 Frame = +1

Query  301   VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAG  480
             V+A  R++DPKKRVVITGMGLVS FG+D + FY+ LL G SG+ +IDRFD +DF  +FA 
Sbjct  89    VTAMARETDPKKRVVITGMGLVSCFGNDYDKFYDKLLAGTSGVKMIDRFDTADFPTKFAA  148

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgf  660
             QI  F +EG +D KN RR+D   +Y LV+G KAL DA L  +V+  MDKT+IG + GSG 
Sbjct  149   QITDFDNEGIVDKKNARRMDDCLQYALVSGNKALMDAGLTDDVIEGMDKTKIGVLAGSGM  208

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GGL VF +GV  LV+ G KKITPFFIPY+ITNMG ALLAIE G MGP YSISTACATANY
Sbjct  209   GGLTVFQDGVKALVEKGPKKITPFFIPYAITNMGGALLAIEKGFMGPNYSISTACATANY  268

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
              F+SAANHIR+GEADIMIAGG EA I   G+GGF+ACRALS  N     ASRPWDK+RDG
Sbjct  269   AFHSAANHIRKGEADIMIAGGVEAPIIPVGLGGFVACRALSSNNDNFAAASRPWDKNRDG  328

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG G+LV+E L+ A+KRGA + AEYLGGA TCDAHHMT+PR DG GV  CI K++E
Sbjct  329   FVMGEGAGLLVLESLESALKRGARIHAEYLGGAITCDAHHMTDPRPDGSGVGLCIEKAVE  388

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFK-DTSEIKMNGTKSLIGHGLGASGGL  1377
             DAG+  +E+NYINAHATST+ GD+ E+NA+KK FK D + +KMNGTKS++GH LGA+ G+
Sbjct  389   DAGIDIKEINYINAHATSTLVGDVAEINAVKKAFKGDLTGVKMNGTKSMVGHCLGAAAGV  448

Query  1378  EAIATIKAITTGWLHPTINQYNLEPEVT-IDTVPNVKKQHQVNVAISNSFGFGGHNSVIV  1554
             EA+ATI AI TGW+HPTINQ +   EV  IDTVPNVK +H+++ AISNSFGFGGHNS  +
Sbjct  449   EAVATIMAIKTGWVHPTINQEDPIDEVEGIDTVPNVKAEHKISAAISNSFGFGGHNSCCI  508

Query  1555  FGPFK  1569
             FGP++
Sbjct  509   FGPYE  513



>ref|XP_003060067.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56019.1| predicted protein [Micromonas pusilla CCMP1545]
Length=467

 Score =   501 bits (1291),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 273/420 (65%), Positives = 330/420 (79%), Gaps = 2/420 (0%)
 Frame = +1

Query  316   RQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGF  495
             R++DPKKR+V+TGMGL SVFG+D + FY+ LL G SG+ +IDRFD  DF  +FA QI  F
Sbjct  47    RETDPKKRIVVTGMGLCSVFGNDYDKFYDKLLAGESGVDMIDRFDTEDFPTKFAAQIKDF  106

Query  496   TSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgv  675
              +EG+ID KN RR+D+  +Y LV+G KAL DA L  + +  +DKTR+G + GSG GGL V
Sbjct  107   DNEGFIDKKNARRMDNCLQYALVSGNKALLDAGLDDDAIEKLDKTRVGVLAGSGMGGLTV  166

Query  676   fgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSA  855
             F +GV  LV+ G KKITPFFIPY+ITNMG ALLAIE G MGP YSISTACATANYCF++A
Sbjct  167   FQDGVKALVEKGPKKITPFFIPYAITNMGGALLAIEKGFMGPNYSISTACATANYCFHAA  226

Query  856   ANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGE  1035
             ANHIR+GEADI++AGG EA I   G+GGF+ACRALS  N   + ASRPWDK RDGFV+GE
Sbjct  227   ANHIRKGEADIIVAGGVEAPIIPVGLGGFVACRALSSNNDNYKGASRPWDKGRDGFVMGE  286

Query  1036  GCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVS  1215
             G G+LV+E L+ A KRGA + AEYLGGA TCDAHHMT+PR DG GV  CITK++EDAG+ 
Sbjct  287   GAGLLVLESLESAQKRGARIHAEYLGGAVTCDAHHMTDPRPDGSGVGLCITKAVEDAGID  346

Query  1216  PEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSE-IKMNGTKSLIGHGLGASGGLEAIAT  1392
               E+NYINAHATST+ GD+ EVNA+KK F +  + +KMNGTKS++GH LGA+ G+EA+AT
Sbjct  347   ISEINYINAHATSTLVGDVAEVNAVKKAFNNKLDGVKMNGTKSMVGHCLGAAAGVEAVAT  406

Query  1393  IKAITTGWLHPTINQYNLEPEVT-IDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             I AI TGWLHPTINQ +   EV  IDT PNVK +H+V VAISNSFGFGGHNS  VF PF+
Sbjct  407   IMAIKTGWLHPTINQEDSIDEVADIDTCPNVKVEHEVKVAISNSFGFGGHNSSCVFAPFE  466



>ref|XP_006852603.1| hypothetical protein AMTR_s00021p00221400 [Amborella trichopoda]
 gb|ERN14070.1| hypothetical protein AMTR_s00021p00221400 [Amborella trichopoda]
Length=318

 Score =   471 bits (1212),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 259/318 (81%), Positives = 287/318 (90%), Gaps = 0/318 (0%)
 Frame = +1

Query  619   MDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMG  798
             MDK+RIG ++G+G GG+  F +GV  LVQ GYK+ITPFFIPYSITNM SALLAIE GLMG
Sbjct  1     MDKSRIGVLVGTGMGGITTFSDGVQALVQKGYKRITPFFIPYSITNMASALLAIETGLMG  60

Query  799   PTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHE  978
             P YSISTACATANYCF +AANHIR+GEADI++AGGTEA +  TG+ GFIACRALSQRN E
Sbjct  61    PNYSISTACATANYCFGAAANHIRRGEADIVVAGGTEAAVNPTGIAGFIACRALSQRNDE  120

Query  979   PERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRT  1158
             P RASRPWDK RDGFV+GEG GVLVME L+HA KRGAN+IAEYLGGA TCDAHHMT+PR+
Sbjct  121   PHRASRPWDKGRDGFVMGEGAGVLVMESLEHASKRGANIIAEYLGGAITCDAHHMTDPRS  180

Query  1159  DGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTK  1338
             DGLGVSSCI KSLEDAGVSPEEVNY+NAHATST+AGD+ EVNAIK VFKDTSEIKMNGTK
Sbjct  181   DGLGVSSCIRKSLEDAGVSPEEVNYVNAHATSTLAGDLAEVNAIKSVFKDTSEIKMNGTK  240

Query  1339  SLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISN  1518
             S+IGHGLGA+GGLEAIATIKAI TGWLHPTINQ + EPEVTIDTVPNVKK+H+V+VAISN
Sbjct  241   SMIGHGLGAAGGLEAIATIKAINTGWLHPTINQDDPEPEVTIDTVPNVKKKHEVHVAISN  300

Query  1519  SFGFGGHNSVIVFGPFKP  1572
             SFGFGGHNSV+VF PF P
Sbjct  301   SFGFGGHNSVVVFAPFLP  318



>gb|KHN28969.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Glycine 
soja]
Length=305

 Score =   467 bits (1201),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 227/290 (78%), Positives = 260/290 (90%), Gaps = 0/290 (0%)
 Frame = +1

Query  703   QSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEA  882
             + G++KITPFFIPY+ITNMGSALL I+ G MGP YSISTACAT+NYCFY+AANHIR+GEA
Sbjct  16    EKGHRKITPFFIPYAITNMGSALLGIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEA  75

Query  883   DIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMER  1062
             D+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDK+RDGFV+GEG GVLVME 
Sbjct  76    DLMIAGGTEAAIIPIGLGGFVACRALSQRNDDPKTASRPWDKERDGFVMGEGAGVLVMES  135

Query  1063  LDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINA  1242
             L+HAMKRGA +IAEYLGGA  CDA+HMT+PR+DGLGVS+CI  SLEDAGVSPEEVNYINA
Sbjct  136   LEHAMKRGAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSTCIQSSLEDAGVSPEEVNYINA  195

Query  1243  HATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLH  1422
             HATST+AGD+ E+NAIKKVFKDTS IK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLH
Sbjct  196   HATSTLAGDLAEINAIKKVFKDTSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLH  255

Query  1423  PTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             PTINQ+N EP V  DTV NVK+QH++NVAISNSFGFGGHNSV+ F  FKP
Sbjct  256   PTINQFNPEPAVDFDTVANVKQQHEINVAISNSFGFGGHNSVVAFSAFKP  305



>gb|EAZ00014.1| hypothetical protein OsI_22012 [Oryza sativa Indica Group]
Length=321

 Score =   467 bits (1201),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 226/290 (78%), Positives = 261/290 (90%), Gaps = 0/290 (0%)
 Frame = +1

Query  703   QSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEA  882
             + G++KITPFFIPY+ITNMGSALL ++ G MGP YSISTACAT+NYCFY+AANHIR+GEA
Sbjct  32    EKGHRKITPFFIPYAITNMGSALLGMDIGFMGPNYSISTACATSNYCFYAAANHIRRGEA  91

Query  883   DIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMER  1062
             D+MIAGGTEA I   GVGGF+ACRALSQRN +P+ ASRPWD+DRDGFV+GEG GVLVME 
Sbjct  92    DVMIAGGTEAAIIPIGVGGFVACRALSQRNDDPKTASRPWDQDRDGFVMGEGAGVLVMES  151

Query  1063  LDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINA  1242
             L+HAMKR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCI +SL DAGV+PEEVNYINA
Sbjct  152   LEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCIKQSLADAGVAPEEVNYINA  211

Query  1243  HATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLH  1422
             HATST+AGD+ EVNAI++VFKD SEIK+N TKS+IGH LGA+GGLEAIAT+KAITTGW+H
Sbjct  212   HATSTLAGDLAEVNAIRQVFKDPSEIKINATKSMIGHCLGAAGGLEAIATVKAITTGWVH  271

Query  1423  PTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             P+INQ+N EP V  DTVPNVKKQH+VNV ISNSFGFGGHNSV+VF PFKP
Sbjct  272   PSINQFNPEPAVEFDTVPNVKKQHEVNVGISNSFGFGGHNSVVVFAPFKP  321



>ref|NP_001152921.1| uncharacterized protein LOC100279917 [Zea mays]
 gb|ACL53726.1| unknown [Zea mays]
Length=321

 Score =   466 bits (1200),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 244/321 (76%), Positives = 282/321 (88%), Gaps = 0/321 (0%)
 Frame = +1

Query  610   LNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAG  789
             +  +DKTR G ++G+G GGL VF +GV  L++ GY+KITPFFIPY+ITNMGSALL ++ G
Sbjct  1     MEKIDKTRAGVLVGTGMGGLTVFSDGVQNLIEKGYRKITPFFIPYAITNMGSALLGMDIG  60

Query  790   LMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQR  969
              MGP YSISTACAT+NYCFY+AANHIR+GEADIMIAGGTEA I   GVGGF+ACRALSQR
Sbjct  61    FMGPNYSISTACATSNYCFYAAANHIRRGEADIMIAGGTEAAIIPIGVGGFVACRALSQR  120

Query  970   NHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTE  1149
             N +P+ ASRPWDKDRDGFV+GEG GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT+
Sbjct  121   NDDPKTASRPWDKDRDGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTD  180

Query  1150  PRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMN  1329
             PR+DGLGVSSCI +SL+DAGV+PEEVNYINAHATST+AGD+ EVNAIK+VFKD S IK+N
Sbjct  181   PRSDGLGVSSCIKQSLKDAGVAPEEVNYINAHATSTLAGDLAEVNAIKQVFKDPSGIKIN  240

Query  1330  GTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVA  1509
              TKS+IGH LGA+GGLEAIATIKAITTGW+HP+INQ+N E  V  DTVPNVKKQH+VNV 
Sbjct  241   ATKSMIGHCLGAAGGLEAIATIKAITTGWVHPSINQFNPEEAVEFDTVPNVKKQHEVNVG  300

Query  1510  ISNSFGFGGHNSVIVFGPFKP  1572
             ISNSFGFGGHNSV+VF PFKP
Sbjct  301   ISNSFGFGGHNSVVVFAPFKP  321



>ref|XP_005642959.1| 3-ketoacyl-ACP-synthase [Coccomyxa subellipsoidea C-169]
 gb|EIE18415.1| 3-ketoacyl-ACP-synthase [Coccomyxa subellipsoidea C-169]
Length=464

 Score =   469 bits (1208),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 251/442 (57%), Positives = 321/442 (73%), Gaps = 5/442 (1%)
 Frame = +1

Query  253   QAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGIS  432
             +  KK R  +  I  A  +      P++RVV+TGMG+VS  G D + FYNNLLEG+SG+S
Sbjct  24    KTTKKIRHAR-RIQAASCSQNGNGKPERRVVVTGMGVVSCLGHDPDEFYNNLLEGKSGVS  82

Query  433   LIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKE--  606
              ID F    +S RFAG+I GF   GY+  KN+RR+D+  +Y +VAGKKAL  A    E  
Sbjct  83    QIDSFSVEGYSTRFAGEIKGFQCNGYVTKKNERRMDNCIKYTMVAGKKALQSAGFSLEPG  142

Query  607   VLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEA  786
               + +D ++ G +IG+  GG+  F N V  L Q G++++ PF IP++ITNM  ALLA++ 
Sbjct  143   SFDGLDLSKCGILIGTAMGGMATFSNAVEDLTQKGFRRMNPFCIPFAITNMSGALLAMDV  202

Query  787   GLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQ  966
             G MGP YSISTACAT NYC  SAA+HIR G+AD+M+AGG +A I  +G+GGFIACRALSQ
Sbjct  203   GFMGPNYSISTACATGNYCILSAADHIRNGDADLMLAGGADAAIIPSGIGGFIACRALSQ  262

Query  967   RNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMT  1146
             RN +P RASRPWD++RDGFV+GEG GVLV+E L+HA  RGA ++AE+LGG+ TCDAHHMT
Sbjct  263   RNEDPARASRPWDRNRDGFVMGEGAGVLVLEELEHAKARGAPILAEFLGGSCTCDAHHMT  322

Query  1147  EPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKM  1326
             EP+  G GV  CI KSLE AG+SPEEVNY+NAHATST AGD+ E  AI+  F   S++++
Sbjct  323   EPQPQGKGVLLCIQKSLEQAGISPEEVNYVNAHATSTQAGDLAEYRAIRAAFPG-SDLRI  381

Query  1327  NGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQ-HQVN  1503
             NGTKS+IGH LGA+G +EAIATI+AI TG+LHPTIN  + E EV +  +    KQ   VN
Sbjct  382   NGTKSMIGHLLGAAGAVEAIATIQAIRTGYLHPTINVEDPEDEVDMGVIVGASKQAMDVN  441

Query  1504  VAISNSFGFGGHNSVIVFGPFK  1569
             VA+SNSFGFGGHNS I+F  +K
Sbjct  442   VALSNSFGFGGHNSSILFRAYK  463



>ref|WP_011175788.1| 3-oxoacyl-ACP synthase [Candidatus Protochlamydia amoebophila]
 ref|YP_008237.1| 3-oxoacyl-ACP synthase [Candidatus Protochlamydia amoebophila 
UWE25]
 emb|CAF23962.1| probable beta-ketoacyl-ACP synthetase [Candidatus Protochlamydia 
amoebophila UWE25]
 gb|KIC71331.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Candidatus 
Protochlamydia amoebophila]
Length=418

 Score =   468 bits (1203),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 249/414 (60%), Positives = 310/414 (75%), Gaps = 1/414 (0%)
 Frame = +1

Query  331   KKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGY  510
             KKR+VITGMG+VS FG+DV+ FY NLL G+SGI  I  F   D+  RFAG I  F +  Y
Sbjct  6     KKRIVITGMGIVSCFGNDVDAFYQNLLAGQSGIQPITEFPCEDYPTRFAGIIPNFEAGEY  65

Query  511   IDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngv  690
             +D K  RR+D S  Y +VAGKK+L  ANL +E L  + K R G +IGSG GG+ +F +GV
Sbjct  66    LDKKQARRVDKSIAYTMVAGKKSLESANLNEENLKRLQKERCGILIGSGMGGMTMFADGV  125

Query  691   ttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIR  870
              TLV+ G +K++PFF+P+ +TNM  ALL I+ G MGP YSISTACATAN    SAA HIR
Sbjct  126   QTLVEKGPRKVSPFFVPFILTNMCGALLGIDIGFMGPNYSISTACATANNSIISAAQHIR  185

Query  871   QGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVL  1050
              GEAD+M+ GG EA +   G+ GF AC+ALSQRN  P +ASRPWD+ RDGFV+GEG GVL
Sbjct  186   NGEADLMLCGGVEAAVMPMGLAGFCACKALSQRNENPAKASRPWDQGRDGFVLGEGAGVL  245

Query  1051  VMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVN  1230
             VME LDHA+ R A ++AEYLGG  +CDA+HMTEPR+DG GV+ CI ++L+DAG+ PEE+N
Sbjct  246   VMESLDHALAREAPILAEYLGGGLSCDAYHMTEPRSDGEGVALCIRRALQDAGIQPEEIN  305

Query  1231  YINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITT  1410
             YINAHATST AGD+ EVNA+KKVFK+ S IKMN TKS+IGH LGA+GG+EAIATIKAI  
Sbjct  306   YINAHATSTPAGDMAEVNALKKVFKNPSSIKMNATKSMIGHLLGAAGGVEAIATIKAILE  365

Query  1411  GWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
               +HPTIN  N EP +  D V +  ++  V  AISNSFGFGGHN+ ++F P++P
Sbjct  366   HQIHPTINLENPEPNLEFD-VSSEAQRFIVKRAISNSFGFGGHNASVIFAPYEP  418



>ref|WP_039359465.1| 3-oxoacyl-ACP synthase [Candidatus Protochlamydia amoebophila]
Length=415

 Score =   467 bits (1202),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 249/414 (60%), Positives = 310/414 (75%), Gaps = 1/414 (0%)
 Frame = +1

Query  331   KKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGY  510
             KKR+VITGMG+VS FG+DV+ FY NLL G+SGI  I  F   D+  RFAG I  F +  Y
Sbjct  3     KKRIVITGMGIVSCFGNDVDAFYQNLLAGQSGIQPITEFPCEDYPTRFAGIIPNFEAGEY  62

Query  511   IDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngv  690
             +D K  RR+D S  Y +VAGKK+L  ANL +E L  + K R G +IGSG GG+ +F +GV
Sbjct  63    LDKKQARRVDKSIAYTMVAGKKSLESANLNEENLKRLQKERCGILIGSGMGGMTMFADGV  122

Query  691   ttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIR  870
              TLV+ G +K++PFF+P+ +TNM  ALL I+ G MGP YSISTACATAN    SAA HIR
Sbjct  123   QTLVEKGPRKVSPFFVPFILTNMCGALLGIDIGFMGPNYSISTACATANNSIISAAQHIR  182

Query  871   QGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVL  1050
              GEAD+M+ GG EA +   G+ GF AC+ALSQRN  P +ASRPWD+ RDGFV+GEG GVL
Sbjct  183   NGEADLMLCGGVEAAVMPMGLAGFCACKALSQRNENPAKASRPWDQGRDGFVLGEGAGVL  242

Query  1051  VMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVN  1230
             VME LDHA+ R A ++AEYLGG  +CDA+HMTEPR+DG GV+ CI ++L+DAG+ PEE+N
Sbjct  243   VMESLDHALAREAPILAEYLGGGLSCDAYHMTEPRSDGEGVALCIRRALQDAGIQPEEIN  302

Query  1231  YINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITT  1410
             YINAHATST AGD+ EVNA+KKVFK+ S IKMN TKS+IGH LGA+GG+EAIATIKAI  
Sbjct  303   YINAHATSTPAGDMAEVNALKKVFKNPSSIKMNATKSMIGHLLGAAGGVEAIATIKAILE  362

Query  1411  GWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
               +HPTIN  N EP +  D V +  ++  V  AISNSFGFGGHN+ ++F P++P
Sbjct  363   HQIHPTINLENPEPNLEFD-VSSEAQRFIVKRAISNSFGFGGHNASVIFAPYEP  415



>gb|EMT32067.1| 3-oxoacyl-(acyl-carrier-protein) synthase I, chloroplastic [Aegilops 
tauschii]
Length=321

 Score =   456 bits (1173),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 221/290 (76%), Positives = 258/290 (89%), Gaps = 0/290 (0%)
 Frame = +1

Query  703   QSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEA  882
             + GY+KITPFFIPY+ITNMGSALL ++ G MGP YSISTACAT+NYCFY+AANHIR+GEA
Sbjct  32    EKGYRKITPFFIPYAITNMGSALLGMDIGFMGPNYSISTACATSNYCFYAAANHIRKGEA  91

Query  883   DIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMER  1062
             D+MIAGGTEA I   GVGGF+ACRALSQRN +P+ ASRPWDK+RDGFV+GEG GVLVME 
Sbjct  92    DVMIAGGTEAAIIPIGVGGFVACRALSQRNDDPKTASRPWDKERDGFVMGEGAGVLVMES  151

Query  1063  LDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINA  1242
             L+HAMKRGA ++AEYLGGA  CDA+HMT+PR DGLGVSSCI +SL+DAGV+PEEVNYINA
Sbjct  152   LEHAMKRGAPIVAEYLGGAVNCDAYHMTDPRADGLGVSSCIRQSLQDAGVAPEEVNYINA  211

Query  1243  HATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLH  1422
             HATST+AGD+ E+NAIK+VFKD S IK+N TKS+IGH LGA+GGLEAIATIKAI TG +H
Sbjct  212   HATSTLAGDLAEMNAIKQVFKDPSGIKVNATKSMIGHCLGAAGGLEAIATIKAINTGLVH  271

Query  1423  PTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             P+INQ++ EP V  DTVPNVK +H++NV ISNSFGFGGHNSV+VF PFKP
Sbjct  272   PSINQFDREPAVEFDTVPNVKVEHEINVGISNSFGFGGHNSVVVFAPFKP  321



>gb|EMS63377.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Triticum 
urartu]
Length=532

 Score =   464 bits (1194),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 246/344 (72%), Positives = 290/344 (84%), Gaps = 2/344 (1%)
 Frame = +1

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL--GKEVLNNMDKTRigavigs  654
             +I GF+SEGYID KNDRRLD   RYC+++GKKAL  A L  G +    +D  R G ++GS
Sbjct  50    EIRGFSSEGYIDGKNDRRLDDCIRYCILSGKKALESAGLSAGSDAHGKLDVGRAGILVGS  109

Query  655   gfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATA  834
             G GGL VF +GV  L++ GY+KI+PFFIPY+ITNMGSALLA++ G MGP YSISTACAT+
Sbjct  110   GMGGLSVFSDGVQNLIEKGYRKISPFFIPYAITNMGSALLAMDVGFMGPNYSISTACATS  169

Query  835   NYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDR  1014
             NYCFY+AANHIR+GEADI++AGGTEA I   G+GGF+ACRALSQRN +P  ASRPWDK+R
Sbjct  170   NYCFYAAANHIRRGEADIIVAGGTEAAIIPIGLGGFVACRALSQRNDDPITASRPWDKER  229

Query  1015  DGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKS  1194
             DGFV+GEG GVLVME L+HAMKR A +IAEYLGGA  CDA+HMT+PR+DGLGVSSCIT S
Sbjct  230   DGFVMGEGAGVLVMESLEHAMKRDAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSSCITMS  289

Query  1195  LEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGG  1374
             L DAGV+PEEVNYINAHATST+AGD+ EV AIK+VFK+ SEIK+N TKS+IGH LGA+GG
Sbjct  290   LRDAGVAPEEVNYINAHATSTLAGDLAEVRAIKQVFKNPSEIKINSTKSMIGHCLGAAGG  349

Query  1375  LEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNV  1506
             LEAIATIK+ITTGW+HPTINQ+  EPEV  DTV N KKQH+VNV
Sbjct  350   LEAIATIKSITTGWVHPTINQFKPEPEVDFDTVANEKKQHEVNV  393



>gb|KDD75769.1| beta-ketoacyl synthase [Helicosporidium sp. ATCC 50920]
Length=464

 Score =   461 bits (1187),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 243/419 (58%), Positives = 312/419 (74%), Gaps = 7/419 (2%)
 Frame = +1

Query  334   KRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQI-HGFTSEGY  510
             +RVVITGMG+VS FG+D + FY+ LLEG SG+  I+ FDAS FS RFA +I +GF     
Sbjct  45    RRVVITGMGVVSAFGNDADAFYDALLEGTSGVRTIESFDASKFSTRFAAEIGNGFKPGDC  104

Query  511   IDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVL----NNMDKTRigavigsgfgglgvf  678
             +D K  RRLD    Y +VA K+AL  A L K++       +D  R G ++ SG GGL V 
Sbjct  105   LDPKLARRLDRELSYAVVASKQALRMAGLDKQIQPEGHAKLDLGRAGVLVSSGMGGLTVL  164

Query  679   gngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAA  858
              + V  L + GY++++PFFIPY+ITNM +AL++I+ G MGP YS+STACAT+NY    AA
Sbjct  165   QDNVRKLFEEGYQRMSPFFIPYAITNMAAALVSIDQGFMGPCYSVSTACATSNYSMVMAA  224

Query  859   NHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEG  1038
             +HIRQG+AD+M+AGG EA +   G+GGF+ACRALSQRN  P+RASRPWD+DRDGFVIGEG
Sbjct  225   SHIRQGDADVMLAGGAEAPVLPVGLGGFVACRALSQRNDAPQRASRPWDRDRDGFVIGEG  284

Query  1039  CGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVS-  1215
              GVLVME L+HA++RGA ++AEYLGGA TCDAHH T+P  +GLGV  C+  +L++AGVS 
Sbjct  285   AGVLVMESLEHALERGAPILAEYLGGALTCDAHHTTQPHPEGLGVGRCVALALQNAGVSD  344

Query  1216  PEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATI  1395
             PE VNYINAHATST  GD+ EV A++        +KMN TKS+IGH LGA+GGLEA+A I
Sbjct  345   PEAVNYINAHATSTGQGDVAEVKALRAALPHLPSVKMNATKSMIGHALGAAGGLEAVAVI  404

Query  1396  KAITTGWLHPTINQYNLEPEVT-IDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             +A+ TGW+HPT+N  N+ PE   +  VP+ K++  VNVA+SNSFGFGGHNSV+VF P+K
Sbjct  405   QAMRTGWVHPTLNLDNVMPEAEGLQLVPHKKERLDVNVALSNSFGFGGHNSVVVFAPYK  463



>gb|EMS61772.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Triticum 
urartu]
Length=321

 Score =   455 bits (1171),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 221/290 (76%), Positives = 257/290 (89%), Gaps = 0/290 (0%)
 Frame = +1

Query  703   QSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEA  882
             + GY+KITPFFIPY+ITNMGSALL ++ G MGP YSISTACAT+NYCFY+AANHIR+GEA
Sbjct  32    EKGYRKITPFFIPYAITNMGSALLGMDIGFMGPNYSISTACATSNYCFYAAANHIRKGEA  91

Query  883   DIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMER  1062
             D+MIAGGTEA I   GVGGF+ACRALSQRN +P+ ASRPWDK+RDGFV+GEG GVLVME 
Sbjct  92    DVMIAGGTEAAIIPIGVGGFVACRALSQRNDDPKTASRPWDKERDGFVMGEGAGVLVMES  151

Query  1063  LDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINA  1242
             L+HAMKRGA ++AEYLGGA  CDA+HMT+PR DGLGVSSCI +SL+DAGV+PEEVNYINA
Sbjct  152   LEHAMKRGAPIVAEYLGGAVNCDAYHMTDPRADGLGVSSCIRQSLQDAGVAPEEVNYINA  211

Query  1243  HATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLH  1422
             HATST+AGD+ E+NAIK+VFKD S IK+N TKS+IGH LGA+GGLEAIATIKAI TG +H
Sbjct  212   HATSTLAGDLAEMNAIKQVFKDPSGIKVNATKSMIGHCLGAAGGLEAIATIKAINTGLVH  271

Query  1423  PTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             P+INQ+  EP V  DTVPNVK +H++NV ISNSFGFGGHNSV+VF PFKP
Sbjct  272   PSINQFEREPAVEFDTVPNVKVEHEINVGISNSFGFGGHNSVVVFAPFKP  321



>gb|KHN25892.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Glycine 
soja]
Length=664

 Score =   467 bits (1201),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 227/290 (78%), Positives = 260/290 (90%), Gaps = 0/290 (0%)
 Frame = +1

Query  703   QSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEA  882
             + G++KITPFFIPY+ITNMGSALL I+ G MGP YSISTACAT+NYCFY+AANHIR+GEA
Sbjct  375   EKGHRKITPFFIPYAITNMGSALLGIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEA  434

Query  883   DIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMER  1062
             D+MIAGGTEA I   G+GGF+ACRALSQRN +P+ ASRPWDKDRDGFV+GEG GVLVME 
Sbjct  435   DLMIAGGTEAAIIPIGLGGFVACRALSQRNDDPKTASRPWDKDRDGFVMGEGAGVLVMES  494

Query  1063  LDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINA  1242
             L+HAMKRGA +IAEYLGGA  CDA+HMT+PR+DGLGVS+CI  SLEDAGVSPEEVNYINA
Sbjct  495   LEHAMKRGAPIIAEYLGGAVNCDAYHMTDPRSDGLGVSTCIQSSLEDAGVSPEEVNYINA  554

Query  1243  HATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLH  1422
             HATST+AGD+ E+NAIKKVFKDTS IK+N TKS+IGH LGA+GGLEAIAT+KAITTGWLH
Sbjct  555   HATSTLAGDLAEINAIKKVFKDTSGIKINATKSMIGHCLGAAGGLEAIATVKAITTGWLH  614

Query  1423  PTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             PTINQ+N EP V  DTV NVK+QH++NVAISNSFGFGGHNSV+ F  F+P
Sbjct  615   PTINQFNPEPAVDFDTVANVKQQHEINVAISNSFGFGGHNSVVAFSAFRP  664



>ref|WP_013182436.1| 3-oxoacyl-ACP synthase [Waddlia chondrophila]
 ref|YP_003709731.1| 3-oxoacyl-ACP synthase [Waddlia chondrophila WSU 86-1044]
 gb|ADI38725.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Waddlia chondrophila 
WSU 86-1044]
 emb|CCB92260.1| 3-oxoacyl-[acyl-carrier-protein] synthase I,chloroplastic [Waddlia 
chondrophila 2032/99]
Length=416

 Score =   456 bits (1172),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 237/413 (57%), Positives = 309/413 (75%), Gaps = 1/413 (0%)
 Frame = +1

Query  331   KKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGY  510
             + R+V+TG+G+VS  G DV+ FY  LLEG+SGIS I  F   D +  FAG+I  F    Y
Sbjct  4     RTRIVVTGLGIVSCHGDDVDAFYRQLLEGKSGISTITGFSTEDLATTFAGEIRDFDPGKY  63

Query  511   IDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngv  690
             +D K  RR+D    Y +VAGKKAL  A L +E LN +D  + GA+IGSG GG+GVF +GV
Sbjct  64    MDKKQARRVDKCIAYTMVAGKKALESAGLNEEALNQVDLEKCGAIIGSGMGGMGVFVDGV  123

Query  691   ttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIR  870
              ++ + G K++TPFFIPY +TNMG AL A++ G MGP YSISTACAT N+   +AANHIR
Sbjct  124   QSMSKQGPKRVTPFFIPYILTNMGGALFAMDLGFMGPNYSISTACATGNHSIAAAANHIR  183

Query  871   QGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVL  1050
              G+AD+M+ GG EA I   G+ GF AC+ALS+RN  PE+ASRPWDK+RDGFV+GEG G+L
Sbjct  184   LGDADVMVCGGVEAAILPMGIAGFNACKALSKRNDAPEKASRPWDKERDGFVMGEGAGIL  243

Query  1051  VMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVN  1230
             V+ERL+HA++RGA+++AEY+G   +CDAHHMTEPR DG G++ C+  +L+DAG+ PEE++
Sbjct  244   VLERLEHALERGASIVAEYMGHGISCDAHHMTEPRPDGKGIAKCMLSALKDAGLKPEEIS  303

Query  1231  YINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITT  1410
             YINAHATST AGD+VEVNA+K+V  D S++ MN TKS+IGHGLGA+ G+EA+ T KAI  
Sbjct  304   YINAHATSTPAGDMVEVNALKQVIPDPSKVVMNATKSMIGHGLGAAAGIEAVVTAKAIQE  363

Query  1411  GWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             G +HPTIN  N EP++   T P    + +V VA+SNSFGFGGHNS I+ G +K
Sbjct  364   GKVHPTINLENPEPDLGFHT-PTEALEMEVKVAVSNSFGFGGHNSSIILGKYK  415



>ref|WP_006340838.1| 3-oxoacyl-ACP synthase [Parachlamydia acanthamoebae]
 ref|YP_004652153.1| 3-oxoacyl-ACP synthase [Parachlamydia acanthamoebae UV-7]
 gb|EFB41814.1| hypothetical protein pah_c022o107 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 emb|CCB86299.1| 3-oxoacyl-[acyl-carrier-protein] synthase I,chloroplastic [Parachlamydia 
acanthamoebae UV-7]
 gb|KIA77957.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Parachlamydia acanthamoebae]
Length=419

 Score =   456 bits (1172),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 238/416 (57%), Positives = 305/416 (73%), Gaps = 1/416 (0%)
 Frame = +1

Query  331   KKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGY  510
             KKR+V+TGMGLVS  G +V+ FY NLL+G+SGI+ I  F   ++  RFAG+I  F    Y
Sbjct  3     KKRIVVTGMGLVSCLGHEVDLFYQNLLQGKSGITPITGFPCEEYPTRFAGEIKDFDPGEY  62

Query  511   IDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngv  690
             ID K  RR+D    Y +VAGKKAL  A L  +    +DK R G +IGSG GG+  F +GV
Sbjct  63    IDKKQARRIDKFIAYTIVAGKKALELAGLNAQKQEELDKERCGIIIGSGMGGMKTFVDGV  122

Query  691   ttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIR  870
               L++ GYKK++PFF+PY ITNMG  LLA E G MGP YSISTACAT N+   +AA+HIR
Sbjct  123   QNLIEKGYKKVSPFFVPYIITNMGGGLLAKELGFMGPNYSISTACATGNHSIIAAASHIR  182

Query  871   QGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVL  1050
              GEADIM+ GG EA +   G+ GF AC+ALS+RN EP +ASRPWDKDRDGFV+GEG GVL
Sbjct  183   SGEADIMLCGGAEATVLPIGLAGFSACKALSERNDEPTKASRPWDKDRDGFVLGEGAGVL  242

Query  1051  VMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVN  1230
             V+E L+HA+ RGA + AEYLGG+++CDAHH+TEPR DG GV+ CI K+L+DAG+S E++N
Sbjct  243   VLESLEHALARGATIYAEYLGGSSSCDAHHITEPRPDGKGVALCIKKALKDAGISAEDIN  302

Query  1231  YINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITT  1410
             Y+NAHATST  GD+ EVNA+K +  + S++ MN TKS+IGH LGA+GG+EAI T+KAI  
Sbjct  303   YVNAHATSTPVGDMAEVNALKLILPNPSKVVMNATKSIIGHCLGAAGGVEAIVTVKAIAE  362

Query  1411  GWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP*T  1578
             G +HPT+N  N EP +    VP   ++  +  A+SNSFGFGGHN+ +VF P+ P T
Sbjct  363   GKVHPTLNLENPEPGLDFH-VPRTAEELTIKAALSNSFGFGGHNATLVFAPYNPNT  417



>ref|WP_032125192.1| 3-oxoacyl-ACP synthase [Chlamydia sp. 'Diamant']
Length=415

 Score =   454 bits (1169),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 246/413 (60%), Positives = 303/413 (73%), Gaps = 1/413 (0%)
 Frame = +1

Query  331   KKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGY  510
             K+R+VITGMG+VS FG+DV+ FY NLL G SGI  I  F   D+  R AG I  F +  Y
Sbjct  3     KRRIVITGMGIVSCFGNDVDIFYQNLLAGNSGIRTITDFPCEDYPTRIAGVIENFDTGEY  62

Query  511   IDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngv  690
             +D K  RR+D S  Y +VAGKK+L  A L  E L  + K R G +IGSG GG+ VF +GV
Sbjct  63    LDKKQARRVDKSIAYTMVAGKKSLESAQLSGEQLERLQKDRCGILIGSGMGGMSVFADGV  122

Query  691   ttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIR  870
              TLV+ G ++++PFF+PY +TNM  ALL ++ G MGP YSISTACATAN    SAANHIR
Sbjct  123   QTLVEKGQRRVSPFFVPYILTNMSGALLGMDIGFMGPNYSISTACATANNAIISAANHIR  182

Query  871   QGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVL  1050
              GEAD+M+ GG EA +   G+ GF AC+ALSQRN EP RASRPWD  RDGFV+GEG GVL
Sbjct  183   NGEADLMLCGGVEAAVIPMGLAGFCACKALSQRNDEPSRASRPWDLGRDGFVMGEGAGVL  242

Query  1051  VMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVN  1230
             VME L+HA+ RGA ++AEYLGG  +CDA+HMTEPR DG GV+ CI  +L+DAG+ PE++N
Sbjct  243   VMESLEHALARGAPILAEYLGGGLSCDAYHMTEPRADGAGVALCIRHALQDAGIKPEDIN  302

Query  1231  YINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITT  1410
             YINAHATST AGD+ EVNA+K+VFK+ + IKMN TKS+IGH LGA+GG+EAIATIKAI  
Sbjct  303   YINAHATSTPAGDMAEVNALKQVFKNPAAIKMNATKSMIGHLLGAAGGVEAIATIKAILD  362

Query  1411  GWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
               +HPTIN  N EP +  D V    ++ +V  AISNSFGFGGHN+ IV   +K
Sbjct  363   HRIHPTINLENPEPNLGFD-VSTKAEEFEVKHAISNSFGFGGHNASIVLARYK  414



>ref|XP_001773138.1| predicted protein [Physcomitrella patens]
 gb|EDQ61991.1| predicted protein [Physcomitrella patens]
Length=556

 Score =   454 bits (1168),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 240/442 (54%), Positives = 323/442 (73%), Gaps = 11/442 (2%)
 Frame = +1

Query  271   RRIKCMISPAVSAPKRQSDPKK---------RVVITGMGLVSVFGSDVETFYNNLLEGRS  423
             R +    S  V  P ++S+ KK         RVV+TGMGLVS  G D +TFY NLL G+S
Sbjct  109   RAVAGKASAVVVQPAKESEQKKNKKTATKQRRVVVTGMGLVSCHGHDPDTFYENLLTGKS  168

Query  424   GISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGK  603
             GI+ I+RFD  DF  RFAG+I  F++EG++  K  RR+D    Y L AGKKA+ DA++ +
Sbjct  169   GITEIERFDCRDFPTRFAGEIKSFSTEGWVAGKFARRMDRFMLYLLTAGKKAVMDADISE  228

Query  604   EVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIE  783
             EV+ ++DK++ G +IGS  GG+ VF + +  L  S Y+K+ PF +P++ TNMGSA+LA++
Sbjct  229   EVMKDLDKSKCGVLIGSAMGGMQVFNDAIEALRVS-YRKMNPFCVPFATTNMGSAMLAMD  287

Query  784   AGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALS  963
              G MGP YSISTACAT+N+C  SAANHI +GEAD+M++GG++A I   G+GGF+ACRALS
Sbjct  288   LGWMGPNYSISTACATSNFCMLSAANHIIRGEADVMLSGGSDAAIIPIGLGGFVACRALS  347

Query  964   QRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHM  1143
             QRN +P +ASRPWDK+RDGFV+GEG GVL++E L+HA  RGA + AE+LGG+ TCDA+HM
Sbjct  348   QRNDDPAKASRPWDKNRDGFVMGEGAGVLLLEELEHAKTRGAEIYAEFLGGSFTCDAYHM  407

Query  1144  TEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIK  1323
             TEP  +G GV  CI K+L  +GV+  +VNY+NAHATST AGD+ E  A+ K F    E+K
Sbjct  408   TEPHPEGAGVLLCIEKALAQSGVNKTDVNYVNAHATSTKAGDLQEYKALMKAFGGNPELK  467

Query  1324  MNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQH-QV  1500
             +N TKS++GH LGA+G +EAIATI+AI +GW+HPTIN  + E EV ++ +   +KQ   +
Sbjct  468   VNSTKSMVGHLLGAAGAVEAIATIQAIRSGWVHPTINLEDPESEVDMNVIVGDEKQRLDI  527

Query  1501  NVAISNSFGFGGHNSVIVFGPF  1566
              VA+SNSFGFGGHNS I+F P+
Sbjct  528   KVALSNSFGFGGHNSSILFAPY  549



>ref|WP_039384131.1| 3-oxoacyl-ACP synthase [Neochlamydia sp. TUME1]
 gb|KIC76638.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Neochlamydia sp. 
TUME1]
Length=415

 Score =   445 bits (1145),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 231/414 (56%), Positives = 305/414 (74%), Gaps = 1/414 (0%)
 Frame = +1

Query  331   KKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGY  510
             KKR+VITGMG+VS FG++V  +Y +LL+G+SG SLI  F   D+  R A  I  F S  Y
Sbjct  3     KKRIVITGMGIVSCFGNEVNDYYQSLLDGKSGASLITSFPCEDYPTRIAASIKNFESGDY  62

Query  511   IDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngv  690
             ID K  RR+D +  Y +VAGKKAL  + L  E++  ++K R G VIGSG GG+ V+  GV
Sbjct  63    IDKKQARRIDKNIAYAMVAGKKALEASQLSPEIIAKLNKERCGVVIGSGMGGMDVYCQGV  122

Query  691   ttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIR  870
              TL+Q G + ++PFF+PY +TNMG A+LA++ G MGP YS+STACAT N    +AANHIR
Sbjct  123   QTLIQKGQRWVSPFFVPYILTNMGGAMLAMDIGFMGPNYSVSTACATGNNAIIAAANHIR  182

Query  871   QGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVL  1050
             +GEAD+MI GG+EA I   G+ GF +C+ALSQRN EPE+ASRPWD+ RDGF++GEG G  
Sbjct  183   KGEADLMICGGSEAPIIPMGLSGFCSCKALSQRNDEPEKASRPWDRGRDGFLMGEGAGTF  242

Query  1051  VMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVN  1230
             ++E L+HA+ RGA +IAEYLGG  +CDA+H+TEPR D  GV+ C+  +L DAG+  EEV+
Sbjct  243   IIESLEHALARGAPIIAEYLGGGMSCDAYHITEPRADSEGVALCVRNALADAGIKAEEVD  302

Query  1231  YINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITT  1410
             YINAH TST AGD+ EV A+KKVFK+ S I MN TKS+IGH LGA+G +EA+ T KAI +
Sbjct  303   YINAHGTSTPAGDMAEVRALKKVFKEPSSIIMNSTKSMIGHCLGAAGAMEAVVTAKAIES  362

Query  1411  GWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             GW+HP+IN  + EP++    +P V ++  +N+AISN+FGFGGHN+ IV G + P
Sbjct  363   GWVHPSINLEDPEPDLEFH-IPTVAEKKDINIAISNTFGFGGHNATIVLGAYHP  415



>gb|EAZ42784.1| hypothetical protein OsJ_27364 [Oryza sativa Japonica Group]
Length=434

 Score =   446 bits (1146),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 237/429 (55%), Positives = 317/429 (74%), Gaps = 12/429 (3%)
 Frame = +1

Query  310   PKRQSDPKK------RVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVR  471
             P+R++  KK      RVVITGMG+V+  G D + FYNNLL+G SGIS I+RFD S F  R
Sbjct  9     PERRTVEKKPDVKQRRVVITGMGVVTPLGHDPDVFYNNLLDGVSGISEIERFDCSTFPTR  68

Query  472   FAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavig  651
              AG+I  F+++G++  K  RR+D    Y + AGKKAL    L +E+ N +DKTR G +IG
Sbjct  69    IAGEIKSFSTDGWVAPKLARRMDKFMLYLITAGKKALEHGGLTEELRNELDKTRCGVLIG  128

Query  652   sgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACAT  831
             S  GG+ VF + +  L  S YKK+ PF +P++ TNMGSA+LA++ G MGP YSISTACAT
Sbjct  129   SAMGGMKVFNDAIEALRVS-YKKMNPFCVPFATTNMGSAILAMDLGWMGPNYSISTACAT  187

Query  832   ANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKD  1011
             +N+C  +AANHIR+GEAD+M+ GG++A +   G+GGF+ACRALSQRN +P +ASRPWD D
Sbjct  188   SNFCILNAANHIRRGEADVMLCGGSDAPLIPIGLGGFVACRALSQRNSDPTKASRPWDVD  247

Query  1012  RDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITK  1191
             RDGFV+GEG GVLV+E L+HA +RGA + AE+LGG+ TCDA+HMTEP  +G G+  CI K
Sbjct  248   RDGFVMGEGAGVLVLEELEHAKQRGAKIYAEFLGGSFTCDAYHMTEPHPEGRGIILCIEK  307

Query  1192  SLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASG  1371
             +L D+GV+ EE+NY+NAHATST +GD+ E  AI + F    ++++N TKS+ GH +GA+G
Sbjct  308   ALADSGVAREEINYVNAHATSTQSGDLKEYEAIVRCFGQNPQLRVNSTKSMTGHLIGAAG  367

Query  1372  GLEAIATIKAITTGWLHPTINQYNLEPEVTIDT---VPNVKKQHQVNVAISNSFGFGGHN  1542
             G+EA+A I+AI TGW+HP +N  N  PE  +D    V + K++ +VNVA+SNSFGFGGHN
Sbjct  368   GIEAVAAIQAIRTGWVHPNLNLEN--PEKIVDVGVLVGSQKERCKVNVALSNSFGFGGHN  425

Query  1543  SVIVFGPFK  1569
             S I+F PFK
Sbjct  426   SSILFAPFK  434



>ref|XP_002986735.1| hypothetical protein SELMODRAFT_158169 [Selaginella moellendorffii]
 gb|EFJ12298.1| hypothetical protein SELMODRAFT_158169 [Selaginella moellendorffii]
Length=512

 Score =   447 bits (1151),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 233/413 (56%), Positives = 309/413 (75%), Gaps = 2/413 (0%)
 Frame = +1

Query  331   KKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGY  510
             K+RVV+TGMG+VS  G + + FY NLL G SGI+ I+ FD  DF  R AG+I  F+ +G+
Sbjct  97    KRRVVVTGMGVVSCLGHEPDAFYENLLRGTSGITEIENFDCKDFPTRIAGEIKDFSPDGW  156

Query  511   IDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngv  690
             +  K  +R+D    Y L AGKKA+ DA + ++V++ +DKT+ G +IGS  GG+ VF + +
Sbjct  157   VAPKFCKRMDKFMLYLLTAGKKAVADAGMTRDVIDQLDKTKCGVLIGSAMGGMQVFSDAI  216

Query  691   ttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIR  870
               L  S Y+K+ PF +P++ TNMGSA+LA++ G MGP YSISTACAT+NYC  SAANHI 
Sbjct  217   EALRVS-YRKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNYCMLSAANHIV  275

Query  871   QGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVL  1050
             +GEAD+M+AGG++A I   G+GGF+ACRALSQRN+EP RASRPWD+ RDGFV+GEG GVL
Sbjct  276   RGEADVMLAGGSDAAIIPIGLGGFVACRALSQRNNEPSRASRPWDEGRDGFVMGEGAGVL  335

Query  1051  VMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVN  1230
             V+E L+HA +RGA + AE+LGG++TCDA+HMTEP  +G G+  CI K+L  AGV  ++VN
Sbjct  336   VLEELEHAKRRGAEIYAEFLGGSSTCDAYHMTEPHPEGAGILLCIEKALAQAGVDRQDVN  395

Query  1231  YINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITT  1410
             Y+NAHATST AGD+ E  AI + F   SEIK+N TKS+ GH LGA+GG+EAIATI+AI +
Sbjct  396   YVNAHATSTQAGDVQEYKAIMRCFGSNSEIKVNSTKSMTGHLLGAAGGVEAIATIQAIRS  455

Query  1411  GWLHPTINQYNLEPEVTIDTVPNVKKQH-QVNVAISNSFGFGGHNSVIVFGPF  1566
             GW+HPTIN    E +V ++ +    KQ   V VA+SNSFGFGGHNS ++F P+
Sbjct  456   GWVHPTINIDTPEKDVNMEVIVGANKQKLDVKVALSNSFGFGGHNSSVIFAPY  508



>ref|XP_002516228.1| 46 kDa ketoavyl-ACP synthase [Ricinus communis]
 gb|EEF46230.1| 46 kDa ketoavyl-ACP synthase [Ricinus communis]
Length=554

 Score =   449 bits (1154),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 237/426 (56%), Positives = 317/426 (74%), Gaps = 6/426 (1%)
 Frame = +1

Query  301   VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAG  480
             V+  K+    ++RVV+TGMG+VS  G D++ +YNNLL+G SGIS ID FD + F  R AG
Sbjct  132   VATNKKPLMKQRRVVVTGMGVVSPLGHDIDVYYNNLLDGSSGISQIDSFDCAQFPTRIAG  191

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgf  660
             +I  F+++G++  K  +R+D    Y L AGKKAL D  + +++++ +DK R G +IGS  
Sbjct  192   EIKSFSTDGWVAPKLSKRMDKFMLYMLTAGKKALADGGITEDMMDELDKARCGVLIGSAM  251

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GG+ VF + +  L  S Y+K+ PF +P++ TNMGSA+LA++ G MGP YSISTACAT+N+
Sbjct  252   GGMKVFNDAIEALRIS-YRKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNF  310

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
             C  +AANHI +GEADIM+ GG++A I   G+GGF+ACRALSQRN +P +ASRPWD +RDG
Sbjct  311   CILNAANHIIRGEADIMLCGGSDAAIIPIGLGGFVACRALSQRNDDPTKASRPWDMNRDG  370

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVL++E L+HA KRGAN+ AE+LGG+ TCDA+HMTEPR DG+GV  CI K+L 
Sbjct  371   FVMGEGAGVLLLEELEHAKKRGANIYAEFLGGSFTCDAYHMTEPRPDGVGVILCIEKALA  430

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
              +GVS EEVNYINAHATST AGD+ E  A+ + F    ++++N TKS+IGH LGA+G +E
Sbjct  431   RSGVSKEEVNYINAHATSTPAGDLKEYEALMRCFSQNPDLRVNSTKSMIGHLLGAAGAVE  490

Query  1381  AIATIKAITTGWLHPTINQYNLEPEVTIDT---VPNVKKQHQVNVAISNSFGFGGHNSVI  1551
             AIATI+AI TGW+HP IN  N  PE  +DT   V   K++  + VA+SNSFGFGGHNS I
Sbjct  491   AIATIQAIRTGWVHPNINLEN--PEEGVDTKVLVGPKKERLDIKVALSNSFGFGGHNSSI  548

Query  1552  VFGPFK  1569
             +F P+K
Sbjct  549   IFAPYK  554



>gb|AAA33872.1| chloroplast beta-ketoacyl-ACP synthase precursor [Ricinus communis]
 gb|ABR01158.1| plastid 3-keto-acyl-ACP synthase II [Ricinus communis]
Length=535

 Score =   448 bits (1152),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 237/426 (56%), Positives = 317/426 (74%), Gaps = 6/426 (1%)
 Frame = +1

Query  301   VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAG  480
             V+  K+    ++RVV+TGMG+VS  G D++ +YNNLL+G SGIS ID FD + F  R AG
Sbjct  113   VATNKKPLMKQRRVVVTGMGVVSPLGHDIDVYYNNLLDGSSGISQIDSFDCAQFPTRIAG  172

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgf  660
             +I  F+++G++  K  +R+D    Y L AGKKAL D  + +++++ +DK R G +IGS  
Sbjct  173   EIKSFSTDGWVAPKLSKRMDKFMLYMLTAGKKALADGGITEDMMDELDKARCGVLIGSAM  232

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GG+ VF + +  L  S Y+K+ PF +P++ TNMGSA+LA++ G MGP YSISTACAT+N+
Sbjct  233   GGMKVFNDAIEALRIS-YRKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNF  291

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
             C  +AANHI +GEADIM+ GG++A I   G+GGF+ACRALSQRN +P +ASRPWD +RDG
Sbjct  292   CILNAANHIIRGEADIMLCGGSDAAIIPIGLGGFVACRALSQRNDDPTKASRPWDMNRDG  351

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVL++E L+HA KRGAN+ AE+LGG+ TCDA+HMTEPR DG+GV  CI K+L 
Sbjct  352   FVMGEGAGVLLLEELEHAKKRGANIYAEFLGGSFTCDAYHMTEPRPDGVGVILCIEKALA  411

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
              +GVS EEVNYINAHATST AGD+ E  A+ + F    ++++N TKS+IGH LGA+G +E
Sbjct  412   RSGVSKEEVNYINAHATSTPAGDLKEYEALMRCFSQNPDLRVNSTKSMIGHLLGAAGAVE  471

Query  1381  AIATIKAITTGWLHPTINQYNLEPEVTIDT---VPNVKKQHQVNVAISNSFGFGGHNSVI  1551
             AIATI+AI TGW+HP IN  N  PE  +DT   V   K++  + VA+SNSFGFGGHNS I
Sbjct  472   AIATIQAIRTGWVHPNINLEN--PEEGVDTKVLVGPKKERLDIKVALSNSFGFGGHNSSI  529

Query  1552  VFGPFK  1569
             +F P+K
Sbjct  530   IFAPYK  535



>gb|EAZ04708.1| hypothetical protein OsI_26869 [Oryza sativa Indica Group]
Length=507

 Score =   446 bits (1148),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 237/429 (55%), Positives = 317/429 (74%), Gaps = 12/429 (3%)
 Frame = +1

Query  310   PKRQSDPKK------RVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVR  471
             P+R++  KK      RVVITGMG+V+  G D + FYNNLL+G SGIS I+RFD S F  R
Sbjct  82    PERRTVEKKPDVKQRRVVITGMGVVTPLGHDPDVFYNNLLDGVSGISEIERFDCSTFPTR  141

Query  472   FAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavig  651
              AG+I  F+++G++  K  RR+D    Y + AGKKAL    L +E+ N +DKTR G +IG
Sbjct  142   IAGEIKSFSTDGWVAPKLARRMDKFMLYLITAGKKALEHGGLTEELRNELDKTRCGVLIG  201

Query  652   sgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACAT  831
             S  GG+ VF + +  L  S YKK+ PF +P++ TNMGSA+LA++ G MGP YSISTACAT
Sbjct  202   SAMGGMKVFNDAIEALRVS-YKKMNPFCVPFATTNMGSAILAMDLGWMGPNYSISTACAT  260

Query  832   ANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKD  1011
             +N+C  +AANHIR+GEAD+M+ GG++A +   G+GGF+ACRALSQRN +P +ASRPWD D
Sbjct  261   SNFCILNAANHIRRGEADVMLCGGSDAPLIPIGLGGFVACRALSQRNSDPTKASRPWDVD  320

Query  1012  RDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITK  1191
             RDGFV+GEG GVLV+E L+HA +RGA + AE+LGG+ TCDA+HMTEP  +G G+  CI K
Sbjct  321   RDGFVMGEGAGVLVLEELEHAKQRGAKIYAEFLGGSFTCDAYHMTEPHPEGRGIILCIEK  380

Query  1192  SLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASG  1371
             +L D+GV+ EE+NY+NAHATST +GD+ E  AI + F    ++++N TKS+ GH +GA+G
Sbjct  381   ALADSGVAREEINYVNAHATSTQSGDLKEYEAIVRCFGQNPQLRVNSTKSMTGHLIGAAG  440

Query  1372  GLEAIATIKAITTGWLHPTINQYNLEPEVTIDT---VPNVKKQHQVNVAISNSFGFGGHN  1542
             G+EA+A I+AI TGW+HP +N  N  PE  +D    V + K++ +VNVA+SNSFGFGGHN
Sbjct  441   GIEAVAAIQAIRTGWVHPNLNLEN--PEKIVDVGVLVGSQKERCKVNVALSNSFGFGGHN  498

Query  1543  SVIVFGPFK  1569
             S I+F PFK
Sbjct  499   SSILFAPFK  507



>ref|XP_002973275.1| hypothetical protein SELMODRAFT_149056 [Selaginella moellendorffii]
 gb|EFJ25649.1| hypothetical protein SELMODRAFT_149056 [Selaginella moellendorffii]
Length=508

 Score =   446 bits (1148),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 232/413 (56%), Positives = 309/413 (75%), Gaps = 2/413 (0%)
 Frame = +1

Query  331   KKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGY  510
             K+RVV+TGMG+VS  G + + FY NLL G SGI+ I+ FD  DF  R AG+I  F+ +G+
Sbjct  93    KRRVVVTGMGVVSCLGHEPDAFYENLLRGTSGITEIENFDCKDFPTRIAGEIKDFSPDGW  152

Query  511   IDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngv  690
             +  K  +R+D    Y L AGKKA+ DA + ++V++ +DKT+ G +IGS  GG+ VF + +
Sbjct  153   VAPKFCKRMDKFMLYLLTAGKKAVADAGMTRDVIDQLDKTKCGVLIGSAMGGMQVFSDAI  212

Query  691   ttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIR  870
               L  S Y+K+ PF +P++ TNMGSA+LA++ G MGP YSISTACAT+NYC  SAANHI 
Sbjct  213   EALRVS-YRKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNYCMLSAANHIV  271

Query  871   QGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVL  1050
             +GEAD+M+AGG++A I   G+GGF+ACRALSQRN+EP RASRPWD+ RDGFV+GEG GV+
Sbjct  272   RGEADVMLAGGSDAAIIPIGLGGFVACRALSQRNNEPSRASRPWDEGRDGFVMGEGAGVI  331

Query  1051  VMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVN  1230
             V+E L+HA +RGA + AE+LGG++TCDA+HMTEP  +G G+  CI K+L  AGV  ++VN
Sbjct  332   VLEELEHAKRRGAEIYAEFLGGSSTCDAYHMTEPHPEGAGILLCIEKALAQAGVDRQDVN  391

Query  1231  YINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITT  1410
             Y+NAHATST AGD+ E  AI + F   SEIK+N TKS+ GH LGA+GG+EAIATI+AI +
Sbjct  392   YVNAHATSTRAGDVQEYKAIMRCFGSNSEIKVNSTKSMTGHLLGAAGGVEAIATIQAIRS  451

Query  1411  GWLHPTINQYNLEPEVTIDTVPNVKKQH-QVNVAISNSFGFGGHNSVIVFGPF  1566
             GW+HPTIN    E +V ++ +    KQ   V VA+SNSFGFGGHNS ++F P+
Sbjct  452   GWVHPTINIDTPEKDVNMEVIVGANKQKLDVKVALSNSFGFGGHNSSVIFAPY  504



>ref|NP_001060274.1| Os07g0616200 [Oryza sativa Japonica Group]
 dbj|BAC79989.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase [Oryza sativa 
Japonica Group]
 dbj|BAF22188.1| Os07g0616200 [Oryza sativa Japonica Group]
 dbj|BAG90343.1| unnamed protein product [Oryza sativa Japonica Group]
Length=507

 Score =   446 bits (1148),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 237/429 (55%), Positives = 317/429 (74%), Gaps = 12/429 (3%)
 Frame = +1

Query  310   PKRQSDPKK------RVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVR  471
             P+R++  KK      RVVITGMG+V+  G D + FYNNLL+G SGIS I+RFD S F  R
Sbjct  82    PERRTVEKKPDVKQRRVVITGMGVVTPLGHDPDVFYNNLLDGVSGISEIERFDCSTFPTR  141

Query  472   FAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavig  651
              AG+I  F+++G++  K  RR+D    Y + AGKKAL    L +E+ N +DKTR G +IG
Sbjct  142   IAGEIKSFSTDGWVAPKLARRMDKFMLYLITAGKKALEHGGLTEELRNELDKTRCGVLIG  201

Query  652   sgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACAT  831
             S  GG+ VF + +  L  S YKK+ PF +P++ TNMGSA+LA++ G MGP YSISTACAT
Sbjct  202   SAMGGMKVFNDAIEALRVS-YKKMNPFCVPFATTNMGSAILAMDLGWMGPNYSISTACAT  260

Query  832   ANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKD  1011
             +N+C  +AANHIR+GEAD+M+ GG++A +   G+GGF+ACRALSQRN +P +ASRPWD D
Sbjct  261   SNFCILNAANHIRRGEADVMLCGGSDAPLIPIGLGGFVACRALSQRNSDPTKASRPWDVD  320

Query  1012  RDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITK  1191
             RDGFV+GEG GVLV+E L+HA +RGA + AE+LGG+ TCDA+HMTEP  +G G+  CI K
Sbjct  321   RDGFVMGEGAGVLVLEELEHAKQRGAKIYAEFLGGSFTCDAYHMTEPHPEGRGIILCIEK  380

Query  1192  SLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASG  1371
             +L D+GV+ EE+NY+NAHATST +GD+ E  AI + F    ++++N TKS+ GH +GA+G
Sbjct  381   ALADSGVAREEINYVNAHATSTQSGDLKEYEAIVRCFGQNPQLRVNSTKSMTGHLIGAAG  440

Query  1372  GLEAIATIKAITTGWLHPTINQYNLEPEVTIDT---VPNVKKQHQVNVAISNSFGFGGHN  1542
             G+EA+A I+AI TGW+HP +N  N  PE  +D    V + K++ +VNVA+SNSFGFGGHN
Sbjct  441   GIEAVAAIQAIRTGWVHPNLNLEN--PEKIVDVGVLVGSQKERCKVNVALSNSFGFGGHN  498

Query  1543  SVIVFGPFK  1569
             S I+F PFK
Sbjct  499   SSILFAPFK  507



>gb|KIC73224.1| 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic [Neochlamydia 
sp. EPS4]
Length=415

 Score =   441 bits (1133),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 231/414 (56%), Positives = 303/414 (73%), Gaps = 1/414 (0%)
 Frame = +1

Query  331   KKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGY  510
             KKR+VITGMG+VS FG++V+ +Y +LL+G+SG SLI  F   D+  R A  I  F S  Y
Sbjct  3     KKRIVITGMGIVSCFGNEVDDYYQSLLDGKSGASLITSFPCEDYPTRIAASIKNFESGDY  62

Query  511   IDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngv  690
             ID K  RR+D +  Y LVAGKKAL  + L  E +  ++K R G VIGSG GG+ V+  GV
Sbjct  63    IDKKQARRIDKNIAYALVAGKKALEASQLNPEAIAKLNKERCGVVIGSGMGGMDVYCQGV  122

Query  691   ttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIR  870
              TL+Q G + ++PFF+PY +TNMG A+LA++ G MGP YS+STACAT N    +AANHIR
Sbjct  123   QTLIQKGQRWVSPFFVPYILTNMGGAMLAMDIGFMGPNYSVSTACATGNNAIIAAANHIR  182

Query  871   QGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVL  1050
             +GEAD+MI GG+EA I   G+ GF +C+ALSQRN EPE+ASRPWD  RDGF++GEG G  
Sbjct  183   KGEADLMICGGSEAPIIPMGLSGFCSCKALSQRNDEPEKASRPWDLGRDGFLMGEGAGTF  242

Query  1051  VMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVN  1230
             ++E L+HA+ RGA +IAEYLGG  +CDA+H+TEPR D  GV+ C+  +L DA +  EEV+
Sbjct  243   IIESLEHALARGAPIIAEYLGGGMSCDAYHITEPRADSEGVALCVRNALADADIKAEEVD  302

Query  1231  YINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITT  1410
             YINAH TST AGD+ EV A+KKVFK+ S I MN TKS+IGH LGA+G +EA+ T KAI +
Sbjct  303   YINAHGTSTPAGDMAEVRALKKVFKEPSSIIMNSTKSMIGHCLGAAGAMEAVVTAKAIES  362

Query  1411  GWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFKP  1572
             GW+HP+IN  + EP++    +P V ++  +N+AISN+FGFGGHN+ IV G + P
Sbjct  363   GWVHPSINLEDPEPDLEFH-IPTVAEKKDINIAISNTFGFGGHNATIVLGAYHP  415



>ref|XP_001763306.1| predicted protein [Physcomitrella patens]
 gb|EDQ71836.1| predicted protein [Physcomitrella patens]
Length=481

 Score =   440 bits (1132),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 229/412 (56%), Positives = 309/412 (75%), Gaps = 2/412 (0%)
 Frame = +1

Query  334   KRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYI  513
             +RVV+TGMGLVS  G +   FY NLL G+SGI+ I+RFD  +F  RFAG+I  F++EG++
Sbjct  65    RRVVVTGMGLVSCHGHEPTQFYENLLAGKSGITEIERFDCKEFPTRFAGEIKSFSTEGWV  124

Query  514   DAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvt  693
               K  RR+D    Y L AGKKA+ DA + ++V+ ++DK++ G +IGS  GG+ VF + + 
Sbjct  125   AGKFARRMDRFMLYLLTAGKKAVKDAGITEDVMKDLDKSKCGVLIGSAMGGMQVFNDAIE  184

Query  694   tlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQ  873
              L  S Y+K+ PF +P++ TNMGSA+LA++ G MGP YSISTACAT+N+C  SAANHI +
Sbjct  185   ALRVS-YRKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNFCILSAANHIIR  243

Query  874   GEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLV  1053
             GEAD+M++GG++A I   G+GGF ACRALSQRN +P +ASRPWD++RDGFV+GEG GVL+
Sbjct  244   GEADLMLSGGSDAAIIPIGLGGFAACRALSQRNDDPAKASRPWDQNRDGFVMGEGAGVLL  303

Query  1054  MERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNY  1233
             +E L+HA  RGA + AE+LGG+ TCDA+HMTEP  +G GV  CI K+L  +GV+  +VNY
Sbjct  304   LEELEHAKARGAEIYAEFLGGSFTCDAYHMTEPHPEGAGVLLCIEKALAQSGVNKADVNY  363

Query  1234  INAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTG  1413
             +NAHATST AGD+ E  A+ KVF    E+K+N TKS++GH LGA+G +EAIATI+AI TG
Sbjct  364   VNAHATSTKAGDLQEYKALMKVFGGNPELKVNSTKSMVGHLLGAAGAVEAIATIQAIRTG  423

Query  1414  WLHPTINQYNLEPEVTIDTVPNVKKQH-QVNVAISNSFGFGGHNSVIVFGPF  1566
             W+HPTIN  N E EV ++ +   +KQ   + VA+SNSFGFGG NS ++F P+
Sbjct  424   WVHPTINLENPESEVDLNVIVGGEKQELDIKVALSNSFGFGGQNSSVLFAPY  475



>ref|XP_001700152.1| 3-ketoacyl-ACP-synthase [Chlamydomonas reinhardtii]
 gb|EDO98446.1| 3-ketoacyl-ACP-synthase [Chlamydomonas reinhardtii]
Length=459

 Score =   439 bits (1129),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 233/439 (53%), Positives = 313/439 (71%), Gaps = 12/439 (3%)
 Frame = +1

Query  265   KCRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDR  444
             +C+ ++  +S AV    +     +RVV+TGMGLVS  G D + FYNNLL G+SGI+ I+ 
Sbjct  24    RCQTVR--VSAAVHDISKTEKAPRRVVVTGMGLVSCLGHDHDEFYNNLLAGKSGITNIEG  81

Query  445   FDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANL---GKEVLN  615
             F  +D++ RFAG+I      GY+  K ++R+D   +Y LVAGKKAL DA L   G+E+  
Sbjct  82    FPCADYTTRFAGEIKSLDCTGYVTKKFEKRVDAVIKYILVAGKKALGDAGLAWDGQEI-K  140

Query  616   NMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLM  795
             ++D+ R G ++G+  GG+  F N V  L  SGY+K+ PF IP++ITNMG A+LA++ G M
Sbjct  141   DLDRMRCGTLVGTAMGGMTSFANAVEALETSGYRKMNPFCIPFAITNMGGAMLAMDIGFM  200

Query  796   GPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNH  975
             GP YSISTACAT NYC  ++A HIR+G+AD+M+AG  +A I  +G+GGFIAC+ALS+RN 
Sbjct  201   GPNYSISTACATGNYCIMNSAEHIRRGDADLMLAGAGDAAIIPSGIGGFIACKALSKRND  260

Query  976   EPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPR  1155
             +P  ASRPWD DRDGFV+GEG GVLV+E  +HA  RGA + AEY+GGA TCDAHHMTEP+
Sbjct  261   DPAAASRPWDTDRDGFVMGEGAGVLVLEEYEHAKARGARIYAEYVGGAVTCDAHHMTEPQ  320

Query  1156  TDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGT  1335
              +G GV  C+ ++L   G+S  +VNY+NAHATST AGD+ E  AI  VF + S++++N T
Sbjct  321   PEGKGVIMCLQRALASTGLSASDVNYVNAHATSTQAGDMAEYRAINTVF-NHSDLRINAT  379

Query  1336  KSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTID---TVPNVKKQHQVNV  1506
             KS+IGH LG +  +EA+ATIKAI TGWLHP+IN +   PE  +D    V   K+ H + V
Sbjct  380   KSMIGHLLGGASAVEAVATIKAIQTGWLHPSINLHT--PEAGVDLVRVVAGAKQHHPIKV  437

Query  1507  AISNSFGFGGHNSVIVFGP  1563
             A+SNSFGFGGHNS ++F P
Sbjct  438   ALSNSFGFGGHNSCVMFKP  456



>ref|XP_006381576.1| FATTY ACID BIOSYNTHESIS 1 family protein [Populus trichocarpa]
 gb|ERP59373.1| FATTY ACID BIOSYNTHESIS 1 family protein [Populus trichocarpa]
Length=493

 Score =   438 bits (1127),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 232/426 (54%), Positives = 312/426 (73%), Gaps = 6/426 (1%)
 Frame = +1

Query  301   VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAG  480
             V   K+    +KRVV+TG+G+VS  G + + FYNNLLEG SG+S I+ FD + FS R AG
Sbjct  71    VETKKKPHTKQKRVVVTGLGVVSPLGHEPDVFYNNLLEGVSGVSQIEAFDCAQFSTRIAG  130

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgf  660
             +I   +++G++  K  +R+D    Y L+AGKKAL D  + ++V++ ++K + G +IGS  
Sbjct  131   EIKSISTDGWVSPKLAKRMDKFMLYMLIAGKKALADGGITEDVMDELNKAKCGVLIGSAM  190

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GG+ VF + +  L  S YKK+ PF +P++ TNMGSA+LA++ G MGP YSISTACAT N+
Sbjct  191   GGMKVFNDAIEALRIS-YKKVNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATGNF  249

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
             C  +AANHI +GEAD+M+ GG+++ I   G+GGF+ACRALSQRN +P +ASRPWD +RDG
Sbjct  250   CILNAANHIIRGEADVMLCGGSDSAIIPIGLGGFVACRALSQRNDDPTKASRPWDMNRDG  309

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVL++E L+HA KRGAN+ AE+LGG+ TCDA+HMTEPR DG GV  CI K+L 
Sbjct  310   FVMGEGAGVLLLEELEHAKKRGANIYAEFLGGSFTCDAYHMTEPRPDGAGVILCIEKALA  369

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
              +GV+ E+VNYINAHATST AGD+ E +A+   F   S +++N TKS+IGH LGASG +E
Sbjct  370   QSGVAKEDVNYINAHATSTPAGDLKEYHALMHCFGRNSGLRVNSTKSMIGHLLGASGAVE  429

Query  1381  AIATIKAITTGWLHPTINQYNLEPEVTIDT---VPNVKKQHQVNVAISNSFGFGGHNSVI  1551
             AIA ++AI TGW+HP IN  N  PE  +DT   V   K++  +  A+SNSFGFGGHNS I
Sbjct  430   AIAAVQAIRTGWVHPNINLEN--PEQGMDTSVLVGPKKERLDIKAALSNSFGFGGHNSSI  487

Query  1552  VFGPFK  1569
             +F PFK
Sbjct  488   IFAPFK  493



>emb|CBI27767.3| unnamed protein product [Vitis vinifera]
Length=517

 Score =   438 bits (1127),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 235/430 (55%), Positives = 315/430 (73%), Gaps = 4/430 (1%)
 Frame = +1

Query  289   ISPA--VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDF  462
             + PA  V+  K+    ++RVV+TGMG++S  G + ++FYNNLLEG SGIS I+ FD S F
Sbjct  89    VQPAKEVTTKKKPLTEQRRVVVTGMGVMSPIGHEPDSFYNNLLEGVSGISEIESFDCSHF  148

Query  463   SVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRiga  642
               R AG+I  F+++G+I  K  +R+D    Y L AGKKAL D  + ++V + +DK+R G 
Sbjct  149   PTRIAGEIKSFSTDGWIAPKLSKRMDKFMLYMLTAGKKALADGGITEDVTDELDKSRCGV  208

Query  643   vigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTA  822
             +IGS  GG+ VF + +  L  S Y+K+ PF +P++ TNMGSA+LA++ G MGP YSISTA
Sbjct  209   LIGSAMGGIKVFNDAIEALRVS-YRKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTA  267

Query  823   CATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPW  1002
             CAT+N+C  +A+NHI +GEAD+M+ GG++A I   G+GGF+ACRALSQRN++P +ASRPW
Sbjct  268   CATSNFCILNASNHIIRGEADMMLCGGSDAAIIPIGLGGFVACRALSQRNNDPTKASRPW  327

Query  1003  DKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSC  1182
             D +RDGFV+GEG GVL++E L+HA KRGA + AE+LGG+ TCDA+HMTEP  DG GV  C
Sbjct  328   DTNRDGFVMGEGAGVLLLEELEHAKKRGAKIYAEFLGGSFTCDAYHMTEPHPDGAGVILC  387

Query  1183  ITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLG  1362
             I  +L  +GVS E+VNYINAHATST+AGD  E  A+ + F    E+K+N TKS+IGH LG
Sbjct  388   IESALARSGVSREDVNYINAHATSTLAGDFREYQALVRCFGQNPELKVNSTKSMIGHLLG  447

Query  1363  ASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQH-QVNVAISNSFGFGGH  1539
             A+G +EAIATI+AI TGW+HP IN  + E  V  D +   KK+   + VA+SNSFGFGGH
Sbjct  448   AAGAVEAIATIQAIRTGWVHPNINLESPEEGVDTDLLVGSKKERLDIKVALSNSFGFGGH  507

Query  1540  NSVIVFGPFK  1569
             NS I+F P+K
Sbjct  508   NSSIIFAPYK  517



>ref|XP_001768994.1| predicted protein [Physcomitrella patens]
 gb|EDQ66192.1| predicted protein [Physcomitrella patens]
Length=546

 Score =   439 bits (1128),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 230/420 (55%), Positives = 311/420 (74%), Gaps = 2/420 (0%)
 Frame = +1

Query  310   PKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIH  489
             PK+ S   +RVV+TGMG+VS  G D ++FY NLLEG+SG+S I+ FD   FS R AG+I 
Sbjct  122   PKKTSTKPRRVVVTGMGVVSCLGHDADSFYANLLEGKSGVSEIENFDCKQFSTRIAGEIK  181

Query  490   GFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfggl  669
              F+++G++  K  +R+D    Y L AGKKA+ DA L ++V+ ++DK+R G +IGS  GG+
Sbjct  182   SFSADGWVAGKFIKRMDKFMLYLLTAGKKAVFDAGLTEDVIKSIDKSRCGVLIGSAMGGM  241

Query  670   gvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFY  849
              +F + +  L  S Y+K+ PF +P + TNMGSA+LA++ G MGP YSISTACAT+N+C  
Sbjct  242   QIFNDAIEALRLS-YRKMNPFCVPLASTNMGSAMLAMDLGWMGPNYSISTACATSNFCIL  300

Query  850   SAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVI  1029
             +AANHI +GEADIM+AGG++A +   G+GGF+ACRALSQRN +P RASRPWDKDRDGFV+
Sbjct  301   NAANHIIRGEADIMLAGGSDAAVLPIGLGGFVACRALSQRNDDPARASRPWDKDRDGFVM  360

Query  1030  GEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAG  1209
             GEG GVL++E L+HA  RGA + AE+LGG+ +CDA+H TEP  +G GV  CI ++L  AG
Sbjct  361   GEGAGVLLLEELEHAKARGAEIYAEFLGGSFSCDAYHTTEPHPEGAGVLLCIDRALSQAG  420

Query  1210  VSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIA  1389
             V+  +VNY+NAHATST AGD+ E  A+ + F    E+++N TKS+IGH LGASG +EAIA
Sbjct  421   VNRHDVNYVNAHATSTKAGDLQEYKALMRSFGQNPELRINSTKSMIGHLLGASGAVEAIA  480

Query  1390  TIKAITTGWLHPTINQYNLEPEVTIDT-VPNVKKQHQVNVAISNSFGFGGHNSVIVFGPF  1566
             T++AI TGW+HPTIN  N E +V +   V   K++  + VA+SNSFGFGG NS I+F P+
Sbjct  481   TVQAIRTGWVHPTINLDNPENDVDMKVIVGGEKRKLDIKVALSNSFGFGGQNSSILFAPY  540



>ref|XP_002276214.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Vitis vinifera]
 ref|XP_010656091.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic 
[Vitis vinifera]
Length=555

 Score =   438 bits (1127),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 235/430 (55%), Positives = 315/430 (73%), Gaps = 4/430 (1%)
 Frame = +1

Query  289   ISPA--VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDF  462
             + PA  V+  K+    ++RVV+TGMG++S  G + ++FYNNLLEG SGIS I+ FD S F
Sbjct  127   VQPAKEVTTKKKPLTEQRRVVVTGMGVMSPIGHEPDSFYNNLLEGVSGISEIESFDCSHF  186

Query  463   SVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRiga  642
               R AG+I  F+++G+I  K  +R+D    Y L AGKKAL D  + ++V + +DK+R G 
Sbjct  187   PTRIAGEIKSFSTDGWIAPKLSKRMDKFMLYMLTAGKKALADGGITEDVTDELDKSRCGV  246

Query  643   vigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTA  822
             +IGS  GG+ VF + +  L  S Y+K+ PF +P++ TNMGSA+LA++ G MGP YSISTA
Sbjct  247   LIGSAMGGIKVFNDAIEALRVS-YRKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTA  305

Query  823   CATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPW  1002
             CAT+N+C  +A+NHI +GEAD+M+ GG++A I   G+GGF+ACRALSQRN++P +ASRPW
Sbjct  306   CATSNFCILNASNHIIRGEADMMLCGGSDAAIIPIGLGGFVACRALSQRNNDPTKASRPW  365

Query  1003  DKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSC  1182
             D +RDGFV+GEG GVL++E L+HA KRGA + AE+LGG+ TCDA+HMTEP  DG GV  C
Sbjct  366   DTNRDGFVMGEGAGVLLLEELEHAKKRGAKIYAEFLGGSFTCDAYHMTEPHPDGAGVILC  425

Query  1183  ITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLG  1362
             I  +L  +GVS E+VNYINAHATST+AGD  E  A+ + F    E+K+N TKS+IGH LG
Sbjct  426   IESALARSGVSREDVNYINAHATSTLAGDFREYQALVRCFGQNPELKVNSTKSMIGHLLG  485

Query  1363  ASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQH-QVNVAISNSFGFGGH  1539
             A+G +EAIATI+AI TGW+HP IN  + E  V  D +   KK+   + VA+SNSFGFGGH
Sbjct  486   AAGAVEAIATIQAIRTGWVHPNINLESPEEGVDTDLLVGSKKERLDIKVALSNSFGFGGH  545

Query  1540  NSVIVFGPFK  1569
             NS I+F P+K
Sbjct  546   NSSIIFAPYK  555



>ref|XP_009104733.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Brassica rapa]
Length=546

 Score =   437 bits (1124),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 231/422 (55%), Positives = 308/422 (73%), Gaps = 6/422 (1%)
 Frame = +1

Query  313   KRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHG  492
             K+    ++RVV+TGMG+ +  G D  TFY NLL+G SGIS I+ FD S+F  R AG+I  
Sbjct  128   KKPPMEQRRVVVTGMGVETSLGHDPNTFYENLLQGNSGISQIENFDCSEFPTRIAGEIKS  187

Query  493   FTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglg  672
             F++EG++  K  +R+D    Y L AGKKAL D  +  EV+   +K + G +IGS  GG+ 
Sbjct  188   FSTEGWVAPKLSKRMDKFMLYLLTAGKKALADGGVTDEVMAEFNKAKCGVLIGSAMGGMK  247

Query  673   vfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYS  852
             VF + +  L  S YKK+ PF +P++ TNMGSA+LA++ G MGP YSISTACAT+N+C  +
Sbjct  248   VFNDAIEALKIS-YKKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNFCILN  306

Query  853   AANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIG  1032
             +ANHI +GEAD+M+ GG++A I   G+GGF+ACRALSQRN++P +ASRPWD +RDGFV+G
Sbjct  307   SANHIIRGEADVMLCGGSDAVIIPIGLGGFVACRALSQRNNDPTKASRPWDSNRDGFVMG  366

Query  1033  EGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGV  1212
             EG GVL++E L+HA KRGA + AE+LGG+ TCDA+HMTEPR DG GV  CI ++L DAG+
Sbjct  367   EGAGVLLLEELEHAKKRGATIYAEFLGGSFTCDAYHMTEPRPDGAGVILCIERALADAGI  426

Query  1213  SPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIAT  1392
             S E++NYINAHATST AGD+ E  A+   F    E+K+N TKS+IGH LGA+G +EAIAT
Sbjct  427   SKEQINYINAHATSTPAGDLKEYQALAHCFGQNPELKVNSTKSMIGHLLGAAGAVEAIAT  486

Query  1393  IKAITTGWLHPTINQYNLEPEVTIDT---VPNVKKQHQVNVAISNSFGFGGHNSVIVFGP  1563
             ++AI TGW+HP IN  N  P+  +DT   V   K++  +  A+SNSFGFGGHNS I+F P
Sbjct  487   VQAIRTGWVHPNINLEN--PDNGVDTSLLVGPKKERLSIKAALSNSFGFGGHNSSIIFAP  544

Query  1564  FK  1569
             +K
Sbjct  545   YK  546



>ref|XP_011039936.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Populus euphratica]
Length=548

 Score =   437 bits (1123),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 231/426 (54%), Positives = 312/426 (73%), Gaps = 6/426 (1%)
 Frame = +1

Query  301   VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAG  480
             V   K+    +KRVV+TG+G+VS  G + + FYNNLLEG SG+S I+ FD + FS R AG
Sbjct  126   VETKKKPHTKQKRVVVTGLGVVSPLGHEPDVFYNNLLEGVSGVSQIEAFDCAQFSTRIAG  185

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgf  660
             +I   +++G++  K  +R+D    Y L+AGKKAL D  + ++V++ ++K + G +IGS  
Sbjct  186   EIKSISTDGWVSPKLAKRMDKFMLYMLIAGKKALADGGITEDVMDELNKAKCGVLIGSAM  245

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GG+ VF + +  L  S YKK+ PF +P++ TNMGSA+LA++ G MGP YSISTACAT N+
Sbjct  246   GGMKVFNDAIEALRIS-YKKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATGNF  304

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
             C  +AANHI +GEAD+M+ GG+++ I   G+GGF+ACRALSQRN +P +ASRPWD +RDG
Sbjct  305   CILNAANHIIRGEADVMLCGGSDSAIIPIGLGGFMACRALSQRNDDPTKASRPWDMNRDG  364

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVL++E L+HA KRGAN+ AE+LGG+ TCDA+HMTEPR DG GV  C+ K+L 
Sbjct  365   FVMGEGAGVLLLEELEHAKKRGANIYAEFLGGSFTCDAYHMTEPRPDGAGVILCVEKALA  424

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
              +GV+ E+VNYINAHATST AGD+ E NA+   F   S +++N TKS+IGH LGASG +E
Sbjct  425   QSGVAKEDVNYINAHATSTPAGDLKEYNALMHCFGRNSGLRVNSTKSMIGHLLGASGAVE  484

Query  1381  AIATIKAITTGWLHPTINQYNLEPEVTIDT---VPNVKKQHQVNVAISNSFGFGGHNSVI  1551
             AIA ++AI TGW+HP IN  N  P+  +DT   V   K++  +  A+SNSFGFGGHNS I
Sbjct  485   AIAAVQAIRTGWVHPNINLEN--PDQGMDTSVLVGPKKERLDIKAALSNSFGFGGHNSSI  542

Query  1552  VFGPFK  1569
             +F PFK
Sbjct  543   IFAPFK  548



>emb|CDX68154.1| BnaA07g21940D [Brassica napus]
Length=546

 Score =   437 bits (1123),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 231/422 (55%), Positives = 308/422 (73%), Gaps = 6/422 (1%)
 Frame = +1

Query  313   KRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHG  492
             K+    ++RVV+TGMG+ +  G D  TFY NLL+G SGIS I+ FD S+F  R AG+I  
Sbjct  128   KKPPMEQRRVVVTGMGVETSLGHDPNTFYENLLQGNSGISQIENFDCSEFPTRIAGEIKS  187

Query  493   FTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglg  672
             F++EG++  K  +R+D    Y L AGKKAL D  +  EV+   +K + G +IGS  GG+ 
Sbjct  188   FSTEGWVAPKLSKRMDKFMLYLLTAGKKALADGAVTDEVMAEFNKAKCGVLIGSAMGGMK  247

Query  673   vfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYS  852
             VF + +  L  S YKK+ PF +P++ TNMGSA+LA++ G MGP YSISTACAT+N+C  +
Sbjct  248   VFNDAIEALKIS-YKKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNFCILN  306

Query  853   AANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIG  1032
             +ANHI +GEAD+M+ GG++A I   G+GGF+ACRALSQRN++P +ASRPWD +RDGFV+G
Sbjct  307   SANHIIRGEADVMLCGGSDAVIIPIGLGGFVACRALSQRNNDPTKASRPWDSNRDGFVMG  366

Query  1033  EGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGV  1212
             EG GVL++E L+HA KRGA + AE+LGG+ TCDA+HMTEPR DG GV  CI ++L DAG+
Sbjct  367   EGAGVLLLEELEHAKKRGATIYAEFLGGSFTCDAYHMTEPRPDGAGVILCIERALADAGI  426

Query  1213  SPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIAT  1392
             S E++NYINAHATST AGD+ E  A+   F    E+K+N TKS+IGH LGA+G +EAIAT
Sbjct  427   SKEQINYINAHATSTPAGDLKEYQALAHCFGQNPELKVNSTKSMIGHLLGAAGAVEAIAT  486

Query  1393  IKAITTGWLHPTINQYNLEPEVTIDT---VPNVKKQHQVNVAISNSFGFGGHNSVIVFGP  1563
             ++AI TGW+HP IN  N  P+  +DT   V   K++  +  A+SNSFGFGGHNS I+F P
Sbjct  487   VQAIRTGWVHPNINLEN--PDNGVDTSLLVGPKKERLSIKAALSNSFGFGGHNSSIIFAP  544

Query  1564  FK  1569
             +K
Sbjct  545   YK  546



>ref|XP_005707986.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Galdieria sulphuraria]
 gb|EME31466.1| 3-oxoacyl-[acyl-carrier-protein] synthase II [Galdieria sulphuraria]
Length=482

 Score =   434 bits (1117),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 232/418 (56%), Positives = 313/418 (75%), Gaps = 5/418 (1%)
 Frame = +1

Query  328   PKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQI--HGFTS  501
             P+KRVV+TGMG+VS FG+DV+ FY+NLL G+SGI  I++F   ++S +  G+I    F +
Sbjct  63    PRKRVVVTGMGVVSCFGTDVDLFYDNLLAGKSGIKRIEKFPVDEYSTKIGGEITPENFQA  122

Query  502   EGYIDAKNDRRLDHSWRYCLVAGKKALNDAN--LGKEVLNNMDKTRigavigsgfgglgv  675
               Y+  K  RR+D    Y + A K AL+ A   +G E  + + K R G +IGSG GGL  
Sbjct  123   NKYLSPKLARRMDPVICYSVAASKLALDHAGVAIGSESFSKLRKERCGVIIGSGMGGLIS  182

Query  676   fgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSA  855
             F +GV  L+   + +I+PFFIP SI N+GSA++AIE G MGP YSIS+ACAT+N+   +A
Sbjct  183   FTDGVGKLLADEFDRISPFFIPNSICNLGSAMVAIETGFMGPNYSISSACATSNHAINNA  242

Query  856   ANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGE  1035
             A HI++GEA++++ GG+EA +T  G+ GFIACRALS+RN +P +A RPWD +RDGFV+GE
Sbjct  243   AMHIQRGEAEMIVTGGSEAALTPIGLTGFIACRALSKRNEDPTKACRPWDTERDGFVMGE  302

Query  1036  GCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVS  1215
             GCGVLV+E L+HA++R A ++ EYLGGA TCDA+H+TEP  +G GV  C+  +++D+G++
Sbjct  303   GCGVLVLESLEHALRREAPILCEYLGGAHTCDAYHITEPHPEGHGVIKCMELAVQDSGIN  362

Query  1216  PEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSE-IKMNGTKSLIGHGLGASGGLEAIAT  1392
               +V+YINAHATST  GDI E  AI+ +FKD  + +K+N TKSLIGHGLGA+G LEAIAT
Sbjct  363   IADVDYINAHATSTPLGDIAEFRAIRSIFKDYKDRVKLNSTKSLIGHGLGAAGALEAIAT  422

Query  1393  IKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQHQVNVAISNSFGFGGHNSVIVFGPF  1566
             +KAI TG LHPT+N   L+PEV +D VPNV K+H+V VA+SNSFGFGGHNSV+VFG +
Sbjct  423   VKAIQTGKLHPTLNVEKLDPEVDMDVVPNVAKEHRVRVAMSNSFGFGGHNSVVVFGAY  480



>ref|XP_010533238.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Tarenaya hassleriana]
Length=549

 Score =   436 bits (1121),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 230/424 (54%), Positives = 310/424 (73%), Gaps = 6/424 (1%)
 Frame = +1

Query  307   APKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQI  486
             A K+    ++RVV+TGMG+ +  G D  TFY NLLEG SGIS I+ FD S+F  R AG+I
Sbjct  129   AEKKPPTEQRRVVVTGMGVATSLGHDPNTFYENLLEGISGISQIENFDCSEFPTRIAGEI  188

Query  487   HGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgg  666
               F+SEG++  K  +R+D    Y L AGKKAL D  + ++V+  +DKT+ G +IGS  GG
Sbjct  189   KDFSSEGWVAPKLSKRMDKFMLYLLTAGKKALVDGGITEDVMAELDKTKCGVLIGSAMGG  248

Query  667   lgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCF  846
             + VF + +  L  S Y+K+ PF +P++ TNMGSA+LA++ G MGP YSISTACAT+N+C 
Sbjct  249   MKVFNDAIEALRIS-YRKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNFCV  307

Query  847   YSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFV  1026
              +AANHI +GEAD+M+ GG+++ I   G+GGF+ACRALSQRN +P +ASRPWD +RDGFV
Sbjct  308   LNAANHIIRGEADVMLCGGSDSVIIPIGLGGFVACRALSQRNDDPTKASRPWDSNRDGFV  367

Query  1027  IGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDA  1206
             +GEG GVL++E L+HA +RGA + AE+ GG+ TCDA+HMTEPR DG GV  CI K+L+ A
Sbjct  368   MGEGAGVLLLEELEHAKRRGATIYAEFCGGSFTCDAYHMTEPRPDGAGVILCIEKALDQA  427

Query  1207  GVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAI  1386
             G+  E+VNYINAHATST AGD+ E  A+   F    E+++N TKS++GH LGA+G +EAI
Sbjct  428   GIPREDVNYINAHATSTPAGDLKEYQALVHCFGQNPELRVNSTKSMVGHLLGAAGAVEAI  487

Query  1387  ATIKAITTGWLHPTINQYNLEPEVTIDT---VPNVKKQHQVNVAISNSFGFGGHNSVIVF  1557
             AT++AI TGW+HP IN  N  P+  +DT   V + K++  +  A+SNSFGFGGHNS I+F
Sbjct  488   ATVQAIRTGWVHPNINLEN--PDEGVDTKLLVGSKKERLNIKAALSNSFGFGGHNSSIIF  545

Query  1558  GPFK  1569
              P+K
Sbjct  546   TPYK  549



>gb|AAL91174.1| putative 3-ketoacyl-ACP synthase [Arabidopsis thaliana]
Length=541

 Score =   435 bits (1119),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 230/422 (55%), Positives = 306/422 (73%), Gaps = 6/422 (1%)
 Frame = +1

Query  313   KRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHG  492
             K+    ++RVV+TGMG+ +  G D  TFY NLL+G SGIS I+ FD S+F  R AG+I  
Sbjct  123   KKPPTEQRRVVVTGMGVETSLGHDPHTFYENLLQGNSGISQIENFDCSEFPTRIAGEIKS  182

Query  493   FTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglg  672
             F++EG++  K  +R+D    Y L AGKKAL D  +  EV+   DKT+ G +IGS  GG+ 
Sbjct  183   FSTEGWVAPKLSKRMDKFMLYLLTAGKKALADGGVTDEVMAEFDKTKCGVLIGSAMGGMK  242

Query  673   vfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYS  852
             VF + +  L  S YKK+ PF +P++ TNMGSA+LA++ G MGP YSISTACAT+N+C  +
Sbjct  243   VFYDAIEALRIS-YKKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNFCILN  301

Query  853   AANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIG  1032
             +ANHI +GEAD+M+ GG++A I   G+GGF+ACRALSQRN++P +ASRPWD +RDGFV+G
Sbjct  302   SANHIIKGEADVMLCGGSDAVIIPIGLGGFVACRALSQRNNDPTKASRPWDTNRDGFVMG  361

Query  1033  EGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGV  1212
             EG GVL++E L+HA KRGA + AE+LGG+ TCDA+HMTEP  DG GV  CI ++L  AG+
Sbjct  362   EGAGVLLLEELEHAKKRGATIYAEFLGGSFTCDAYHMTEPHPDGAGVILCIERALASAGI  421

Query  1213  SPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIAT  1392
             S E++NYINAHATST AGDI E  A+   F    E+K+N TKS+IGH LG +G +EA+AT
Sbjct  422   SKEQINYINAHATSTHAGDIKEYQALAHCFGQNPELKVNSTKSMIGHLLGVAGAVEAVAT  481

Query  1393  IKAITTGWLHPTINQYNLEPEVTIDT---VPNVKKQHQVNVAISNSFGFGGHNSVIVFGP  1563
             ++AI TGW+HP IN  N  P+  +DT   V   K++  +  A+SNSFGFGGHNS I+F P
Sbjct  482   VQAIRTGWVHPNINLEN--PDSGVDTKLLVGPKKERLDIKAALSNSFGFGGHNSSIIFAP  539

Query  1564  FK  1569
             +K
Sbjct  540   YK  541



>ref|XP_003638193.1| Beta-ketoacyl-ACP synthase I [Medicago truncatula]
Length=466

 Score =   432 bits (1110),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 234/375 (62%), Positives = 284/375 (76%), Gaps = 1/375 (0%)
 Frame = +1

Query  205   PVETMQNQPDSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSD  384
             P+E ++ +  + A      K+  RI   ++   +AP+R+ DPKKRVVITGMGL SVFG+D
Sbjct  18    PLEPLRRKSSNAATATAKTKRVTRISAAVT-TTTAPQREKDPKKRVVITGMGLASVFGND  76

Query  385   VETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLV  564
             V+ +Y+ LL G SGI+ IDRFDAS F  RFAGQI  F+SEGYID KNDRRLD   RYC+V
Sbjct  77    VDAYYDKLLAGESGITSIDRFDASKFPTRFAGQIRDFSSEGYIDGKNDRRLDDCLRYCIV  136

Query  565   AGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPY  744
             AGKKAL  ANLG   L+ +DK R G ++GSG GGL VF  GV  L++ GY+KITPFFIPY
Sbjct  137   AGKKALEHANLGAANLSKIDKERAGVLVGSGMGGLTVFSEGVKNLIEKGYRKITPFFIPY  196

Query  745   SITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitt  924
             +ITNMGSALL I+ G MGP YSISTACAT+NYCFY+AANHIR+GEAD+MIAGGTEA I  
Sbjct  197   AITNMGSALLGIDLGFMGPNYSISTACATSNYCFYAAANHIRRGEADLMIAGGTEAAIIP  256

Query  925   tgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAE  1104
              G+GGF+ACRALSQRN +P+ ASRPWDK RDGFV+GEG GVLV+E L+HAMKRGA +IAE
Sbjct  257   IGLGGFVACRALSQRNDDPKTASRPWDKARDGFVMGEGSGVLVLESLEHAMKRGAPIIAE  316

Query  1105  YLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVN  1284
             YLGGA  CDA+HMT+PR+DGLGVS+CI  SLEDAGVSPEEV + + +   T    + +V+
Sbjct  317   YLGGAVNCDAYHMTDPRSDGLGVSTCIQSSLEDAGVSPEEVPFHSLYPAYTFCLRLKKVS  376

Query  1285  AIKKVFKDTSEIKMN  1329
                 V    +E   N
Sbjct  377   HKNNVVSGNAETAGN  391



>ref|XP_006658817.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Oryza brachyantha]
Length=439

 Score =   428 bits (1101),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 223/402 (55%), Positives = 301/402 (75%), Gaps = 6/402 (1%)
 Frame = +1

Query  373   FGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWR  552
              G D + FYNNLL+G SGIS I+RFD S F  R AG+I  F+++G++  K  +R+D    
Sbjct  41    LGHDPDVFYNNLLDGVSGISEIERFDCSKFPTRIAGEIKSFSTDGWVAPKLAKRMDKFML  100

Query  553   YCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPF  732
             Y + AGKKAL    L +E+ N +DKTR G +IGS  GG+ VF + +  L  S YKK+ PF
Sbjct  101   YLITAGKKALEHGGLTEELRNELDKTRCGVLIGSAMGGMKVFNDAIEALRVS-YKKMNPF  159

Query  733   FIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggtea  912
              +P++ TNMGSA+LA++ G MGP YSISTACAT+N+C  +AANHIR+GEAD+M+ GG++A
Sbjct  160   CVPFATTNMGSAILAMDLGWMGPNYSISTACATSNFCILNAANHIRRGEADVMLCGGSDA  219

Query  913   gitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGAN  1092
              +   G+GGF+ACRALSQRN +P +ASRPWD DRDGFV+GEG GVLV+E L+HA +RGA 
Sbjct  220   PLIPIGLGGFVACRALSQRNSDPTKASRPWDVDRDGFVMGEGSGVLVLEELEHAKQRGAK  279

Query  1093  VIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDI  1272
             + AE+LGG+ TCDA+HMTEP  +G G++ CI K+L D+GV+ EE+NY+NAHATST +GD+
Sbjct  280   IYAEFLGGSFTCDAYHMTEPHPEGRGITLCIEKALADSGVAREEINYVNAHATSTQSGDV  339

Query  1273  VEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEP  1452
              E  AI + F    ++++N TKS+ GH +GA+GG+EA+A ++AI TGW+HP +N  N  P
Sbjct  340   KEYEAIVRCFGQNPQLRVNSTKSMTGHLIGAAGGIEAVAAVQAIRTGWVHPNLNLEN--P  397

Query  1453  EVTIDT---VPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             E T+D    V + K++ +VNVA+SNSFGFGGHNS I+F PFK
Sbjct  398   EKTVDVGVLVGSKKERCEVNVALSNSFGFGGHNSSILFAPFK  439



>ref|XP_008651372.1| PREDICTED: uncharacterized protein LOC100280304 isoform X1 [Zea 
mays]
 tpg|DAA63605.1| TPA: hypothetical protein ZEAMMB73_843178 [Zea mays]
Length=496

 Score =   430 bits (1106),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 224/402 (56%), Positives = 303/402 (75%), Gaps = 6/402 (1%)
 Frame = +1

Query  373   FGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWR  552
              G D + FYNNLL+G SGIS I+RFD S+F  R AG+I  F+++G++  K  +R+D    
Sbjct  98    LGHDPDVFYNNLLDGVSGISEIERFDCSNFPTRIAGEIKSFSTDGWVAPKLAKRMDKFML  157

Query  553   YCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPF  732
             Y + AGKKAL +  L +E+ N +DKTR G +IGS  GG+ VF + +  L  S YKK+ PF
Sbjct  158   YLITAGKKALENGGLTEELRNELDKTRCGVLIGSAMGGMKVFNDAIEALRVS-YKKMNPF  216

Query  733   FIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggtea  912
              +P++ TNMGSA+LA++ G MGP YSISTACAT+N+C  +AANHIR+GEAD+M+ GG++A
Sbjct  217   CVPFATTNMGSAILAMDLGWMGPNYSISTACATSNFCILNAANHIRRGEADVMLCGGSDA  276

Query  913   gitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGAN  1092
              +   G+GGF+ACRALSQRN +P +ASRPWD  RDGFV+GEG GVLV+E L+HA +RGA 
Sbjct  277   PLIPIGLGGFVACRALSQRNSDPTKASRPWDMGRDGFVMGEGAGVLVLEELEHAKERGAT  336

Query  1093  VIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDI  1272
             + AE+LGG+ TCDA+HMTEP  +G G++ CI K+L DAGV+ EE+NY+NAHATST AGD+
Sbjct  337   IYAEFLGGSFTCDAYHMTEPHPEGRGITLCIEKALADAGVAREEINYVNAHATSTQAGDL  396

Query  1273  VEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEP  1452
              E  AI + F+   ++++N TKS+ GH +GA+GG+EA+A+I+AI TGW+HP +N  N  P
Sbjct  397   KEYEAIVRCFRQNPQLRVNSTKSMTGHLIGAAGGIEAVASIQAIRTGWVHPNLNLEN--P  454

Query  1453  EVTIDT---VPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             E T+D    V + K++ +V VA+SNSFGFGGHNS I+F PFK
Sbjct  455   EDTVDVGVLVGSQKERCEVKVALSNSFGFGGHNSSILFAPFK  496



>ref|NP_001132041.1| uncharacterized protein LOC100193451 precursor [Zea mays]
 gb|ACF80721.1| unknown [Zea mays]
 tpg|DAA41446.1| TPA: LOW QUALITY PROTEIN: 3-oxoacyl-synthase I [Zea mays]
Length=505

 Score =   430 bits (1106),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 224/402 (56%), Positives = 303/402 (75%), Gaps = 6/402 (1%)
 Frame = +1

Query  373   FGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWR  552
              G D + FYNNLL+G SGIS I+RFD S+F  R AG+I  F+++G++  K  +R+D    
Sbjct  98    LGHDPDVFYNNLLDGVSGISEIERFDCSNFPTRIAGEIKSFSTDGWVVPKLAKRMDKFML  157

Query  553   YCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPF  732
             Y + AGKKAL +  L +E+ N +DKTR G +IGS  GG+ VF + +  L  S YKK+ PF
Sbjct  158   YLITAGKKALENGGLTEELRNELDKTRCGVLIGSAMGGMKVFNDAIEALRVS-YKKMNPF  216

Query  733   FIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggtea  912
              +P++ TNMGSA+LA++ G MGP YSISTACAT+N+C  +AANHIR+GEAD+M+ GG++A
Sbjct  217   CVPFATTNMGSAILAMDLGWMGPNYSISTACATSNFCILNAANHIRRGEADVMLCGGSDA  276

Query  913   gitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGAN  1092
              +   G+GGF+ACRALSQRN +P +ASRPWD  RDGFV+GEG GVLV+E L+HA +RGA 
Sbjct  277   PLIPIGLGGFVACRALSQRNSDPTKASRPWDMGRDGFVMGEGAGVLVLEELEHAKERGAT  336

Query  1093  VIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDI  1272
             + AE+LGG+ TCDA+HMTEP  +G G++ CI K+L DAGV+ EE+NY+NAHATST AGD+
Sbjct  337   IYAEFLGGSFTCDAYHMTEPHPEGRGITLCIEKALADAGVAREEINYVNAHATSTQAGDL  396

Query  1273  VEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEP  1452
              E  AI + F+   ++++N TKS+ GH +GA+GG+EA+A+I+AI TGW+HP +N  N  P
Sbjct  397   KEYEAIVRCFRQNPQLRVNSTKSMTGHLIGAAGGIEAVASIQAIRTGWVHPNLNLEN--P  454

Query  1453  EVTIDT---VPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             E T+D    V + K++ +V VA+SNSFGFGGHNS I+F PFK
Sbjct  455   EDTVDVGILVGSQKERCEVKVALSNSFGFGGHNSSILFAPFK  496



>ref|XP_002463181.1| hypothetical protein SORBIDRAFT_02g039230 [Sorghum bicolor]
 gb|EER99702.1| hypothetical protein SORBIDRAFT_02g039230 [Sorghum bicolor]
Length=496

 Score =   430 bits (1105),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 223/402 (55%), Positives = 303/402 (75%), Gaps = 6/402 (1%)
 Frame = +1

Query  373   FGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWR  552
              G D + FYNNLL+G SGIS I+RFD S+F  R AG+I  F+++G++  K  +R+D    
Sbjct  98    LGHDPDVFYNNLLDGVSGISEIERFDCSNFPTRIAGEIKSFSTDGWVAPKLAKRMDKFML  157

Query  553   YCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPF  732
             Y + AGKKAL +  L +E+ N +DKTR G +IGS  GG+ VF + +  L  S YKK+ PF
Sbjct  158   YLITAGKKALENGGLTEELRNELDKTRCGVLIGSAMGGMKVFNDAIEALRVS-YKKMNPF  216

Query  733   FIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggtea  912
              +P++ TNMGSA+LA++ G MGP YSISTACAT+N+C  +AANHIR+GEAD+M+ GG++A
Sbjct  217   CVPFATTNMGSAILAMDLGWMGPNYSISTACATSNFCILNAANHIRRGEADVMLCGGSDA  276

Query  913   gitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGAN  1092
              +   G+GGF+ACRALSQRN +P +ASRPWD  RDGFV+GEG GVLV+E L+HA +RGA 
Sbjct  277   PLIPIGLGGFVACRALSQRNSDPTKASRPWDMGRDGFVMGEGAGVLVLEELEHAKERGAT  336

Query  1093  VIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDI  1272
             + AE+LGG+ TCDA+HMTEP  +G G++ CI K+L DAGV+ EE+NY+NAHATST AGD+
Sbjct  337   IYAEFLGGSFTCDAYHMTEPHPEGRGITLCIEKALADAGVAREEINYVNAHATSTQAGDL  396

Query  1273  VEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEP  1452
              E  AI + F+   ++++N TKS+ GH +GA+GG+EA+A+++AI TGW+HP +N  N  P
Sbjct  397   KEYEAIVRCFRQNPQLRVNSTKSMTGHLIGAAGGIEAVASVQAIRTGWVHPNLNLEN--P  454

Query  1453  EVTIDT---VPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             E T+D    V + K++ +V VA+SNSFGFGGHNS I+F PFK
Sbjct  455   EDTVDVGVLVGSQKERCEVKVALSNSFGFGGHNSSILFAPFK  496



>emb|CDP03046.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   431 bits (1109),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 231/444 (52%), Positives = 316/444 (71%), Gaps = 8/444 (2%)
 Frame = +1

Query  253   QAAKKCRRIKCMISPAVSAPKRQSDPKK--RVVITGMGLVSVFGSDVETFYNNLLEGRSG  426
             Q     + +   + P + A  ++  P K  RVV+TGMG+ +  G + + FY NLL+G SG
Sbjct  109   QPVHSGKAVAIAVQPTMEAAPKKKPPTKQRRVVVTGMGVETPLGDNPDVFYTNLLQGASG  168

Query  427   ISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKE  606
             IS I+ FD S+F  R AG+I  FT++G++  K  +R+D    Y L AGKKAL D  + ++
Sbjct  169   ISEIEAFDCSNFPTRIAGEIKSFTTDGWVAPKLSKRMDKFMLYMLTAGKKALADGGITED  228

Query  607   VLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEA  786
             +++ +DKT+ G +IGS  GG+ VF + +  L  S YKK+ PF +P++ TNMGSA+LA++ 
Sbjct  229   IMDELDKTKCGVLIGSAMGGMQVFNDAIEALRIS-YKKMNPFCVPFATTNMGSAMLAMDL  287

Query  787   GLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQ  966
             G MGP YSISTACAT+N+C  +AANHI +GEAD+M+ GG++A I   G+GGF+ACRALSQ
Sbjct  288   GWMGPNYSISTACATSNFCILNAANHIIRGEADMMLCGGSDAAIIPIGLGGFVACRALSQ  347

Query  967   RNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMT  1146
             RN +P +ASRPWD +RDGFV+GEG GVL++E L+HA  RGAN+ AE+LGG+ TCDA+HMT
Sbjct  348   RNSDPSKASRPWDSNRDGFVMGEGAGVLLLEELEHAKGRGANIYAEFLGGSFTCDAYHMT  407

Query  1147  EPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKM  1326
             EP   G GV  CI K+L  +GVS  +VNYINAHATST AGD+ E  A+   F +  E+ +
Sbjct  408   EPHPQGTGVILCIEKALSQSGVSRGDVNYINAHATSTPAGDLKEYQALVHCFGENQELLV  467

Query  1327  NGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDT---VPNVKKQHQ  1497
             N TKS+IGH LGA+GG+EA+AT++AI TGW+HP IN  N  P+  +DT   V   K++  
Sbjct  468   NSTKSMIGHLLGAAGGVEAVATVQAIRTGWVHPNINLEN--PDDDVDTKLLVGPEKERLD  525

Query  1498  VNVAISNSFGFGGHNSVIVFGPFK  1569
             + +A+SNSFGFGGHNS I+F P+K
Sbjct  526   IKIALSNSFGFGGHNSSILFAPYK  549



>gb|ACG25173.1| 3-oxoacyl-synthase I [Zea mays]
Length=496

 Score =   430 bits (1105),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 224/402 (56%), Positives = 303/402 (75%), Gaps = 6/402 (1%)
 Frame = +1

Query  373   FGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWR  552
              G D + FYNNLL+G SGIS I+RFD S+F  R AG+I  F+++G++  K  +R+D    
Sbjct  98    LGHDPDVFYNNLLDGVSGISEIERFDCSNFPTRIAGEIKSFSTDGWVVPKLAKRMDKFML  157

Query  553   YCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPF  732
             Y + AGKKAL +  L +E+ N +DKTR G +IGS  GG+ VF + +  L  S YKK+ PF
Sbjct  158   YLITAGKKALENGGLTEELRNELDKTRCGVLIGSAMGGMKVFNDAIEALRVS-YKKMNPF  216

Query  733   FIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggtea  912
              +P++ TNMGSA+LA++ G MGP YSISTACAT+N+C  +AANHIR+GEAD+M+ GG++A
Sbjct  217   CVPFATTNMGSAILAMDLGWMGPNYSISTACATSNFCILNAANHIRRGEADVMLCGGSDA  276

Query  913   gitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGAN  1092
              +   G+GGF+ACRALSQRN +P +ASRPWD  RDGFV+GEG GVLV+E L+HA +RGA 
Sbjct  277   PLIPIGLGGFVACRALSQRNSDPTKASRPWDMGRDGFVMGEGAGVLVLEELEHAKERGAT  336

Query  1093  VIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDI  1272
             + AE+LGG+ TCDA+HMTEP  +G G++ CI K+L DAGV+ EE+NY+NAHATST AGD+
Sbjct  337   IYAEFLGGSFTCDAYHMTEPHPEGRGITLCIEKALADAGVAREEINYVNAHATSTQAGDL  396

Query  1273  VEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEP  1452
              E  AI + F+   ++++N TKS+ GH +GA+GG+EA+A+I+AI TGW+HP +N  N  P
Sbjct  397   KEYEAIVRCFRQNPQLRVNSTKSMTGHLIGAAGGIEAVASIQAIRTGWVHPNLNLEN--P  454

Query  1453  EVTIDT---VPNVKKQHQVNVAISNSFGFGGHNSVIVFGPFK  1569
             E T+D    V + K++ +V VA+SNSFGFGGHNS I+F PFK
Sbjct  455   EDTVDVGILVGSQKERCEVKVALSNSFGFGGHNSSILFAPFK  496



>ref|XP_002989269.1| hypothetical protein SELMODRAFT_129433, partial [Selaginella 
moellendorffii]
 gb|EFJ09707.1| hypothetical protein SELMODRAFT_129433, partial [Selaginella 
moellendorffii]
Length=420

 Score =   427 bits (1097),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 223/413 (54%), Positives = 306/413 (74%), Gaps = 2/413 (0%)
 Frame = +1

Query  334   KRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYI  513
             +RVVITGMGLVS  G+D +TFY+NLLEG SGIS I  FD  +F  R AG+I  F+++G++
Sbjct  3     RRVVITGMGLVSSLGNDPDTFYDNLLEGNSGISEIQNFDCQEFPTRIAGEIKDFSADGWV  62

Query  514   DAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglgvfgngvt  693
               K  RR+D    Y L AGKKA+ +A +  +    +DK++ G ++GS  GG+ VF + + 
Sbjct  63    APKFSRRMDKFMLYLLTAGKKAVANAGIAGDGSVELDKSKCGVLMGSAMGGMQVFNDAIE  122

Query  694   tlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQ  873
              L  S Y+K+ PF +P++ TNMGSA+LA++ G MGP Y+ISTACAT+N C  SAANHI +
Sbjct  123   ALRVS-YRKMNPFCVPFATTNMGSAMLAMDLGWMGPNYAISTACATSNSCILSAANHIIR  181

Query  874   GEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLV  1053
             GEAD+M++GG++A I   G+GGF+ACRALSQRN +P +ASRPWD+DRDGFV+GEG G LV
Sbjct  182   GEADVMVSGGSDAAIIPIGLGGFVACRALSQRNDDPSKASRPWDRDRDGFVLGEGAGALV  241

Query  1054  MERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNY  1233
             +E L+HA +RGA + AE+LGG+ TCDA+H+T    +G G+  CI K+L+ +GV  ++VNY
Sbjct  242   LEELEHAKRRGAEIYAEFLGGSLTCDAYHVTAAHPEGTGMLLCIEKALDQSGVRRDDVNY  301

Query  1234  INAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTG  1413
             +NAHA ST +GD+ E  AI +   D +E+++N TKS++GH LGA+G ++AIATI+AI TG
Sbjct  302   VNAHAASTRSGDVQEYKAIMQSLGDNTELRVNSTKSMMGHLLGAAGAVDAIATIQAIKTG  361

Query  1414  WLHPTINQYNLEPEVTIDTVPNVKKQH-QVNVAISNSFGFGGHNSVIVFGPFK  1569
             WLHPTIN  N E +V +D +   +KQ   V VA+SNSFGFGGHNS I+F P++
Sbjct  362   WLHPTINIENPEKDVNMDYIVGSQKQRFDVKVALSNSFGFGGHNSSILFAPYQ  414



>gb|EMS61602.1| 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic [Triticum 
urartu]
Length=435

 Score =   427 bits (1098),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 230/420 (55%), Positives = 313/420 (75%), Gaps = 2/420 (0%)
 Frame = +1

Query  313   KRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHG  492
             KR    ++RVV+TGMG+V+  G D + FYNNLL+G SGIS I+ FD S F  R AG+I  
Sbjct  17    KRPDVKQRRVVVTGMGVVTPLGHDPDVFYNNLLDGHSGISEIETFDCSKFPTRIAGEIKS  76

Query  493   FTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglg  672
             F++EG++  K  +R+D    Y + AGKKAL +  L +EV N++DKTR G +IGS  GG+ 
Sbjct  77    FSTEGWVVPKLSKRMDKFMLYLITAGKKALENGGLTEEVRNDLDKTRCGVLIGSAMGGMK  136

Query  673   vfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYS  852
             VF + +  L  S Y+K+ PF +P++ TNMGSA+LA++ G MGP YSISTACAT+N+C  +
Sbjct  137   VFNDAIEALRVS-YRKMNPFCVPFATTNMGSAILAMDLGWMGPNYSISTACATSNFCILN  195

Query  853   AANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIG  1032
             AANHIR+GEAD+M+ GG++A +   G+GGF+ACRALSQRN +P +ASRPWD DRDGFV+G
Sbjct  196   AANHIRRGEADVMLCGGSDAPLIPIGLGGFVACRALSQRNSDPTKASRPWDMDRDGFVMG  255

Query  1033  EGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGV  1212
             EG GVLV+E L+HA +RGA + AE+LGG+ TCDA+HMTEP  +G G++ CI K+L D+GV
Sbjct  256   EGAGVLVLEELEHAKQRGATIYAEFLGGSFTCDAYHMTEPHPEGTGITLCIEKALADSGV  315

Query  1213  SPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIAT  1392
             + EE+NY+NAHATST +GD+ E  AI + F    ++++N TKS+ GH +GA+GG+EA+A 
Sbjct  316   AREEINYVNAHATSTQSGDLKEYEAIVRCFGQNPQLRVNSTKSMTGHLIGAAGGIEAVAC  375

Query  1393  IKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQH-QVNVAISNSFGFGGHNSVIVFGPFK  1569
             I+AI TGW+HP +N  N E  V +  +   +K+  +V VA+SNSFGFGGHNS I+F PFK
Sbjct  376   IQAIRTGWVHPNLNLENPEKVVDVGVLVGAEKERCEVKVALSNSFGFGGHNSSILFAPFK  435



>ref|XP_011006167.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Populus euphratica]
 ref|XP_011006168.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Populus euphratica]
Length=549

 Score =   431 bits (1108),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 229/426 (54%), Positives = 310/426 (73%), Gaps = 6/426 (1%)
 Frame = +1

Query  301   VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAG  480
             V   K+    ++RVV+TGMG+VS  G D   FYNNLL+G SG++ I+ FD + F  R AG
Sbjct  127   VVTKKKPLTRQRRVVVTGMGMVSPLGHDPGVFYNNLLQGVSGVTRIEAFDCAQFPTRIAG  186

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgf  660
             +I   +++G++  K  +R+D    Y L AGKKAL D  + ++V++ ++K + G +IGS  
Sbjct  187   EIKSLSTDGWVAPKLSKRMDKFMLYMLTAGKKALADGGITEDVMDELNKKKCGVLIGSAM  246

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GG+ VF + +  L  S YKK+ PF +P++ TNMGSA+LA++ G  GP YSISTACAT+N+
Sbjct  247   GGMKVFNDAIEALRIS-YKKMNPFCVPFATTNMGSAMLAMDLGWRGPNYSISTACATSNF  305

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
             C  +AANHI +GEAD+M+ GG++A I   G+GGF+ACRALSQRN +P RASRPW+ +RDG
Sbjct  306   CILNAANHIIRGEADVMLCGGSDAAIIPIGLGGFVACRALSQRNDDPTRASRPWNVNRDG  365

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVL++E L+HA KRGAN+ AE+LGG+ TCDA+HMT+PR DG+GV  CI K+L 
Sbjct  366   FVMGEGAGVLLLEELEHAKKRGANIYAEFLGGSFTCDAYHMTQPRPDGIGVILCIEKALS  425

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
              +G+S E+VNYINAHATST AGD+ E  A+   F   S +++N TKS+IGH LGA+G +E
Sbjct  426   QSGISKEDVNYINAHATSTPAGDLKEYQALMHCFGQNSGLRVNATKSMIGHLLGAAGAVE  485

Query  1381  AIATIKAITTGWLHPTINQYNLEPEVTIDT---VPNVKKQHQVNVAISNSFGFGGHNSVI  1551
             AIATI+AI TGW+HP IN  N  P+  +DT   V   K++  +  A+SNSFGFGGHNS I
Sbjct  486   AIATIQAIRTGWVHPNINLEN--PDQGVDTSVLVGPKKERLDIKAALSNSFGFGGHNSSI  543

Query  1552  VFGPFK  1569
             +F PFK
Sbjct  544   IFAPFK  549



>ref|XP_002950994.1| hypothetical protein VOLCADRAFT_104947 [Volvox carteri f. nagariensis]
 gb|EFJ47888.1| hypothetical protein VOLCADRAFT_104947 [Volvox carteri f. nagariensis]
Length=462

 Score =   427 bits (1099),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 241/450 (54%), Positives = 320/450 (71%), Gaps = 12/450 (3%)
 Frame = +1

Query  232   DSVAYKAQAAKKCRRIKCMISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLL  411
             D + Y+A+  +  R +    + AV    +     +RVV+TGMG+VS  G + E FYNNLL
Sbjct  17    DKLPYRARCPRAPRVVA---TAAVHDLAKTETTPRRVVVTGMGVVSCLGHEHEEFYNNLL  73

Query  412   EGRSGISLIDRFDASDFSVRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDA  591
              G+SGIS I+ F+ASD++ RFAG+I      GYI  K ++R+D   +Y +VAGKKAL DA
Sbjct  74    AGKSGISYIEGFNASDYTTRFAGEIKSLDCTGYISKKFEKRVDAVIKYIIVAGKKALGDA  133

Query  592   NLGKE--VLNNMDKTRigavigsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGS  765
              L  +   L ++++ R G +IG+  GG+  F N V  L  +GY+K+ PF IP++ITNMG 
Sbjct  134   GLAWDGPALKDLNRMRCGTLIGTAMGGMTSFANAVEALETAGYRKMNPFCIPFAITNMGG  193

Query  766   ALLAIEAGLMGPTYSISTACATANYCFYSAANHIRQGEADIMiaggteagitttgvggFI  945
             A+LA++ G MGP YSISTACAT NYC  SAA HI++G+AD+M+AG  +A I  +G+GGFI
Sbjct  194   AMLAMDLGFMGPNYSISTACATGNYCILSAAEHIKRGDADLMLAGAGDAAIIPSGIGGFI  253

Query  946   ACRALSQRNHEPERASRPWDKDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATT  1125
             AC+ALS+RN +P  ASRPWD +RDGFV+GEG  VLV+E  +HA  RGA + AEY+GGA T
Sbjct  254   ACKALSKRNDDPASASRPWDTNRDGFVMGEGAAVLVLEEYEHAKARGAPIYAEYVGGALT  313

Query  1126  CDAHHMTEPRTDGLGVSSCITKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFK  1305
             CDAHHMTEP+ +G GV  C+ ++L  +GVS E+VNY+NAHATST AGD+ E  AI +VF 
Sbjct  314   CDAHHMTEPQPEGKGVIMCLERALASSGVSAEDVNYVNAHATSTQAGDMAEYRAINRVF-  372

Query  1306  DTSEIKMNGTKSLIGHGLGASGGLEAIATIKAITTGWLHPTINQYNLEPEVTID---TVP  1476
             +  +++MN TKS+IGH LG +G +EA+A IKAI TGWLHPTIN +  +PE  +D    V 
Sbjct  373   NHEQLRMNSTKSMIGHLLGGAGAVEAVAAIKAIQTGWLHPTINLH--DPENGVDPVRVVA  430

Query  1477  NVKKQHQVNVAISNSFGFGGHNSVIVF-GP  1563
              VK+ H V VA+SNSFGFGGHNS I+F GP
Sbjct  431   GVKQHHPVKVALSNSFGFGGHNSCIMFRGP  460



>ref|XP_006416523.1| hypothetical protein EUTSA_v10007353mg [Eutrema salsugineum]
 gb|ESQ34876.1| hypothetical protein EUTSA_v10007353mg [Eutrema salsugineum]
Length=527

 Score =   430 bits (1105),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 227/429 (53%), Positives = 309/429 (72%), Gaps = 3/429 (1%)
 Frame = +1

Query  286   MISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFS  465
             M   A+   K  ++P+ RVV+TGMG+ +  G D  +FY NLL+G SGIS I+ FD S F 
Sbjct  101   MEKEAIVNKKLPTEPR-RVVVTGMGVETPLGHDPHSFYENLLQGISGISQIENFDCSAFP  159

Query  466   VRFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigav  645
              R AG+I  +++EG +  K  +R+D    Y L AGKKAL D  + ++V+  +DK+R G +
Sbjct  160   TRIAGEIKSYSTEGLVAPKLSKRMDKFMLYLLTAGKKALVDGGVTEDVMAELDKSRCGVL  219

Query  646   igsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTAC  825
             IGS  GG+ VF + +  L  S YKK+ PF +P++ TNMGSA+LA++ G MGP YSISTAC
Sbjct  220   IGSAMGGMKVFYDALEALKIS-YKKMNPFCVPFATTNMGSAMLALDLGWMGPNYSISTAC  278

Query  826   ATANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWD  1005
             AT N+C  +AANHI +GEAD+M+ GG+++ I   G+GGF+ACRALS++N +P +ASRPWD
Sbjct  279   ATGNFCILNAANHIIRGEADVMLCGGSDSVIIPIGLGGFVACRALSEKNDDPTKASRPWD  338

Query  1006  KDRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCI  1185
              +RDGFV+GEG GVL++E L+HA KRGA + AE+LGG+ TCDA+H+TEPR DG GV  CI
Sbjct  339   SNRDGFVMGEGAGVLLLEELEHAKKRGATIYAEFLGGSFTCDAYHITEPRPDGAGVILCI  398

Query  1186  TKSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGA  1365
              K+L +AG+S E++NYINAHATST AGD+ E NA+   F    E+++N TKS+IGH LGA
Sbjct  399   EKALANAGISKEDINYINAHATSTPAGDLKEYNALAHCFGQNPELRVNSTKSMIGHLLGA  458

Query  1366  SGGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQH-QVNVAISNSFGFGGHN  1542
             SG +EA+AT++AI TGW+HP IN  N +  V    +  +KK+   +  A+SNSFGFGG N
Sbjct  459   SGAVEAVATVQAIKTGWVHPNINLENPDKAVNTKLLVGLKKERLDIKAALSNSFGFGGQN  518

Query  1543  SVIVFGPFK  1569
             S I+F P+K
Sbjct  519   SSIIFAPYK  527



>gb|KDO73814.1| hypothetical protein CISIN_1g008146mg [Citrus sinensis]
Length=433

 Score =   426 bits (1095),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 230/426 (54%), Positives = 311/426 (73%), Gaps = 6/426 (1%)
 Frame = +1

Query  301   VSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAG  480
             V+  K+    +KRVV+TGMGLVS  G + + FYNNLLEG SGIS I+ FD + F  + A 
Sbjct  11    VTTKKKPHMKQKRVVVTGMGLVSPLGHEPDVFYNNLLEGVSGISEIETFDCTSFPTKIAA  70

Query  481   QIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgf  660
             +I  F+++G++  K  +R+D    Y L AGKKAL D  + ++V+N +DK++ G +IGSG 
Sbjct  71    EIKSFSTDGWVAPKLSKRMDKFMLYLLTAGKKALADGGITEDVMNELDKSKCGVLIGSGL  130

Query  661   gglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANY  840
             GG+ VF + +  L  S YKK+ PF +P++ TNMGSA+LA++ G MGP YSISTACAT+N+
Sbjct  131   GGMKVFYDAIEALRIS-YKKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNF  189

Query  841   CFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDG  1020
             C  +AANHI +GEA++M+ GG++A +   G+GGF+ACRALSQRN++P +ASRPWD +RDG
Sbjct  190   CILNAANHIIRGEANVMLCGGSDAAVIPIGLGGFVACRALSQRNNDPTKASRPWDINRDG  249

Query  1021  FVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLE  1200
             FV+GEG GVL++E L+HA KRGA + AE+ GG+ T DA+HMTEP  DG+GV  CI K+L 
Sbjct  250   FVMGEGAGVLLLEELEHAKKRGAKIYAEFRGGSFTSDAYHMTEPHPDGVGVILCIEKALA  309

Query  1201  DAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLE  1380
              +GVS E+VNYINAHATST AGDI E  A+   F     +++N TKS+IGH LGA+G +E
Sbjct  310   HSGVSREDVNYINAHATSTPAGDIKEYQALIHCFGQNRGLRVNSTKSMIGHLLGAAGAVE  369

Query  1381  AIATIKAITTGWLHPTINQYNLEPEVTIDT---VPNVKKQHQVNVAISNSFGFGGHNSVI  1551
             AIA ++AI TGW+HP IN  N  P+  +DT   V   K++ +V  A+SNSFGFGGHNS I
Sbjct  370   AIAVVQAIRTGWIHPNINLEN--PDAVVDTNVLVGPKKERLEVKAALSNSFGFGGHNSSI  427

Query  1552  VFGPFK  1569
             +F P+K
Sbjct  428   IFSPYK  433



>ref|XP_004488123.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like 
[Cicer arietinum]
Length=484

 Score =   426 bits (1096),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 237/428 (55%), Positives = 316/428 (74%), Gaps = 6/428 (1%)
 Frame = +1

Query  289   ISPAVSAPKRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSV  468
             ++P +  P +Q    +RVV+TGMG+V+  G D + FYNNLL+G SGIS ID FD ++F  
Sbjct  62    VTPMIKPPIKQ----RRVVVTGMGVVTPLGHDPDVFYNNLLDGVSGISEIDGFDCAEFPT  117

Query  469   RFAGQIHGFTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavi  648
             R AG+I  F+++G++  K  +R+D    Y L AGKKAL D  + +EV+N ++K + G +I
Sbjct  118   RIAGEIKSFSTDGWVAPKFSKRMDKFMLYMLTAGKKALVDGGITEEVMNELNKAKCGVLI  177

Query  649   gsgfgglgvfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACA  828
             GSG GG+ VF + +  L  S YKK+ PF +P++ TNMGSA+LAI+ G MGP YSISTACA
Sbjct  178   GSGMGGMQVFYDAIEALRIS-YKKMNPFCVPFATTNMGSAMLAIDLGWMGPNYSISTACA  236

Query  829   TANYCFYSAANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDK  1008
             T+N+C  +AANHI +GEAD+M+ GG++A I   G+GGF+ACRALSQRNH+P +ASRPWD 
Sbjct  237   TSNFCILNAANHIIRGEADVMLCGGSDAAIIPIGLGGFVACRALSQRNHDPTKASRPWDI  296

Query  1009  DRDGFVIGEGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCIT  1188
             +RDGFV+GEG GVL++E L+HA KRGAN+ AE+LGG+ T DA+H+TEPR DG GV  CI 
Sbjct  297   NRDGFVMGEGAGVLLLEELEHAKKRGANIYAEFLGGSFTSDAYHVTEPRPDGAGVILCIE  356

Query  1189  KSLEDAGVSPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGAS  1368
             K+L ++GVS E+VNYINAHATST AGD+ E  A+   F    E+K+N TKS+IGH LGA+
Sbjct  357   KALANSGVSREDVNYINAHATSTPAGDLKEYQALIHCFGQNPELKVNSTKSMIGHLLGAA  416

Query  1369  GGLEAIATIKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQH-QVNVAISNSFGFGGHNS  1545
             GG+EA+ATI+AI TGW+HP IN  N +  V  + +   KK+   +   +SNSFGFGGHNS
Sbjct  417   GGVEAVATIQAIKTGWVHPNINLENPDEAVDTNVLVGAKKERLDIKAGLSNSFGFGGHNS  476

Query  1546  VIVFGPFK  1569
              I+F PFK
Sbjct  477   SIIFAPFK  484



>ref|XP_006307215.1| hypothetical protein CARUB_v10008814mg [Capsella rubella]
 gb|EOA40113.1| hypothetical protein CARUB_v10008814mg [Capsella rubella]
Length=532

 Score =   427 bits (1098),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 226/420 (54%), Positives = 303/420 (72%), Gaps = 2/420 (0%)
 Frame = +1

Query  313   KRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHG  492
             K+     +RVV+TGMG+ +  G D  TFY+NLL+G SGIS I+ FD S F  R AG+I  
Sbjct  114   KKPPLESRRVVVTGMGVETPLGHDPHTFYDNLLQGISGISQIENFDCSAFPTRIAGEIKT  173

Query  493   FTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglg  672
             F++EG +  K  +R+D    Y L AGKKAL D  + ++V+  +DK++ G +IGS  GG+ 
Sbjct  174   FSTEGLVAPKLSKRMDKFMLYLLTAGKKALADGGVTEDVMAELDKSKCGVLIGSAMGGMK  233

Query  673   vfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYS  852
             VF + +  L  S Y+K+ PF +P++ TNMGSA+LAI+ G MGP YSISTACAT N+C  S
Sbjct  234   VFYDALEALKIS-YRKMNPFCVPFATTNMGSAMLAIDLGWMGPNYSISTACATGNFCILS  292

Query  853   AANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIG  1032
             AANHI +GEAD+M+ GG+++ I   G+GGF+ACRALS++N +P +ASRPWD +RDGFV+G
Sbjct  293   AANHIIRGEADVMLCGGSDSVIIPIGLGGFVACRALSEKNDDPTKASRPWDSNRDGFVMG  352

Query  1033  EGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGV  1212
             EG GVL++E L+HA KRGA + AE+LGG+ T DA+H+TEPR DG GV  CI K+L  AG+
Sbjct  353   EGAGVLLLEELEHAKKRGATIYAEFLGGSFTSDAYHITEPRPDGSGVILCIEKALAHAGI  412

Query  1213  SPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIAT  1392
             S E++NYINAHATST AGD+ E  A+   F    E+++N TKS+IGH LGASG +EA+AT
Sbjct  413   SKEDINYINAHATSTPAGDLKEYQALAHCFGQNPELRINSTKSMIGHLLGASGAVEAVAT  472

Query  1393  IKAITTGWLHPTINQYNLEPEVTIDTVPNVKKQH-QVNVAISNSFGFGGHNSVIVFGPFK  1569
             I+AI TGW+HP IN  N +  V    +  +KK+   +  A+SNSFGFGGHNS I+F P+K
Sbjct  473   IQAIKTGWVHPNINLENPDKAVDTKLLVGLKKERLDIKAALSNSFGFGGHNSSIIFAPYK  532



>dbj|BAJ91001.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   424 bits (1091),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 231/422 (55%), Positives = 313/422 (74%), Gaps = 6/422 (1%)
 Frame = +1

Query  313   KRQSDPKKRVVITGMGLVSVFGSDVETFYNNLLEGRSGISLIDRFDASDFSVRFAGQIHG  492
             KR    ++RVV+TGMG+V+  G D + FY NLL+G SGIS I+ FD S F  R AG+I  
Sbjct  77    KRPDVKQRRVVVTGMGVVTPLGHDPDVFYTNLLDGHSGISEIETFDCSKFPTRIAGEIKS  136

Query  493   FTSEGYIDAKNDRRLDHSWRYCLVAGKKALNDANLGKEVLNNMDKTRigavigsgfgglg  672
             F++EG++  K  +R+D    Y + AGKKAL +  L +EV N +DKTR G +IGS  GG+ 
Sbjct  137   FSTEGWVVPKLSKRMDKFMLYLITAGKKALENGGLTEEVRNELDKTRCGVLIGSAMGGMK  196

Query  673   vfgngvttlvQSGYKKITPFFIPYSITNMGSALLAIEAGLMGPTYSISTACATANYCFYS  852
             VF + +  L  S Y+KI PF +P++ TNMGSA+LA++ G MGP YSISTACAT+N+C  +
Sbjct  197   VFNDAIEALRVS-YRKINPFCVPFATTNMGSAILAMDLGWMGPNYSISTACATSNFCILN  255

Query  853   AANHIRQGEADIMiaggteagitttgvggFIACRALSQRNHEPERASRPWDKDRDGFVIG  1032
             AANHIR+GEAD+M+ GG++A +   G+GGF+ACRALSQRN +P +ASRPWD DRDGFV+G
Sbjct  256   AANHIRRGEADVMLCGGSDAPLIPIGLGGFVACRALSQRNSDPTKASRPWDMDRDGFVMG  315

Query  1033  EGCGVLVMERLDHAMKRGANVIAEYLGGATTCDAHHMTEPRTDGLGVSSCITKSLEDAGV  1212
             EG GVLV+E L+HA +RGA + AE+LGG+ TCDA+HMTEP  +G G++ CI K+L D+GV
Sbjct  316   EGAGVLVLEELEHAKQRGATIYAEFLGGSFTCDAYHMTEPHPEGTGITLCIEKALADSGV  375

Query  1213  SPEEVNYINAHATSTVAGDIVEVNAIKKVFKDTSEIKMNGTKSLIGHGLGASGGLEAIAT  1392
             + EE+NY+NAHATST +GD+ E  AI + F    ++++N TKS+ GH +GA+GG+EA+A 
Sbjct  376   AREEINYVNAHATSTQSGDLKEYEAIVRCFGQNPQLRVNSTKSMTGHLIGAAGGIEAVAC  435

Query  1393  IKAITTGWLHPTINQYNLEPEVTIDT---VPNVKKQHQVNVAISNSFGFGGHNSVIVFGP  1563
             ++AI TGW+HP +N  N  PE  +D    V + K++ +V VA+SNSFGFGGHNS I+F P
Sbjct  436   VQAIRTGWVHPNLNLEN--PEKVVDVGVLVGSEKERCEVKVALSNSFGFGGHNSSILFAP  493

Query  1564  FK  1569
             FK
Sbjct  494   FK  495



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5085976925088