BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15834_g2_i1 len=584 path=[1692:0-413 2106:414-583]

Length=584
                                                                      Score     E

ref|XP_011076945.1|  PREDICTED: pentatricopeptide repeat-containi...  91.7    5e-18   
gb|EYU19809.1|  hypothetical protein MIMGU_mgv1a005320mg              89.7    1e-17   
ref|XP_009612668.1|  PREDICTED: pentatricopeptide repeat-containi...  86.3    3e-16   
ref|XP_009612667.1|  PREDICTED: pentatricopeptide repeat-containi...  86.3    4e-16   
ref|XP_010523366.1|  PREDICTED: pentatricopeptide repeat-containi...  84.0    3e-15   
ref|XP_010523367.1|  PREDICTED: pentatricopeptide repeat-containi...  83.6    3e-15   
ref|XP_006296608.1|  hypothetical protein CARUB_v10013258mg           83.2    5e-15   
ref|XP_002884468.1|  pentatricopeptide repeat-containing protein      82.8    7e-15   
ref|XP_010694937.1|  PREDICTED: pentatricopeptide repeat-containi...  82.4    9e-15   
dbj|BAD95034.1|  hypothetical protein                                 82.4    9e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566237.1|  pentatricopeptide repeat-containing protein         82.0    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010660210.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    4e-14   
emb|CDY41899.1|  BnaC05g47050D                                        80.5    4e-14   
ref|XP_002266822.2|  PREDICTED: pentatricopeptide repeat-containi...  80.1    5e-14   Vitis vinifera
emb|CAN67401.1|  hypothetical protein VITISV_025967                   80.1    5e-14   Vitis vinifera
ref|XP_009767473.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    6e-14   
ref|XP_010418757.1|  PREDICTED: pentatricopeptide repeat-containi...  79.7    7e-14   
ref|XP_011038512.1|  PREDICTED: pentatricopeptide repeat-containi...  79.3    9e-14   
ref|XP_003590960.1|  Pentatricopeptide repeat-containing protein      79.0    1e-13   
ref|XP_007030407.1|  Pentatricopeptide repeat (PPR-like) superfam...  78.6    2e-13   
gb|KFK37890.1|  hypothetical protein AALP_AA3G042500                  78.2    2e-13   
ref|XP_009124196.1|  PREDICTED: pentatricopeptide repeat-containi...  78.2    2e-13   
emb|CDY50755.1|  BnaAnng10620D                                        78.2    2e-13   
ref|XP_010102224.1|  hypothetical protein L484_024505                 77.4    4e-13   
ref|XP_010463963.1|  PREDICTED: pentatricopeptide repeat-containi...  76.6    7e-13   
ref|XP_006442665.1|  hypothetical protein CICLE_v10019446mg           76.3    8e-13   
ref|XP_010485860.1|  PREDICTED: pentatricopeptide repeat-containi...  76.3    1e-12   
ref|XP_002521980.1|  pentatricopeptide repeat-containing protein,...  75.5    2e-12   Ricinus communis
ref|XP_006487702.1|  PREDICTED: pentatricopeptide repeat-containi...  75.1    2e-12   
gb|KDO44558.1|  hypothetical protein CISIN_1g047017mg                 74.7    3e-12   
ref|XP_006371094.1|  hypothetical protein POPTR_0019s03630g           74.7    3e-12   
ref|XP_007205118.1|  hypothetical protein PRUPE_ppa004835mg           73.9    5e-12   
ref|XP_008218329.1|  PREDICTED: pentatricopeptide repeat-containi...  73.9    6e-12   
gb|KDP23717.1|  hypothetical protein JCGZ_23550                       72.8    1e-11   
ref|XP_011036314.1|  PREDICTED: pentatricopeptide repeat-containi...  72.0    2e-11   
ref|XP_004236781.1|  PREDICTED: pentatricopeptide repeat-containi...  72.0    3e-11   
ref|XP_009343763.1|  PREDICTED: pentatricopeptide repeat-containi...  71.2    5e-11   
ref|XP_009364581.1|  PREDICTED: pentatricopeptide repeat-containi...  70.5    5e-11   
ref|XP_008370748.1|  PREDICTED: pentatricopeptide repeat-containi...  70.9    6e-11   
gb|KHN04951.1|  Pentatricopeptide repeat-containing protein, chlo...  70.1    9e-11   
ref|XP_009420922.1|  PREDICTED: pentatricopeptide repeat-containi...  70.5    9e-11   
ref|XP_008443759.1|  PREDICTED: pentatricopeptide repeat-containi...  70.1    1e-10   
gb|EPS74045.1|  hypothetical protein M569_00706                       69.7    1e-10   
ref|XP_009379757.1|  PREDICTED: pentatricopeptide repeat-containi...  70.1    1e-10   
ref|XP_003555568.1|  PREDICTED: pentatricopeptide repeat-containi...  69.7    1e-10   
ref|XP_009333596.1|  PREDICTED: uncharacterized protein LOC103926525  70.1    1e-10   
ref|XP_006589209.1|  PREDICTED: pentatricopeptide repeat-containi...  69.7    1e-10   
ref|XP_004142590.1|  PREDICTED: pentatricopeptide repeat-containi...  68.2    4e-10   
ref|XP_010265021.1|  PREDICTED: pentatricopeptide repeat-containi...  68.2    5e-10   
ref|XP_010024947.1|  PREDICTED: pentatricopeptide repeat-containi...  67.8    7e-10   
ref|XP_006361415.1|  PREDICTED: pentatricopeptide repeat-containi...  67.4    8e-10   
ref|XP_006408151.1|  hypothetical protein EUTSA_v10022408mg           66.2    1e-09   
ref|XP_004304772.1|  PREDICTED: pentatricopeptide repeat-containi...  65.9    2e-09   
ref|XP_008389018.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    3e-08   
ref|XP_004494750.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    5e-08   
ref|XP_007144014.1|  hypothetical protein PHAVU_007G121900g           61.2    9e-08   
gb|KHN43158.1|  Pentatricopeptide repeat-containing protein, chlo...  60.5    9e-08   
ref|XP_003521773.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    1e-07   
gb|EYU45465.1|  hypothetical protein MIMGU_mgv1a003559mg              57.0    2e-06   
ref|XP_006857320.1|  hypothetical protein AMTR_s00067p00076830        56.2    3e-06   
ref|XP_010254618.1|  PREDICTED: pentatricopeptide repeat-containi...  56.2    4e-06   
ref|XP_011071341.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    5e-06   
emb|CDO45299.1|  Pentratricopeptide repeat-containing protein         51.6    6e-06   
emb|CDG58334.1|  pentatricopeptide repeat-containing protein          51.6    6e-06   
emb|CDG58322.1|  pentatricopeptide repeat-containing protein          51.6    7e-06   
ref|XP_010917143.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    7e-06   
emb|CDO45369.1|  Pentratricopeptide repeat-containing protein         51.6    8e-06   
emb|CDO45318.1|  Pentratricopeptide repeat-containing protein         51.2    8e-06   
emb|CDO45276.1|  Pentratricopeptide repeat-containing protein         51.6    8e-06   
emb|CDG58328.1|  pentatricopeptide repeat-containing protein          51.2    8e-06   
ref|XP_008791930.1|  PREDICTED: pentatricopeptide repeat-containi...  53.9    9e-06   
emb|CDO45295.1|  Pentratricopeptide repeat-containing protein         51.2    9e-06   
emb|CDP00950.1|  unnamed protein product                              55.1    9e-06   
emb|CDO45344.1|  Pentratricopeptide repeat-containing protein         51.2    9e-06   
emb|CDG58351.1|  pentatricopeptide repeat-containing protein          51.2    9e-06   
emb|CDG58323.1|  pentatricopeptide repeat-containing protein          51.2    9e-06   
emb|CDG58321.1|  pentatricopeptide repeat-containing protein          51.2    9e-06   
emb|CDO45268.1|  Pentratricopeptide repeat-containing protein         51.2    9e-06   
emb|CDG58358.1|  pentatricopeptide repeat-containing protein          51.2    1e-05   
emb|CDG58340.1|  pentatricopeptide repeat-containing protein          51.2    1e-05   
emb|CDG58324.1|  pentatricopeptide repeat-containing protein          50.8    1e-05   
ref|XP_010544054.1|  PREDICTED: pentatricopeptide repeat-containi...  54.3    1e-05   
ref|XP_006433766.1|  hypothetical protein CICLE_v10000605mg           53.9    2e-05   
ref|XP_007018302.1|  Pentatricopeptide repeat (PPR-like) superfam...  53.9    2e-05   
emb|CDO45282.1|  Pentratricopeptide repeat-containing protein         50.1    2e-05   
emb|CDG58344.1|  pentatricopeptide repeat-containing protein          50.1    3e-05   
emb|CDO45284.1|  Pentratricopeptide repeat-containing protein         49.7    3e-05   
emb|CDG58354.1|  pentatricopeptide repeat-containing protein          49.7    3e-05   
emb|CDG58327.1|  pentatricopeptide repeat-containing protein          49.7    3e-05   
ref|NP_172461.1|  pentatricopeptide repeat-containing protein         53.1    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006856585.1|  hypothetical protein AMTR_s00046p00202770        52.8    5e-05   
ref|XP_008338987.1|  PREDICTED: pentatricopeptide repeat-containi...  52.4    6e-05   
emb|CDG58355.1|  pentatricopeptide repeat-containing protein          48.9    6e-05   
ref|XP_009366374.1|  PREDICTED: pentatricopeptide repeat-containi...  52.4    6e-05   
emb|CDG58331.1|  pentatricopeptide repeat-containing protein          48.9    6e-05   
emb|CAN61988.1|  hypothetical protein VITISV_026694                   52.0    8e-05   Vitis vinifera
ref|XP_002285611.1|  PREDICTED: pentatricopeptide repeat-containi...  52.0    8e-05   Vitis vinifera
gb|KDO81276.1|  hypothetical protein CISIN_1g043144mg                 52.0    1e-04   
ref|XP_006472405.1|  PREDICTED: pentatricopeptide repeat-containi...  51.6    1e-04   
emb|CBI19302.3|  unnamed protein product                              51.6    1e-04   
ref|XP_010490447.1|  PREDICTED: pentatricopeptide repeat-containi...  51.6    1e-04   
ref|XP_010462615.1|  PREDICTED: pentatricopeptide repeat-containi...  50.8    1e-04   
ref|XP_009800134.1|  PREDICTED: pentatricopeptide repeat-containi...  51.6    1e-04   
ref|XP_004488838.1|  PREDICTED: pentatricopeptide repeat-containi...  51.6    1e-04   
ref|XP_009148305.1|  PREDICTED: pentatricopeptide repeat-containi...  51.2    1e-04   
ref|XP_002527349.1|  pentatricopeptide repeat-containing protein,...  51.2    2e-04   Ricinus communis
ref|XP_007031149.1|  Pentatricopeptide repeat (PPR-like) superfam...  50.8    2e-04   
ref|XP_010061566.1|  PREDICTED: pentatricopeptide repeat-containi...  50.8    2e-04   
ref|XP_007222300.1|  hypothetical protein PRUPE_ppa003362mg           50.8    2e-04   
ref|XP_002302359.2|  hypothetical protein POPTR_0002s11020g           50.8    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_008657162.1|  PREDICTED: pentatricopeptide repeat-containi...  50.8    2e-04   
ref|XP_007031148.1|  Pentatricopeptide repeat (PPR-like) superfam...  50.8    2e-04   
emb|CDX94933.1|  BnaC05g07380D                                        50.4    2e-04   
emb|CDX93465.1|  BnaA06g05830D                                        50.4    2e-04   
ref|XP_006306156.1|  hypothetical protein CARUB_v10011677mg           50.4    3e-04   
emb|CDO45366.1|  Pentratricopeptide repeat-containing protein         47.4    3e-04   
ref|XP_010104578.1|  hypothetical protein L484_025557                 50.1    3e-04   
ref|XP_004501057.1|  PREDICTED: pentatricopeptide repeat-containi...  50.1    4e-04   
gb|KFK43289.1|  hypothetical protein AALP_AA1G104700                  49.7    5e-04   
ref|XP_004490467.1|  PREDICTED: pentatricopeptide repeat-containi...  49.7    5e-04   
ref|XP_002889775.1|  pentatricopeptide repeat-containing protein      49.3    6e-04   
ref|XP_008378619.1|  PREDICTED: pentatricopeptide repeat-containi...  49.3    7e-04   
ref|XP_008219211.1|  PREDICTED: pentatricopeptide repeat-containi...  48.9    0.001   
emb|CDO45296.1|  Pentratricopeptide repeat-containing protein         45.8    0.001   



>ref|XP_011076945.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Sesamum indicum]
Length=582

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+ EAI ILEEM  KGCQPNE TY +L+ GIGF GWR EA+ LAN+L + NV S +A
Sbjct  499  KAHRIGEAISILEEMVKKGCQPNETTYVLLIEGIGFAGWRVEAMELANSLYKKNVVSGQA  558

Query  403  LLGFQKTFPI  374
            L    +TFPI
Sbjct  559  LRRLNRTFPI  568



>gb|EYU19809.1| hypothetical protein MIMGU_mgv1a005320mg [Erythranthe guttata]
Length=489

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+ +A+ +LEEM  KGCQPNE +Y +L+ GIGF GWR EA+ LANTLC+  V S ++
Sbjct  406  KAHRIGDAVLMLEEMVEKGCQPNETSYVLLVEGIGFAGWRVEAMELANTLCEKGVISNQS  465

Query  403  LLGFQKTFPI  374
            L    +TFPI
Sbjct  466  LRRLDRTFPI  475



>ref|XP_009612668.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic isoform X2 [Nicotiana tomentosiformis]
Length=458

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+DEAI +L EM  KG +PNE TY +L+ GIGF GWR +A+ +AN+L Q N  SK++
Sbjct  375  KAHRIDEAIEVLREMVEKGRRPNETTYILLIEGIGFSGWRVQAMEVANSLYQKNAISKES  434

Query  403  LLGFQKTFPI  374
            L   +KTFPI
Sbjct  435  LQRLRKTFPI  444



>ref|XP_009612667.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic isoform X1 [Nicotiana tomentosiformis]
Length=586

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+DEAI +L EM  KG +PNE TY +L+ GIGF GWR +A+ +AN+L Q N  SK++
Sbjct  503  KAHRIDEAIEVLREMVEKGRRPNETTYILLIEGIGFSGWRVQAMEVANSLYQKNAISKES  562

Query  403  LLGFQKTFPI  374
            L   +KTFPI
Sbjct  563  LQRLRKTFPI  572



>ref|XP_010523366.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic isoform X1 [Tarenaya hassleriana]
Length=590

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+DEAI IL  M   GC+PNE T+++L+ GIGF GWR EA+ LAN+L ++   S KA
Sbjct  510  KAHRVDEAIDILASMVETGCRPNETTFTLLIEGIGFAGWRAEAMELANSLVRLGAVSDKA  569

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  570  FKRLNRTFPL  579



>ref|XP_010523367.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic isoform X2 [Tarenaya hassleriana]
Length=563

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+DEAI IL  M   GC+PNE T+++L+ GIGF GWR EA+ LAN+L ++   S KA
Sbjct  483  KAHRVDEAIDILASMVETGCRPNETTFTLLIEGIGFAGWRAEAMELANSLVRLGAVSDKA  542

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  543  FKRLNRTFPL  552



>ref|XP_006296608.1| hypothetical protein CARUB_v10013258mg [Capsella rubella]
 gb|EOA29506.1| hypothetical protein CARUB_v10013258mg [Capsella rubella]
Length=607

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+++AI +LE M G GC+PNE+TY+VL+ GIGF G+R EA+ LAN L +++  S+ +
Sbjct  524  KAHRIEDAIDVLESMVGNGCRPNESTYTVLIEGIGFAGYRAEAMELANDLVRIDAISEHS  583

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  584  FKRLHRTFPL  593



>ref|XP_002884468.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH60727.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=598

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+++AI +L+ M G GC+PNE TY+VL+ GIGF G+R EA+ LAN L ++N  S+ +
Sbjct  516  KAHRIEDAIDVLDSMVGNGCRPNETTYTVLIEGIGFAGYRAEAMELANDLVRINAISEYS  575

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  576  FKRLHRTFPL  585



>ref|XP_010694937.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=584

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K  RL +A+ +L  M  KGCQPNE TY++L+ GIGF GW YEA+ LANTL +M+  S  +
Sbjct  500  KEQRLADAVELLGRMVEKGCQPNETTYTLLIEGIGFAGWHYEAMELANTLMEMDAISSDS  559

Query  403  LLGFQKTFP  377
                 KTFP
Sbjct  560  FRRLSKTFP  568



>dbj|BAD95034.1| hypothetical protein [Arabidopsis thaliana]
Length=602

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+++AI +LE M G GC+PNE TY+VL+ GIGF G+R EA+ LAN L +++  S+ +
Sbjct  520  KAHRIEDAINVLESMVGNGCRPNETTYTVLIEGIGFAGYRAEAMELANDLVRIDAISEYS  579

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  580  FKRLHRTFPL  589



>ref|NP_566237.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9SR00.1|PP213_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF04902.1|AC011437_17 hypothetical protein [Arabidopsis thaliana]
 gb|AAL07067.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91709.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74132.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=602

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+++AI +LE M G GC+PNE TY+VL+ GIGF G+R EA+ LAN L +++  S+ +
Sbjct  520  KAHRIEDAINVLESMVGNGCRPNETTYTVLIEGIGFAGYRAEAMELANDLVRIDAISEYS  579

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  580  FKRLHRTFPL  589



>ref|XP_010660210.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic isoform X2 [Vitis vinifera]
Length=582

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K  R+D+AIG+  EM  KGC+PNE TY +L+ GIGF GWR EA+ LAN+L   +V S+ +
Sbjct  499  KVRRIDDAIGMFAEMIEKGCRPNETTYILLIEGIGFAGWRTEAMELANSLFSRDVISQDS  558

Query  403  LLGFQKTFPI  374
                 KTFP+
Sbjct  559  FKRLNKTFPM  568



>emb|CDY41899.1| BnaC05g47050D [Brassica napus]
Length=574

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+D+AIG+L+ M   GC+PNE TY++L+ GIGF G+R EA+ LAN L +++  S+ +
Sbjct  492  KAHRIDDAIGVLDTMVEDGCKPNETTYTMLIEGIGFAGYRAEAMELANDLVRIDAISEFS  551

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  552  FKRLHRTFPL  561



>ref|XP_002266822.2| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic isoform X1 [Vitis vinifera]
Length=592

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K  R+D+AIG+  EM  KGC+PNE TY +L+ GIGF GWR EA+ LAN+L   +V S+ +
Sbjct  509  KVRRIDDAIGMFAEMIEKGCRPNETTYILLIEGIGFAGWRTEAMELANSLFSRDVISQDS  568

Query  403  LLGFQKTFPI  374
                 KTFP+
Sbjct  569  FKRLNKTFPM  578



>emb|CAN67401.1| hypothetical protein VITISV_025967 [Vitis vinifera]
Length=592

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K  R+D+AIG+  EM  KGC+PNE TY +L+ GIGF GWR EA+ LAN+L   +V S+ +
Sbjct  509  KVRRIDDAIGMFAEMIEKGCRPNETTYILLIEGIGFAGWRTEAMELANSLFSRDVISQDS  568

Query  403  LLGFQKTFPI  374
                 KTFP+
Sbjct  569  FKRLNKTFPM  578



>ref|XP_009767473.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Nicotiana sylvestris]
Length=585

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+DEAI +L  M  KG +PNE TY +L+ GIGF GWR +A+ +A++L Q N  SK++
Sbjct  503  KAHRVDEAIEVLRVMVEKGRRPNETTYILLIEGIGFSGWRVQAMEVASSLYQKNAISKES  562

Query  403  LLGFQKTFPI  374
            +   +KTFPI
Sbjct  563  VQRLRKTFPI  572



>ref|XP_010418757.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Camelina sativa]
Length=608

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+ +AI +LE M G GC+PNE+TY+VL+ GIGF G+R EA+ LAN L +++  S  +
Sbjct  526  KAHRIVDAIDVLESMVGNGCRPNESTYTVLIEGIGFAGYRAEAMELANDLVRIDAISDYS  585

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  586  FKRLHRTFPL  595



>ref|XP_011038512.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Populus euphratica]
Length=585

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+D+AI +L  M   GCQPNE TY++L+ GIGF G R +A+ LAN+L  MN  SK +
Sbjct  505  KAHRIDDAIEVLAAMIENGCQPNETTYTLLIEGIGFSGSRAQAMELANSLYIMNAISKDS  564

Query  403  LLGFQKTFPI  374
                 KTFP+
Sbjct  565  FKRLNKTFPL  574



>ref|XP_003590960.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES61211.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=590

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K  R+ +AI +L  M  +GC PNE TY++L+ GIGF GWRY+A+ LAN L  M+  S+ +
Sbjct  509  KVQRIIDAIEVLAAMVNEGCLPNETTYTLLIQGIGFAGWRYDAMELANLLVNMDAISEDS  568

Query  403  LLGFQKTFPI  374
               FQK FP+
Sbjct  569  FKRFQKIFPV  578



>ref|XP_007030407.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma 
cacao]
 gb|EOY10909.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma 
cacao]
Length=586

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K HR+++AI +L  M  K CQPNE TY +L+ GIGF GWR EA+ LAN L +M   SK +
Sbjct  503  KVHRINDAIEVLAAMVDKRCQPNETTYILLIEGIGFAGWRSEAMELANALFRMEAISKDS  562

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  563  FKRLNRTFPL  572



>gb|KFK37890.1| hypothetical protein AALP_AA3G042500 [Arabis alpina]
Length=489

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+++AI +LE M   GC+PNE TY+V++ GIGF G+R EA+ LAN L +++  S+ +
Sbjct  406  KAHRIEDAIDVLESMVENGCRPNETTYTVIIEGIGFAGYRAEAMELANDLVRIDAISEYS  465

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  466  FKRLHRTFPL  475



>ref|XP_009124196.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Brassica rapa]
Length=572

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+++AIG+L+ M   GC+PNE TY++L+ GIGF G+R EA+ LAN L +++  S+ +
Sbjct  490  KAHRIEDAIGVLDTMVENGCKPNETTYTMLIEGIGFAGYRAEAMELANDLVRIDAISEFS  549

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  550  FKRLHRTFPL  559



>emb|CDY50755.1| BnaAnng10620D [Brassica napus]
Length=572

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+++AIG+L+ M   GC+PNE TY++L+ GIGF G+R EA+ LAN L +++  S+ +
Sbjct  490  KAHRIEDAIGVLDTMVENGCKPNETTYTMLIEGIGFAGYRAEAMELANDLVRIDAISEFS  549

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  550  FKRLHRTFPL  559



>ref|XP_010102224.1| hypothetical protein L484_024505 [Morus notabilis]
 gb|EXB93167.1| hypothetical protein L484_024505 [Morus notabilis]
Length=587

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ R+D+AI +L  M  KGC+PNE TY++L+ GIGF GWR EA+ LAN L  +   S+ +
Sbjct  504  KARRIDDAIELLAAMVEKGCRPNETTYTLLIEGIGFAGWRVEAMGLANLLFDIEAISEHS  563

Query  403  LLGFQKTFPI  374
                 KTFP+
Sbjct  564  FKRLNKTFPM  573



>ref|XP_010463963.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Camelina sativa]
Length=603

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+ +AI +LE M   GC+PNE+TY+VL+ GIGF G+R EA+ LAN L +++  S  +
Sbjct  520  KTHRIVDAIDVLESMVRNGCKPNESTYTVLIEGIGFAGYRAEAMELANDLVRIDAISDYS  579

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  580  FKRLHRTFPL  589



>ref|XP_006442665.1| hypothetical protein CICLE_v10019446mg [Citrus clementina]
 gb|ESR55905.1| hypothetical protein CICLE_v10019446mg [Citrus clementina]
Length=583

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ R++EAI +L  M  KGC+PNE TY +L+ GIG+ GWR EA+ LAN L  M+  S+  
Sbjct  500  KTRRINEAIEVLAAMFEKGCKPNETTYVLLIEGIGYGGWRAEAMELANALVSMHAISRDT  559

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  560  FKRLNRTFPL  569



>ref|XP_010485860.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Camelina sativa]
Length=610

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+ +AI +LE M G GC+PNE+T +VL+ GIGF G+R EA+ LAN L +++  S  +
Sbjct  527  KTHRIVDAIDVLESMVGNGCRPNESTSAVLIEGIGFAGYRAEAMELANDLVRIDAISDYS  586

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  587  FKRLHRTFPL  596



>ref|XP_002521980.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF40384.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=584

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K +R ++AI +L  MT KGCQPNE TY +L+ GIGF G R EA+ LAN+L  MN  S+ +
Sbjct  500  KVNRANDAIEVLAAMTEKGCQPNETTYILLIEGIGFSGLRAEAMELANSLHGMNAISEDS  559

Query  403  LLGFQKTFPI  374
                 KTFP+
Sbjct  560  FNRLNKTFPL  569



>ref|XP_006487702.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Citrus sinensis]
Length=583

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ R++E+I +L  M  KGC+PNE TY +L+ GIG+ GWR EA+ LAN L  M+  S+  
Sbjct  500  KTRRINESIEVLAAMFEKGCKPNETTYVLLIEGIGYGGWRAEAMELANALVSMHAISRDT  559

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  560  FKRLNRTFPL  569



>gb|KDO44558.1| hypothetical protein CISIN_1g047017mg, partial [Citrus sinensis]
Length=534

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ R++E+I +L  M  KGC+PNE TY +L+ GIG+ GWR EA+ LAN L  M+  S+  
Sbjct  451  KTRRINESIEVLAAMFEKGCKPNETTYVLLIEGIGYGGWRAEAMELANALVSMHAISRDT  510

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  511  FKRLNRTFPL  520



>ref|XP_006371094.1| hypothetical protein POPTR_0019s03630g [Populus trichocarpa]
 gb|ERP48891.1| hypothetical protein POPTR_0019s03630g [Populus trichocarpa]
Length=586

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K HR+D+AI +L  M   GCQPNE TY++L+ GIGF G R +A+ LAN+L  MN  S+ +
Sbjct  505  KVHRIDDAIEVLTAMIENGCQPNETTYTLLIEGIGFSGSRAQAMELANSLYSMNAISEGS  564

Query  403  LLGFQKTFPI  374
                 K FP+
Sbjct  565  YKRLNKVFPL  574



>ref|XP_007205118.1| hypothetical protein PRUPE_ppa004835mg [Prunus persica]
 gb|EMJ06317.1| hypothetical protein PRUPE_ppa004835mg [Prunus persica]
Length=489

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ R+ +AI +L EM  KGC+PNE TY +L+ GIGF GWR EA+ LAN++  +   S+ +
Sbjct  406  KTRRVVDAIQVLTEMVEKGCRPNETTYILLIEGIGFAGWRAEAMELANSVFSLRAISEDS  465

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  466  FKRLNRTFPM  475



>ref|XP_008218329.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Prunus mume]
Length=592

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ R+ +AI +L EM  KGC+PNE TY +L+ GIGF GWR EA+ LAN++  +   S+ +
Sbjct  509  KTRRVVDAIQVLTEMVEKGCRPNETTYILLIEGIGFAGWRAEAMELANSVFSLRAISEDS  568

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  569  FKRLNRTFPM  578



>gb|KDP23717.1| hypothetical protein JCGZ_23550 [Jatropha curcas]
Length=584

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K++R+++AI +L  +  KGCQPNE TY++L+ G+GF G R EA+ LAN L  MN  S+ +
Sbjct  501  KANRVNDAIEVLAAIIEKGCQPNETTYTLLIEGVGFTGLRAEAMRLANALHYMNAISEDS  560

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  561  FKRLNRTFPL  570



>ref|XP_011036314.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Populus euphratica]
Length=586

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K HR+D+AI +L  M   GCQPNE TY++L+ GIGF G R +A+ LA +L  MN  S+ +
Sbjct  505  KVHRIDDAIEVLTAMIENGCQPNETTYTLLIEGIGFSGSRAQAMELAYSLYSMNAISEDS  564

Query  403  LLGFQKTFPI  374
                 K FP+
Sbjct  565  YKRLNKVFPL  574



>ref|XP_004236781.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Solanum lycopersicum]
Length=575

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+ EAI +L EM  KGC+PNE TY +L+ GIGF G R +A+ +A  +   N  SK++
Sbjct  490  KAHRVVEAIEVLAEMVEKGCRPNETTYILLIEGIGFSGRRVQAMEMATAIYHKNAISKES  549

Query  403  LLGFQKTFPI  374
            L   +KTF +
Sbjct  550  LQRLRKTFQV  559



>ref|XP_009343763.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Pyrus x bretschneideri]
Length=633

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/70 (43%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ R+ +AI +L  M  KGC+PNE TY++L+ GIGF GWR EA+ LA+++  +   S+ +
Sbjct  550  KTRRIVDAIEVLAAMVEKGCRPNETTYTLLIEGIGFAGWRAEAMQLAHSVFSLRAISEDS  609

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  610  FRRLNRTFPM  619



>ref|XP_009364581.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Pyrus x bretschneideri]
Length=426

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ R+  AI +L  M  KGC+PNE TY++L+ GIGF GW+ EA+ LAN++  +   S+ +
Sbjct  343  KTPRIVNAIEVLAAMVEKGCRPNETTYTLLIEGIGFAGWQAEAMELANSVSSLRAISEDS  402

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  403  FTLLNRTFPM  412



>ref|XP_008370748.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Malus domestica]
 ref|XP_008355828.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Malus domestica]
Length=633

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/70 (43%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ R+ +AI +L  M  KGC+PNE TY++L+ GIGF GWR EA+ LA+++  +   S+ +
Sbjct  550  KTRRIVDAIEVLAAMVEKGCRPNETTYTLLIEGIGFAGWRAEAMQLAHSVFSIRAISEDS  609

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  610  FRRLNRTFPM  619



>gb|KHN04951.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=474

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+ +AI +L  M   GCQPNE TY++L+ G+G+ GWR  A+ LA +L  MN  S+  
Sbjct  403  KAHRIVDAIEVLAVMVDNGCQPNETTYTLLVEGVGYAGWRSYAVELAKSLVSMNAISQDL  462

Query  403  LLGFQK  386
                QK
Sbjct  463  FRRLQK  468



>ref|XP_009420922.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, 
chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=1025

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -2

Query  583   KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
             K HR+D AI IL EM  KGC+ NE TY +L+ GI + G + EA+ LA  L   NVFS+ +
Sbjct  944   KVHRIDMAINILAEMMDKGCRTNETTYIILVEGIAYAGHKAEAMELAKDLAMRNVFSEDS  1003

Query  403   LLGFQKTFPI  374
             L    + FPI
Sbjct  1004  LKRLNQNFPI  1013



>ref|XP_008443759.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Cucumis melo]
Length=581

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+ E I +L  M  KGC PNE +Y +L+ GI + GWR EA+ LAN+L ++ V S+ +
Sbjct  493  KAHRVFEGIELLITMVEKGCPPNETSYVLLIEGIAYAGWRAEAMELANSLYRLGVISEDS  552

Query  403  LLGFQKTFPI  374
                 KTFP+
Sbjct  553  SKRLNKTFPM  562



>gb|EPS74045.1| hypothetical protein M569_00706, partial [Genlisea aurea]
Length=515

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMT--GKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSK  410
            K+HR+DEA+ +L EM   G  C+PNE ++ +L+ GIGF GW  EA+ +A+ L Q +V S 
Sbjct  441  KAHRMDEAVEVLAEMVEGGGDCEPNETSFVLLIEGIGFSGWPVEAMEIASCLHQRDVIST  500

Query  409  KALLGFQKTFPI  374
             +L     TFP+
Sbjct  501  SSLKRLTVTFPL  512



>ref|XP_009379757.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Pyrus x bretschneideri]
Length=705

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/70 (43%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ R+ +AIG+L  M  KGC+ NE T+++L+ GIGF GWR EA+ L N++  +   S+ +
Sbjct  622  KTRRIVDAIGVLAAMVEKGCRANETTHTLLIEGIGFAGWRAEAMELDNSVFSLRAISEDS  681

Query  403  LLGFQKTFPI  374
            L    +TFP+
Sbjct  682  LRRLNRTFPM  691



>ref|XP_003555568.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Glycine max]
Length=576

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+ +AI +L  M   GCQPNE TY++L+ G+G+ GWR  A+ LA +L  MN  S+  
Sbjct  505  KAHRIVDAIEVLAVMVDNGCQPNETTYTLLVEGVGYAGWRSYAVELAKSLVSMNAISQDL  564

Query  403  LLGFQK  386
                QK
Sbjct  565  FRRLQK  570



>ref|XP_009333596.1| PREDICTED: uncharacterized protein LOC103926525 [Pyrus x bretschneideri]
Length=926

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ R+  AI  L  M  KGC+PNE TY++L+ GIGF GWR EA+ LAN++  +   S+ +
Sbjct  843  KTPRIVNAIEALAAMVEKGCRPNETTYTLLIEGIGFAGWRAEAMELANSVFSLRAISEDS  902

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  903  FRRLNRTFPM  912



>ref|XP_006589209.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Glycine max]
 gb|KHN14814.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=561

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+ +AI +L  M   GCQPNE TY++L+ G+G+ GWR  A+ LA +L  MN  S+  
Sbjct  490  KAHRIVDAIEVLAVMVDNGCQPNETTYTLLVEGVGYAGWRSYAVELAKSLVSMNAISQDL  549

Query  403  LLGFQK  386
                QK
Sbjct  550  FRRLQK  555



>ref|XP_004142590.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Cucumis sativus]
 gb|KGN66736.1| hypothetical protein Csa_1G666460 [Cucumis sativus]
Length=581

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+ E I +L  M  KGC PNE +Y +L+ GI + GWR EA+ LAN+L ++ V S  +
Sbjct  493  KAHRVFEGIELLITMVEKGCLPNETSYVLLIEGIAYAGWRAEAMELANSLYRLGVISGDS  552

Query  403  LLGFQKTFPI  374
                 KTFP+
Sbjct  553  SKRLNKTFPM  562



>ref|XP_010265021.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic [Nelumbo nucifera]
Length=582

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+D AI +L  M  KGC+PNE T  +L+ GI + GWR EA+ LAN L    V S  A
Sbjct  499  KAHRIDNAIDLLVVMVKKGCRPNETTCILLIEGIAYAGWRGEAMELANALFSREVISIDA  558

Query  403  LLGFQKTFPI  374
            +    + FP+
Sbjct  559  VKRLNRIFPM  568



>ref|XP_010024947.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Eucalyptus grandis]
 gb|KCW61500.1| hypothetical protein EUGRSUZ_H04228 [Eucalyptus grandis]
Length=584

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K  R+D+AI +L  M  KG +PNE T+ +L+ GI F GWR EA+ LAN+L  ++  S+ +
Sbjct  502  KVSRIDDAIEVLAVMVEKGIRPNETTFILLIEGISFAGWRAEAMELANSLTAIDAISEDS  561

Query  403  LLGFQKTFPI  374
                ++TFP+
Sbjct  562  FKRLKRTFPM  571



>ref|XP_006361415.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Solanum tuberosum]
Length=583

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+HR+ EAI +L EM  KG +PNE TY +L+ GIGF G R +A+ +A+ +   N  SK++
Sbjct  495  KAHRVVEAIEVLAEMVEKGRRPNETTYILLIEGIGFSGRRVQAMEMASAIYHKNAISKES  554

Query  403  LLGFQKTFPI  374
            L   +KTF +
Sbjct  555  LQRLRKTFQV  564



>ref|XP_006408151.1| hypothetical protein EUTSA_v10022408mg, partial [Eutrema salsugineum]
 gb|ESQ49604.1| hypothetical protein EUTSA_v10022408mg, partial [Eutrema salsugineum]
Length=460

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTL  434
            K+HR+++AI +LE M   GC+PNE TY++L+ GIGF G+R EA+ LAN L
Sbjct  374  KAHRIEDAIDVLESMVENGCRPNETTYTMLIEGIGFAGYRAEAMELANDL  423



>ref|XP_004304772.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=586

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ R+ +AI +   M  KGC+PNE TY +L+ GIGF GWR EA+ LA ++  ++   + +
Sbjct  503  KARRIVDAIEVFTAMVEKGCRPNETTYILLIEGIGFAGWRAEAMELAKSVYSLSAICEDS  562

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  563  FKRLSRTFPM  572



>ref|XP_008389018.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Malus domestica]
Length=673

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ R+ +AI +L  M  KGC+PNE T ++L+ GIGF G R EA+ LAN++       + +
Sbjct  590  KTRRIVDAIEVLAAMVXKGCRPNETTXTLLIEGIGFAGXRAEAMELANSVFSXXAIXEDS  649

Query  403  LLGFQKTFPI  374
                 +TFP+
Sbjct  650  FXXLNRTFPM  659



>ref|XP_004494750.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Cicer arietinum]
Length=591

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K  R+D+AI +L  M  +GC PNE TY VL+ GIG+ GW  +A+ L ++L  +    +  
Sbjct  509  KVRRIDDAIEVLATMVDRGCMPNETTYLVLIEGIGYAGWPNDAMELGSSLVSLGAIHQHT  568

Query  403  LLGFQKTFPI  374
                 K FP+
Sbjct  569  FKRLFKIFPM  578



>ref|XP_007144014.1| hypothetical protein PHAVU_007G121900g [Phaseolus vulgaris]
 gb|ESW16008.1| hypothetical protein PHAVU_007G121900g [Phaseolus vulgaris]
Length=570

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSK  410
            K+HR+ +AI +L  M   GCQPN+ TY++L+ GI + GW  +A+ LA +L  M   S+
Sbjct  499  KAHRIVDAIEVLAVMVDNGCQPNQTTYTLLVEGISYAGWPSDAVELAKSLSSMKAISQ  556



>gb|KHN43158.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=344

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -2

Query  574  RLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKALLG  395
            R+ +A  +L  M  KGC PNE TY+ L+ GIGF GW  +A  LA TL  M+  S+ +   
Sbjct  267  RVSDATEVLAAMVDKGCLPNETTYTFLIEGIGFGGWLNDARDLATTLVNMDAISEHSFER  326

Query  394  FQKTF  380
              KTF
Sbjct  327  LYKTF  331



>ref|XP_003521773.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Glycine max]
 gb|KHN35321.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=570

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K  R+ +AI +L  M  KGC+PNE TY+ L+ GIGF G   +A  LA TL  M+  S+ +
Sbjct  490  KVSRVSDAIEVLAAMVDKGCRPNETTYTFLIEGIGFGGCLNDARDLATTLVNMDAISEHS  549

Query  403  LLGFQKTF  380
                 KTF
Sbjct  550  FERLYKTF  557



>gb|EYU45465.1| hypothetical protein MIMGU_mgv1a003559mg [Erythranthe guttata]
Length=578

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ + D AI  L  M  KGC+P E+TY++L+ G+ + G+  EA+ L N LC   V  K +
Sbjct  511  KARKTDRAINFLVHMVSKGCKPTESTYTILIEGLAYEGFTKEALELLNELCSRGVVKKSS  570



>ref|XP_006857320.1| hypothetical protein AMTR_s00067p00076830 [Amborella trichopoda]
 gb|ERN18787.1| hypothetical protein AMTR_s00067p00076830 [Amborella trichopoda]
Length=602

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K HR+D  I +L +M  +GC P E TY +L+ G+ + G   EA+ L   L    VFSK++
Sbjct  495  KMHRIDMCIDMLAKMVERGCLPIEATYVILIEGVAYDGLLAEAVGLVEALLTRGVFSKES  554

Query  403  LLGFQKTFPIHAS  365
            L    KT  +  S
Sbjct  555  LKRLYKTLSMLES  567



>ref|XP_010254618.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Nelumbo nucifera]
Length=624

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            KS + D AI  L  M  KGC+P E TY++L+ GI + G   EA+ L N LC   V  K +
Sbjct  557  KSRQTDRAIDFLAYMVSKGCKPTEATYTILIEGIAYEGLAKEALELLNELCARGVVKKSS  616



>ref|XP_011071341.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Sesamum indicum]
Length=600

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ + D AI  L  M  KGC+P E+TY++L+ G+ + G+  EA+ L N LC   V  K +
Sbjct  533  KARQTDRAIDFLVYMVSKGCKPTESTYTILIEGLAYEGFTKEALELLNELCSRGVVKKSS  592



>emb|CDO45299.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
diemontianum]
 emb|CDO45300.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
diemontianum]
Length=76

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPTEATYTILIEGVAYEGMAKEALELLSELCSRGVMKKSS  59



>emb|CDG58334.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
flexuosum]
 emb|CDG58337.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
lanigerum var. laevigatum]
 emb|CDG58343.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
modestum]
 emb|CDO45298.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
diemontianum]
 emb|CDO45306.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
flexuosum]
 emb|CDO45307.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
foedum]
 emb|CDO45308.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
foedum]
 emb|CDO45309.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
foedum]
 emb|CDO45315.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
lanigerum var. laevigatum]
 emb|CDO45316.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
lanigerum var. laevigatum]
 emb|CDO45317.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
lanigerum var. lanigerum]
 emb|CDO45319.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
lanigerum var. lanigerum]
 emb|CDO45339.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
procerum]
 emb|CDO45351.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
salignum]
 emb|CDO45352.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
salignum]
 emb|CDO45367.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
stelligerum]
 emb|CDO45368.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
stelligerum]
Length=76

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPTEATYTILIEGVAYEGMAKEALELLSELCSRGVMKKSS  59



>emb|CDG58322.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
barkerae]
 emb|CDO45271.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
burchellii]
 emb|CDO45285.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
cordatum]
 emb|CDO45305.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
elimense subsp. vyeboomense]
 emb|CDO45342.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
pubibracteolatum]
 emb|CDO45371.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
sp. JT-2014b]
 emb|CDO45372.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
sp. JT-2014b]
 emb|CDO45373.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
tradouwense]
Length=76

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPTEATYTILIEGVAYEGMAKEALELLSXLCSRGVMKKSS  59



>ref|XP_010917143.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Elaeis guineensis]
Length=585

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            KS + D AI     M  KGC PNE+TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  518  KSRQTDRAIDFFAYMVSKGCMPNESTYTILIEGMAYEGMSKEALDLLSELCSRGVVKKSS  577

Query  403  L  401
            +
Sbjct  578  M  578



>emb|CDO45369.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
strobilinum]
Length=76

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPXEATYTILIEGVAYEGMAKEALXLLSELCSRGVMKKSS  59



>emb|CDO45318.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
lanigerum var. lanigerum]
Length=73

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = -2

Query  568  DEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            D A+  L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  2    DRAVDFLAYMVSKGCKPTEATYTILIEGVAYEGMAKEALELLSELCSRGVMKKSS  56



>emb|CDO45276.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
chamelaea]
Length=76

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPTEATYTILIEGVAYEGMAKEALELLSELCSRGVMKKSS  59



>emb|CDG58328.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
discolor]
Length=76

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMISKGCKPTEATYTILIEGVAYEGMAKEALELLSELCSRGVMKKSS  59



>ref|XP_008791930.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like, 
partial [Phoenix dactylifera]
Length=234

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            KS + D AI     M  KGC PNE+TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  159  KSRQTDRAIDFFAYMVLKGCMPNESTYTILIEGLAYEGMSKEALELLSELCSRGVVKKSS  218

Query  403  L  401
            +
Sbjct  219  M  219



>emb|CDO45295.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
cryptocephalum]
 emb|CDO45297.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
cryptocephalum]
Length=76

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPTEATYTILIEGVAYEGMAKEALELLSELCSRGVMKKSS  59



>emb|CDP00950.1| unnamed protein product [Coffea canephora]
Length=626

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ + D AI  L  M  KGC+P E+TY++L+ GI + G   EA+ L N LC   V  + +
Sbjct  404  KARQTDRAIDFLAYMVSKGCKPTESTYTILIEGIAYEGLANEALELLNELCSRGVVKRSS  463



>emb|CDO45344.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
radiatum]
 emb|CDO45345.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
radiatum]
 emb|CDO45347.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
radiatum]
Length=76

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPTEATYTILIEGVAYEGMAKEALELLSELCSRGVMKKSS  59



>emb|CDG58351.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
sericeum]
Length=76

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPTEATYTILIEGVAYEGMXKEALELLSELCSRGVMKKSS  59



>emb|CDG58323.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
brunioides var. brunioides]
Length=76

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPTEATYTILIEGVAYEGMAKEALELLSELCSRGVMKKSS  59



>emb|CDG58321.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
album]
 emb|CDG58325.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
chamelaea]
 emb|CDG58326.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
conicum]
 emb|CDG58329.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
dregei]
 emb|CDG58330.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
dubium]
 emb|CDG58333.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
ericifolium]
 emb|CDG58335.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
floridum]
 emb|CDG58338.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
laureolum]
 emb|CDG58339.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
loranthifolium]
 emb|CDG58341.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
meyerianum]
 emb|CDG58345.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
nervosum]
 emb|CDG58346.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
nitidum]
 emb|CDG58347.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
osbornei]
 emb|CDG58349.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
roodii]
 emb|CDG58350.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
rubrum]
 emb|CDG58353.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
singulare]
 emb|CDG58356.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
stellare]
 emb|CDG58357.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
thymifolium]
 emb|CDG58359.1| pentatricopeptide repeat-containing protein, partial [Paranomus 
spathulatus]
 emb|CDO45264.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
album]
 emb|CDO45265.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
arcuatum]
 emb|CDO45266.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
argenteum]
 emb|CDO45267.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
barkerae]
 emb|CDO45269.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
brunioides var. brunioides]
 emb|CDO45270.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
brunioides var. flumenlupimum]
 emb|CDO45273.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
cadens]
 emb|CDO45274.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
cadens]
 emb|CDO45275.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
chamelaea]
 emb|CDO45277.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
chamelaea]
 emb|CDO45278.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
cinereum]
 emb|CDO45279.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
cinereum]
 emb|CDO45280.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
cinereum]
 emb|CDO45281.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
cinereum]
 emb|CDO45283.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
concavum]
 emb|CDO45286.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
cordatum]
 emb|CDO45287.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
cordatum]
 emb|CDO45288.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
coriaceum]
 emb|CDO45289.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
coriaceum]
 emb|CDO45290.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
coriaceum]
 emb|CDO45291.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
corymbosum]
 emb|CDO45293.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
crassulifolium]
 emb|CDO45301.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
dregei]
 emb|CDO45302.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
dubium]
 emb|CDO45303.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
dubium]
 emb|CDO45310.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
galpinii]
 emb|CDO45313.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
gydoense]
 emb|CDO45314.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
gydoense]
 emb|CDO45320.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
levisanus]
 emb|CDO45321.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
linifolium]
 emb|CDO45322.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
loranthifolium]
 emb|CDO45323.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
meyerianum]
 emb|CDO45324.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
meyerianum]
 emb|CDO45329.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
nervosum]
 emb|CDO45330.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
nervosum]
 emb|CDO45332.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
olens]
 emb|CDO45333.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
olens]
 emb|CDO45340.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
pubescens]
 emb|CDO45341.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
pubibracteolatum]
 emb|CDO45343.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
pubibracteolatum]
 emb|CDO45348.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
roodii]
 emb|CDO45349.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
rourkei]
 emb|CDO45350.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
salicifolium]
 emb|CDO45353.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
sericeum]
 emb|CDO45354.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
sheilae]
 emb|CDO45355.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
sheilae]
 emb|CDO45356.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
sheilae]
 emb|CDO45357.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
sheilae]
 emb|CDO45358.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
singulare]
 emb|CDO45359.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
sorocephalodes]
 emb|CDO45360.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
sorocephalodes]
 emb|CDO45361.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
sorocephalodes]
 emb|CDO45365.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
stellare]
 emb|CDO45370.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
thymifolium]
 emb|CDO45374.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
uliginosum subsp. glabratum]
 emb|CDO45375.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
uliginosum subsp. uliginosum]
 emb|CDO45377.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
xanthoconus]
Length=76

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPTEATYTILIEGVAYEGMAKEALELLSELCSRGVMKKSS  59



>emb|CDO45268.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
brunioides var. brunioides]
Length=76

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPTEATYTILIEGVAYEGMAKEALELLSELCSRGVMKKSS  59



>emb|CDG58358.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
verticillatum]
 emb|CDO45376.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
verticillatum]
Length=73

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPTEATYTILIEGVAYEGMANEALELLSELCSRGVMKKSS  59



>emb|CDG58340.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
meridianum]
 emb|CDG58342.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
microcephalum]
 emb|CDO45294.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
cryptocephalum]
 emb|CDO45326.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
microcephalum]
 emb|CDO45327.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
microcephalum]
Length=76

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPTEATYTILIEGVAYEGMAKEALELLSELCSRGVMKKSS  59



>emb|CDG58324.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
burchellii]
 emb|CDG58332.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
elimense subsp. vyeboomense]
 emb|CDG58352.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
sessile]
 emb|CDO45272.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
burchellii]
 emb|CDO45304.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
sp. JT-2014a]
 emb|CDO45311.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
glaberrimum subsp. erubescens]
 emb|CDO45312.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
glaberrimum subsp. erubescens]
 emb|CDO45331.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
nitidum]
 emb|CDO45334.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
orientale]
 emb|CDO45335.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
orientale]
Length=76

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPTEATYTILIEGVAYEGMAKEALELLSGLCSRGVMKKSS  59



>ref|XP_010544054.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Tarenaya hassleriana]
Length=596

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K  R D AI  L  M  +GC+PNE TY++L+ GI + G+  EA+ L N LC+  +  + +
Sbjct  529  KKRRTDNAIEFLGYMIERGCKPNEATYTILIEGIAYEGFAKEALELLNELCRKGLMKRSS  588



>ref|XP_006433766.1| hypothetical protein CICLE_v10000605mg [Citrus clementina]
 gb|ESR47006.1| hypothetical protein CICLE_v10000605mg [Citrus clementina]
Length=619

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ +   AI IL +M  +GC+P E TY++L+ GI + G   EA+ L N LC   V  K +
Sbjct  552  KARQTYRAIDILADMVTRGCKPTEATYTILIEGIAYEGLAKEALDLLNQLCSRGVVKKSS  611



>ref|XP_007018302.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma 
cacao]
 gb|EOY15527.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma 
cacao]
Length=606

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ + D AI  L  M  +GC+P E+TY++L+ G+ + G+  EA+ L N LC   V  K +
Sbjct  539  KARQTDRAIDFLAYMVMRGCKPTESTYTILIEGLAYEGFANEALELLNELCSRGVVKKSS  598



>emb|CDO45282.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
comosum subsp. comosum]
Length=76

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   +A+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPTEATYTILIEGVAYEGMAKQALELLSELCSRGVMKKSS  59



>emb|CDG58344.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
muirii]
 emb|CDG58348.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
platyspermum]
 emb|CDO45328.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
muirii]
 emb|CDO45337.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
platyspermum]
 emb|CDO45338.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
platyspermum]
Length=76

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   +A+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPTEATYTILIEGVAYEGMAKQALELLSELCSRGVMKKSS  59



>emb|CDO45284.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
conicum]
 emb|CDO45325.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
microcephalum]
 emb|CDO45363.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
spissifolium subsp. fragrans]
 emb|CDO45364.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
spissifolium subsp. philipsii]
Length=76

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  +GC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSQGCKPTEATYTILIEGVAYEGMAKEALELLSELCSRGVMKKSS  59



>emb|CDG58354.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
spissifolium subsp. spissifolium]
Length=76

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 32/59 (54%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M   GC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSXGCKPTEATYTILIEGVAYEGMAKEALXLLSELCSRGVMKKSS  59



>emb|CDG58327.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
corymbosum]
 emb|CDO45292.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
corymbosum]
Length=76

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 32/59 (54%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY+ L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPTEATYTXLIEGVAYEGMAKEALELLSELCSRGVMKKSS  59



>ref|NP_172461.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q3EDF8.1|PPR28_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g09900 
[Arabidopsis thaliana]
 gb|AEE28512.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=598

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            KS + D AI  L  M  +GC+PNE +Y++L+ G+ + G   EA+ L N LC   +  K +
Sbjct  531  KSRQTDRAIDFLVFMINRGCKPNETSYTILIEGLAYEGMAKEALELLNELCNKGLMKKSS  590



>ref|XP_006856585.1| hypothetical protein AMTR_s00046p00202770 [Amborella trichopoda]
 gb|ERN18052.1| hypothetical protein AMTR_s00046p00202770 [Amborella trichopoda]
Length=585

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ R  +AI  L  M  KGC+P E+TY++L+ G+   G   EA+ L N LC+  V  + +
Sbjct  518  KAQRTGQAIDFLAHMVSKGCKPTESTYTILIEGVANEGRPKEALNLLNELCERGVVKRSS  577



>ref|XP_008338987.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Malus domestica]
Length=613

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ +   AI  L  M  KGCQP E TY++L+ GI + G   EA+ L N LC   V  K +
Sbjct  546  KAKQAGRAIDFLAYMVSKGCQPTEATYTILIEGIAYEGLAKEALELLNELCYRGVVKKSS  605



>emb|CDG58355.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
spissifolium subsp. fragrans]
 emb|CDO45362.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
spissifolium subsp. fragrans]
Length=76

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 32/59 (54%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M   GC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSXGCKPTEATYTILIEGVAYEGMAKEALELLSELCSRGVMKKSS  59



>ref|XP_009366374.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Pyrus x bretschneideri]
Length=613

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ +   AI  L  M  KGCQP E TY++L+ GI + G   EA+ L N LC   V  K +
Sbjct  546  KAKQTGRAIDFLAYMVSKGCQPTEVTYTILIEGIAYEGLTKEALDLLNELCYRGVVKKSS  605



>emb|CDG58331.1| pentatricopeptide repeat-containing protein, partial [Leucadendron 
elimense subsp. salteri]
Length=76

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 32/59 (54%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A   L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  1    ARQTDRAXDFLAYMVSKGCKPTEATYTILIEGVAYEGMAKEALELLSGLCSRGVMKKSS  59



>emb|CAN61988.1| hypothetical protein VITISV_026694 [Vitis vinifera]
Length=553

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            KS + D AI  L  M  K C+P E TY++L+ GI + G   EA+ L N LC   +  K +
Sbjct  486  KSRQTDRAIDFLAYMISKRCKPTEATYTILIEGIAYEGLAKEALDLLNELCSRGLVKKSS  545



>ref|XP_002285611.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Vitis vinifera]
Length=610

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            KS + D AI  L  M  K C+P E TY++L+ GI + G   EA+ L N LC   +  K +
Sbjct  543  KSRQTDRAIDFLAYMISKRCKPTEATYTILIEGIAYEGLAKEALDLLNELCSRGLVKKSS  602



>gb|KDO81276.1| hypothetical protein CISIN_1g043144mg, partial [Citrus sinensis]
Length=580

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ +   AI IL +M  + C+P E TY++L+ GI + G   EA+ L N LC   V  K +
Sbjct  513  KARQTYRAIDILADMVTRSCKPTEATYTILIEGIAYEGLAKEALDLLNQLCSRGVVKKSS  572



>ref|XP_006472405.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Citrus sinensis]
Length=619

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ +   AI IL +M  + C+P E TY++L+ GI + G   EA+ L N LC   V  K +
Sbjct  552  KARQTYRAIDILADMVTRSCKPTEATYTILIEGIAYEGLAKEALDLLNQLCSRGVVKKSS  611



>emb|CBI19302.3| unnamed protein product [Vitis vinifera]
Length=609

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            KS + D AI  L  M  K C+P E TY++L+ GI + G   EA+ L N LC   +  K +
Sbjct  374  KSRQTDRAIDFLAYMISKRCKPTEATYTILIEGIAYEGLAKEALDLLNELCSRGLVKKSS  433



>ref|XP_010490447.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Camelina sativa]
Length=600

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ + D AI  L  M  +GC+P E +Y++L+ GI + G   EA+ L N LC   +  K +
Sbjct  533  KTRQTDRAIDFLVYMINRGCKPTETSYTILIEGIAYEGMPKEALELLNELCNKGLMKKSS  592



>ref|XP_010462615.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Camelina sativa]
Length=229

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ + D AI  L  M  +GC P E +Y++L+ GI + G   EA+ L N LC   +  K +
Sbjct  162  KTRQTDRAIDFLVYMINRGCTPTETSYTILIEGIAYEGMAKEALELLNELCNKGLMKKSS  221



>ref|XP_009800134.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Nicotiana sylvestris]
Length=587

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ +   AI  L  M  KGC+P E+TY++L+ GI + G   EA+ L N LC   V  K +
Sbjct  520  KARQTVRAIDFLAYMISKGCKPTESTYTILIEGIAYEGLAEEALDLLNELCCRGVMKKSS  579



>ref|XP_004488838.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic-like [Cicer arietinum]
Length=572

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 34/61 (56%), Gaps = 0/61 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            KSH++D +I + + M  KGC PNE TY++L+ GI F      A  L   LC   V SK  
Sbjct  498  KSHKIDLSIEVFQMMVNKGCMPNEITYTILVEGIAFEEENDLAASLLKELCLKGVLSKNT  557

Query  403  L  401
            +
Sbjct  558  V  558



>ref|XP_009148305.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Brassica rapa]
Length=593

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ + D AI  L  M  +GC+P E +Y++L+ GI + G   EA+ L N LC   +  + +
Sbjct  523  KTRQTDRAIDFLVYMINRGCKPTETSYTILIEGIAYEGMAKEALELVNELCNKGLMKRSS  582



>ref|XP_002527349.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF35021.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=443

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ + D AI  L  M  +GC+P E +Y++L+ G+ + G   EA+ L N LC   V  K +
Sbjct  376  KARKTDRAIDFLAYMVQRGCKPTEASYTILIEGLAYEGLAKEALELLNELCLRGVVKKSS  435



>ref|XP_007031149.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 
2 [Theobroma cacao]
 ref|XP_007031150.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOY11651.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOY11652.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 
2 [Theobroma cacao]
Length=448

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = -2

Query  574  RLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQ  428
            RLDEAIG+L+EM G G +PN  TY+VL+NG G  G   EA  L + + +
Sbjct  189  RLDEAIGLLDEMVGLGLKPNVVTYNVLINGFGKKGKMKEATDLFDNIVK  237



>ref|XP_010061566.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Eucalyptus grandis]
 gb|KCW68536.1| hypothetical protein EUGRSUZ_F02164 [Eucalyptus grandis]
Length=620

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/60 (37%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ + D AI +L+ M  + C+P E TY++L+ GI   G+  EA+ L N LC   V  + +
Sbjct  553  KTRQTDRAIDLLDYMVSRKCKPTEATYTILIEGIAHEGFAKEALQLLNELCTRGVVKRSS  612



>ref|XP_007222300.1| hypothetical protein PRUPE_ppa003362mg [Prunus persica]
 gb|EMJ23499.1| hypothetical protein PRUPE_ppa003362mg [Prunus persica]
Length=581

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ +   AI  L  M  KGC+P E TY++L+ GI + G   EA+ L N LC   V  K +
Sbjct  514  KAKQTGRAIDFLAYMVSKGCKPTEATYTILIEGIAYEGLAKEALELLNELCCRGVVKKSS  573



>ref|XP_002302359.2| hypothetical protein POPTR_0002s11020g [Populus trichocarpa]
 gb|EEE81632.2| hypothetical protein POPTR_0002s11020g [Populus trichocarpa]
Length=637

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ + D AI  L  M  KGC+P E +Y++L+ GI   G   EA+ L N LC   V  K +
Sbjct  570  KAQQTDRAIDFLAYMISKGCKPTEVSYTILIEGIANEGLAKEALELLNELCSRGVVKKSS  629



>ref|XP_008657162.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Zea mays]
 ref|XP_008657163.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Zea mays]
 ref|XP_008657164.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Zea mays]
 ref|XP_008657166.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Zea mays]
 gb|AFW84888.1| hypothetical protein ZEAMMB73_407218 [Zea mays]
Length=668

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 0/58 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSK  410
            K H +D AI  L  M   GC PNE+TY +L+ G+   G   EA  L + LC   V SK
Sbjct  606  KRHEIDNAIDFLAYMVSNGCMPNESTYIILIEGLAREGLLKEAQDLLSMLCSRGVVSK  663



>ref|XP_007031148.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY11650.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=587

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  574  RLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNV  419
            RLDEAIG+L+EM G G +PN  TY+VL+NG G  G   EA  L + + +  +
Sbjct  328  RLDEAIGLLDEMVGLGLKPNVVTYNVLINGFGKKGKMKEATDLFDNIVKKGI  379



>emb|CDX94933.1| BnaC05g07380D [Brassica napus]
Length=590

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ + D AI  L  M  +GC+P E +Y++L+ GI + G   EA+ L N LC   +  + +
Sbjct  520  KTRQTDRAIDFLVYMINRGCKPTETSYTILIEGIAYEGMAKEALELLNELCNKGLMKRSS  579



>emb|CDX93465.1| BnaA06g05830D [Brassica napus]
Length=593

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ + D AI  L  M  +GC+P E +Y++L+ GI + G   EA+ L N LC   +  + +
Sbjct  523  KTRQTDRAIDFLVYMINRGCKPTETSYTILIEGIAYEGMAKEALELLNELCNKGLMKRSS  582



>ref|XP_006306156.1| hypothetical protein CARUB_v10011677mg, partial [Capsella rubella]
 gb|EOA39054.1| hypothetical protein CARUB_v10011677mg, partial [Capsella rubella]
Length=609

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ + D AI  L  M  +GC+P E +Y++L+ G+ + G   EA+ L N LC   +  K +
Sbjct  520  KTRQTDRAIDFLVYMINRGCKPTETSYTILIEGLAYEGMAKEALELLNELCNKGLMKKSS  579



>emb|CDO45366.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
stelligerum]
Length=76

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 32/59 (54%), Gaps = 0/59 (0%)
 Frame = -2

Query  580  SHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            + + D A+  L  M  KGC+P E TY++L+ G+ + G   EA+ L   LC   V  K +
Sbjct  1    ARQTDRAVDFLAYMVSKGCKPTEATYTILIEGVAYEGMAKEALELLXELCSRGVMKKSS  59



>ref|XP_010104578.1| hypothetical protein L484_025557 [Morus notabilis]
 gb|EXC01179.1| hypothetical protein L484_025557 [Morus notabilis]
Length=610

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ +   AI  L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  543  KARQTSRAIDFLAHMVSKGCKPTEATYTILIEGLAYEGLAKEALELLSELCARGVVKKSS  602



>ref|XP_004501057.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Cicer arietinum]
Length=591

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 34/60 (57%), Gaps = 1/60 (2%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ R   AI +L  M  KGC+P E TY++L+ GI + G   EA+ L N L     F KK+
Sbjct  519  KARRTSHAIDLLARMIAKGCKPTEATYTILIEGIAYEGLAEEALGLLNELSSRG-FVKKS  577



>gb|KFK43289.1| hypothetical protein AALP_AA1G104700 [Arabis alpina]
Length=594

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            KS + D AI  L  M  +GC+P E +Y++L+ G+ + G   EA+ L + LC   +  K +
Sbjct  524  KSRQTDRAIDFLVYMINRGCKPTETSYTILIEGLAYEGMANEALALLSELCNKGLMKKSS  583



>ref|XP_004490467.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Cicer arietinum]
Length=578

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 4/67 (6%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTL----CQMNVF  416
            K   +++A+ + +EM  KGC+PN  TY+VL++GI   G   EAI L   L    CQ +VF
Sbjct  229  KKSGVNKAMRLFDEMRSKGCKPNVVTYNVLIDGICNEGRSDEAIRLLKYLPSYGCQPDVF  288

Query  415  SKKALLG  395
            S   +LG
Sbjct  289  SYNIILG  295



>ref|XP_002889775.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66034.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=598

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ + D AI  L  M  +GC+P E +Y++L+ G+ + G   EA+ L N LC   +  + +
Sbjct  531  KTRQTDRAIDFLVYMINRGCKPTETSYTILIEGLAYEGMAKEALELLNELCNKGLMKRSS  590



>ref|XP_008378619.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Malus domestica]
Length=613

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            K+ +   AI  L  M  +GC+P E TY++L+ GI + G   EA+ L N LC   V  K +
Sbjct  546  KAKQTCRAIDFLAYMVSRGCKPTEATYTILIEGIAYEGLAKEALELLNELCYKGVVKKSS  605



>ref|XP_008219211.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Prunus mume]
Length=611

 Score = 48.9 bits (115),  Expect = 0.001, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 4/66 (6%)
 Frame = -2

Query  583  KSHRLDEAIGILEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTL----CQMNVF  416
            K + +++A+ +L+EM  KGC+P+  TY+VL+NGI   G   EAI   N +    CQ NV 
Sbjct  264  KEYGVEQAMKLLDEMRSKGCKPDVVTYNVLINGICKEGRLDEAIRFLNEMPSSDCQPNVI  323

Query  415  SKKALL  398
            +   +L
Sbjct  324  THNIIL  329



>emb|CDO45296.1| Pentratricopeptide repeat-containing protein, partial [Leucadendron 
cryptocephalum]
Length=68

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 28/49 (57%), Gaps = 0/49 (0%)
 Frame = -2

Query  550  LEEMTGKGCQPNENTYSVLLNGIGFHGWRYEAIFLANTLCQMNVFSKKA  404
            L  M  KGC+P E TY++L+ G+ + G   EA+ L + LC   V  K +
Sbjct  3    LAYMVSKGCKPTEATYTILIEGVAYEGMAKEALELLSELCSRGVMKKSS  51



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 666899500002