BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15831_g1_i1 len=794 path=[795:0-93 889:94-701 1497:702-739
1535:740-748 1544:749-793]

Length=794
                                                                      Score     E

emb|CDP00795.1|  unnamed protein product                                209   5e-64   
ref|XP_002280830.1|  PREDICTED: MLP-like protein 28                     207   3e-63   Vitis vinifera
ref|XP_011070614.1|  PREDICTED: MLP-like protein 28                     201   6e-61   
gb|EYU30076.1|  hypothetical protein MIMGU_mgv1a015662mg                198   8e-60   
ref|XP_010066616.1|  PREDICTED: MLP-like protein 423                    189   2e-56   
gb|KCW64575.1|  hypothetical protein EUGRSUZ_G02178                     181   2e-53   
gb|KDP38072.1|  hypothetical protein JCGZ_04715                         150   5e-41   
emb|CBI26887.3|  unnamed protein product                                147   4e-40   
ref|XP_002284534.2|  PREDICTED: MLP-like protein 34                     148   9e-39   Vitis vinifera
ref|XP_009351501.1|  PREDICTED: MLP-like protein 28                     142   3e-38   
ref|XP_004297384.1|  PREDICTED: kirola-like                             142   4e-38   
ref|XP_002284527.1|  PREDICTED: MLP-like protein 43                     141   1e-37   Vitis vinifera
ref|XP_008339534.1|  PREDICTED: MLP-like protein 28                     140   2e-37   
ref|XP_007045170.1|  MLP-like protein 34 isoform 1                      140   2e-37   
ref|XP_010099804.1|  MLP-like protein 31                                140   2e-37   
ref|XP_009349512.1|  PREDICTED: MLP-like protein 28                     137   3e-36   
ref|XP_003631205.1|  PREDICTED: MLP-like protein 43                     137   5e-36   
ref|XP_007224404.1|  hypothetical protein PRUPE_ppa021708m1g            139   5e-36   
ref|XP_002284516.1|  PREDICTED: MLP-like protein 43                     136   5e-36   Vitis vinifera
emb|CAN75774.1|  hypothetical protein VITISV_033953                     136   9e-36   Vitis vinifera
ref|XP_007045177.1|  MLP-like protein 34, putative                      134   4e-35   
ref|XP_011021651.1|  PREDICTED: MLP-like protein 423                    132   3e-34   
emb|CAN83049.1|  hypothetical protein VITISV_030287                     130   2e-33   Vitis vinifera
ref|NP_001268151.1|  ripening-related protein-like                      129   6e-33   
ref|XP_009629007.1|  PREDICTED: MLP-like protein 423                    123   8e-31   
ref|XP_010272006.1|  PREDICTED: MLP-like protein 423                    122   9e-31   
ref|XP_008245210.1|  PREDICTED: MLP-like protein 423                    122   1e-30   
ref|XP_009789323.1|  PREDICTED: MLP-like protein 423                    122   2e-30   
emb|CDP00197.1|  unnamed protein product                                121   3e-30   
ref|XP_002314732.1|  Bet 5 1 allergen family protein                    121   3e-30   Populus trichocarpa [western balsam poplar]
ref|XP_010043801.1|  PREDICTED: MLP-like protein 423                    121   5e-30   
ref|XP_008340260.1|  PREDICTED: MLP-like protein 31                     119   3e-29   
ref|XP_007227537.1|  hypothetical protein PRUPE_ppa012809mg             118   4e-29   
ref|XP_008793846.1|  PREDICTED: MLP-like protein 423                    118   5e-29   
gb|KDP21316.1|  hypothetical protein JCGZ_21787                         118   7e-29   
ref|XP_007045171.1|  MLP-like protein 34 isoform 2                      117   9e-29   
ref|XP_004293036.1|  PREDICTED: major latex protein 146-like            117   1e-28   
ref|XP_009360478.1|  PREDICTED: MLP-like protein 423                    117   2e-28   
ref|XP_008389602.1|  PREDICTED: MLP-like protein 423                    117   2e-28   
ref|XP_004297655.1|  PREDICTED: MLP-like protein 423-like               116   3e-28   
ref|XP_008446239.1|  PREDICTED: MLP-like protein 423                    116   3e-28   
ref|XP_004509856.1|  PREDICTED: MLP-like protein 423-like               115   9e-28   
ref|XP_008457062.1|  PREDICTED: MLP-like protein 423                    115   1e-27   
ref|XP_004135228.1|  PREDICTED: MLP-like protein 423-like               114   1e-27   
ref|XP_006438454.1|  hypothetical protein CICLE_v10032973mg             114   2e-27   
ref|XP_004145833.1|  PREDICTED: MLP-like protein 31-like                114   2e-27   
ref|XP_010320602.1|  PREDICTED: MLP-like protein 423                    114   2e-27   
ref|XP_007045173.1|  MLP-like protein 34                                114   2e-27   
ref|XP_010928576.1|  PREDICTED: MLP-like protein 423                    113   3e-27   
ref|XP_008340001.1|  PREDICTED: MLP-like protein 423                    112   6e-27   
ref|XP_004975890.1|  PREDICTED: MLP-like protein 423-like               113   6e-27   
emb|CDP20848.1|  unnamed protein product                                112   6e-27   
ref|XP_002284570.1|  PREDICTED: MLP-like protein 34                     112   7e-27   Vitis vinifera
ref|XP_006289231.1|  hypothetical protein CARUB_v10002687mg             112   1e-26   
gb|AFK48227.1|  unknown                                                 112   1e-26   
ref|XP_004291554.1|  PREDICTED: MLP-like protein 28-like                111   1e-26   
ref|XP_010913536.1|  PREDICTED: MLP-like protein 423                    111   2e-26   
gb|AFK40667.1|  unknown                                                 111   2e-26   
ref|XP_002267219.1|  PREDICTED: MLP-like protein 423                    111   2e-26   Vitis vinifera
ref|XP_004164830.1|  PREDICTED: MLP-like protein 34-like                111   3e-26   
gb|AAY26389.1|  salt tolerant protein                                   110   3e-26   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004149789.1|  PREDICTED: MLP-like protein 34-like                110   3e-26   
gb|KCW64566.1|  hypothetical protein EUGRSUZ_G02171                     110   4e-26   
ref|XP_009105754.1|  PREDICTED: MLP-like protein 31                     110   4e-26   
ref|XP_006416036.1|  hypothetical protein EUTSA_v10008991mg             110   5e-26   
gb|EMT05612.1|  MLP-like protein 423                                    110   5e-26   
ref|XP_002893317.1|  bet v I allergen family protein                    110   6e-26   
ref|XP_006355987.1|  PREDICTED: MLP-like protein 423-like               110   6e-26   
ref|XP_010494066.1|  PREDICTED: MLP-like protein 31                     110   7e-26   
ref|XP_007153302.1|  hypothetical protein PHAVU_003G023600g             110   7e-26   
gb|EYU29709.1|  hypothetical protein MIMGU_mgv1a015595mg                109   8e-26   
ref|NP_001105279.1|  Bet v I allergen                                   109   9e-26   Zea mays [maize]
ref|XP_010254473.1|  PREDICTED: MLP-like protein 423                    109   9e-26   
ref|XP_008386234.1|  PREDICTED: MLP-like protein 423                    109   1e-25   
ref|XP_009391743.1|  PREDICTED: MLP-like protein 423                    109   1e-25   
gb|KFK44468.1|  hypothetical protein AALP_AA1G260200                    109   1e-25   
ref|NP_173813.1|  MLP-like protein 423                                  109   1e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65899.1|  pollen allergen-like protein                            109   1e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CAN76954.1|  hypothetical protein VITISV_008439                     109   1e-25   Vitis vinifera
ref|XP_010421666.1|  PREDICTED: MLP-like protein 31                     109   2e-25   
gb|ABF81693.1|  pathogenesis-related protein 2                          108   2e-25   Zea mays [maize]
ref|XP_010068712.1|  PREDICTED: MLP-like protein 328                    108   2e-25   
ref|NP_177245.1|  MLP-like protein 43                                   108   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103140.1|  PREDICTED: LOW QUALITY PROTEIN: MLP-like pro...    108   2e-25   
ref|XP_002284578.2|  PREDICTED: MLP-like protein 28                     108   2e-25   Vitis vinifera
gb|ABV89615.1|  bet v I allergen family protein                         108   3e-25   Brassica rapa
ref|XP_002531396.1|  Major latex protein, putative                      107   4e-25   Ricinus communis
ref|XP_011086520.1|  PREDICTED: MLP-like protein 423                    107   5e-25   
emb|CDP00797.1|  unnamed protein product                                107   7e-25   
gb|AFK38000.1|  unknown                                                 107   7e-25   
ref|XP_010498918.1|  PREDICTED: MLP-like protein 423 isoform X1         107   8e-25   
ref|XP_010498919.1|  PREDICTED: MLP-like protein 423 isoform X2         107   8e-25   
ref|XP_010460171.1|  PREDICTED: MLP-like protein 423                    107   9e-25   
ref|XP_004498312.1|  PREDICTED: MLP-like protein 34-like                107   9e-25   
ref|XP_009127832.1|  PREDICTED: MLP-like protein 31                     107   1e-24   
ref|XP_003626964.1|  MLP-like protein                                   107   1e-24   
ref|XP_009339700.1|  PREDICTED: MLP-like protein 28                     107   1e-24   
emb|CDX68328.1|  BnaA07g23680D                                          107   1e-24   
ref|XP_002872296.1|  bet v I allergen family protein                    107   1e-24   
ref|XP_006652389.1|  PREDICTED: MLP-like protein 423-like               106   1e-24   
ref|XP_003579929.1|  PREDICTED: MLP-like protein 423                    106   1e-24   
ref|NP_001236164.1|  uncharacterized protein LOC100527699               106   1e-24   
emb|CAH59440.1|  major latex-like protein 1                             106   1e-24   Plantago major [cart-track plant]
ref|NP_001053026.1|  Os04g0465600                                       106   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011099470.1|  PREDICTED: MLP-like protein 28                     106   1e-24   
ref|XP_010427896.1|  PREDICTED: MLP-like protein 43                     106   1e-24   
ref|XP_009127833.1|  PREDICTED: MLP-like protein 31                     106   2e-24   
gb|EAY94463.1|  hypothetical protein OsI_16233                          105   3e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_008439042.1|  PREDICTED: MLP-like protein 43 isoform X2          105   3e-24   
ref|XP_009104932.1|  PREDICTED: MLP-like protein 34                     105   3e-24   
ref|NP_198153.1|  polyketide cyclase/dehydrase and lipid transpor...    105   4e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KHG05186.1|  MLP-like protein 28                                     105   5e-24   
ref|XP_007223673.1|  hypothetical protein PRUPE_ppa012870mg             105   5e-24   
gb|AAF87152.1|AC002423_17  T23E23.17                                    109   5e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010693434.1|  PREDICTED: MLP-like protein 43                     105   5e-24   
ref|XP_009610076.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...    105   6e-24   
ref|XP_008243380.1|  PREDICTED: MLP-like protein 28                     104   6e-24   
ref|XP_011023662.1|  PREDICTED: MLP-like protein 328                    104   9e-24   
gb|KFK44400.1|  hypothetical protein AALP_AA1G252500                    104   1e-23   
emb|CDY23474.1|  BnaC06g24430D                                          104   1e-23   
gb|ACU19047.1|  unknown                                                 104   1e-23   Glycine max [soybeans]
ref|XP_006836680.1|  hypothetical protein AMTR_s00088p00081230          103   1e-23   
ref|XP_004498311.1|  PREDICTED: MLP-like protein 34-like                103   1e-23   
emb|CBI26883.3|  unnamed protein product                                103   1e-23   
gb|ABK24165.1|  unknown                                                 103   1e-23   Picea sitchensis
ref|XP_006598268.1|  PREDICTED: MLP-like protein 34-like                103   1e-23   
ref|XP_004297383.1|  PREDICTED: MLP-like protein 28-like                103   1e-23   
ref|XP_008439039.1|  PREDICTED: MLP-like protein 43                     103   1e-23   
ref|XP_002312447.1|  hypothetical protein POPTR_0008s13050g             103   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010427881.1|  PREDICTED: MLP-like protein 31                     104   1e-23   
ref|XP_010415785.1|  PREDICTED: MLP-like protein 43                     103   2e-23   
ref|XP_002888799.1|  predicted protein                                  107   2e-23   
emb|CDP00798.1|  unnamed protein product                                103   2e-23   
ref|XP_002874413.1|  bet v I allergen family protein                    103   2e-23   
emb|CAC83580.1|  major latex-like protein                               103   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KHN22818.1|  MLP-like protein 34                                     103   2e-23   
ref|XP_010415776.1|  PREDICTED: MLP-like protein 31                     103   2e-23   
gb|AAD55499.1|AC008148_9  Unknown protein                               103   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010693433.1|  PREDICTED: kirola-like                             103   3e-23   
ref|XP_009351498.1|  PREDICTED: MLP-like protein 329                    103   3e-23   
ref|NP_177241.3|  MLP-like protein 31                                   103   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010681182.1|  PREDICTED: MLP-like protein 28                     102   3e-23   
ref|NP_001237398.1|  uncharacterized protein LOC100500396               102   3e-23   
dbj|BAA83470.1|  Csf-2                                                  102   4e-23   Cucumis sativus [cucumbers]
ref|WP_039311017.1|  hypothetical protein                               103   4e-23   
ref|XP_007149299.1|  hypothetical protein PHAVU_005G058600g             102   5e-23   
ref|XP_009351486.1|  PREDICTED: MLP-like protein 329 isoform X2         102   6e-23   
ref|XP_002446634.1|  hypothetical protein SORBIDRAFT_06g019320          102   6e-23   Sorghum bicolor [broomcorn]
gb|KGN57232.1|  Csf-2 protein                                           102   6e-23   
ref|XP_003631204.1|  PREDICTED: MLP-like protein 34                     102   6e-23   
ref|XP_004147647.1|  PREDICTED: MLP-like protein 34-like                102   6e-23   
ref|XP_009591453.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...    105   6e-23   
ref|XP_002888798.1|  bet v I allergen family protein                    102   8e-23   
ref|NP_565003.3|  MLP-like protein 34                                   103   8e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303389.1|  hypothetical protein CARUB_v10010538mg             101   8e-23   
ref|XP_006301425.1|  hypothetical protein CARUB_v10021843mg             101   9e-23   
ref|XP_010100504.1|  MLP-like protein 423                               101   9e-23   
emb|CDX91696.1|  BnaC08g06150D                                          101   9e-23   
gb|ACH72969.1|  major latex-like protein                                101   9e-23   Panax ginseng [Chinese ginseng]
gb|KDP20178.1|  hypothetical protein JCGZ_00008                         101   1e-22   
ref|XP_002862769.1|  predicted protein                                  103   1e-22   
ref|XP_010427894.1|  PREDICTED: MLP-like protein 43                     101   1e-22   
gb|ABK96619.1|  unknown                                                 101   1e-22   Populus trichocarpa x Populus deltoides
ref|XP_007045185.1|  MLP-like protein 28                                101   1e-22   
ref|XP_004140475.1|  PREDICTED: MLP-like protein 28-like                101   1e-22   
ref|XP_004290369.1|  PREDICTED: MLP-like protein 43-like                101   1e-22   
ref|XP_006367897.1|  PREDICTED: kirola-like                             101   1e-22   
ref|XP_009798271.1|  PREDICTED: kirola-like                             101   1e-22   
ref|XP_006300911.1|  hypothetical protein CARUB_v10021281mg             101   1e-22   
ref|XP_003589655.1|  MLP-like protein                                   100   1e-22   
ref|NP_198152.1|  SRPBCC ligand-binding domain-containing protein       101   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006469314.1|  PREDICTED: MLP-like protein 28-like                104   1e-22   
emb|CDY65619.1|  BnaAnng20750D                                          101   2e-22   
ref|NP_850976.1|  MLP-like protein 34                                   103   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011038618.1|  PREDICTED: MLP-like protein 43                     100   2e-22   
gb|KDP44595.1|  hypothetical protein JCGZ_22177                         100   2e-22   
ref|XP_009127830.1|  PREDICTED: MLP-like protein 34                     101   2e-22   
ref|XP_007223651.1|  hypothetical protein PRUPE_ppa012742mg             100   2e-22   
ref|XP_010415784.1|  PREDICTED: MLP-like protein 43                     100   2e-22   
ref|XP_002888797.1|  bet v I allergen family protein                    104   2e-22   
ref|XP_009351485.1|  PREDICTED: MLP-like protein 328 isoform X1         101   2e-22   
ref|XP_010471086.1|  PREDICTED: MLP-like protein 34                     103   2e-22   
ref|XP_007149098.1|  hypothetical protein PHAVU_005G041000g             100   2e-22   
emb|CDY09495.1|  BnaC02g20370D                                          100   2e-22   
ref|WP_039311068.1|  hypothetical protein                               100   2e-22   
ref|XP_006303112.1|  hypothetical protein CARUB_v100206590mg            102   3e-22   
ref|NP_001238700.1|  uncharacterized protein LOC100305916               100   3e-22   
emb|CDY03715.1|  BnaA02g15220D                                          100   3e-22   
ref|XP_009105755.1|  PREDICTED: MLP-like protein 31                     100   3e-22   
ref|XP_002315876.1|  Csf-2 family protein                               100   3e-22   Populus trichocarpa [western balsam poplar]
ref|XP_011038620.1|  PREDICTED: MLP-like protein 43                     100   4e-22   
gb|KHN05143.1|  MLP-like protein 43                                   99.8    4e-22   
ref|XP_002534267.1|  Major latex protein, putative                    99.8    4e-22   Ricinus communis
ref|XP_007225967.1|  hypothetical protein PRUPE_ppa012615mg             100   4e-22   
gb|KDP38075.1|  hypothetical protein JCGZ_04718                         100   4e-22   
ref|XP_007045183.1|  MLP-like protein 28                              99.8    5e-22   
gb|KFK41514.1|  hypothetical protein AALP_AA2G139500                  99.8    5e-22   
ref|XP_009115561.1|  PREDICTED: MLP-like protein 43                     100   5e-22   
ref|XP_004489875.1|  PREDICTED: MLP-like protein 423-like             99.8    5e-22   
ref|XP_003519004.2|  PREDICTED: MLP-like protein 28-like                100   5e-22   
ref|XP_010682610.1|  PREDICTED: MLP-like protein 423                  99.4    6e-22   
pdb|2I9Y|A  Chain A, Solution Structure Of Arabidopsis Thaliana P...  99.8    6e-22   
ref|XP_006303098.1|  hypothetical protein CARUB_v100206591mg            102   6e-22   
gb|KFK44401.1|  hypothetical protein AALP_AA1G252600                  99.8    6e-22   
ref|XP_006302942.1|  hypothetical protein CARUB_v10021082mg           99.8    6e-22   
emb|CDY21418.1|  BnaA09g30090D                                          100   6e-22   
gb|AFK47321.1|  unknown                                               99.4    6e-22   
ref|XP_004147670.1|  PREDICTED: MLP-like protein 28-like                102   7e-22   
gb|EYU31817.1|  hypothetical protein MIMGU_mgv1a015578mg              99.4    7e-22   
ref|XP_009803723.1|  PREDICTED: kirola-like                             102   7e-22   
ref|XP_003613297.1|  MLP-like protein                                 99.4    7e-22   
gb|KFK41510.1|  hypothetical protein AALP_AA2G139000                    100   7e-22   
gb|KFK41512.1|  hypothetical protein AALP_AA2G139300                  99.8    7e-22   
ref|XP_010427877.1|  PREDICTED: MLP-like protein 34                     102   7e-22   
ref|XP_004240135.1|  PREDICTED: kirola-like                           99.0    8e-22   
ref|XP_006390831.1|  hypothetical protein EUTSA_v10019454mg             102   9e-22   
gb|AFZ93654.1|  major latex protein                                   99.0    9e-22   
ref|XP_004240136.1|  PREDICTED: kirola-like                           99.0    9e-22   
ref|NP_001117579.1|  MLP-like protein 28                              99.4    9e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008340261.1|  PREDICTED: MLP-like protein 329                  99.0    9e-22   
gb|AFK45085.1|  unknown                                               98.6    1e-21   
ref|XP_002888804.1|  hypothetical protein ARALYDRAFT_894909           98.6    1e-21   
emb|CBI26882.3|  unnamed protein product                                101   1e-21   
ref|XP_008358813.1|  PREDICTED: MLP-like protein 329                  99.0    1e-21   
gb|KCW64564.1|  hypothetical protein EUGRSUZ_G02169                   98.6    1e-21   
ref|NP_001077806.1|  MLP-like protein 28                              99.8    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006367968.1|  PREDICTED: MLP-like protein 34-like              98.6    1e-21   
ref|XP_010066609.1|  PREDICTED: MLP-like protein 28                   98.6    1e-21   
ref|XP_002862770.1|  hypothetical protein ARALYDRAFT_497301           98.2    1e-21   
ref|XP_010248963.1|  PREDICTED: kirola-like                           98.2    1e-21   
ref|XP_011075467.1|  PREDICTED: kirola-like                           98.2    2e-21   
gb|ACJ11748.1|  major latex-like protein                              98.2    2e-21   Gossypium hirsutum [American cotton]
ref|XP_009349506.1|  PREDICTED: MLP-like protein 34                   98.2    2e-21   
ref|XP_010415777.1|  PREDICTED: MLP-like protein 28                   98.2    2e-21   
ref|XP_008465556.1|  PREDICTED: MLP-like protein 28                   98.2    2e-21   
ref|XP_009127828.1|  PREDICTED: MLP-like protein 31                   99.8    2e-21   
ref|XP_008221417.1|  PREDICTED: MLP-like protein 31                   98.2    2e-21   
ref|XP_007223642.1|  hypothetical protein PRUPE_ppa012705mg           98.2    2e-21   
ref|XP_006304267.1|  hypothetical protein CARUB_v10010497mg           98.2    2e-21   
ref|XP_010427878.1|  PREDICTED: MLP-like protein 34 isoform X1          100   2e-21   
ref|XP_010415772.1|  PREDICTED: MLP-like protein 34                     102   2e-21   
gb|EPS70333.1|  hypothetical protein M569_04429                       97.8    3e-21   
ref|XP_010427880.1|  PREDICTED: MLP-like protein 43 isoform X2          100   3e-21   
ref|XP_010676168.1|  PREDICTED: MLP-like protein 31                   97.4    3e-21   
ref|XP_004160106.1|  PREDICTED: MLP-like protein 31-like              96.7    3e-21   
gb|EYU34509.1|  hypothetical protein MIMGU_mgv1a026388mg              97.4    3e-21   
ref|XP_002535412.1|  Major latex protein, putative                    97.4    3e-21   Ricinus communis
ref|XP_010415773.1|  PREDICTED: MLP-like protein 28 isoform X1          100   3e-21   
ref|XP_002862771.1|  hypothetical protein ARALYDRAFT_497302           99.4    4e-21   
gb|AFK42542.1|  unknown                                               97.1    4e-21   
gb|EYU23173.1|  hypothetical protein MIMGU_mgv1a020758mg              97.1    4e-21   
ref|XP_009351488.1|  PREDICTED: MLP-like protein 329 isoform X4       97.4    4e-21   
ref|XP_006448199.1|  hypothetical protein CICLE_v10017039mg           97.1    4e-21   
gb|KDP32317.1|  hypothetical protein JCGZ_13242                       97.1    4e-21   
gb|AFK45005.1|  unknown                                               97.1    5e-21   
emb|CDP20847.1|  unnamed protein product                              97.1    5e-21   
ref|NP_177240.3|  MLP-like protein 28                                 99.0    5e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009351487.1|  PREDICTED: MLP-like protein 329 isoform X3       97.1    6e-21   
ref|XP_010694239.1|  PREDICTED: MLP-like protein 31                   96.7    6e-21   
ref|XP_010092945.1|  MLP-like protein 28                              99.4    7e-21   
ref|XP_006303111.1|  hypothetical protein CARUB_v100206590mg          98.6    7e-21   
ref|XP_010415774.1|  PREDICTED: MLP-like protein 43 isoform X2        99.0    8e-21   
ref|NP_849875.1|  MLP-like protein 28                                 99.4    8e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AEV59669.1|  ripening-related protein                              96.3    8e-21   
emb|CDX72753.1|  BnaC06g32010D                                        96.3    8e-21   
gb|ACG32526.1|  major latex protein 22                                96.7    8e-21   Zea mays [maize]
ref|XP_004161613.1|  PREDICTED: MLP-like protein 34-like              96.3    9e-21   
gb|AGE09563.1|  MLP28-like protein                                    95.9    9e-21   
ref|XP_008243379.1|  PREDICTED: MLP-like protein 328                  95.9    1e-20   
ref|XP_009105753.1|  PREDICTED: MLP-like protein 43                   96.3    1e-20   
ref|XP_004293037.1|  PREDICTED: MLP-like protein 31-like              95.9    1e-20   
ref|XP_009351493.1|  PREDICTED: MLP-like protein 43                   96.3    1e-20   
gb|KCW86226.1|  hypothetical protein EUGRSUZ_B02913                   97.1    1e-20   
emb|CDP00796.1|  unnamed protein product                              94.7    1e-20   
gb|KEH19271.1|  pathogenesis-related protein bet V I family protein   95.9    1e-20   
emb|CDY41465.1|  BnaA08g20670D                                        95.9    1e-20   
ref|XP_010044197.1|  PREDICTED: MLP-like protein 28                   95.9    1e-20   
ref|XP_002888800.1|  hypothetical protein ARALYDRAFT_894905           95.9    1e-20   
emb|CDP21429.1|  unnamed protein product                              95.5    1e-20   
ref|XP_009127831.1|  PREDICTED: MLP-like protein 31                   95.5    2e-20   
ref|XP_010471088.1|  PREDICTED: MLP-like protein 28 isoform X2        98.2    2e-20   
ref|XP_009758199.1|  PREDICTED: MLP-like protein 43                   95.1    2e-20   
ref|XP_010462854.1|  PREDICTED: MLP-like protein 28                   98.6    2e-20   
gb|AEV59667.1|  ripening-related protein                              95.1    2e-20   
ref|XP_010471087.1|  PREDICTED: MLP-like protein 34 isoform X1        97.8    2e-20   
ref|XP_004498289.1|  PREDICTED: MLP-like protein 328-like             94.7    3e-20   
ref|XP_009110123.1|  PREDICTED: MLP-like protein 31                   95.1    3e-20   
ref|XP_008457052.1|  PREDICTED: major latex protein 149-like          94.7    3e-20   
ref|XP_008389201.1|  PREDICTED: MLP-like protein 28                   94.7    3e-20   
gb|EYU31821.1|  hypothetical protein MIMGU_mgv1a015566mg              94.7    3e-20   
ref|XP_010683260.1|  PREDICTED: MLP-like protein 28                   94.7    3e-20   
ref|XP_010552705.1|  PREDICTED: MLP-like protein 34                   97.4    3e-20   
ref|XP_003628200.1|  MLP-like protein                                 94.7    3e-20   
ref|XP_006367717.1|  PREDICTED: MLP-like protein 28-like              94.4    3e-20   
ref|XP_008339536.1|  PREDICTED: MLP-like protein 329                  94.7    4e-20   
gb|KHN28650.1|  MLP-like protein 423                                  94.4    4e-20   
gb|AAQ72568.1|  ripening-related protein                              94.4    4e-20   
ref|XP_004149788.1|  PREDICTED: MLP-like protein 43-like              94.4    5e-20   
ref|NP_001235026.1|  uncharacterized protein LOC100499973             94.4    5e-20   
ref|XP_010427882.1|  PREDICTED: MLP-like protein 28                   94.4    5e-20   
ref|XP_006390832.1|  hypothetical protein EUTSA_v10019117mg           95.5    6e-20   
ref|XP_010044190.1|  PREDICTED: MLP-like protein 328                  94.0    6e-20   
gb|KHG22340.1|  MLP-like protein 28                                   94.0    6e-20   
ref|XP_003628210.1|  MLP-like protein                                 94.0    6e-20   
gb|ABQ42010.1|  pollen allergen-like protein                          93.2    7e-20   
gb|ABQ42012.1|  pollen allergen-like protein                          93.2    7e-20   
ref|XP_008339537.1|  PREDICTED: MLP-like protein 34                   94.0    7e-20   
gb|KHG27208.1|  MLP-like protein 28                                   93.6    7e-20   
ref|NP_001241124.1|  uncharacterized protein LOC100783267             93.6    8e-20   
ref|XP_010044194.1|  PREDICTED: MLP-like protein 43                   93.6    8e-20   
ref|XP_009626144.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  93.6    8e-20   
gb|ACJ83999.1|  unknown                                               93.6    8e-20   
gb|AFK46963.1|  unknown                                               93.6    9e-20   
gb|ABQ42009.1|  pollen allergen-like protein                          92.8    9e-20   
gb|ABA01325.1|  VDRG6                                                 93.6    1e-19   
ref|XP_004151401.1|  PREDICTED: MLP-like protein 28-like              93.2    1e-19   
gb|ABQ42011.1|  pollen allergen-like protein                          92.8    1e-19   
ref|XP_007226522.1|  hypothetical protein PRUPE_ppa025363mg           93.2    1e-19   
ref|XP_007044603.1|  Major latex protein, putative                    92.8    1e-19   
ref|XP_002524916.1|  Major latex protein, putative                    92.8    1e-19   
ref|NP_001077807.1|  MLP-like protein 28                              95.5    1e-19   
ref|XP_010319391.1|  PREDICTED: kirola-like                           95.5    2e-19   
emb|CDY03718.1|  BnaA02g15190D                                        94.4    2e-19   
ref|XP_011027744.1|  PREDICTED: kirola-like                           92.4    2e-19   
ref|XP_010044191.1|  PREDICTED: MLP-like protein 28                   92.4    2e-19   
emb|CDP14657.1|  unnamed protein product                              92.4    2e-19   
gb|KDP32318.1|  hypothetical protein JCGZ_13243                       92.4    2e-19   
emb|CDP21915.1|  unnamed protein product                              92.4    2e-19   
ref|XP_011070613.1|  PREDICTED: kirola-like                           92.4    2e-19   
ref|XP_007225991.1|  hypothetical protein PRUPE_ppa012886mg           92.0    2e-19   
ref|XP_006301818.1|  hypothetical protein CARUB_v10022286mg           92.4    3e-19   
ref|XP_010415778.1|  PREDICTED: MLP-like protein 31                   92.0    3e-19   
ref|XP_004145832.1|  PREDICTED: kirola-like                           91.7    4e-19   
ref|XP_010471089.1|  PREDICTED: MLP-like protein 28                   92.0    4e-19   
ref|XP_011023650.1|  PREDICTED: MLP-like protein 328                  91.7    4e-19   
ref|XP_010415783.1|  PREDICTED: MLP-like protein 31                   91.7    4e-19   
ref|XP_010427883.1|  PREDICTED: MLP-like protein 31                   91.7    4e-19   
gb|AAW80931.1|  unknown                                               92.0    4e-19   
gb|KDO36351.1|  hypothetical protein CISIN_1g038195mg                 92.0    4e-19   
gb|KHG20379.1|  MLP protein                                           91.3    5e-19   
ref|XP_007045179.1|  MLP-like protein 28, putative                    92.0    5e-19   
ref|XP_006355094.1|  PREDICTED: kirola-like                           91.3    5e-19   
ref|XP_006367513.1|  PREDICTED: MLP-like protein 34-like isoform X1   91.3    5e-19   
ref|XP_011038619.1|  PREDICTED: MLP-like protein 28                   91.3    6e-19   
ref|WP_033581553.1|  hypothetical protein                             91.3    6e-19   
ref|XP_010272877.1|  PREDICTED: MLP-like protein 34                   91.3    6e-19   
ref|XP_010533357.1|  PREDICTED: MLP-like protein 31                   91.3    6e-19   
gb|AFK40304.1|  unknown                                               91.3    6e-19   
ref|XP_006367964.1|  PREDICTED: MLP-like protein 34-like              93.6    7e-19   
emb|CDY09492.1|  BnaC02g20340D                                        92.8    7e-19   
ref|XP_002323752.1|  major latex protein homologue                    90.9    7e-19   
ref|XP_011023626.1|  PREDICTED: MLP-like protein 328                  90.9    8e-19   
ref|XP_009339701.1|  PREDICTED: MLP-like protein 28                   90.5    8e-19   
ref|XP_004246323.1|  PREDICTED: kirola-like                           90.9    8e-19   
ref|XP_010693432.1|  PREDICTED: MLP-like protein 34                   90.5    9e-19   
ref|XP_003628202.1|  MLP-like protein                                 90.5    9e-19   
ref|XP_003628207.1|  MLP-like protein                                 90.5    1e-18   
ref|XP_003631203.2|  PREDICTED: MLP-like protein 31                   90.1    1e-18   
gb|AER29899.1|  MLP                                                   90.5    1e-18   
ref|XP_010683259.1|  PREDICTED: MLP-like protein 34                   90.5    1e-18   
sp|P85524.1|KIRO_ACTDE  RecName: Full=Kirola; AltName: Allergen=A...  90.1    1e-18   
ref|XP_007223674.1|  hypothetical protein PRUPE_ppa012890mg           90.1    1e-18   
ref|XP_006448234.1|  hypothetical protein CICLE_v10017061mg           90.1    1e-18   
ref|XP_007045180.1|  MLP-like protein 28, putative                    90.9    1e-18   
gb|KDO64622.1|  hypothetical protein CISIN_1g031775mg                 90.1    1e-18   
gb|AET02682.2|  pathogenesis-related protein bet V I family protein   90.5    1e-18   
gb|AFK49330.1|  unknown                                               90.1    1e-18   
ref|XP_009105751.1|  PREDICTED: MLP-like protein 43                   90.5    1e-18   
pdb|4IHR|A  Chain A, Crystal Structure Of Recombinant Kirola (act...  90.1    1e-18   
ref|XP_010471091.1|  PREDICTED: MLP-like protein 31                   90.1    2e-18   
ref|XP_010325795.1|  PREDICTED: kirola-like                           89.7    2e-18   
ref|XP_004237018.1|  PREDICTED: kirola                                89.7    2e-18   
ref|XP_008243381.1|  PREDICTED: MLP-like protein 328                  90.1    2e-18   
ref|XP_007223676.1|  hypothetical protein PRUPE_ppa012898mg           89.7    2e-18   
gb|KHG17607.1|  MLP-like protein 31                                   89.7    2e-18   
ref|XP_002888803.1|  bet v I allergen family protein                  89.7    2e-18   
ref|XP_010666837.1|  PREDICTED: MLP-like protein 43                   89.7    2e-18   
emb|CDY70359.1|  BnaAnng33440D                                        88.6    2e-18   
ref|XP_004151203.1|  PREDICTED: major latex protein 146-like          89.7    3e-18   
ref|XP_006301346.1|  hypothetical protein CARUB_v10021755mg           89.4    3e-18   
ref|XP_010046546.1|  PREDICTED: MLP-like protein 328                  90.1    3e-18   
gb|KEH40553.1|  pathogenesis-related protein bet V I family protein   89.4    3e-18   
emb|CDP14655.1|  unnamed protein product                              89.0    3e-18   
ref|XP_010666838.1|  PREDICTED: MLP-like protein 43                   89.7    3e-18   
gb|KGN57584.1|  hypothetical protein Csa_3G219190                     89.0    3e-18   
ref|XP_006344378.1|  PREDICTED: kirola-like                           89.0    3e-18   
gb|KDP38074.1|  hypothetical protein JCGZ_04717                       89.0    3e-18   
gb|AFK46559.1|  unknown                                               89.4    3e-18   
gb|KGN57824.1|  hypothetical protein Csa_3G331340                     89.4    3e-18   
ref|XP_006366347.1|  PREDICTED: kirola-like                           89.0    4e-18   
ref|XP_004159886.1|  PREDICTED: major latex protein 146-like          89.0    4e-18   
ref|XP_003628192.1|  MLP-like protein                                 89.0    4e-18   
ref|XP_004170313.1|  PREDICTED: MLP-like protein 28-like              89.0    4e-18   
ref|XP_004147648.1|  PREDICTED: MLP-like protein 34-like              89.0    4e-18   
ref|XP_007153403.1|  hypothetical protein PHAVU_003G032100g           88.6    4e-18   
ref|XP_002312446.1|  putative major latex family protein              88.6    4e-18   
gb|AEV59676.1|  ripening-related protein                              88.2    4e-18   
ref|XP_007226732.1|  hypothetical protein PRUPE_ppa025402mg           88.6    5e-18   
gb|AEV59674.1|  ripening-related protein                              88.2    5e-18   
ref|XP_010044193.1|  PREDICTED: MLP-like protein 34                   88.6    5e-18   
gb|EYU31820.1|  hypothetical protein MIMGU_mgv1a015676mg              88.2    5e-18   
ref|XP_010427893.1|  PREDICTED: MLP-like protein 31                   88.6    6e-18   
ref|XP_002888801.1|  hypothetical protein ARALYDRAFT_894906           89.0    6e-18   
ref|XP_008457053.1|  PREDICTED: MLP-like protein 28 isoform X1        88.6    6e-18   
ref|XP_002534266.1|  Major latex protein, putative                    88.2    6e-18   
ref|XP_007133501.1|  hypothetical protein PHAVU_011G184200g           88.6    6e-18   
ref|XP_009105750.1|  PREDICTED: MLP-like protein 43                   89.4    6e-18   
ref|XP_008339533.1|  PREDICTED: MLP-like protein 43                   88.2    6e-18   
ref|XP_006367636.1|  PREDICTED: MLP-like protein 34-like              90.5    7e-18   
ref|XP_009349511.1|  PREDICTED: MLP-like protein 43                   88.2    7e-18   
ref|XP_006599132.1|  PREDICTED: MLP-like protein 43-like              88.2    7e-18   
ref|XP_003628206.1|  MLP-like protein                                 90.5    8e-18   
gb|AEV59664.1|  ripening-related protein                              87.8    8e-18   
ref|XP_009351499.1|  PREDICTED: MLP-like protein 43                   88.2    8e-18   
ref|XP_004161617.1|  PREDICTED: major latex protein 149-like          88.2    8e-18   
ref|XP_007045187.1|  MLP protein 28                                   87.8    9e-18   
ref|XP_006469318.1|  PREDICTED: MLP-like protein 34-like              87.8    1e-17   
ref|XP_009339696.1|  PREDICTED: MLP-like protein 328                  87.8    1e-17   
gb|EYU40241.1|  hypothetical protein MIMGU_mgv1a016485mg              86.7    1e-17   
ref|XP_008389200.1|  PREDICTED: MLP-like protein 328                  87.4    1e-17   
emb|CAD31716.1|  putative ripening related protein                    87.4    1e-17   
ref|XP_009339697.1|  PREDICTED: MLP-like protein 328                  87.4    1e-17   
gb|EYU29497.1|  hypothetical protein MIMGU_mgv1a021619mg              87.4    1e-17   
gb|ABK21041.1|  unknown                                               87.4    1e-17   
gb|ABR18234.1|  unknown                                               87.4    1e-17   
gb|KFK44403.1|  hypothetical protein AALP_AA1G252800                  87.8    1e-17   
gb|KCW86238.1|  hypothetical protein EUGRSUZ_B02924                   87.0    1e-17   
ref|XP_011070720.1|  PREDICTED: kirola-like                           87.4    1e-17   
ref|XP_002888805.1|  hypothetical protein ARALYDRAFT_476224           87.4    1e-17   
ref|XP_004511176.1|  PREDICTED: MLP-like protein 28-like              89.7    2e-17   
ref|XP_010415780.1|  PREDICTED: MLP-like protein 31                   87.8    2e-17   
ref|XP_008439040.1|  PREDICTED: MLP-like protein 43                   87.0    2e-17   
emb|CBI26880.3|  unnamed protein product                              87.0    2e-17   
gb|KDO39372.1|  hypothetical protein CISIN_1g041437mg                 87.0    2e-17   
ref|XP_006390830.1|  hypothetical protein EUTSA_v10019433mg           87.0    2e-17   
ref|XP_010551642.1|  PREDICTED: MLP-like protein 423                  87.4    2e-17   
gb|EPS66705.1|  hypothetical protein M569_08073                       86.7    2e-17   
ref|XP_010694238.1|  PREDICTED: MLP-like protein 28                   87.0    2e-17   
emb|CDY12484.1|  BnaC07g13240D                                        87.0    2e-17   
ref|XP_008457056.1|  PREDICTED: kirola-like                           86.7    2e-17   
ref|XP_009110120.1|  PREDICTED: MLP-like protein 31                   86.7    2e-17   
ref|XP_006354582.1|  PREDICTED: kirola-like                           86.7    2e-17   
ref|XP_010427885.1|  PREDICTED: MLP-like protein 43 isoform X2        87.4    3e-17   
ref|XP_006367998.1|  PREDICTED: MLP-like protein 34-like              85.9    3e-17   
gb|KEH40555.1|  polyketide cyclase/dehydrase and lipid transporter    86.7    3e-17   
ref|XP_010693431.1|  PREDICTED: kirola-like                           86.3    3e-17   
ref|XP_004246757.1|  PREDICTED: MLP-like protein 28                   86.3    3e-17   
ref|XP_008457054.1|  PREDICTED: MLP-like protein 165 isoform X2       86.3    3e-17   
ref|XP_006366344.1|  PREDICTED: MLP-like protein 34-like              86.3    3e-17   
ref|XP_011071063.1|  PREDICTED: MLP-like protein 423                  86.7    3e-17   
ref|XP_009103193.1|  PREDICTED: MLP-like protein 34                   86.3    4e-17   
gb|AEV59668.1|  ripening-related protein                              85.5    4e-17   
ref|XP_006304590.1|  hypothetical protein CARUB_v10011642mg           85.9    4e-17   
ref|XP_009351491.1|  PREDICTED: MLP-like protein 328                  85.9    4e-17   
ref|XP_011070612.1|  PREDICTED: kirola-like                           85.9    5e-17   
gb|KFK44402.1|  hypothetical protein AALP_AA1G252700                  85.9    5e-17   
ref|XP_011092069.1|  PREDICTED: kirola-like                           85.9    5e-17   
ref|XP_006305730.1|  hypothetical protein CARUB_v10010508mg           85.9    5e-17   
gb|AAM64541.1|  major latex protein (MLP149), putative                86.3    5e-17   
ref|XP_004149787.1|  PREDICTED: kirola-like                           85.5    5e-17   
ref|XP_006361655.1|  PREDICTED: MLP-like protein 34-like              85.5    5e-17   
ref|XP_002526038.1|  Major latex protein, putative                    85.5    6e-17   
ref|XP_004246324.1|  PREDICTED: MLP-like protein 31                   85.5    6e-17   
ref|XP_004237027.1|  PREDICTED: kirola-like                           85.5    7e-17   
ref|XP_009351490.1|  PREDICTED: MLP-like protein 328                  85.1    7e-17   
ref|XP_003628184.1|  MLP-like protein                                 85.5    7e-17   
ref|NP_177244.1|  SRPBCC domain-containing protein                    85.5    8e-17   
gb|AFK35144.1|  unknown                                               85.1    8e-17   
ref|XP_009349505.1|  PREDICTED: MLP-like protein 328                  85.1    9e-17   
ref|XP_010477597.1|  PREDICTED: MLP-like protein 31                   85.1    9e-17   
gb|KFK41515.1|  hypothetical protein AALP_AA2G139600                  85.1    1e-16   
ref|XP_006366346.1|  PREDICTED: MLP-like protein 34-like              84.7    1e-16   
ref|XP_010683257.1|  PREDICTED: MLP-like protein 34                   84.7    1e-16   
ref|XP_010066614.1|  PREDICTED: MLP-like protein 328                  84.7    1e-16   
ref|XP_011043108.1|  PREDICTED: MLP-like protein 31                   84.7    1e-16   
ref|XP_011084196.1|  PREDICTED: kirola-like                           84.3    1e-16   
ref|XP_010460090.1|  PREDICTED: MLP-like protein 31                   84.7    1e-16   
ref|XP_009607912.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  84.3    1e-16   
gb|AAC14179.1|  major latex protein homolog                           84.3    2e-16   
ref|XP_004142287.1|  PREDICTED: major latex protein 146-like isof...  84.0    2e-16   
ref|XP_006367980.1|  PREDICTED: MLP-like protein 28-like              84.0    2e-16   
gb|KDO64616.1|  hypothetical protein CISIN_1g031759mg                 84.0    2e-16   
ref|XP_009783369.1|  PREDICTED: kirola-like                           84.0    2e-16   
sp|Q06394.1|ML146_PAPSO  RecName: Full=Major latex protein 146; S...  84.3    2e-16   
ref|XP_002305767.1|  hypothetical protein POPTR_0004s05080g           84.0    2e-16   
ref|XP_004237031.1|  PREDICTED: kirola-like                           83.6    2e-16   
ref|XP_004167410.1|  PREDICTED: kirola-like                           84.0    2e-16   
ref|XP_010427884.1|  PREDICTED: MLP-like protein 31 isoform X1        85.9    2e-16   
emb|CDY03712.1|  BnaA02g15250D                                        83.6    3e-16   
gb|ABK22867.1|  unknown                                               84.0    3e-16   
ref|XP_009592503.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  83.6    3e-16   
ref|XP_004240133.1|  PREDICTED: kirola-like                           83.6    3e-16   
ref|NP_564456.1|  MLP-like protein 165                                83.6    3e-16   
ref|XP_006366068.1|  PREDICTED: kirola-like                           83.2    3e-16   
ref|XP_010477599.1|  PREDICTED: MLP-like protein 31                   83.6    3e-16   
ref|XP_007133493.1|  hypothetical protein PHAVU_011G183400g           83.2    3e-16   
gb|AFV09180.1|  pathogenesis-related protein 10a                      83.2    4e-16   
ref|XP_009127834.1|  PREDICTED: MLP-like protein 31                   83.2    4e-16   
gb|KHN37761.1|  MLP-like protein 43                                   83.2    4e-16   
ref|XP_006448231.1|  hypothetical protein CICLE_v10017056mg           83.2    4e-16   



>emb|CDP00795.1| unnamed protein product [Coffea canephora]
Length=153

 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 124/149 (83%), Gaps = 4/149 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQ+ KLE +T++KS   + FD+Y N +SL+PKI P K++S+Q+LEGDGKSVGS+RLWTY
Sbjct  1    MAQLCKLELQTEMKSSPDRVFDVYKNKTSLMPKISPDKLQSIQVLEGDGKSVGSIRLWTY  60

Query  225  ILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASG----NSVKWTLEYE  392
             +G  V+AKDKIDA+D EN+++TF LIGGEVT+YFKSF+ATLQA      N VKWTLEYE
Sbjct  61   FMGTPVVAKDKIDAIDMENKTITFELIGGEVTSYFKSFKATLQAIAQGDVNMVKWTLEYE  120

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            KA +++PTPHSH++FL++ +R+VD YLLK
Sbjct  121  KAREDIPTPHSHLDFLISCSRDVDAYLLK  149



>ref|XP_002280830.1| PREDICTED: MLP-like protein 28 [Vitis vinifera]
 emb|CBI26889.3| unnamed protein product [Vitis vinifera]
Length=150

 Score =   207 bits (526),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 124/149 (83%), Gaps = 4/149 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQI +LE +T+IKS   + FDIY N +SL+PKI P K++S+++LEGDGKSVGSVRLWTY
Sbjct  1    MAQICRLELQTEIKSSPDRIFDIYKNKTSLMPKISPDKLKSIEVLEGDGKSVGSVRLWTY  60

Query  225  ILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASG----NSVKWTLEYE  392
            ++GG VIAKDKI A+DEE  S+TF LIGGEVTNY+KSF+AT++A+     N VKW+LEYE
Sbjct  61   VMGGAVIAKDKIVAIDEEKGSMTFDLIGGEVTNYYKSFKATIEATSEAHTNLVKWSLEYE  120

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            KAN+ VP+P SH+ FL++V++EVD YLLK
Sbjct  121  KANETVPSPESHLAFLLDVSKEVDAYLLK  149



>ref|XP_011070614.1| PREDICTED: MLP-like protein 28 [Sesamum indicum]
Length=150

 Score =   201 bits (511),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 121/149 (81%), Gaps = 4/149 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQ+ KL+ +TQI S   K FD+Y N + L+P I P K++S+Q+L+GDGKSVGS+RLWTY
Sbjct  1    MAQLHKLQLQTQISSSPDKIFDVYKNKTYLMPSISPDKLQSIQVLQGDGKSVGSIRLWTY  60

Query  225  ILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASG----NSVKWTLEYE  392
            ++G  V+AKDKI AVDEEN+S+TF LIGGEVT YF SFRAT +A+G    N V W++EYE
Sbjct  61   VMGVAVVAKDKIVAVDEENKSITFELIGGEVTKYFNSFRATFRATGKGERNIVTWSVEYE  120

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            KA+++VP PHSH+EFL+N++REVD +LLK
Sbjct  121  KASEDVPHPHSHLEFLVNLSREVDAFLLK  149



>gb|EYU30076.1| hypothetical protein MIMGU_mgv1a015662mg [Erythranthe guttata]
Length=150

 Score =   198 bits (503),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 122/149 (82%), Gaps = 4/149 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQ+ KLE +TQI S  +KFFD+Y N + L+PKI P K++S+++LEGDGKS+GSVRLWTY
Sbjct  1    MAQLHKLELQTQITSRPEKFFDLYKNKTYLMPKISPDKLQSIRVLEGDGKSLGSVRLWTY  60

Query  225  ILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASG----NSVKWTLEYE  392
            ++G  VIAKDKI AVDE NRS+TF LIGGEVT YF SF+ATL+A+     N +KW+LEYE
Sbjct  61   VMGIPVIAKDKIVAVDEVNRSITFELIGGEVTKYFNSFKATLEATTEGNKNIIKWSLEYE  120

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            K +++VP PHSH+EFL+ +++E+D YL+K
Sbjct  121  KMSESVPNPHSHLEFLVTMSKEIDTYLIK  149



>ref|XP_010066616.1| PREDICTED: MLP-like protein 423 [Eucalyptus grandis]
 gb|KCW64576.1| hypothetical protein EUGRSUZ_G02178 [Eucalyptus grandis]
 gb|KCW64577.1| hypothetical protein EUGRSUZ_G02178 [Eucalyptus grandis]
Length=151

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 115/149 (77%), Gaps = 4/149 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQ  KLE + QIKS  +K FD+Y N + L+PKI P K+RS++++EGDGKSVGSVRLWTY
Sbjct  1    MAQTRKLEKQAQIKSSPEKLFDVYKNKTDLMPKISPDKLRSIEVIEGDGKSVGSVRLWTY  60

Query  225  ILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEYE  392
             LG +V+AKDKIDA+DE N+S+TF +IGGEVT YF  ++AT+Q       N VKW++EYE
Sbjct  61   FLGDSVVAKDKIDAIDEGNKSITFDIIGGEVTRYFARYKATIQLVSTGQNNFVKWSVEYE  120

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            K N+ VP PH  ++FL+ +A+EVD YL++
Sbjct  121  KMNEQVPDPHPQLDFLITMAKEVDNYLVQ  149



>gb|KCW64575.1| hypothetical protein EUGRSUZ_G02178 [Eucalyptus grandis]
Length=146

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 110/143 (77%), Gaps = 4/143 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQ  KLE + QIKS  +K FD+Y N + L+PKI P K+RS++++EGDGKSVGSVRLWTY
Sbjct  1    MAQTRKLEKQAQIKSSPEKLFDVYKNKTDLMPKISPDKLRSIEVIEGDGKSVGSVRLWTY  60

Query  225  ILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEYE  392
             LG +V+AKDKIDA+DE N+S+TF +IGGEVT YF  ++AT+Q       N VKW++EYE
Sbjct  61   FLGDSVVAKDKIDAIDEGNKSITFDIIGGEVTRYFARYKATIQLVSTGQNNFVKWSVEYE  120

Query  393  KANDNVPTPHSHVEFLMNVAREV  461
            K N+ VP PH  ++FL+ +A+EV
Sbjct  121  KMNEQVPDPHPQLDFLITMAKEV  143



>gb|KDP38072.1| hypothetical protein JCGZ_04715 [Jatropha curcas]
Length=158

 Score =   150 bits (378),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 110/148 (74%), Gaps = 4/148 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQ+ KL+ +T+IKS + KF++I  + + L+PKICP  ++ +++L+GD  +VGS+R+WTY
Sbjct  1    MAQLKKLQAQTEIKSSADKFYEILRSKAYLIPKICPNYVKDIRVLQGDWDTVGSLRVWTY  60

Query  225  ILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEYE  392
            + G +   K+ ++A+DE++R +TF ++ GE+ NY+KS++ +++ +    G+ VKWT+EYE
Sbjct  61   VAGNSETVKETMEAIDEKSRRITFNMLEGEIMNYYKSYKLSMEVASMGKGSLVKWTVEYE  120

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K N+ +  PH ++EFL+N ++ +D YLL
Sbjct  121  KQNEEISPPHKYLEFLVNFSKSIDAYLL  148



>emb|CBI26887.3| unnamed protein product [Vitis vinifera]
Length=151

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 104/150 (69%), Gaps = 5/150 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQI K+E + +IKSP+ KF ++      L+PK CP KI+S++++EGD K+VGSV+LWTY
Sbjct  1    MAQIAKMEVQAEIKSPASKFHEVCSRKVYLVPKACPEKIKSIEVVEGDWKTVGSVQLWTY  60

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEY  389
             +GGN   AK  ++ VDEEN++VT  ++ G++  YFK F+ T+Q +    G+ V W++EY
Sbjct  61   FIGGNTEEAKLVVERVDEENKTVTMNVVEGDIVKYFKIFKCTIQVTVKDKGSLVTWSVEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            EK N++ P P +++ F M +   VD YLLK
Sbjct  121  EKLNESGPAPDAYLNFAMGIVENVDAYLLK  150



>ref|XP_002284534.2| PREDICTED: MLP-like protein 34 [Vitis vinifera]
Length=313

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 108/158 (68%), Gaps = 6/158 (4%)
 Frame = +3

Query  21   FSRIEKSIMAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSV  200
            FS   K IMAQI K+E + +IKSP+ KF ++      L+PK CP KI+S++++EGD K+V
Sbjct  156  FSNTTK-IMAQIAKMEVQAEIKSPASKFHEVCSRKVYLVPKACPEKIKSIEVVEGDWKTV  214

Query  201  GSVRLWTYILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GN  365
            GSV+LWTY +GGN   AK  ++ VDEEN++VT  ++ G++  YFK F+ T+Q +    G+
Sbjct  215  GSVQLWTYFIGGNTEEAKLVVERVDEENKTVTMNVVEGDIVKYFKIFKCTIQVTVKDKGS  274

Query  366  SVKWTLEYEKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
             V W++EYEK N++ P P +++ F M +   VD YLLK
Sbjct  275  LVTWSVEYEKLNESGPAPDAYLNFAMGIVENVDAYLLK  312


 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 110/150 (73%), Gaps = 5/150 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQI K+E   + KSP+ +F++++ + + L+PK CP KI+S++++EGD KSVGSV+LWTY
Sbjct  1    MAQIDKMETHVEKKSPANEFYEVFSSKAHLIPKACPDKIKSIEVVEGDWKSVGSVKLWTY  60

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEY  389
             +GGN   +K++++  D++N+S+TF  + GEV   FKS  + L+ S    G+ VKWTLEY
Sbjct  61   CIGGNTSSSKERVEKKDDKNKSITFKALDGEVMKDFKSVISILEVSAKDDGSLVKWTLEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            EK+N+ +  P +++  ++++++E+D YLLK
Sbjct  121  EKSNEKLLPPDAYLSLVISMSKEIDAYLLK  150



>ref|XP_009351501.1| PREDICTED: MLP-like protein 28 [Pyrus x bretschneideri]
Length=157

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 109/154 (71%), Gaps = 10/154 (6%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQI K+E + +IK+ + KF++I+L+   LLPK+CP  I+ +Q+++GD  SVGSV+ WTY
Sbjct  1    MAQIAKMEVQAEIKASADKFYEIFLSKGYLLPKMCPNVIKDLQVIQGDWGSVGSVKQWTY  60

Query  225  ILGGNV--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS--------GNSVK  374
               GNV  ++++ I+A+DE+N+SVTF  +GG++   +KSF+AT+Q +         +SVK
Sbjct  61   FAAGNVSEVSRETIEAIDEKNKSVTFRTVGGQLAKCYKSFKATVQVTPKVSGGSSSSSVK  120

Query  375  WTLEYEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            WT+EYEK  + VP PH +++FL+ +   +D +LL
Sbjct  121  WTVEYEKLTEGVPVPHKYMDFLVLLTNNIDAHLL  154



>ref|XP_004297384.1| PREDICTED: kirola-like [Fragaria vesca subsp. vesca]
Length=152

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 109/151 (72%), Gaps = 6/151 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQI K++ E +IK+ ++ F++++ +   LLPKICP  I+ +++LEGD  +VGSV+ WTY
Sbjct  1    MAQIAKMQVEAEIKAGAETFYEVFRSKGYLLPKICPDMIKDIRVLEGDWGTVGSVKQWTY  60

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASG-----NSVKWTLE  386
            +  GN  IAK+ +DA+DE+++SVTF  + G +   +K+ +AT+Q +      +SVKW++E
Sbjct  61   VAAGNSEIAKETVDAMDEKSKSVTFKTVDGTLLKIYKTMKATVQVTAKGGGCSSVKWSIE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            YEK N++ P P+ +++F++ + ++VD YLLK
Sbjct  121  YEKLNEDSPPPNKYLDFVLILTKKVDAYLLK  151



>ref|XP_002284527.1| PREDICTED: MLP-like protein 43 [Vitis vinifera]
 emb|CAN75773.1| hypothetical protein VITISV_033952 [Vitis vinifera]
 emb|CBI26885.3| unnamed protein product [Vitis vinifera]
Length=151

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 104/149 (70%), Gaps = 5/149 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   KLE ET+IK+P+ KFF I+ + +  LP IC  KI  +++ EGD ++ GSV+ W+Y
Sbjct  1    MALTGKLEIETEIKAPADKFFKIFRSQAHHLPNICSDKIHKIEVHEGDWETQGSVKHWSY  60

Query  225  ILGGNVIA-KDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEY  389
             +GGN  + K+ ++++DEENRS+TF +  GEV N +KS++ T QA     G  VKWT+EY
Sbjct  61   TIGGNSKSIKESVESIDEENRSITFKVSDGEVLNDYKSYKFTTQAIPKGEGCLVKWTIEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            EKA+++ P PH ++EF + V ++++ +LL
Sbjct  121  EKASEDGPDPHDYLEFAVTVTKDIESHLL  149



>ref|XP_008339534.1| PREDICTED: MLP-like protein 28 [Malus domestica]
Length=157

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 108/154 (70%), Gaps = 10/154 (6%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQI K+E + +IK+ + KF++I+ +   LLPK+CP  I+ +Q+++GD  SVGSV+ WTY
Sbjct  1    MAQIAKMEVQAEIKASADKFYEIFRSKGYLLPKMCPNVIKDLQVIQGDWGSVGSVKQWTY  60

Query  225  ILGGNV--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS--------GNSVK  374
                NV  ++++ ++A+DE+N+SVTF  +GGE+  Y+KSF+AT+Q +         +SVK
Sbjct  61   FAADNVSEVSRETVEAIDEKNKSVTFRTVGGELAKYYKSFKATVQVTPKVSGGCSSSSVK  120

Query  375  WTLEYEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            WT+EYEK  + VP PH +++FL+ +   +D +LL
Sbjct  121  WTVEYEKLTEGVPVPHKYMDFLVLLTNNIDAHLL  154



>ref|XP_007045170.1| MLP-like protein 34 isoform 1 [Theobroma cacao]
 gb|EOY01002.1| MLP-like protein 34 isoform 1 [Theobroma cacao]
Length=150

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 100/149 (67%), Gaps = 4/149 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQI KLE +++I+S + K +DI+ +   L+PKICP  +  V++++GD ++VGSVR+W Y
Sbjct  1    MAQILKLEVQSEIQSSADKVYDIFKHKMYLMPKICPELVTDVKVVKGDWETVGSVRIWKY  60

Query  225  ILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFR----ATLQASGNSVKWTLEYE  392
            + G +  A + I+A+D+ N+S+T   + G++T Y+K+F+     T    G+ VKWTL YE
Sbjct  61   VAGLSENASETIEAIDDRNKSITLNALDGDITKYYKTFKVIVTVTANGQGSLVKWTLMYE  120

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            K N N+P P  ++EF   + + VD YLLK
Sbjct  121  KQNQNIPDPEKYIEFASAITKSVDAYLLK  149



>ref|XP_010099804.1| MLP-like protein 31 [Morus notabilis]
 ref|XP_010108502.1| MLP-like protein 31 [Morus notabilis]
 gb|EXB80472.1| MLP-like protein 31 [Morus notabilis]
 gb|EXC19581.1| MLP-like protein 31 [Morus notabilis]
Length=153

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 102/149 (68%), Gaps = 6/149 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQI K+E +  IKS ++ F++I+     L+PKIC   ++ VQ+++GD +S+GS++ WTY
Sbjct  1    MAQIAKMEVQLDIKSSAQSFYEIFRRKQYLMPKICLDILKDVQVIKGDWESLGSIKQWTY  60

Query  225  ILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLE  386
            + G +   K+ ++A+DEEN+ +TF ++ GE+T Y+K+ + T+Q +      G+SVKWTLE
Sbjct  61   VAGNSESGKEIVEAIDEENKKITFKVLDGEITKYYKTMKTTVQVTAKGDKGGSSVKWTLE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYL  473
            YEK ND++P P  +++ L    + V+ YL
Sbjct  121  YEKLNDSIPAPTKYLDLLSATTKNVEAYL  149



>ref|XP_009349512.1| PREDICTED: MLP-like protein 28 [Pyrus x bretschneideri]
Length=160

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 108/154 (70%), Gaps = 10/154 (6%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQI K+E + +IK+ + KF++I+L+   LLPK+CP  I+ +Q+++GD  SVGSV+ WTY
Sbjct  1    MAQIAKMEVQAEIKASADKFYEIFLSKGYLLPKMCPNVIKDLQVIQGDWGSVGSVKQWTY  60

Query  225  ILGGNV--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS--------GNSVK  374
                NV  ++++ I+A+DE+++SVTF  +GG++   +KSF+AT+Q +         +SVK
Sbjct  61   FAADNVSEVSRETIEAIDEKSKSVTFRTVGGQLAKCYKSFKATVQVTPKVSGGCSSSSVK  120

Query  375  WTLEYEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            WT+EYEK  + VP PH +++FL+ +   +D +LL
Sbjct  121  WTVEYEKLTEGVPVPHKYMDFLVLLTNNIDAHLL  154



>ref|XP_003631205.1| PREDICTED: MLP-like protein 43 [Vitis vinifera]
 emb|CBI26884.3| unnamed protein product [Vitis vinifera]
Length=151

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 102/151 (68%), Gaps = 5/151 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   KLE E +I SP+ KF++I+   +  +P IC  K+  + + EGD ++ GSV+ W Y
Sbjct  1    MALTGKLEVEMEINSPADKFYNIFRRQAHHIPNICSDKVHQIDVHEGDWETPGSVKNWGY  60

Query  225  ILGGNVIA-KDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEY  389
             LGG  ++ K+ +++VD+EN+S+TF ++ GE+ N+FK F++ LQ      G+ VKW+LEY
Sbjct  61   TLGGTSMSLKETVESVDDENKSITFKVVDGEIMNHFKCFKSNLQVKAKDEGSLVKWSLEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            EK N +VP P +++EF +NV ++++ + LK 
Sbjct  121  EKVNKDVPNPDAYLEFAVNVTKDIESHYLKA  151



>ref|XP_007224404.1| hypothetical protein PRUPE_ppa021708m1g, partial [Prunus persica]
 gb|EMJ25603.1| hypothetical protein PRUPE_ppa021708m1g, partial [Prunus persica]
Length=236

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 105/148 (71%), Gaps = 10/148 (7%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            +E + +IK+ + KF++I+ +   LLPKICP  I+ +Q+L+GDG SVGS++ WTY+  GN 
Sbjct  86   IEVQAEIKASADKFYEIFRSKGYLLPKICPNIIKDLQVLKGDGSSVGSIKQWTYVAAGNF  145

Query  243  --IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ--------ASGNSVKWTLEYE  392
              ++K+ I+++DE+N+S+ F  + GEVT ++KSF+AT++        +S +SVKW +EYE
Sbjct  146  SEVSKETIESIDEKNKSIAFRTVEGEVTKHYKSFKATVEVTPRGNGCSSSSSVKWNIEYE  205

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K N+ VP P+ +++F++ +   VD YLL
Sbjct  206  KQNEAVPAPNKYLDFVVILTNNVDAYLL  233



>ref|XP_002284516.1| PREDICTED: MLP-like protein 43 [Vitis vinifera]
Length=151

 Score =   136 bits (343),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 105/149 (70%), Gaps = 5/149 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   K+E ET+IK+P+ KFF ++ + +  LP IC  KI  +++ EGD ++ GSV+ W+Y
Sbjct  1    MALTAKVETETEIKAPADKFFKLFRSQAHHLPNICSDKIHKIEVHEGDWETQGSVKHWSY  60

Query  225  ILGGNVIA-KDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEY  389
             +GGN  + K+ ++++DEENRS+TF ++ GEV   +KS++ T QA     G+ V WT+EY
Sbjct  61   TIGGNSQSIKETVESIDEENRSITFKVLDGEVLKEYKSYKFTAQAIPKGEGSLVIWTIEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            EKA++  P PH+++EF +N+ ++++ +LL
Sbjct  121  EKASEGGPDPHNYLEFAVNITKDIESHLL  149



>emb|CAN75774.1| hypothetical protein VITISV_033953 [Vitis vinifera]
Length=151

 Score =   136 bits (342),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 101/151 (67%), Gaps = 5/151 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   KLE E +I SP+ KF++I+   +  +P IC  K+  + + EGD ++ GSV+ W Y
Sbjct  1    MALTGKLEVEMEINSPADKFYNIFRRQAHHIPNICSDKVHQIDVHEGDWETPGSVKNWGY  60

Query  225  ILGGNVIA-KDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEY  389
             LGG  ++ K+ +++VD+EN+S+TF ++ GE+ N+FK F++ LQ      G+ VKW LEY
Sbjct  61   TLGGTSMSLKETVESVDDENKSITFKVVDGEIMNHFKCFKSNLQVKAKDEGSLVKWXLEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            EK N +VP P +++EF +NV ++++ + LK 
Sbjct  121  EKVNKDVPNPDAYLEFAVNVTKDIESHYLKA  151



>ref|XP_007045177.1| MLP-like protein 34, putative [Theobroma cacao]
 gb|EOY01009.1| MLP-like protein 34, putative [Theobroma cacao]
Length=151

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 100/149 (67%), Gaps = 5/149 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQI K+E + +IKS + KF+DI+ +   L+PKICP   +  +L+EGD  SVGSVRLW Y
Sbjct  1    MAQIAKMEVQIEIKSSADKFYDIFRSKMHLMPKICPQNFKDGKLVEGDWNSVGSVRLWFY  60

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEY  389
               GN    K+  +A+D++++++TF ++ G++  Y+KSF++ L  +    G+ VKWT+EY
Sbjct  61   FAAGNSETVKETTEAIDDKSKTMTFNMLEGDMMKYYKSFKSILNVTALGQGSLVKWTMEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            EK N+ +P P  + +FL + +  VD YLL
Sbjct  121  EKQNEGIPDPIKYEDFLRSWSNNVDGYLL  149



>ref|XP_011021651.1| PREDICTED: MLP-like protein 423 [Populus euphratica]
Length=152

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 105/151 (70%), Gaps = 6/151 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA + KLE + +IKS +KKF+D   ++++L PK  P + +S+++LEGDGK+ GS+RL+TY
Sbjct  1    MASVGKLEVDVEIKSAAKKFWDNIRDSTTLFPKAFPDQYKSIEILEGDGKAAGSIRLFTY  60

Query  225  ILGGNV--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLE  386
              G  +  ++K++ID VDE  + V++++I G++  Y+KSFRAT+    +  G+ VKW  E
Sbjct  61   AEGSPLVKVSKERIDTVDEAKKEVSYSVIEGDLLKYYKSFRATIVVNPKGDGSLVKWMCE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            YEKA+++V  PH   +F++    EVDE +LK
Sbjct  121  YEKASEDVEVPHMIKDFVVKNFLEVDELILK  151



>emb|CAN83049.1| hypothetical protein VITISV_030287 [Vitis vinifera]
 emb|CBI26886.3| unnamed protein product [Vitis vinifera]
Length=151

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 100/149 (67%), Gaps = 5/149 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   KLE ET+IK+P+ KFF I+ + +  LP IC  KI  +++ EGD ++ GSV+ W+ 
Sbjct  1    MALTGKLETETEIKAPADKFFKIFRSQAHHLPNICSDKIHKIEVHEGDWETQGSVKHWSL  60

Query  225  ILGGNVIA-KDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEY  389
             +G N  + K+ +D +DEENRS+TF ++ GEV   +KS++ T QA     G  V WT+EY
Sbjct  61   TVGENSESIKETVDQIDEENRSITFKVLDGEVLKDYKSYKFTTQAIPKGEGCLVIWTIEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            EKA++  P PH+ +EF +N+ ++++ +LL
Sbjct  121  EKASEGGPDPHNCLEFSVNITKDIESHLL  149



>ref|NP_001268151.1| ripening-related protein-like [Vitis vinifera]
 emb|CAB85634.1| putative ripening-related protein [Vitis vinifera]
Length=151

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 100/149 (67%), Gaps = 5/149 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   KLE ET+IK+P+ KFF I+ + +  LP IC  KI  +++ EGD ++ GSV+ W+ 
Sbjct  1    MALTGKLETETEIKAPADKFFKIFRSQAHHLPNICSDKIHKIEVHEGDWETQGSVKHWSL  60

Query  225  ILGGNVIA-KDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEY  389
             +G N  + K+ +D +DEENRS+TF ++ GEV   +KS++ T QA     G  V WT+EY
Sbjct  61   TVGENSESIKETVDQIDEENRSITFKVLDGEVLKDYKSYKFTTQAIPKGEGCLVIWTIEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            EKA++  P PH+ +EF +N+ ++++ +L+
Sbjct  121  EKASEGGPDPHNCLEFSVNITKDIESHLV  149



>ref|XP_009629007.1| PREDICTED: MLP-like protein 423 [Nicotiana tomentosiformis]
Length=152

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 101/150 (67%), Gaps = 6/150 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   K++ E ++K+P+ KF++   ++++L PK  P + +S++++EGDGKSVGSVRL  Y
Sbjct  1    MAAKGKIDVEVEVKTPADKFWNSIRDSTNLFPKAFPHQYKSIEVVEGDGKSVGSVRLINY  60

Query  225  ILGGNVI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLE  386
              G  ++  AK+KI++VDE N++V +++I GE   Y+KSF+ +L  S    G+ VKW  E
Sbjct  61   AEGSPLVTFAKEKIESVDEGNKTVVYSVIDGETMKYYKSFKGSLTVSPKGDGSLVKWCCE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            +EKA+D VP P    +F +   +++D YL+
Sbjct  121  FEKASDEVPEPQLIKDFAVKNFKDLDAYLI  150



>ref|XP_010272006.1| PREDICTED: MLP-like protein 423 [Nelumbo nucifera]
Length=151

 Score =   122 bits (307),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 99/145 (68%), Gaps = 6/145 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E   ++KSP+ KF+     ++ L P+I P + +S++++EGDG+SVGSVRL  Y  G  
Sbjct  3    KIEIAVEVKSPADKFWGAIKESTKLFPEIFPEQYKSIEIVEGDGQSVGSVRLIKYAEGIP  62

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEYEKAN  401
            +I  +K++++  DEE++SV++ +I G+++N++K F+A+LQ      G+ VKW++EYEKA 
Sbjct  63   IITFSKERVETADEESKSVSYTVIDGDISNFYKHFKASLQVVPKGEGSCVKWSVEYEKAT  122

Query  402  DNVPTPHSHVEFLMNVAREVDEYLL  476
            + VP P+   EF +    ++D YLL
Sbjct  123  EEVPEPNLIQEFAVKTFSDLDTYLL  147



>ref|XP_008245210.1| PREDICTED: MLP-like protein 423 [Prunus mume]
Length=153

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 97/145 (67%), Gaps = 6/145 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE E ++KSPS+KF++   N++++ PK  P   +S+ +LEGDGK+VGSVRL TY  G  
Sbjct  7    KLEVEIEVKSPSQKFWECLRNSTTIFPKAFPHDYKSIDVLEGDGKAVGSVRLITYSEGSP  66

Query  240  V--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAN  401
            +  ++K+ IDAVDE N+SV + +I G++  Y+KSF+  L    +  G+ VKW+  YEKA+
Sbjct  67   IVKVSKEAIDAVDEANKSVAYKVIDGDLLKYYKSFKCILTVTPKGDGSLVKWSSVYEKAH  126

Query  402  DNVPTPHSHVEFLMNVAREVDEYLL  476
            + +P P    +F +   +E+D Y+L
Sbjct  127  EQIPDPSLIKDFAVKNFQELDAYVL  151



>ref|XP_009789323.1| PREDICTED: MLP-like protein 423 [Nicotiana sylvestris]
Length=152

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 103/150 (69%), Gaps = 6/150 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M+ I K++ E ++K+P+ KF++   ++++L PK  P + +S++++EGDGKSVGSVRL  Y
Sbjct  1    MSSIGKIDVEVEVKTPADKFWNSIRDSTNLFPKAFPDQYKSIEVVEGDGKSVGSVRLIKY  60

Query  225  ILGGNVI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS--GNS--VKWTLE  386
              G  +I  AK+KI++VDE N++V +++I GE   Y+KSF+ +L  S  G++  VKW  E
Sbjct  61   GEGSPLITFAKEKIESVDEGNKAVVYSVIDGETMKYYKSFKGSLTVSPKGDASLVKWCCE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            +EKA+D VP P    +F +   +++D YL+
Sbjct  121  FEKASDEVPEPQLIKDFAVKNFKDLDAYLI  150



>emb|CDP00197.1| unnamed protein product [Coffea canephora]
Length=150

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 97/147 (66%), Gaps = 6/147 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            +L+ E ++KS + KF+D  +++ +L PK CP + +S+++LEGDGKSVGSVRL  Y  G  
Sbjct  4    QLDVEVEVKSSADKFWDAIMDSVALFPKACPNQYKSIEVLEGDGKSVGSVRLVKYAEGSP  63

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAN  401
             I  +K+KI+ VDE N++V +++I G++  ++K F+ TL    +  G+SVKW  E+EK +
Sbjct  64   EITFSKEKIEFVDEGNKTVRYSVIEGDLLKFYKLFKPTLVVSAKGDGSSVKWVCEFEKTS  123

Query  402  DNVPTPHSHVEFLMNVAREVDEYLLKT  482
            D +P P    +F     +E+D YLLK 
Sbjct  124  DEIPNPDIIKDFAAKNFQELDAYLLKA  150



>ref|XP_002314732.1| Bet 5 1 allergen family protein [Populus trichocarpa]
 gb|EEF00903.1| Bet 5 1 allergen family protein [Populus trichocarpa]
Length=152

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 102/151 (68%), Gaps = 6/151 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   KLE + +IKS +KKF+D   ++++L PK  P + +S+++LEGDGK+ GS RL+TY
Sbjct  1    MASGGKLEVDVEIKSAAKKFWDNIRDSTTLFPKAFPDQYKSIEILEGDGKAAGSTRLFTY  60

Query  225  ILGGNV--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLE  386
              G  +  ++K++ID VDE  + V++++I G++  Y+KSF+AT+    +  G+ VKW  E
Sbjct  61   GEGSPLVKVSKERIDTVDEAKKEVSYSVIEGDLLKYYKSFKATIVVTPKGDGSLVKWMCE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            + KA+++V  PH   +F++    EVDE +LK
Sbjct  121  FVKASEDVEVPHVIKDFVVKNFLEVDELILK  151



>ref|XP_010043801.1| PREDICTED: MLP-like protein 423 [Eucalyptus grandis]
 gb|KCW85794.1| hypothetical protein EUGRSUZ_B02546 [Eucalyptus grandis]
Length=152

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 101/152 (66%), Gaps = 6/152 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M     LE E ++KSP+ KF+    +++ L PKI P + +++++LEGDGK+ GSVRL+TY
Sbjct  1    MGGPLTLEAEVEVKSPADKFWVSMRDSTKLFPKIFPDQYKNIEVLEGDGKAPGSVRLFTY  60

Query  225  ILGGNV--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLE  386
              G  +  ++K+KID VDE ++ VT+++I G++  Y+K+F  ++    +  G+ VKW+  
Sbjct  61   GEGSPLVKVSKEKIDGVDEADKVVTYSVIDGDLLKYYKNFNGSIKVIPKGDGSLVKWSCG  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            +EKA+D +P PH   +F +   +E+DE++LK 
Sbjct  121  FEKASDEIPDPHVIKDFAIQNFKELDEFILKA  152



>ref|XP_008340260.1| PREDICTED: MLP-like protein 31 [Malus domestica]
Length=181

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 95/145 (66%), Gaps = 7/145 (5%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            LE E +I + + KF+ I+     LLP IC  KI+ V+L EGD ++ GSV+ W Y L G+ 
Sbjct  35   LETEVEISTAADKFYKIFSGQMHLLPNICSDKIQGVELHEGDWETAGSVKHWDYTLDGSS  94

Query  243  IA-KDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKAN  401
            ++ K+ ++A+DEEN++V F ++ GE+  ++KSFR TL+ +      G+ VKW ++YEK  
Sbjct  95   LSVKETVEAIDEENKTVKFNVLDGEILKHYKSFRVTLKVTEKTTGGGSLVKWIIDYEKVK  154

Query  402  DNVPTPHSHVEFLMNVAREVDEYLL  476
            + +P P S+ +F + V ++++ +LL
Sbjct  155  EEIPDPESYQDFAVKVTKDLEAHLL  179



>ref|XP_007227537.1| hypothetical protein PRUPE_ppa012809mg [Prunus persica]
 gb|EMJ28736.1| hypothetical protein PRUPE_ppa012809mg [Prunus persica]
Length=153

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 97/145 (67%), Gaps = 6/145 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE E ++KSPS+KF++   +++++ PK  P   +S+ +LEGDGK+VGSVRL TY  G  
Sbjct  7    KLEVEIEVKSPSQKFWEGLRDSTTIFPKAFPHDYKSIDVLEGDGKAVGSVRLITYSEGSP  66

Query  240  V--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAN  401
            +  ++K+ IDAVDE N+SV + +I G++  Y+KSF+  L    +  G+ VKW+  +EKA+
Sbjct  67   IVKVSKETIDAVDEANKSVAYKVIDGDLLKYYKSFKCILTVTPKGDGSLVKWSSVFEKAH  126

Query  402  DNVPTPHSHVEFLMNVAREVDEYLL  476
            + +P P    +F +   +E+D Y+L
Sbjct  127  EQIPDPSLIKDFAVQNFQELDAYVL  151



>ref|XP_008793846.1| PREDICTED: MLP-like protein 423 [Phoenix dactylifera]
Length=150

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 95/146 (65%), Gaps = 6/146 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K E E ++KSP+ KF+    +++ L PKI P + +S++++EGDGKSVG++R+  Y  G  
Sbjct  4    KAEVEVEVKSPADKFWGAIRDSTDLFPKIFPEQYKSIEIVEGDGKSVGTIRILKYAEGFP  63

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEYEKAN  401
            ++  +K++I+  D+ N+ V+ ++I GE+  ++K+F+ATLQ      G  VKW L+YEKAN
Sbjct  64   IVTFSKERIEVADDANKQVSCSVIDGELVGFYKAFKATLQVVPKGEGGLVKWCLDYEKAN  123

Query  402  DNVPTPHSHVEFLMNVAREVDEYLLK  479
            + VP P    E  +   + +D YLL+
Sbjct  124  EEVPQPDLLQETAVKTFKGLDAYLLQ  149



>gb|KDP21316.1| hypothetical protein JCGZ_21787 [Jatropha curcas]
Length=153

 Score =   118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 100/152 (66%), Gaps = 6/152 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA    LE + +IKS   KF++   ++++L PK  P   +S+Q+L+GDGK+ GS+R +TY
Sbjct  1    MASNGTLEVDVEIKSSPDKFWNNIRDSTTLFPKAFPHDYKSIQVLQGDGKAAGSIRQFTY  60

Query  225  ILGGNV--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLE  386
              G  +  +++++IDAVDE  + V++++I G++  Y+KSF+  L    +  G+ VKW+ E
Sbjct  61   GEGSPIVKVSQERIDAVDEAAKEVSYSVIEGDLLKYYKSFKGKLVVLPKGDGSLVKWSCE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            YEKA+D+V  PH+  +F++   +EVDE  LK 
Sbjct  121  YEKASDDVGVPHAIKDFVVKNFKEVDELDLKA  152



>ref|XP_007045171.1| MLP-like protein 34 isoform 2 [Theobroma cacao]
 gb|EOY01003.1| MLP-like protein 34 isoform 2 [Theobroma cacao]
Length=123

 Score =   117 bits (292),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 80/120 (67%), Gaps = 4/120 (3%)
 Frame = +3

Query  132  LLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNVIAKDKIDAVDEENRSVTFALIGG  311
            L+PKICP  +  V++++GD ++VGSVR+W Y+ G +  A + I+A+D+ N+S+T   + G
Sbjct  3    LMPKICPELVTDVKVVKGDWETVGSVRIWKYVAGLSENASETIEAIDDRNKSITLNALDG  62

Query  312  EVTNYFKSFR----ATLQASGNSVKWTLEYEKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            ++T Y+K+F+     T    G+ VKWTL YEK N N+P P  ++EF   + + VD YLLK
Sbjct  63   DITKYYKTFKVIVTVTANGQGSLVKWTLMYEKQNQNIPDPEKYIEFASAITKSVDAYLLK  122



>ref|XP_004293036.1| PREDICTED: major latex protein 146-like [Fragaria vesca subsp. 
vesca]
Length=152

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 90/152 (59%), Gaps = 6/152 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA+I KLE +TQI + + KFF  + NN +   +I P   +  Q++ G          W Y
Sbjct  1    MAKIGKLESQTQINASADKFFGFFKNNMTKFVQIFPQNFKGFQVVGGGEIRAACEIYWKY  60

Query  225  ILGGNVI-AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS-----GNSVKWTLE  386
             +G  V+ AK K+ A+D+ENRS+TF  + G+    +KSF+A +QA+     G +VKWT+E
Sbjct  61   DIGSGVLTAKLKVQAIDDENRSITFIFLEGDALKVYKSFKAKMQANKAGNGGCTVKWTME  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            +EKAN+NVP P  + E    V+R +D YL  T
Sbjct  121  FEKANENVPDPKGYTELGEKVSRGLDAYLAGT  152



>ref|XP_009360478.1| PREDICTED: MLP-like protein 423 [Pyrus x bretschneideri]
 ref|XP_009363503.1| PREDICTED: MLP-like protein 423 [Pyrus x bretschneideri]
Length=153

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 95/145 (66%), Gaps = 6/145 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE E ++KSP++KF++   +++++ PK  P   +S+ +LEGDGK+VGSVRL TY  G  
Sbjct  7    KLEVEVEVKSPAQKFWEALRDSTTVFPKAFPHDYKSIDVLEGDGKAVGSVRLITYAEGSA  66

Query  240  V--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAN  401
            +  ++K+ IDAVDE  ++V + +I G++  Y+KSF+ TL    +  G+ VKW+  YEKA+
Sbjct  67   LVKVSKETIDAVDEVGKAVAYKVIDGDLLKYYKSFKCTLTVTPKGDGSLVKWSSVYEKAH  126

Query  402  DNVPTPHSHVEFLMNVAREVDEYLL  476
            + VP P    +F      E+D Y+L
Sbjct  127  EQVPEPSIIKDFAAKNFLELDAYVL  151



>ref|XP_008389602.1| PREDICTED: MLP-like protein 423 [Malus domestica]
Length=153

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 95/145 (66%), Gaps = 6/145 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE E ++KSP++KF++   +++++ PK  P   +S+ +LEGDGK+VGSVRL TY  G  
Sbjct  7    KLEVEVEVKSPAQKFWEALRDSTTVFPKAFPHDYKSIDVLEGDGKAVGSVRLITYAEGSA  66

Query  240  V--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAN  401
            +  ++K+ IDAVDE  ++V + +I G++  Y+KSF+ TL    +  G+ VKW+  YEKA+
Sbjct  67   LVKVSKETIDAVDEVGKAVAYKVIDGDLLKYYKSFKCTLTVTPKGDGSLVKWSSVYEKAH  126

Query  402  DNVPTPHSHVEFLMNVAREVDEYLL  476
            + VP P    +F      E+D Y+L
Sbjct  127  EQVPEPSIIKDFAAKNFLELDAYVL  151



>ref|XP_004297655.1| PREDICTED: MLP-like protein 423-like [Fragaria vesca subsp. vesca]
Length=157

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 96/152 (63%), Gaps = 9/152 (6%)
 Frame = +3

Query  48   AQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYI  227
            + + KL  E ++KSP+ KF+    +++ + PK  P   +S+ +LEGDGK+VGSVRL TY 
Sbjct  4    SDVGKLHVEVEVKSPADKFWVSIRDSTEVFPKAFPHDYKSIDVLEGDGKAVGSVRLITYS  63

Query  228  LGGNV--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL-------QASGNSVKWT  380
             G  +  ++K+ ID VDE N++V + +I G++  Y+KSF+  L       +  G+ VKW+
Sbjct  64   EGSPIVKVSKETIDMVDETNKAVAYQVIDGDLLKYYKSFKCILTVIPKGAEGEGSLVKWS  123

Query  381  LEYEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
             EYEKA++ VP P    +F +   +E+D+Y+L
Sbjct  124  CEYEKAHEQVPEPSIIKDFAVKNFKELDDYVL  155



>ref|XP_008446239.1| PREDICTED: MLP-like protein 423 [Cucumis melo]
Length=155

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 99/151 (66%), Gaps = 8/151 (5%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA    L  E  +KS + KF+    +++ + PK  P   +S+++LEGDGK+VGS+RL TY
Sbjct  1    MASDGTLSVEVDVKSVADKFWKNMRDSTIIFPKAFPHDYKSIEVLEGDGKAVGSIRLITY  60

Query  225  ILGGNVI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL------QASGNSVKWT  380
              G  ++  +K++I+A DEE ++V++++IGG++  Y+KSF+  +        +G+SVKW+
Sbjct  61   SEGSPIVKESKERIEAADEEKKTVSYSVIGGDLLKYYKSFKGHIVVIPKEDGNGSSVKWS  120

Query  381  LEYEKANDNVPTPHSHVEFLMNVAREVDEYL  473
             E+EKA++ +P PH+  +F++    E+D+Y 
Sbjct  121  CEFEKASEEIPDPHAIKDFVVKNFMELDDYC  151



>ref|XP_004509856.1| PREDICTED: MLP-like protein 423-like [Cicer arietinum]
Length=152

 Score =   115 bits (287),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 95/150 (63%), Gaps = 6/150 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   KLE E ++KS + KF+ I  +++S+ PK  P   +S+++LEGDG +VGSVRL T+
Sbjct  1    MATNGKLEVEIEVKSNADKFWSIIKDSASIFPKAFPNDYKSIEILEGDGNTVGSVRLVTF  60

Query  225  ILGGNV--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLE  386
              G     I K+KID +D+  R++T+++I G++  YFK  ++ L    +  G+ VKW+ E
Sbjct  61   GEGSPFVKINKEKIDDIDDSKRTLTYSVIDGDLLKYFKQLKSHLSVTPKGDGSLVKWSSE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            YEK +  VP P    EF +N   +VDEY+L
Sbjct  121  YEKDSQEVPEPEIIKEFAVNTFLKVDEYIL  150



>ref|XP_008457062.1| PREDICTED: MLP-like protein 423 [Cucumis melo]
Length=154

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 91/154 (59%), Gaps = 8/154 (5%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M+Q   +  + Q+KSP +KF+  + N+   L  + P   +S Q LEG+  + GSV  W Y
Sbjct  1    MSQTESIWAKVQLKSPPEKFYGFFRNHMGDLVHMFPDNFQSFQFLEGESFTTGSVMHWQY  60

Query  225  ILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA--------SGNSVKWT  380
             LG    AK K+  VD+  +S+ + ++ G+V  Y+K FRA L+A         GN  KWT
Sbjct  61   HLGSPAAAKIKMRLVDDVKKSIVYEIMDGDVLKYYKVFRAKLEAVNGGLNKVGGNFAKWT  120

Query  381  LEYEKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            +EY+KAN+NVP+P +++E  + V++ +D Y+ K 
Sbjct  121  IEYQKANENVPSPENYMELAVKVSKGLDAYIFKN  154



>ref|XP_004135228.1| PREDICTED: MLP-like protein 423-like [Cucumis sativus]
 ref|XP_004155345.1| PREDICTED: MLP-like protein 423-like [Cucumis sativus]
 gb|KGN51827.1| Major latex-like protein [Cucumis sativus]
Length=155

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 100/151 (66%), Gaps = 8/151 (5%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA    L  E  +KS + KF+    +++ + PK  P   +S+++LEGDGK+VGS+RL TY
Sbjct  1    MASDGTLSVELDVKSVADKFWKNMRDSTIIFPKAFPHDYKSIEVLEGDGKAVGSIRLITY  60

Query  225  ILGGNVI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL------QASGNSVKWT  380
              G  ++  +K++I+AVDEE ++V++++I G++  Y+KSF+  +      + +G+SVKW+
Sbjct  61   SEGSPIVKESKERIEAVDEEKKTVSYSVIEGDLLKYYKSFKGHIAVIPKEEENGSSVKWS  120

Query  381  LEYEKANDNVPTPHSHVEFLMNVAREVDEYL  473
             E+EKA++ +P PH+  +F++    E+D+Y 
Sbjct  121  CEFEKASEEIPDPHAIKDFVVKNFMELDDYC  151



>ref|XP_006438454.1| hypothetical protein CICLE_v10032973mg [Citrus clementina]
 ref|XP_006483797.1| PREDICTED: MLP-like protein 423-like [Citrus sinensis]
 gb|ESR51694.1| hypothetical protein CICLE_v10032973mg [Citrus clementina]
 gb|KDO82563.1| hypothetical protein CISIN_1g031700mg [Citrus sinensis]
Length=154

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 95/147 (65%), Gaps = 6/147 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE E ++KS + KF+    ++++L PK      +S+Q+LEGDGK+ GSVRL TY  G  
Sbjct  7    KLEVELEVKSSADKFWGSIRDSTTLFPKAFSHDYKSIQVLEGDGKAPGSVRLITYADGSP  66

Query  240  V--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAN  401
            +  ++ +KI+ VDE N+ VT+ +I G++  Y+K+F+  +    +  G+ VKW  E+EKA+
Sbjct  67   IVKVSTEKIENVDEANKVVTYKVIDGDLLKYYKAFKGIVSVNPKGEGSLVKWACEFEKAS  126

Query  402  DNVPTPHSHVEFLMNVAREVDEYLLKT  482
            D+VP P    +F +   +EVD+Y+LK 
Sbjct  127  DDVPDPSVIKDFALKNFQEVDDYILKA  153



>ref|XP_004145833.1| PREDICTED: MLP-like protein 31-like [Cucumis sativus]
 gb|KGN57817.1| Major latex protein [Cucumis sativus]
Length=152

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 95/149 (64%), Gaps = 6/149 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQI ++  + QIK  ++KF+  +  N   L ++ P  + + + LEG+  + G++  W+Y
Sbjct  1    MAQISQVSADVQIKCGAEKFYGFFRKNMFQLAQMFPKNLHACEFLEGNDFTTGALMQWSY  60

Query  225  ILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASGN------SVKWTLE  386
             + G    K K+D VDE+N+S+T+  + G++ +++  FRA  QAS N      +VKWT+E
Sbjct  61   DIVGPAKVKAKVDDVDEQNKSITYEAVEGDILSHYNFFRAKFQASPNGESGSATVKWTIE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYL  473
            +EKA++N+PTP ++++F+  ++  +D YL
Sbjct  121  FEKADENIPTPEAYLDFVSKLSLGLDAYL  149



>ref|XP_010320602.1| PREDICTED: MLP-like protein 423 [Solanum lycopersicum]
Length=153

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 98/149 (66%), Gaps = 6/149 (4%)
 Frame = +3

Query  48   AQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYI  227
            + + K++ E ++KSP  KF++   ++ +L PK  P + +S++++EGDGKSVGSV L  Y 
Sbjct  3    SNLGKIDVEVEVKSPVDKFWNGIRDSINLFPKASPNEYKSIEVVEGDGKSVGSVLLIKYT  62

Query  228  LGGNVI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEY  389
             G  ++  +K+KI+++DE N+++ +++I GE   Y+KSF+ TL    + +G+ VKW  E+
Sbjct  63   EGFPLVTFSKEKIESIDEANKTLVYSVIDGETLKYYKSFKGTLTVIPKGNGSLVKWCCEF  122

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            E+AND +P P    EF +   + +D YL+
Sbjct  123  ERANDEIPEPQIIKEFAVKNFKNLDAYLI  151



>ref|XP_007045173.1| MLP-like protein 34 [Theobroma cacao]
 gb|EOY01005.1| MLP-like protein 34 [Theobroma cacao]
Length=156

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 80/120 (67%), Gaps = 4/120 (3%)
 Frame = +3

Query  132  LLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNVIAKDKIDAVDEENRSVTFALIGG  311
            L+PKICP  +  +++++GD ++VGSVR+W Y+ G +    + I+++D+ N+S+TF  + G
Sbjct  36   LVPKICPELVTDIKVVKGDWETVGSVRIWKYVAGLSENVSETIESIDDRNKSITFNALDG  95

Query  312  EVTNYFKSFRA----TLQASGNSVKWTLEYEKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            ++T Y+K+F+     T    G+ VKWTL YEK N N+P P  ++E +  + + VD YLLK
Sbjct  96   DITKYYKTFKGIVTVTANGQGSLVKWTLMYEKQNQNIPDPEKYIELVSAITKSVDAYLLK  155



>ref|XP_010928576.1| PREDICTED: MLP-like protein 423 [Elaeis guineensis]
Length=150

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 92/146 (63%), Gaps = 6/146 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K E E ++KS + KF+    +++ L PKI P + +S++++EGDGKS GS+RL  Y  G  
Sbjct  4    KAEMEVEVKSSADKFWGALRDSTDLFPKIFPEQYKSIEIVEGDGKSAGSIRLLKYTEGFP  63

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEYEKAN  401
            ++  +K++I+  D+ N+ V++++I GE+ +++K F+A+LQ      G  VKW LEYEK N
Sbjct  64   ILTFSKERIEVADDANKQVSYSVIDGELVSFYKPFKASLQVVPKGEGGLVKWCLEYEKVN  123

Query  402  DNVPTPHSHVEFLMNVAREVDEYLLK  479
            +  P P    E      +++D YLL+
Sbjct  124  EEFPQPDIIQETAAQTFKDLDAYLLQ  149



>ref|XP_008340001.1| PREDICTED: MLP-like protein 423 [Malus domestica]
Length=153

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 95/145 (66%), Gaps = 6/145 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE E ++KSP++KF++   +++++ PK  P   +S+ +LEGDGK+VGSVRL TY     
Sbjct  7    KLEVEVEVKSPAQKFWEALRDSTTVFPKAFPQDYKSIDVLEGDGKAVGSVRLITYADDSA  66

Query  240  V--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAN  401
            +  ++K+ IDAVDE  ++V + +I G++  Y+KSF+  L    +  G+ VKW+  +EKA+
Sbjct  67   LVKVSKETIDAVDEVGKAVAYKVIDGDLLKYYKSFKCVLTVTPKGDGSLVKWSSVFEKAH  126

Query  402  DNVPTPHSHVEFLMNVAREVDEYLL  476
            + VP P    +F +   +E+D Y+L
Sbjct  127  EQVPEPSIIKDFAVKNFQELDAYVL  151



>ref|XP_004975890.1| PREDICTED: MLP-like protein 423-like [Setaria italica]
Length=168

 Score =   113 bits (282),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 96/149 (64%), Gaps = 9/149 (6%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K E   ++KSP++K +    +++ L PKI P + +S++ +EGDGKS G+VRL  Y  G  
Sbjct  4    KAELVVEVKSPAEKLWAALRDSTELFPKIFPQQYKSIETVEGDGKSAGTVRLLKYAEGVP  63

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS-------GNSVKWTLEYE  392
            ++  AK+K++ VD+ENR V+++++ GE+ N++K+F+ TL+ S       G  V W++E++
Sbjct  64   MLTFAKEKVELVDDENRVVSYSVVDGELVNFYKNFKITLKVSPAKEGEAGAVVNWSMEFD  123

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            KA++ VP P    E       ++D+YLLK
Sbjct  124  KASEQVPDPDVIKETATKTFHDLDDYLLK  152



>emb|CDP20848.1| unnamed protein product [Coffea canephora]
Length=153

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 86/145 (59%), Gaps = 4/145 (3%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE E +IKS   +FF  +   +  LP +C  K+  V++ +GD K+ GSV+LWTY + G 
Sbjct  9    KLEAEIKIKSDPDEFFQSFGGKAHKLPNLCSDKVHGVKVHQGDWKTKGSVKLWTYAIDGK  68

Query  240  VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEYEKANDN  407
            V    +   VDEEN++VT   +GG +    KS++A+LQ       N  KWT+EYE  N+N
Sbjct  69   VETLKERLTVDEENKTVTAEAVGGHILEQLKSYKASLQVIPKGQSNYAKWTIEYENINEN  128

Query  408  VPTPHSHVEFLMNVAREVDEYLLKT  482
             P P  ++ +L++  ++VD  L+K 
Sbjct  129  EPAPTKYLHWLIHAGKDVDASLVKA  153



>ref|XP_002284570.1| PREDICTED: MLP-like protein 34 [Vitis vinifera]
Length=151

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 94/151 (62%), Gaps = 5/151 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M  I KL+ ET I + + KF +I+      +  +CPAKI+ V L EG+  + GSV  W Y
Sbjct  1    MGLIGKLQAETLIMASADKFHEIFWCRPHHISNVCPAKIQKVHLHEGEWGTSGSVIQWHY  60

Query  225  ILGGN-VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEY  389
             + GN  +AK+ ++A+DEEN+SVTF +I G++   +KSFR  +QA        V WTLEY
Sbjct  61   NIDGNDHVAKEIVEAIDEENKSVTFKVIEGDLMKEYKSFRIIVQAIPKGDATYVHWTLEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            EK N +V  P   + F+++V+ ++D++L++ 
Sbjct  121  EKLNKDVLAPIKILGFVVHVSEDIDDHLVQA  151



>ref|XP_006289231.1| hypothetical protein CARUB_v10002687mg [Capsella rubella]
 gb|EOA22129.1| hypothetical protein CARUB_v10002687mg [Capsella rubella]
Length=169

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 91/146 (62%), Gaps = 8/146 (5%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            +E E +IKSP+ KF+ +Y    + + K    K+++  LLEGD  +VGS+  W Y+  G  
Sbjct  21   VEVEVEIKSPAVKFYQVYAGRPNHVAKATSTKVQACDLLEGDWGTVGSIVNWNYVYAGKA  80

Query  243  -IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS-------GNSVKWTLEYEKA  398
             +AK++I+ V+ E   + F +I G+V   +KSF  T+QA+       G+ VKW LEYE+ 
Sbjct  81   KVAKERIELVEPEKNLIKFRVIEGDVLALYKSFLITIQATTAKEGGVGSVVKWHLEYERN  140

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            ++NVP P +++ FL  + +E+DE+LL
Sbjct  141  DENVPHPENYLPFLAEMTKEIDEHLL  166



>gb|AFK48227.1| unknown [Lotus japonicus]
Length=153

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 95/151 (63%), Gaps = 6/151 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M    KLE +  +KS + K++    +++++ PK  P   +S+++LEGDGK+ GSVR  TY
Sbjct  1    MGTRGKLEVDIDLKSNADKYWLTLRDSTTIFPKAFPHDYKSIEILEGDGKAAGSVRHITY  60

Query  225  ILGGNVI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLE  386
              G  ++  + +KIDA D+E ++V++A+I GE+  Y+K F+ T+       G+ VKW+ E
Sbjct  61   AEGSPLVKSSTEKIDAGDDEKKTVSYAVIDGELLQYYKKFKGTISVIAVGEGSEVKWSAE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            YEKA+ ++P P    +F +    EVDEY+L+
Sbjct  121  YEKASTDIPDPSVVKDFAVKNFLEVDEYVLQ  151



>ref|XP_004291554.1| PREDICTED: MLP-like protein 28-like [Fragaria vesca subsp. vesca]
Length=152

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 92/149 (62%), Gaps = 6/149 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQI K+E + ++KS + KF+  + +N S   ++ P   ++ +++ G     GSV  WTY
Sbjct  1    MAQIAKIESQAELKSSAAKFYGFFKSNMSSFVQMFPQIFKNFEVVGGGEIRTGSVTKWTY  60

Query  225  ILGGNVI-AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS-----GNSVKWTLE  386
             LG  VI AK KI A+D+ + S+TF ++ G+V   +KSF A +Q +     G+ VKWTLE
Sbjct  61   DLGEGVIAAKIKIQALDDGDTSITFVILEGDVLKVYKSFMAKMQVTKAGNGGSIVKWTLE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYL  473
            +EKAN N P P  + E+ + V++ +D YL
Sbjct  121  FEKANSNTPDPKIYAEYAIKVSKGIDAYL  149



>ref|XP_010913536.1| PREDICTED: MLP-like protein 423 [Elaeis guineensis]
Length=150

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 95/146 (65%), Gaps = 6/146 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E E ++KSP+  F+    ++++L P+I P + +S++ +EGDGKS G++RL  Y  G  
Sbjct  4    KVEAEVEVKSPADNFWGALRDSTALFPRIFPEQYKSIETVEGDGKSAGTIRLLKYAEGAP  63

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEYEKAN  401
            ++  AK++++  D+ N+ V++++I GE+ +++K F+ TLQ    + G  VKW LEY+K N
Sbjct  64   IVTFAKERVEVADDGNKLVSYSVIDGELVSFYKPFKVTLQVVPKSDGGLVKWWLEYDKVN  123

Query  402  DNVPTPHSHVEFLMNVAREVDEYLLK  479
            + VP P   +   +   +++D YLL+
Sbjct  124  EEVPQPDFILGTAVKTFKDLDAYLLQ  149



>gb|AFK40667.1| unknown [Lotus japonicus]
Length=153

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 93/149 (62%), Gaps = 6/149 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M    KLE +  +KS + K++    +++++ PK  P   +S+++LEGDGK+ GSVR  TY
Sbjct  1    MGTRGKLEVDIDLKSNADKYWLTLRDSTTIFPKAFPHDYKSIEILEGDGKAAGSVRHITY  60

Query  225  ILGGNVI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLE  386
              G  ++  + +KIDA D+E ++V++A+I GE+  Y+K F+ T+       G+ VKW+ E
Sbjct  61   AEGSPLVKSSTEKIDAADDEKKTVSYAVIDGELLQYYKKFKGTISVIAVGEGSEVKWSAE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYL  473
            YEKA+ +VP P    +F +    EVDEY+
Sbjct  121  YEKASTDVPDPSVVKDFAVKNFLEVDEYV  149



>ref|XP_002267219.1| PREDICTED: MLP-like protein 423 [Vitis vinifera]
 emb|CBI32104.3| unnamed protein product [Vitis vinifera]
Length=153

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 101/147 (69%), Gaps = 6/147 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE + ++K  ++K+++   +++++ PK  P + + +++LEGDGKSVGSVR  TY  G  
Sbjct  4    KLEVDVEVKCNAEKYWESIRDSNTIFPKAFPDQYKCIKVLEGDGKSVGSVRHITYGEGSP  63

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAN  401
            ++  +++++D VDE ++ V++++IGG++  Y+K+F+ATL    +  G+ VKWT ++EKA+
Sbjct  64   LVKESEERVDIVDEADKKVSYSVIGGDLLKYYKNFKATLVITPKGDGSLVKWTCDFEKAS  123

Query  402  DNVPTPHSHVEFLMNVAREVDEYLLKT  482
              +P P+   EF +    E+D+Y+ KT
Sbjct  124  AEIPDPNVIKEFAVKNFIELDDYIHKT  150



>ref|XP_004164830.1| PREDICTED: MLP-like protein 34-like [Cucumis sativus]
Length=154

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 90/153 (59%), Gaps = 8/153 (5%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M+Q   +  +  +KSP +KF+  + N+   L  + P   +S Q LEG+  + GSV  W Y
Sbjct  1    MSQTESIWAKVPLKSPPEKFYGFFRNHMGDLVHMFPDNFQSFQFLEGESFTTGSVMHWQY  60

Query  225  ILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA--------SGNSVKWT  380
             LG    AK K+  VD+  +S+ + ++ G+V  ++K FRA L+A         GN  KWT
Sbjct  61   HLGSPAAAKIKMRVVDDVKKSIVYEIMDGDVLKHYKVFRAKLEAVNGGLNKVGGNFAKWT  120

Query  381  LEYEKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            +EY+KAN+NVP+P +++E  + V++ +D Y+ K
Sbjct  121  IEYQKANENVPSPETYMELAVKVSKGLDAYIFK  153



>gb|AAY26389.1| salt tolerant protein [Triticum aestivum]
Length=153

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 94/149 (63%), Gaps = 9/149 (6%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E   ++KSP++K +     ++ L PKI P + +S++ +EGDGKS G+VRL  Y  G  
Sbjct  4    KVELVVEVKSPAEKLWTAMRESTELFPKIFPEQYKSIETMEGDGKSAGTVRLIKYTEGVP  63

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ-------ASGNSVKWTLEYE  392
            ++  AK+K++  D+E + V+++++ GE+ +++K+FR T+Q        +G  V WT++++
Sbjct  64   MVTFAKEKVEVADDEKKVVSYSVVDGELVSFYKNFRVTVQVTDKGADGAGAVVNWTMDFD  123

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            KA+D VP P    E       ++D+YLLK
Sbjct  124  KASDEVPEPDVIKETAAKTFHDLDDYLLK  152



>ref|XP_004149789.1| PREDICTED: MLP-like protein 34-like [Cucumis sativus]
 gb|KGN57834.1| hypothetical protein Csa_3G342860 [Cucumis sativus]
Length=154

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 89/153 (58%), Gaps = 8/153 (5%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M+Q   +  +  +KSP +KF+  + N+   L  + P   +S Q LEG+  + GSV  W Y
Sbjct  1    MSQTESIWAKVPLKSPPEKFYGFFRNHMGDLVHMFPDNFQSFQFLEGESFTTGSVMHWQY  60

Query  225  ILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA--------SGNSVKWT  380
             LG    AK K+  VD+  +S+ +  + G+V  ++K FRA L+A         GN  KWT
Sbjct  61   HLGSPAAAKIKMRVVDDVKKSIVYEFMDGDVLKHYKVFRAKLEAVNGGLNKVGGNFAKWT  120

Query  381  LEYEKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            +EY+KAN+NVP+P +++E  + V++ +D Y+ K
Sbjct  121  IEYQKANENVPSPETYMELAVKVSKGLDAYIFK  153



>gb|KCW64566.1| hypothetical protein EUGRSUZ_G02171 [Eucalyptus grandis]
Length=148

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 92/150 (61%), Gaps = 6/150 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQ+ K+E + +++SP++K FDI+   S L P+I P  ++ V+L+ GD  SVGSV LWT 
Sbjct  1    MAQLVKVEAQVELESPAEKVFDIFRRKSYLFPEIAPHVVKDVKLVSGDWDSVGSVWLWTQ  60

Query  225  ILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASGN----SVKWTLEYE  392
               G+   K+  +A D+E +S+TF  + G   N++KS +++LQ S      + K  L YE
Sbjct  61   CDSGS--GKETFEAFDDETKSITFKCLDGVAMNFYKSLKSSLQFSPEGERCTAKAVLTYE  118

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            K N +VP  + ++EF  ++   VD YLLK 
Sbjct  119  KQNADVPDANKYLEFTRSLLISVDGYLLKA  148



>ref|XP_009105754.1| PREDICTED: MLP-like protein 31 [Brassica rapa]
Length=157

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 91/146 (62%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGG-  236
            KLE + +IK+ ++KF  ++      LPK  P K+R+ +L EGD   VGSV +W+Y++ G 
Sbjct  10   KLEADVEIKASAEKFHHMWAGRVHDLPKATPDKVRNCELQEGDWGKVGSVVIWSYVIDGV  69

Query  237  NVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
             ++ KD+++ V+ E   +TF +I  ++   +KSF +T+Q +      G  V W LEYEK 
Sbjct  70   AIVCKDRVEEVEPEKNLITFRVIESDLLKMYKSFVSTIQVTPKHGGPGGIVHWDLEYEKV  129

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            ++ V  P SH++  + V++++DEYLL
Sbjct  130  SEEVEHPESHLQLSVEVSKDIDEYLL  155



>ref|XP_006416036.1| hypothetical protein EUTSA_v10008991mg [Eutrema salsugineum]
 gb|ESQ34389.1| hypothetical protein EUTSA_v10008991mg [Eutrema salsugineum]
Length=155

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 93/151 (62%), Gaps = 6/151 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA    L  E ++KSP++KF+    +   L PK  P   +++Q+L GDG + GS+RL TY
Sbjct  1    MALTGVLHVEVEVKSPAEKFWLALGDGVKLFPKEFPKDYKTIQVLAGDGNAPGSIRLITY  60

Query  225  ILGGNV--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLE  386
              G  +  I+ +KI+ VD E +S+T+++IGGE+  Y+K+F+ T+  +    G+ +KW+ E
Sbjct  61   GEGSPLVKISAEKIETVDLERKSITYSIIGGEMLEYYKTFKGTITVTPKDGGSILKWSGE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            +EK    +  PH   +F +   +E+DEYLLK
Sbjct  121  FEKTGHEIADPHVIKDFAVKNFKEIDEYLLK  151



>gb|EMT05612.1| MLP-like protein 423 [Aegilops tauschii]
Length=153

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 94/149 (63%), Gaps = 9/149 (6%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E   ++KSP++K +     ++ L PKI P + +S++ +EGDGKS G+VRL  Y  G  
Sbjct  4    KVELVVEVKSPAEKLWTAMRESTELFPKIFPEQYKSIETVEGDGKSAGTVRLIKYTEGVP  63

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS-------GNSVKWTLEYE  392
            ++  AK+K++  D+E + V+++++ GE+ +++K+FR T+Q +       G  V WT++++
Sbjct  64   MVTFAKEKVEVADDEKKVVSYSVVDGELVSFYKNFRVTVQVTDKGADGGGAVVNWTMDFD  123

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            KA+D VP P    E       ++D+YLLK
Sbjct  124  KASDEVPEPDVIKETAAKTLHDLDDYLLK  152



>ref|XP_002893317.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69576.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata]
Length=155

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 95/145 (66%), Gaps = 6/145 (4%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            L  E ++KSP++KF+    +  +L PK  P   +++Q+L GDG + GS+RL TY  G  +
Sbjct  7    LHVEVEVKSPAEKFWVALGDGINLFPKAFPNDYKTIQVLAGDGNAPGSIRLITYGEGSPL  66

Query  243  --IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAND  404
              I+ ++I+AVD EN+S+++++IGGE+  Y+K+F+ T+    +  G+ +KW+ E+EK + 
Sbjct  67   VKISAERIEAVDLENKSMSYSIIGGEMLEYYKTFKGTITVIPKDGGSLLKWSGEFEKTSH  126

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
             +  PH   +F +   +E+DEYLLK
Sbjct  127  EIDDPHVIKDFAVKNFKEIDEYLLK  151



>ref|XP_006355987.1| PREDICTED: MLP-like protein 423-like [Solanum tuberosum]
Length=153

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 99/151 (66%), Gaps = 6/151 (4%)
 Frame = +3

Query  42   IMAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWT  221
            + + + K++ E ++K+P  KF++   ++++L PK  P + +S++++EGDGKSVGSV L  
Sbjct  1    MSSNLGKIDVEVEVKTPVDKFWNGIRDSTNLFPKASPNEYKSIEVVEGDGKSVGSVLLIK  60

Query  222  YILGGNVI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTL  383
            Y  G  ++  +K+KI+++DE N+++ +++I GE   Y+KSF+  L    + +G+ VKW  
Sbjct  61   YTEGFPLVTFSKEKIESIDEANKTLAYSVIDGETLKYYKSFKGKLTVTPKGNGSLVKWCC  120

Query  384  EYEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            E+EKA+D +P P    +F +   + +D YL+
Sbjct  121  EFEKASDEIPEPQIIKDFAVKNFKNLDAYLI  151



>ref|XP_010494066.1| PREDICTED: MLP-like protein 31 [Camelina sativa]
Length=168

 Score =   110 bits (275),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 91/146 (62%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            ++E E  IK+P+ KF+ +Y      + K    K+++  LLEG+  +VGS+  W Y+ GG 
Sbjct  20   EVEVEVDIKAPAAKFYHVYAGRPDNVAKATSRKVQACDLLEGEWGTVGSIVNWNYVYGGK  79

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              +AK++I+ V+ E + + F +I G+V   +KSF  T+QA+      G+ VKW LEYE+ 
Sbjct  80   AKVAKERIELVEPEKKLIKFRVIEGDVLAVYKSFLITIQATPKEGGVGSVVKWHLEYERN  139

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            ++NVP P + + FL  + +E+DE+LL
Sbjct  140  DENVPHPENFLPFLAEMTKEIDEHLL  165



>ref|XP_007153302.1| hypothetical protein PHAVU_003G023600g [Phaseolus vulgaris]
 gb|ESW25296.1| hypothetical protein PHAVU_003G023600g [Phaseolus vulgaris]
Length=154

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 97/153 (63%), Gaps = 8/153 (5%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M+   K+E E +I++ + KFF I+      +P I   +I + ++ EGD ++VGSV+ W  
Sbjct  1    MSLSGKVEGEVEIQASADKFFHIFRKKLHHVPNISSERIHAAKVHEGDWENVGSVKHWDI  60

Query  225  -ILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA-----SGNSVKWTLE  386
             I G     K+KI+A+D++NR +T++L  GE++  +KSF+ TLQ      +G  VKWT E
Sbjct  61   TIEGKKTSVKEKIEAIDDDNRILTYSLFDGEISESYKSFKGTLQVIDKENNGGIVKWTFE  120

Query  387  YEKANDNV--PTPHSHVEFLMNVAREVDEYLLK  479
            YEK ++N+   +P S++EF   V +++D++LLK
Sbjct  121  YEKLSENITAASPESYLEFASVVTKDIDDHLLK  153



>gb|EYU29709.1| hypothetical protein MIMGU_mgv1a015595mg [Erythranthe guttata]
Length=152

 Score =   109 bits (273),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 95/147 (65%), Gaps = 8/147 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYI--LG  233
            K+E E ++KS ++K ++    ++++ PK  P +  SV+LLEGDGKS GSVRL  Y    G
Sbjct  4    KVEVEVEVKSSAEKIWESIRESTTVFPKALPNQYNSVELLEGDGKSAGSVRLMKYPPNAG  63

Query  234  GNVI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEK  395
               I  +K+KI+ VDEE RS+++ +I G+V  Y+K+F+A+L    +  G+ VKW  E++K
Sbjct  64   STEITSSKEKIEEVDEEKRSLSYIVIDGDVLKYYKNFKASLGVNTKGDGSVVKWCCEFDK  123

Query  396  ANDNVPTPHSHVEFLMNVAREVDEYLL  476
            A++ VP P    +F +   +++D YLL
Sbjct  124  ADEQVPDPDIIKDFAIKSFQDLDAYLL  150



>ref|NP_001105279.1| Bet v I allergen [Zea mays]
 gb|AAV28626.1| Bet v I allergen [Zea mays]
Length=154

 Score =   109 bits (273),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 93/150 (62%), Gaps = 10/150 (7%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E   ++KSP+ K +    +++ L PKI P + +S++ +EGDGKS G+VRL  Y     
Sbjct  4    KVELVVEVKSPADKLWAALRDSTELFPKIFPEQYKSIETVEGDGKSAGTVRLLKYTEAVP  63

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS--------GNSVKWTLEY  389
            ++  AK+K++  D+EN+ V+++++ GE+ +++K+F+ TL+ +        G  V W +E+
Sbjct  64   MLTFAKEKLETADDENKVVSYSVVDGELADFYKNFKITLKVTPAKADGEGGAVVSWAMEF  123

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            +KAND VP P    E       ++D+YLLK
Sbjct  124  DKANDQVPDPDVTKETATKTFHDLDDYLLK  153



>ref|XP_010254473.1| PREDICTED: MLP-like protein 423 [Nelumbo nucifera]
Length=158

 Score =   109 bits (273),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 94/155 (61%), Gaps = 11/155 (7%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   KLE E +IKSP+ KF++   ++++L PK+       ++++EGDGKS GSVRL  Y
Sbjct  1    MASPGKLEVEMEIKSPTDKFWESIRSSTTLFPKVLSDYYERIEVVEGDGKSEGSVRLVKY  60

Query  225  ILGGNV----IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ---ASGNS----V  371
               G +    ++K++ID VDE N+   ++ I G++  ++K FRA +    A G+     V
Sbjct  61   TSTGGIPVITMSKERIDLVDEANKVEAYSAIEGDILKFYKHFRARVHVTTAGGDDKKKVV  120

Query  372  KWTLEYEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            KW+ E++KA+D VP PH   +F     + +D+YL+
Sbjct  121  KWSCEFDKASDEVPDPHLVQDFATKTLKALDDYLV  155



>ref|XP_008386234.1| PREDICTED: MLP-like protein 423 [Malus domestica]
Length=152

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 90/149 (60%), Gaps = 6/149 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQI K++ + +IKS   KF   + NN +  P++ P   +SV+++ G     G+V    Y
Sbjct  1    MAQIAKIDAQAEIKSSPDKFHGFFKNNITSFPQMFPQIFKSVEVVGGGALRAGAVFSCKY  60

Query  225  ILG-GNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS-----GNSVKWTLE  386
             LG G V AK KI AVD+EN S+ F ++ G+V   +K+F+A L+ S     G++VKWTLE
Sbjct  61   DLGEGPVTAKIKIPAVDDENTSINFVVLEGDVLKLYKTFKAKLEISKAGNGGSTVKWTLE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYL  473
             EKAN N P P  + +  + V++ +D YL
Sbjct  121  VEKANANAPEPKLYADHAIKVSKGIDAYL  149



>ref|XP_009391743.1| PREDICTED: MLP-like protein 423 [Musa acuminata subsp. malaccensis]
Length=150

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 89/139 (64%), Gaps = 6/139 (4%)
 Frame = +3

Query  81   IKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNVI--AKD  254
            +KS   +F++    ++ L PK+ P + +S++++EGDG+S G+VRL  Y  G  ++  AK+
Sbjct  11   VKSSPDRFWEAIRGSTELFPKVFPEQYQSIEIVEGDGRSAGTVRLLKYAQGVPLVTFAKE  70

Query  255  KIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEYEKANDNVPTPH  422
            KI+ VD+ ++ V+++LI GE+ +Y+K+F+A+L+      G+ VKW +EYEKAN  VP P 
Sbjct  71   KIEEVDDASKQVSYSLIDGELVSYYKNFKASLKVEPNGDGSQVKWCMEYEKANIEVPDPD  130

Query  423  SHVEFLMNVAREVDEYLLK  479
               E        +DEYL K
Sbjct  131  LVTETATKTFSALDEYLAK  149



>gb|KFK44468.1| hypothetical protein AALP_AA1G260200 [Arabis alpina]
Length=155

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 91/145 (63%), Gaps = 6/145 (4%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            L  E ++K P++ F+    +  +L PK  P   +++Q+L GDG + GS+RL TY  G  +
Sbjct  7    LHVEVEVKCPAETFWLALGDGVNLFPKAFPKDYKTIQILAGDGNAPGSIRLITYGEGSPL  66

Query  243  --IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEYEKAND  404
              I+ ++I+AVD E RS+T+++IGGE+  Y+K+F+ T+  +    G+ +KW+ E+EK   
Sbjct  67   VKISAERIEAVDLEKRSMTYSIIGGEMMEYYKTFKGTITVTPKDGGSILKWSGEFEKTGH  126

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
             V  PH   +F +   +E+DEYLLK
Sbjct  127  EVADPHVIKDFAVKNFKEIDEYLLK  151



>ref|NP_173813.1| MLP-like protein 423 [Arabidopsis thaliana]
 ref|NP_001185075.1| MLP-like protein 423 [Arabidopsis thaliana]
 sp|Q93VR4.1|ML423_ARATH RecName: Full=MLP-like protein 423 [Arabidopsis thaliana]
 gb|AAK96470.1| At1g24020/T23E23_22 [Arabidopsis thaliana]
 emb|CAC83600.1| major latex-like protein [Arabidopsis thaliana]
 gb|AAL31239.1| At1g24020/T23E23_22 [Arabidopsis thaliana]
 gb|AEE30466.1| MLP-like protein 423 [Arabidopsis thaliana]
 gb|AEE30467.1| MLP-like protein 423 [Arabidopsis thaliana]
Length=155

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 94/145 (65%), Gaps = 6/145 (4%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            L  E ++KSP++KF+    +  +L PK  P   +++Q+L GDG + GS+RL TY  G  +
Sbjct  7    LHVEVEVKSPAEKFWVALGDGINLFPKAFPNDYKTIQVLAGDGNAPGSIRLITYGEGSPL  66

Query  243  --IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAND  404
              I+ ++I+AVD EN+S+++++IGGE+  Y+K+F+ T+    +  G+ +KW+ E+EK   
Sbjct  67   VKISAERIEAVDLENKSMSYSIIGGEMLEYYKTFKGTITVIPKDGGSLLKWSGEFEKTAH  126

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
             +  PH   +F +   +E+DEYLLK
Sbjct  127  EIDDPHVIKDFAVKNFKEIDEYLLK  151



>gb|AAM65899.1| pollen allergen-like protein [Arabidopsis thaliana]
Length=155

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 94/145 (65%), Gaps = 6/145 (4%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            L  E ++KSP++KF+    +  +L PK  P   +++Q+L GDG + GS+RL TY  G  +
Sbjct  7    LHVEVEVKSPAEKFWVALGDGINLFPKAFPNDYKTIQVLAGDGNAPGSIRLITYGEGSPL  66

Query  243  --IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAND  404
              I+ ++I+AVD EN+S+++++IGGE+  Y+K+F+ T+    +  G+ +KW+ E+EK   
Sbjct  67   VKISAERIEAVDLENKSMSYSIIGGEMLEYYKTFKGTITVIPKNGGSLLKWSGEFEKTAH  126

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
             +  PH   +F +   +E+DEYLLK
Sbjct  127  EIDDPHVIKDFAVKNFKEIDEYLLK  151



>emb|CAN76954.1| hypothetical protein VITISV_008439 [Vitis vinifera]
Length=153

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 100/146 (68%), Gaps = 6/146 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE + ++K  ++K+++   +++++ PK  P + + +++LEGDGKSVGSVR  TY  G  
Sbjct  4    KLEVDVEVKCNAEKYWESIRDSNTIFPKAFPDQYKCIKVLEGDGKSVGSVRHITYGEGSP  63

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAN  401
            ++  +++++D VDE ++ V++++IGG++  Y+K+F+ATL    +  G+ VKWT ++EKA+
Sbjct  64   LVKESEERVDIVDEADKKVSYSVIGGDLLKYYKNFKATLVITPKGDGSLVKWTCDFEKAS  123

Query  402  DNVPTPHSHVEFLMNVAREVDEYLLK  479
              +P P+   EF +    E+D+Y+ K
Sbjct  124  AEIPDPNVIKEFAVKNFIELDDYIHK  149



>ref|XP_010421666.1| PREDICTED: MLP-like protein 31 [Camelina sativa]
Length=168

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 90/146 (62%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            ++E E  IK+P+ KF+ +Y      + K    K+++  LLEG+   VGS+  W Y+ GG 
Sbjct  20   EVEVEVDIKAPAAKFYHVYAGRPDHVAKATSRKVQACDLLEGEWGLVGSIVNWNYVYGGK  79

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              +AK+ I+ V+ E + + F +I G+V   +KSF  T+QA+      G+ VKW LEYE++
Sbjct  80   AKVAKESIELVEPEKKLIKFRVIEGDVLAVYKSFLITIQATPKEGGVGSVVKWHLEYERS  139

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            ++NVP P + + FL  + +E+DE+LL
Sbjct  140  DENVPHPDNFLPFLAEMTKEIDEHLL  165



>gb|ABF81693.1| pathogenesis-related protein 2 [Zea mays]
 gb|ACG35347.1| major latex protein 22 [Zea mays]
 tpg|DAA37407.1| TPA: pathogeneis protein2 [Zea mays]
Length=154

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 93/150 (62%), Gaps = 10/150 (7%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E   ++KSP+ K +    +++ L PKI P + +S++ +EGDGKS G+VRL  Y     
Sbjct  4    KVELVVEVKSPADKLWAALRDSTELFPKIFPEQYKSIETVEGDGKSAGTVRLLKYTEAVP  63

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS--------GNSVKWTLEY  389
            ++  AK+K++  D+EN+ V+++++ GE+ +++K+F+ TL+ +        G  V W +E+
Sbjct  64   MLTFAKEKLETADDENKVVSYSVVDGELADFYKNFKITLKVTPAKAEGEGGAVVSWAMEF  123

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            +KAND VP P    E       ++D+YLLK
Sbjct  124  DKANDQVPDPDVIKETATKTFHDLDDYLLK  153



>ref|XP_010068712.1| PREDICTED: MLP-like protein 328 [Eucalyptus grandis]
Length=149

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 90/150 (60%), Gaps = 5/150 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQ+ K+E + +++SP++K FDI+   S L P+I P  ++ V+L+ GD  SVGSV LWT 
Sbjct  1    MAQLVKVEAQVELESPAEKVFDIFRRKSYLFPEIAPHVVKDVKLVSGDWDSVGSVWLWTQ  60

Query  225  ILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASGN----SVKWTLEYE  392
                    K+  +A D+E +S+TF  + G   N++KS +++LQ S      + K  L YE
Sbjct  61   CCDSGS-GKETFEAFDDETKSITFKCLDGVAMNFYKSLKSSLQFSPEGERCTAKAVLTYE  119

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            K N +VP  + ++EF  ++   VD YLLK 
Sbjct  120  KQNADVPDANKYLEFTRSLLISVDGYLLKA  149



>ref|NP_177245.1| MLP-like protein 43 [Arabidopsis thaliana]
 sp|Q9SSK5.1|MLP43_ARATH RecName: Full=MLP-like protein 43 [Arabidopsis thaliana]
 gb|AAD55504.1|AC008148_14 Unknown protein [Arabidopsis thaliana]
 emb|CAC83578.1| major latex-like protein [Arabidopsis thaliana]
 gb|AAL38311.1| unknown protein [Arabidopsis thaliana]
 gb|AAP37800.1| At1g70890 [Arabidopsis thaliana]
 gb|AEE35134.1| MLP-like protein 43 [Arabidopsis thaliana]
Length=158

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 89/148 (60%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE E +IK+ +KKF  ++      + K  P KI   +L EGD   VGS+ +W Y+  
Sbjct  8    VGKLETEVEIKASAKKFHHMFTERPHHVSKATPDKIHGCELHEGDWGKVGSIVIWKYVHD  67

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA------SGNSVKWTLEYE  392
            G + + K+KI+AVD E   +TF ++ G++ N +KSF  TLQ       SG+   W LEYE
Sbjct  68   GKLTVGKNKIEAVDPEKNLITFKVLEGDLMNEYKSFAFTLQVTPKQGESGSIAHWHLEYE  127

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K ++ V  P + ++F + +++E+DE+LL
Sbjct  128  KISEEVAHPETLLQFCVEISKEIDEHLL  155



>ref|XP_009103140.1| PREDICTED: LOW QUALITY PROTEIN: MLP-like protein 423 [Brassica 
rapa]
 ref|XP_009103150.1| PREDICTED: LOW QUALITY PROTEIN: MLP-like protein 423 [Brassica 
rapa]
Length=155

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 92/145 (63%), Gaps = 6/145 (4%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            L  E ++KSP++KF+    +  +L PK  P   +++Q+L GDG S GS+RL  Y  G  +
Sbjct  7    LHVEVEVKSPAEKFWVALGDGINLFPKEFPXDYKTMQVLAGDGNSPGSIRLIIYGEGSPL  66

Query  243  --IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAND  404
              ++ ++I+ VD EN+S+T+++IGGE+  Y+K+F+ T+    +  G+ +KW+ E+EK   
Sbjct  67   VKVSAERIETVDLENKSMTYSIIGGEMLEYYKTFKGTITVTPKGGGSILKWSAEFEKTGH  126

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
             +  PH   +F +   +E+DEYLLK
Sbjct  127  EIEDPHVIKDFAVKNFKEIDEYLLK  151



>ref|XP_002284578.2| PREDICTED: MLP-like protein 28 [Vitis vinifera]
Length=151

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 97/151 (64%), Gaps = 5/151 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M  + +LE E  I +P+ KF +++      +  + P KI+ V L EGD  +VGSV  W+Y
Sbjct  1    MGLVGRLEAEILILAPADKFHEVWGGRPHHMSSVSPGKIQKVDLHEGDWGTVGSVIEWSY  60

Query  225  ILGG-NVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ--ASGNS--VKWTLEY  389
            ++ G N +AK+ ++A+D+EN++VTF +I G++   +KSF+A +Q  + G +  V+WT EY
Sbjct  61   VIDGKNHVAKEIVEAIDKENKAVTFKVIEGDLLKEYKSFKAIVQTISKGETTWVRWTFEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            EK N  + TP   + F++++  E+D++L++ 
Sbjct  121  EKLNKEISTPVKLLGFVIHMNEELDDHLIQA  151



>gb|ABV89615.1| bet v I allergen family protein [Brassica rapa]
Length=155

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 92/145 (63%), Gaps = 6/145 (4%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            L  E ++KSP++KF+    +  +L PK  P   +++Q+L GDG S GS+RL  Y  G  +
Sbjct  7    LHVEVEVKSPAEKFWVALGDGINLFPKEFPKDYKTMQVLAGDGNSPGSIRLIIYGEGSPL  66

Query  243  --IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAND  404
              ++ ++I+ VD EN+S+T+++IGGE+  Y+K+F+ T+    +  G+ +KW+ E+EK   
Sbjct  67   VKVSAERIETVDLENKSMTYSIIGGEMLEYYKTFKGTITVTPKGGGSILKWSAEFEKTGH  126

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
             +  PH   +F +   +E+DEYLLK
Sbjct  127  EIEDPHVIKDFAVKNFKEIDEYLLK  151



>ref|XP_002531396.1| Major latex protein, putative [Ricinus communis]
 gb|EEF30980.1| Major latex protein, putative [Ricinus communis]
Length=154

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 92/149 (62%), Gaps = 6/149 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA    L    +IKS   KF+    +++SL PK  P + +S+++LEGDGK+ GSVRL+TY
Sbjct  1    MAASGTLHVAVEIKSSPDKFWGSIRDSTSLFPKFFPDQYKSIEVLEGDGKAAGSVRLFTY  60

Query  225  ILGGNV--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLE  386
              G  +  I+K++ID V E  + V++++I G++  Y+K F+  +    +  G+ V+W+ E
Sbjct  61   AEGSPIVKISKERIDVVHEAEKKVSYSVIEGDLLKYYKVFKGHITVLPKGDGSLVEWSCE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYL  473
            YEK +D V  PH   +F++   +EVDE +
Sbjct  121  YEKTSDEVEVPHIIKDFVVKNFKEVDELI  149



>ref|XP_011086520.1| PREDICTED: MLP-like protein 423 [Sesamum indicum]
Length=153

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 95/145 (66%), Gaps = 6/145 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE E ++KS  +K ++    +++L PK  P +  S+++LEGDGKSV SVRL  Y  G +
Sbjct  4    KLEVEFEMKSSPEKVWESIRESTTLFPKALPKEYESIEILEGDGKSVASVRLIKYPPGLS  63

Query  240  VIA--KDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEYEKAN  401
             I+  K+KI+ VDE  + +++++IGG++  Y+K+F+A L  S    G+ VKW+ E+EKA+
Sbjct  64   AISSTKEKIEVVDEGKKMLSYSVIGGDILKYYKNFKAHLSVSPKDEGSWVKWSCEFEKAS  123

Query  402  DNVPTPHSHVEFLMNVAREVDEYLL  476
            + VP P    +F +   +++D Y+L
Sbjct  124  EEVPNPDLVRDFAIKNFQDLDAYIL  148



>emb|CDP00797.1| unnamed protein product [Coffea canephora]
Length=153

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 85/146 (58%), Gaps = 6/146 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE E  IKS   +FF  +   +  LP +C  K+ ++ L EGD K+ GSV+ WTY++ G 
Sbjct  7    KLEAEINIKSDPDEFFHSFGGKAHQLPNLCSEKLHAIDLHEGDWKTEGSVKHWTYVIDGK  66

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEYEKAND  404
            V  AK++   VDEENR VT   I G++   +KS++  LQ       N   W++EYE   +
Sbjct  67   VETAKERF-KVDEENRIVTLEAIEGDIKEQYKSYKVELQVISKGVSNFAHWSIEYETVKE  125

Query  405  NVPTPHSHVEFLMNVAREVDEYLLKT  482
            N P P  ++ +L++ A++VD  LLK 
Sbjct  126  NDPAPTKYLHWLIHAAKDVDASLLKA  151



>gb|AFK38000.1| unknown [Medicago truncatula]
Length=156

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 88/147 (60%), Gaps = 5/147 (3%)
 Frame = +3

Query  48   AQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYI  227
            + I K+E +  IK+  ++F+++  N +  +  +CP  ++ ++L EGD  + G +  W Y+
Sbjct  4    SAIEKIEMDVPIKATPQQFYEVLCNKTHHISNVCPDIVKGIELHEGDWGTEGCIISWNYV  63

Query  228  LGG-NVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEYE  392
              G   I+K +I+ +D+EN  +TF ++GG++   +KSF+  +Q      G+ V+W +EYE
Sbjct  64   FAGKTCISKQRIEDIDKENNKITFKVLGGDLLEDYKSFKFIMQTVPQREGSVVRWIVEYE  123

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYL  473
            K N+NVP PHS     + V + VD +L
Sbjct  124  KLNNNVPNPHSLFHLSVEVLKYVDAHL  150



>ref|XP_010498918.1| PREDICTED: MLP-like protein 423 isoform X1 [Camelina sativa]
 ref|XP_010477722.1| PREDICTED: MLP-like protein 423 [Camelina sativa]
Length=154

 Score =   107 bits (267),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 93/145 (64%), Gaps = 6/145 (4%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            L  E ++KSP++KF+    +  +  PK  P   +++Q+L GDG + GS+RL TY  G  +
Sbjct  7    LHVEVEVKSPAEKFWVALGDGINFFPKAFPNDYKTIQVLAGDGNAPGSIRLITYGEGSPL  66

Query  243  --IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAND  404
              I+ ++I+ VD EN+S+++++IGGE+  Y+K+F+ T+    +  G+ +KW+ E+EK + 
Sbjct  67   VKISAERIEEVDLENKSMSYSIIGGEMMEYYKTFKGTITVIPKDGGSLLKWSGEFEKTSH  126

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
             +  PH   +F +   +E+DEYLLK
Sbjct  127  EIADPHVIKDFAVKNFKEIDEYLLK  151



>ref|XP_010498919.1| PREDICTED: MLP-like protein 423 isoform X2 [Camelina sativa]
Length=154

 Score =   107 bits (266),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 93/145 (64%), Gaps = 6/145 (4%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            L  E ++KSP++KF+    +  +  PK  P   +++Q+L GDG + GS+RL TY  G  +
Sbjct  7    LHVEVEVKSPAEKFWVALGDGINFFPKAFPNDYKTIQVLAGDGNAPGSIRLITYGEGSPL  66

Query  243  --IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAND  404
              I+ ++I+ VD EN+S+++++IGGE+  Y+K+F+ T+    +  G+ +KW+ E+EK + 
Sbjct  67   VKISAERIEEVDLENKSMSYSIIGGEMMEYYKTFKGTITVIPKDGGSLLKWSGEFEKTSH  126

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
             +  PH   +F +   +E+DEYLLK
Sbjct  127  EIADPHVIKDFAVKNFKEIDEYLLK  151



>ref|XP_010460171.1| PREDICTED: MLP-like protein 423 [Camelina sativa]
Length=154

 Score =   107 bits (266),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 93/145 (64%), Gaps = 6/145 (4%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            L  E ++KSP++KF+    +  +  PK  P   +++Q+L GDG + GS+RL TY  G  +
Sbjct  7    LHVEVEVKSPAEKFWVALGDGINFFPKAFPNDYKTIQVLAGDGNAPGSIRLITYGEGSPL  66

Query  243  --IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAND  404
              I+ ++I+ VD EN+S+++++IGGE+  Y+K+F+ T+    +  G+ +KW+ E+EK + 
Sbjct  67   VKISAERIEEVDLENKSMSYSIIGGEMMEYYKTFKGTITVIPKDGGSLLKWSGEFEKTSH  126

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
             +  PH   +F +   +E+DEYLLK
Sbjct  127  EIADPHVIKDFAVKNFKEIDEYLLK  151



>ref|XP_004498312.1| PREDICTED: MLP-like protein 34-like [Cicer arietinum]
Length=153

 Score =   107 bits (266),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 96/147 (65%), Gaps = 7/147 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E E +I++P+ KF++I+      +P I    +   ++ EGD ++VGS++ W + + G 
Sbjct  6    KVEGEVEIEAPAAKFYNIFRKQLHHIPNIASDSVHGAKVHEGDWENVGSIKQWDFTIEGT  65

Query  240  VI-AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEYEKAND  404
             + AK+KI+++D++N+ +T+++  G+V+  +KSF+ TLQ      G  VKWT EYEK  +
Sbjct  66   KLSAKEKIESIDDDNKVITYSIFDGDVSENYKSFKGTLQVVDKEHGGIVKWTFEYEKLKE  125

Query  405  NV--PTPHSHVEFLMNVAREVDEYLLK  479
            ++   +P S+++F + V +++D +L+K
Sbjct  126  DIIGASPESYLDFAVKVTKDIDAHLVK  152



>ref|XP_009127832.1| PREDICTED: MLP-like protein 31 [Brassica rapa]
Length=158

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 90/148 (61%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IK+P+ KF  ++      + K  P  I++ +L EGD   VGSV +W Y+  
Sbjct  8    VGKLETDVEIKAPAGKFHHMFAGRPHHVSKATPGNIQNCELHEGDWGKVGSVVIWNYVHD  67

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++++AV+ E   +TF ++ G++   +KSF  T+Q +      G+ V W LEYE
Sbjct  68   GEAKVAKERVEAVEPEKNLITFRVVEGDLMKEYKSFVITIQVTPKHGGPGSVVHWYLEYE  127

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K +D V  P + ++F + ++RE+DE+LL
Sbjct  128  KISDEVAHPETLLQFCVEISREIDEHLL  155



>ref|XP_003626964.1| MLP-like protein [Medicago truncatula]
 gb|AET01440.1| polyketide cyclase/dehydrase and lipid transporter [Medicago 
truncatula]
Length=156

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 88/147 (60%), Gaps = 5/147 (3%)
 Frame = +3

Query  48   AQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYI  227
            + I K+E +  IK+  ++F+++  N +  +  +CP  ++ ++L EGD  + G +  W Y+
Sbjct  4    SAIEKIEMDVPIKATPQQFYEVLCNKTHHISNVCPDIVKGIELHEGDWGTEGCIISWNYV  63

Query  228  LGG-NVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEYE  392
              G   I+K +I+ +D+EN  +TF ++GG++   +KSF+  +Q      G+ V+W +EYE
Sbjct  64   FAGKTCISKQRIEDIDKENNKITFKVLGGDLLEDYKSFKFIMQIVPQREGSVVRWIVEYE  123

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYL  473
            K N+NVP PHS     + V + VD +L
Sbjct  124  KLNNNVPNPHSLFHLSVEVLKYVDAHL  150



>ref|XP_009339700.1| PREDICTED: MLP-like protein 28 [Pyrus x bretschneideri]
Length=155

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 90/146 (62%), Gaps = 5/146 (3%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E + +IK+ + KF +++ +    +       I+   L EGD  +VGSV  W Y   G 
Sbjct  7    KVEADVEIKASAAKFHEMFTHKPHHISNASNRNIQGCDLHEGDWGTVGSVIYWNYFHDGK  66

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEYEKAND  404
              +AKD ++A+D EN  +TF +I G++  ++KSF+AT+ A+    G +V WT+EYEK +D
Sbjct  67   AKVAKDLVEAIDAENNLITFKVIEGDLLEHYKSFKATIHATPKGEGCNVHWTMEYEKHHD  126

Query  405  NVPTPHSHVEFLMNVAREVDEYLLKT  482
            ++  PH+ ++F + V++++D +L  T
Sbjct  127  DIEDPHTLLQFAVEVSKDIDAHLTST  152



>emb|CDX68328.1| BnaA07g23680D [Brassica napus]
Length=164

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 90/149 (60%), Gaps = 8/149 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IK+ + KF  ++      + K  P KI++  L EGD   VGS+  W Y+ G
Sbjct  13   VGKLETDVEIKASAGKFHHMFAGRPHHVSKASPGKIKACDLHEGDWGKVGSIVYWNYVHG  72

Query  234  --GNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEY  389
                V+AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W LEY
Sbjct  73   KYATVVAKERIEAVEPEKNLITFRVIEGDLMKEYKSFLITIQVTPKHGGPGSIVHWHLEY  132

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            EK +D V  P + ++F ++V++E+DE+LL
Sbjct  133  EKISDEVAHPETLLQFCVDVSKEIDEHLL  161



>ref|XP_002872296.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48555.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata]
Length=164

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 93/151 (62%), Gaps = 8/151 (5%)
 Frame = +3

Query  48   AQIW-KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            + +W ++E E  IK+P+ KF+ +Y      + K   +K+++  LLEG+   VGS+  W Y
Sbjct  11   SSLWGEVEVEVDIKAPAAKFYHVYAGRPDHVAKATSSKVQACDLLEGEWGIVGSIVNWNY  70

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTL  383
            +  G   +AK++I+ V+ E + + F +I G+V   +KSF  T++ +      G+ VKW L
Sbjct  71   VYAGKAKVAKERIEIVEPEKKLIKFRVIEGDVLAVYKSFLITIRVTPKEGEVGSVVKWHL  130

Query  384  EYEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            EYEK ++NVP P++ + FL  + +E+DE+LL
Sbjct  131  EYEKNDENVPHPYNFLPFLAEMTKEIDEHLL  161



>ref|XP_006652389.1| PREDICTED: MLP-like protein 423-like [Oryza brachyantha]
Length=153

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 91/149 (61%), Gaps = 9/149 (6%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E   ++KSP+ K +     ++ L PKI P + +S++ +EGDGKS G+VRL  Y  G  
Sbjct  4    KVELVVEVKSPADKLWTALRGSTELFPKIFPEQYKSIETVEGDGKSAGTVRLLKYAEGVP  63

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ-------ASGNSVKWTLEYE  392
            ++  AK+K++  D+E + V+++++ GE+ +++K+FR TLQ        SG  V W ++++
Sbjct  64   MVTFAKEKVEVADDEKKVVSYSVVDGELVSFYKNFRVTLQVTPKGGDGSGAVVSWAMDFD  123

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            K ++ VP P    E       ++D+YLLK
Sbjct  124  KTSEQVPDPDVIKETAAKTFHDLDDYLLK  152



>ref|XP_003579929.1| PREDICTED: MLP-like protein 423 [Brachypodium distachyon]
Length=156

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 94/152 (62%), Gaps = 12/152 (8%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E   ++KSP+ K +    +++ L PKI P + +S++ +EGDGKS G+VRL  Y  G  
Sbjct  4    KVELVVEVKSPADKLWTALRDSTELFPKIFPEQYKSIETVEGDGKSAGTVRLLKYTEGVP  63

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASGNS----------VKWTL  383
            ++  AK+K++  D+E + V+++++ GE+ +++K+FR T+Q + ++          V W +
Sbjct  64   MVTFAKEKVEMADDEKKVVSYSVVDGELVSFYKNFRVTVQVTPSAKDDGAAAGAVVNWAM  123

Query  384  EYEKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            E++KA+D VP P    E       ++D+YLLK
Sbjct  124  EFDKASDAVPDPDVIKETAAKTFHDLDDYLLK  155



>ref|NP_001236164.1| uncharacterized protein LOC100527699 [Glycine max]
 gb|ACU16843.1| unknown [Glycine max]
 gb|KHN36424.1| MLP-like protein 43 [Glycine soja]
Length=153

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 94/148 (64%), Gaps = 7/148 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY-ILGG  236
            K+E E +I++P+ KF+ ++      +P +   ++   ++ EGD +++GSV+ W + I G 
Sbjct  6    KVETEVEIQAPAAKFYHVFRKQIHHVPNMSTERVHGAKVHEGDWENIGSVKHWDFTIEGR  65

Query  237  NVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEYEKAND  404
               AK+KI+A+D++N+ ++++L  GE++  +KS R TLQ     +G  VKWT EYEK  +
Sbjct  66   KTSAKEKIEAIDDDNKIISYSLFDGEISEGYKSLRGTLQVINKENGGIVKWTFEYEKLQE  125

Query  405  NV--PTPHSHVEFLMNVAREVDEYLLKT  482
            N+   +P S ++F   V +++D++L+K 
Sbjct  126  NITAASPDSFLDFAAKVTKDIDDHLVKA  153



>emb|CAH59440.1| major latex-like protein 1 [Plantago major]
Length=146

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 84/145 (58%), Gaps = 1/145 (1%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQI K+E   Q K  S K +D+  NN + L  I PA+ +SV+LL G+    G V+L  Y
Sbjct  1    MAQIAKVEALVQTKCCSTKVYDLMKNNLAKLVDILPAQFKSVELLGGEEGCAGHVKLVKY  60

Query  225  ILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA-SGNSVKWTLEYEKAN  401
             LGG    K + + +D+  +S+      G+V   +KSF+ T+ A  GN+VKW++E+EKAN
Sbjct  61   DLGGPKTVKLRFEVIDDAKKSMEIVAFEGDVMQLYKSFKTTITAVDGNTVKWSIEFEKAN  120

Query  402  DNVPTPHSHVEFLMNVAREVDEYLL  476
            +  P P  ++     V + +D YL+
Sbjct  121  ELAPAPDHYILLATQVTKMLDAYLV  145



>ref|NP_001053026.1| Os04g0465600 [Oryza sativa Japonica Group]
 emb|CAD40936.1| OSJNBb0048E02.12 [Oryza sativa Japonica Group]
 dbj|BAF14940.1| Os04g0465600 [Oryza sativa Japonica Group]
 gb|EAZ31019.1| hypothetical protein OsJ_15102 [Oryza sativa Japonica Group]
 dbj|BAG86926.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGH17540.1| hypothetical protein [Oryza sativa]
Length=157

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 93/153 (61%), Gaps = 13/153 (8%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E   ++KSP+ K +    +++ L PKI P + +S++ +EGDGKS G+VRL  Y  G  
Sbjct  4    KVELVVEVKSPADKLWTALRDSTELFPKIFPEQYKSIETVEGDGKSAGTVRLLKYTEGVP  63

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASGNS-----------VKWT  380
            ++  AK+K++  D+E + V+++++ GE+ +++K+FR TLQ +              V WT
Sbjct  64   MVTFAKEKVEVADDEKKVVSYSVVDGELVSFYKNFRVTLQVTPKGGAAAPAADGAVVSWT  123

Query  381  LEYEKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            ++++KA++ VP P    E       ++D+YLLK
Sbjct  124  MDFDKASEEVPDPDVIKETAAKTFHDLDDYLLK  156



>ref|XP_011099470.1| PREDICTED: MLP-like protein 28 [Sesamum indicum]
Length=149

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = +3

Query  81   IKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGG-NVIAKDK  257
            IKSP+ KFF  +  + + + KI PA    VQLLEG+  +VG ++ W YI+GG  + A  K
Sbjct  15   IKSPADKFFKFFRYSMNEIVKIFPAAFTGVQLLEGEEGTVGCIKRWNYIVGGIPLTATVK  74

Query  258  IDAVDEENRSVTFALIGGEVTNYFKSFRATLQASGNSVKWTLEYEKANDNVPTPHSHVEF  437
            I+A+DE  +S+TFA++ G++   +KSF+ATL  S    KWT  +EKA    P P  ++  
Sbjct  75   IEAIDEAAKSITFAVLEGDLLLLYKSFQATLTVSEGLAKWTFVFEKATLLTPPPELYIPL  134

Query  438  LMNVAREVDEYLL  476
             + +   VD +LL
Sbjct  135  AVTLCTLVDAFLL  147



>ref|XP_010427896.1| PREDICTED: MLP-like protein 43 [Camelina sativa]
Length=158

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 90/148 (61%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE E +IK+ ++KF  ++      + K  P +I   +L EGD   VGS+ +W Y+  
Sbjct  8    VGKLETEVEIKASAEKFHHMFAEKPHHVSKATPGRIHGCELHEGDWGKVGSIVIWKYVHD  67

Query  234  GNVI-AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G V+  K++I+AVD E   +TF +IGG +   +KSF  T+Q +      G+ V W LEYE
Sbjct  68   GKVVEGKNRIEAVDTEKNLITFKVIGGVLMKEYKSFAFTIQVTPKQGGPGSIVHWHLEYE  127

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K ++ V  P + ++F +++++++DE+LL
Sbjct  128  KISNEVAHPETLLQFCVDISKDIDEHLL  155



>ref|XP_009127833.1| PREDICTED: MLP-like protein 31 [Brassica rapa]
Length=158

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 90/148 (61%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IK+P+ KF  ++      + K  P  I++ +L EGD   VGSV +W Y+  
Sbjct  8    VGKLETDVEIKAPAGKFHHMFAGRPHHVSKATPGNIQNCELHEGDWGKVGSVVIWNYVHD  67

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++++AV+ E   +TF ++ G++   +KSF  T+Q +      G+ V W LEYE
Sbjct  68   GEAKVAKERVEAVEPEKNLITFRVVEGDLMKEYKSFVITIQVTPKHGGPGSVVHWHLEYE  127

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K +D V  P + ++F + +++E+DE+LL
Sbjct  128  KISDEVAHPETLLQFCVEISKEIDEHLL  155



>gb|EAY94463.1| hypothetical protein OsI_16233 [Oryza sativa Indica Group]
Length=157

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 92/153 (60%), Gaps = 13/153 (8%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E   ++KSP+ K +     ++ L PKI P + +S++ +EGDGKS G+VRL  Y  G  
Sbjct  4    KVELVVEVKSPADKLWTALRESTELFPKIFPEQYKSIETVEGDGKSAGTVRLLKYTEGVP  63

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASGNS-----------VKWT  380
            ++  AK+K++  D+E + V+++++ GE+ +++K+FR TLQ +              V WT
Sbjct  64   MVTFAKEKVEVADDEKKVVSYSVVDGELVSFYKNFRVTLQVTPKGGAAAPAADGAVVSWT  123

Query  381  LEYEKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            ++++KA++ VP P    E       ++D+YLLK
Sbjct  124  MDFDKASEEVPDPDVIKETAAKTFHDLDDYLLK  156



>ref|XP_008439042.1| PREDICTED: MLP-like protein 43 isoform X2 [Cucumis melo]
Length=151

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 86/149 (58%), Gaps = 5/149 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M +  KLE +  I++P+ KF +++      +      KI  V L EG+   VGS+  W Y
Sbjct  1    MGRYGKLEIDVPIRAPASKFHEMFHKKPHHISNASSDKIHGVDLHEGEWGQVGSIICWKY  60

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEY  389
               G   IAK+ I+ VDEEN S+ F +I G++T ++K F+ T+Q      G+ V W LEY
Sbjct  61   FSDGKARIAKEIIEHVDEENNSIAFKVIEGDLTEHYKDFKLTIQCIPKGKGSVVHWILEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            EK +D +P  H+ ++F + V++++D+ L 
Sbjct  121  EKLHDKIPDSHTLLQFCVEVSKDIDKQLC  149



>ref|XP_009104932.1| PREDICTED: MLP-like protein 34 [Brassica rapa]
Length=161

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 87/147 (59%), Gaps = 6/147 (4%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IK+ + KF  ++      + K  P KI++  L EGD   VGS+  W Y+ G
Sbjct  12   VGKLETDVEIKASAGKFHHMFAGRPHHVSKASPGKIKACDLHEGDWGKVGSIVYWNYVHG  71

Query  234  GNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEK  395
                AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W LEYEK
Sbjct  72   KGKGAKERIEAVEPEKNLITFRVIEGDLMKEYKSFLITIQVTPKHGGPGSIVHWHLEYEK  131

Query  396  ANDNVPTPHSHVEFLMNVAREVDEYLL  476
             +D V  P + ++F + V++E+DE+LL
Sbjct  132  ISDEVAHPETLLQFCVEVSKEIDEHLL  158



>ref|NP_198153.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
 gb|AED93758.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
Length=166

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 87/146 (60%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE E +IK+P+  F+ IY      + K  P  ++S  L +G+  +VGS+  W Y+  G 
Sbjct  18   KLEVEVEIKAPAAIFYHIYAGRPHHVAKATPRNVQSCDLHDGEWGTVGSIVYWNYVHEGQ  77

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYEKA  398
              +AK++I+ V+ E + + F +I G+V   +KSF  T+Q       +G+ VKW +EYEK 
Sbjct  78   AKVAKERIELVEPEKKLIKFRVIEGDVMAEYKSFLITIQVTPKEGGTGSVVKWHIEYEKI  137

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            ++NVP P + + F   + +E+DE+LL
Sbjct  138  DENVPHPENLLPFFAEMTKEIDEHLL  163



>gb|KHG05186.1| MLP-like protein 28 [Gossypium arboreum]
Length=151

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 96/149 (64%), Gaps = 5/149 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQI K++ +  IKS + +F++ + +    LPK+    I+ V+LL+GD  SVG+VRLW+Y
Sbjct  1    MAQIRKMDCQVMIKSTADEFYNAFRSKPQFLPKMSNGLIKDVKLLQGDWNSVGAVRLWSY  60

Query  225  IL-GGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFR--ATLQASG--NSVKWTLEY  389
               G + + K+  + VDE+++++ + L+ G++ N + S+R   T++  G  + VKWT+E+
Sbjct  61   SSEGKSQMVKEIFEKVDEKSKTMVYKLVEGDLLNSYNSWRNIITIRPVGERSMVKWTMEF  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            EK N+++P P  + + L+ +   +D YLL
Sbjct  121  EKQNEDIPDPVGYADSLIALTNNIDAYLL  149



>ref|XP_007223673.1| hypothetical protein PRUPE_ppa012870mg [Prunus persica]
 gb|EMJ24872.1| hypothetical protein PRUPE_ppa012870mg [Prunus persica]
Length=151

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 93/146 (64%), Gaps = 6/146 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E E +IK+P++KF++I+ + +  +P I P  I+ VQ+ EGD K+ GS++ W Y +G  
Sbjct  7    KVETEIEIKAPAEKFYNIFNSRAHHVPNISPGSIQGVQVHEGDWKTHGSIKSWNYTVGDE  66

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEYEKAND  404
            V + K+K++  ++EN+S+T   + G+V  YFKSF+   Q +    G+    ++ YEK ND
Sbjct  67   VGVFKEKVE-YNDENKSITLNGVEGDVFKYFKSFKPVYQFTQKDEGSIATLSIAYEKLND  125

Query  405  NVPTPHSHVEFLMNVAREVDEYLLKT  482
            NV  P  +V  ++N+ +++D + +K 
Sbjct  126  NVAAPDKYVGLMVNIVKDLDAHFIKA  151



>gb|AAF87152.1|AC002423_17 T23E23.17 [Arabidopsis thaliana]
Length=418

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 94/145 (65%), Gaps = 6/145 (4%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            L  E ++KSP++KF+    +  +L PK  P   +++Q+L GDG + GS+RL TY  G  +
Sbjct  7    LHVEVEVKSPAEKFWVALGDGINLFPKAFPNDYKTIQVLAGDGNAPGSIRLITYGEGSPL  66

Query  243  --IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAND  404
              I+ ++I+AVD EN+S+++++IGGE+  Y+K+F+ T+    +  G+ +KW+ E+EK   
Sbjct  67   VKISAERIEAVDLENKSMSYSIIGGEMLEYYKTFKGTITVIPKDGGSLLKWSGEFEKTAH  126

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
             +  PH   +F +   +E+DEYLLK
Sbjct  127  EIDDPHVIKDFAVKNFKEIDEYLLK  151



>ref|XP_010693434.1| PREDICTED: MLP-like protein 43 [Beta vulgaris subsp. vulgaris]
Length=154

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 88/146 (60%), Gaps = 8/146 (5%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYI---LG  233
            +E ET++K  ++KFF+++   S L+ ++CP +   ++L EGD   VGSV  WTY+   +G
Sbjct  7    VEGETKLKCDAEKFFEVWSRKSYLVSQLCPHRYPKIELHEGDWDKVGSVHTWTYVCNEVG  66

Query  234  GNVIAKDKIDAVDEENRSVTFALIGGEV-TNYFKSFRATLQAS----GNSVKWTLEYEKA  398
             +   K ++D  D ENR V ++   G V  N++K+ ++ +Q +    G  VKW  +YEK 
Sbjct  67   EHSFVKIRVDEFDGENRCVNYSYEDGAVIKNHYKTLKSKIQVTPQDEGCIVKWHFDYEKM  126

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            N N P P+ +++FL+  A+++D  L 
Sbjct  127  NKNAPDPNLYIDFLLGTAKDIDACLC  152



>ref|XP_009610076.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like [Nicotiana 
tomentosiformis]
Length=155

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 86/145 (59%), Gaps = 5/145 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   +LEFE +IKSP   F +IY +N   LPKIC   +  + LLEG+   VG V +  Y
Sbjct  1    MALSGELEFEVEIKSPGSVFVEIYGSNKEYLPKICSKIVPRIDLLEGEWGQVGCVIMVYY  60

Query  225  ILGG-NVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEY  389
             + G  +I+K+ ++AVDE+N+S+ + L+ GE+   +K+ R T Q         VK T+EY
Sbjct  61   SIDGVEMISKELVEAVDEKNKSIVYNLLEGELMKLYKTLRFTFQIISKNEAEFVKTTIEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVD  464
            EK +++VP P    EF+  V + +D
Sbjct  121  EKLSEDVPFPDKLKEFVTAVTKTID  145



>ref|XP_008243380.1| PREDICTED: MLP-like protein 28 [Prunus mume]
Length=151

 Score =   104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 93/146 (64%), Gaps = 6/146 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E E +IK+P++KF++I+ + +  +P I P  I+ VQ+ EGD K+ GS++ W Y +G  
Sbjct  7    KVETEIEIKAPAEKFYNIFKSRAHHVPNISPGSIQGVQVHEGDWKTHGSIKSWNYSVGDE  66

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEYEKAND  404
            V + K+K++  ++EN+S+T   + G+V  YFKSF+   Q +    G+    ++ YEK ND
Sbjct  67   VGVFKEKVE-YNDENKSITLNGVEGDVFKYFKSFKPVYQFTQKDEGSIATLSIAYEKLND  125

Query  405  NVPTPHSHVEFLMNVAREVDEYLLKT  482
            NV  P  +V  ++N+ +++D + +K 
Sbjct  126  NVAAPDKYVGLMVNIVKDLDAHFIKA  151



>ref|XP_011023662.1| PREDICTED: MLP-like protein 328 [Populus euphratica]
Length=150

 Score =   104 bits (259),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 95/151 (63%), Gaps = 6/151 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   KLE + ++K  + +FF+I    +  +P     +I+++++ EGD  + GSV+LWTY
Sbjct  1    MALAGKLEIKCELKCSADRFFEILSCQAHQIPNASSGEIQAIEVHEGDWVATGSVKLWTY  60

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEY  389
             + G   + K+K++ VDE N+SV+   +GG V   +KS++ TL+    A G  VK  L+Y
Sbjct  61   TIDGKPEVFKEKVE-VDEVNKSVSLIAVGGHVLEQYKSYKITLKTVSMAEGGFVKILLDY  119

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            EK   + P P+ +++F++NV +++DE+L+K 
Sbjct  120  EKLKPDDPPPNKYLDFVINVVKDIDEHLVKA  150



>gb|KFK44400.1| hypothetical protein AALP_AA1G252500 [Arabis alpina]
Length=161

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 88/146 (60%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            + E E +IK+P+ KF+D+Y      + K  P  +++ +L +G+  +VGS+  W Y+  G 
Sbjct  13   EFELEFEIKAPAAKFYDMYAGRPHHVAKATPRNVQACELHDGEWGTVGSIIFWNYVHDGE  72

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              ++K++++ V+ E   +T+ ++ G++   +KSF  T+Q +      G+ V+W  EYEK 
Sbjct  73   AQVSKERVELVEPEKNLITYRVLEGDLMKEYKSFVNTIQVTPKQGENGSIVRWYFEYEKI  132

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            +DNV  P S + F + V +E+DEYLL
Sbjct  133  DDNVAHPESFLPFFVEVVKEIDEYLL  158



>emb|CDY23474.1| BnaC06g24430D [Brassica napus]
Length=163

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 88/148 (59%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IK+ + KF  ++      + K  P KI++  L EGD   VGS+  W Y+ G
Sbjct  13   VGKLETDVEIKASAGKFHHMFAGRPHHVSKASPGKIKACDLHEGDWGKVGSIVYWNYVHG  72

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
              + +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W LEYE
Sbjct  73   KKIYVAKERIEAVEPEKNLITFRVIEGDLMKEYKSFLITIQVTPKHGGPGSIVHWHLEYE  132

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K +D V  P + ++F + V+ E+DE+LL
Sbjct  133  KISDEVAHPETLLQFCVEVSEEIDEHLL  160



>gb|ACU19047.1| unknown [Glycine max]
Length=155

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 91/147 (62%), Gaps = 5/147 (3%)
 Frame = +3

Query  48   AQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYI  227
            +Q+ K+E    IK+ + +F ++  N +  +  I P K++SV++ +G+  + GSV  W Y+
Sbjct  4    SQLQKVEANVHIKASADQFHNVLCNRTHHIANIFPGKVQSVEIHKGEWGTEGSVISWNYL  63

Query  228  LGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEYE  392
              G V +AK+ ++ +D +N  +TF +I G++  ++KSF+  LQ +    G+ V W LEYE
Sbjct  64   HEGKVCVAKEMVEGIDTKNNKMTFKVIEGDLLGHYKSFKFLLQVTPKEKGSVVNWVLEYE  123

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYL  473
            K NDN P P++ +E  + +++E+  YL
Sbjct  124  KQNDNTPDPYTLLELTVEMSKEIGAYL  150



>ref|XP_006836680.1| hypothetical protein AMTR_s00088p00081230 [Amborella trichopoda]
 gb|ERM99533.1| hypothetical protein AMTR_s00088p00081230 [Amborella trichopoda]
Length=152

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 89/145 (61%), Gaps = 7/145 (5%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            L  E  +KSP+ KF+    +++ L PKI P + +S++++EGDGKSVGS+R+  Y  G  V
Sbjct  5    LPLEVALKSPADKFWAAIRDSTELFPKIFPDQYKSIKVVEGDGKSVGSIRVIDYAEGMPV  64

Query  243  -IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYEKAN  401
              +K+KI   D+  + VT+A++ G++ +++K F ATLQ      A  +  KW + YEKAN
Sbjct  65   SYSKEKIKVADDATKKVTYAVVDGDILSFYKVFEATLQVVLSADAKSSVAKWDIHYEKAN  124

Query  402  DNVPTPHSHVEFLMNVAREVDEYLL  476
             +VP P+   +      + +D++++
Sbjct  125  PDVPEPNLIQDLASKTFKALDDHVM  149



>ref|XP_004498311.1| PREDICTED: MLP-like protein 34-like [Cicer arietinum]
Length=153

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 91/147 (62%), Gaps = 7/147 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGG-  236
            K+E E +I++P+ KF++I+      +P I    +   +L EGD ++VGS++ W Y +GG 
Sbjct  6    KVEGEVEIEAPAAKFYNIFRKQLHHIPNIATDVVHGAELHEGDWENVGSIKQWNYTIGGI  65

Query  237  NVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEYEKAND  404
               AK KI+ +D++N  +T+++  GE++  +KS + TLQ      G  VKWT EYEK  +
Sbjct  66   KQSAKTKIETIDDDNMVLTYSIFDGEMSESYKSLKITLQVIGKEHGGLVKWTYEYEKLKE  125

Query  405  NV--PTPHSHVEFLMNVAREVDEYLLK  479
            ++    P S++EF + + +++D +L+K
Sbjct  126  DITGAPPESYLEFAVKITKDIDAHLVK  152



>emb|CBI26883.3| unnamed protein product [Vitis vinifera]
Length=138

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 86/137 (63%), Gaps = 5/137 (4%)
 Frame = +3

Query  87   SPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN-VIAKDKID  263
            + + KF +I+      +  +CPAKI+ V L EG+  + GSV  W Y + GN  +AK+ ++
Sbjct  2    ASADKFHEIFWCRPHHISNVCPAKIQKVHLHEGEWGTSGSVIQWHYNIDGNDHVAKEIVE  61

Query  264  AVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEYEKANDNVPTPHSHV  431
            A+DEEN+SVTF +I G++   +KSFR  +QA        V WTLEYEK N +V  P   +
Sbjct  62   AIDEENKSVTFKVIEGDLMKEYKSFRIIVQAIPKGDATYVHWTLEYEKLNKDVLAPIKIL  121

Query  432  EFLMNVAREVDEYLLKT  482
             F+++V+ ++D++L++ 
Sbjct  122  GFVVHVSEDIDDHLVQA  138



>gb|ABK24165.1| unknown [Picea sitchensis]
Length=153

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 90/145 (62%), Gaps = 8/145 (6%)
 Frame = +3

Query  72   ETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNVI--  245
            E  ++ P++KF+    +++S+ PKI P + +S++++EGDGKSVGS R   Y  G  ++  
Sbjct  8    ELDLRVPAQKFWGAIQDSASVFPKIMPTQFKSIEMIEGDGKSVGSTRHIKYGEGMKMLTH  67

Query  246  AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYEKANDN  407
            A ++IDAVDE N +VT+ +I GE+ + +K FR TL+      A+  SV WT+E+E A + 
Sbjct  68   ATERIDAVDETNMTVTYTVIEGEILSIYKVFRPTLKVIPGADANSCSVSWTVEFEPAGNE  127

Query  408  VPTPHSHVEFLMNVAREVDEYLLKT  482
             P      E  +++ + V+ YLL T
Sbjct  128  TPPSDPIKEAAISMFKTVEGYLLTT  152



>ref|XP_006598268.1| PREDICTED: MLP-like protein 34-like [Glycine max]
 gb|KHN39933.1| MLP-like protein 28 [Glycine soja]
Length=155

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 91/147 (62%), Gaps = 5/147 (3%)
 Frame = +3

Query  48   AQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYI  227
            +Q+ K+E    IK+ + +F ++  N +  +  I P K++SV++ +G+  + GSV  W Y+
Sbjct  4    SQLQKVEANVHIKASADQFHNVLCNRTHHIANIFPGKVQSVEIHKGEWGTEGSVISWNYL  63

Query  228  LGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEYE  392
              G V +AK+ ++ +D +N  +TF +I G++  ++KSF+  LQ +    G+ V W LEYE
Sbjct  64   HEGKVCVAKEMVEGIDMKNNKMTFKVIEGDLLGHYKSFKFLLQVTPKEKGSVVNWVLEYE  123

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYL  473
            K NDN P P++ +E  + +++E+  YL
Sbjct  124  KQNDNTPDPYTLLELTVEMSKEIGAYL  150



>ref|XP_004297383.1| PREDICTED: MLP-like protein 28-like [Fragaria vesca subsp. vesca]
Length=153

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 92/150 (61%), Gaps = 5/150 (3%)
 Frame = +3

Query  42   IMAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWT  221
            + +++ KLE + +IK+   +F + +      +  +   KI+   L EGD  +VGSV  W 
Sbjct  1    MSSKLEKLETDVEIKASPVQFHEYFTRRPHHISNVSSDKIQGCDLHEGDWGNVGSVIYWN  60

Query  222  YILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLE  386
            Y+  G   + K+ I+A+D+E  S+T  +I G++  ++KSF+AT+QAS    G+SV WT E
Sbjct  61   YVHDGKPRVCKELIEAIDDETNSITLKIIEGDLLEHYKSFKATIQASPKGEGSSVHWTFE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            YEK +D V  PH+ ++ +  +++++D +L+
Sbjct  121  YEKLHDEVSDPHTLLQLVAELSKDIDNHLI  150



>ref|XP_008439039.1| PREDICTED: MLP-like protein 43 [Cucumis melo]
Length=153

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 91/143 (64%), Gaps = 5/143 (3%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE +  I++P+ KF ++   N   +  I   K++S +L EG+   VGS+  W Y+  G 
Sbjct  6    KLETDVVIEAPAWKFHEMLHRNPHHVSNIASDKVQSCELHEGEWGKVGSIIYWNYVHDGK  65

Query  240  -VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEYEKAND  404
              +AKD I+AVDEEN S T+ ++ G++ N++KSFR T+Q+     G+ + +TLEYEK ++
Sbjct  66   ACVAKDLIEAVDEENNSFTWKVLEGDLLNHYKSFRLTIQSIPKDKGSVIHYTLEYEKLHE  125

Query  405  NVPTPHSHVEFLMNVAREVDEYL  473
            ++   H+ ++  ++VA+ +D +L
Sbjct  126  DIEDSHTFLQLCVDVAKAIDAHL  148



>ref|XP_002312447.1| hypothetical protein POPTR_0008s13050g [Populus trichocarpa]
 gb|EEE89814.1| hypothetical protein POPTR_0008s13050g [Populus trichocarpa]
Length=150

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 93/151 (62%), Gaps = 6/151 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   KLE   ++K  + KFF+I    +  +P     +I ++++ EGD  + GSV+LWTY
Sbjct  1    MALAGKLEINFELKCSADKFFEILSCQAHQIPNASSGEIHAIEVHEGDWVATGSVKLWTY  60

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEY  389
             + G   + K+K++ VDE N+SV+   +GG V   +KS++ TL+    A G  VK  L+Y
Sbjct  61   TIDGKPEVFKEKVE-VDEVNKSVSLIAVGGHVLEQYKSYKITLKTVSMAEGGVVKILLDY  119

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            EK   + P P+ +++F++NV +++DE+L+K 
Sbjct  120  EKLKPDDPPPNKYLDFVINVVKDIDEHLVKA  150



>ref|XP_010427881.1| PREDICTED: MLP-like protein 31 [Camelina sativa]
Length=171

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 88/148 (59%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE +  I++ + +F  ++      + K  P KI+  +L EGD   VGS+  W Y+  
Sbjct  21   VGKLEIDVDIRASAGQFHHMFAGRPHHVSKASPGKIQRCELHEGDWGKVGSIVFWNYVHD  80

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W +EYE
Sbjct  81   GEAKVAKERIEAVEPEKNLITFRVIDGDLLKEYKSFVITIQVTPKQGGRGSVVHWHVEYE  140

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K +D V  P + +EF ++V++E+DE+LL
Sbjct  141  KIDDKVAHPETFLEFCVHVSKEIDEHLL  168



>ref|XP_010415785.1| PREDICTED: MLP-like protein 43 [Camelina sativa]
Length=159

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 87/147 (59%), Gaps = 8/147 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG--  233
            KLE E +IK+ ++KF  ++      + K  P KI   +L EGD   VGS+ +W Y+ G  
Sbjct  10   KLETEVEIKASAEKFHHMFAEKPHHVSKATPGKIHGCELHEGDWGKVGSIVIWKYVHGKW  69

Query  234  GNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEK  395
                 K++I+AVD E   +TF +IGG +   +KSF  T+Q +      G+ V W LEYEK
Sbjct  70   KGSRGKNRIEAVDTEKNLITFKVIGGVLMKEYKSFAFTIQVTPKQGGPGSIVHWHLEYEK  129

Query  396  ANDNVPTPHSHVEFLMNVAREVDEYLL  476
             ++ V  P + ++F +++++E+DE+LL
Sbjct  130  ISNEVAHPETLLQFCVDISKEIDEHLL  156



>ref|XP_002888799.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65058.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=316

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 88/148 (59%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE E +IK+ + KF  ++      + K  P  I+S  L EGD  +VGS+  W Y+  
Sbjct  10   VGKLETEVEIKASAGKFHHMFAGKPHHVSKASPGNIQSCDLHEGDWGTVGSIVFWNYVHD  69

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I G++   +KSF  T+Q       SG+ V W LEYE
Sbjct  70   GEAKVAKERIEAVEPEKNLITFRVIEGDLMKEYKSFVITIQVTPKHGGSGSIVHWHLEYE  129

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K +D V  P + ++F + V++E+DE+LL
Sbjct  130  KISDEVAHPETLLQFCVEVSKEIDEHLL  157


 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 83/139 (60%), Gaps = 7/139 (5%)
 Frame = +3

Query  81   IKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV-IAKDK  257
            IK+ ++KF  ++      + K  P KI+S  L EGD  +VGSV  W YI  G   +AK++
Sbjct  175  IKASAQKFHHMFAGKPHHVSKATPDKIQSCDLHEGDWGTVGSVVFWNYIHDGEAKVAKER  234

Query  258  IDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYEKANDNVPTP  419
            I+AVD E   +TF +I G++   +KSF  T+Q       SG+ V W  EYEK N+ V  P
Sbjct  235  IEAVDPEKNLITFRVIEGDLMKEYKSFVITIQVTPKHGGSGSVVHWHFEYEKINEEVAHP  294

Query  420  HSHVEFLMNVAREVDEYLL  476
             + ++F + +++E+DE+LL
Sbjct  295  ETLLQFAVEISKEIDEHLL  313



>emb|CDP00798.1| unnamed protein product [Coffea canephora]
Length=152

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 96/148 (65%), Gaps = 6/148 (4%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE E ++KS + +FF  +   +  LP +   K+  +++ EGD K+ GS++LWTY++ 
Sbjct  6    VGKLEAEFELKSDADEFFHSFGAKAHQLPDLVNEKVNRIEVHEGDWKTDGSIKLWTYVID  65

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASGNSV----KWTLEYEKA  398
            G V + KD++  +DEEN+++T   I G+   ++K++  TLQ     V    K+T++YEK 
Sbjct  66   GKVEVFKDRL-KIDEENKTITSEAIDGDCMKHYKNYIITLQVISRGVSSFAKYTIDYEKL  124

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            N+N+P+P  ++++L+++ ++VD  L+K 
Sbjct  125  NENMPSPTKYLDWLLHMGKDVDASLIKA  152



>ref|XP_002874413.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50672.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata]
Length=164

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 86/146 (59%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            +LE E +IK+P+  F+ IY      + K  P  ++S  L +G+  +VGS+  W Y+  G 
Sbjct  16   ELEVEVEIKAPAATFYHIYAGRPHHVAKATPRNVQSCDLHDGEWGTVGSIVFWNYVHEGQ  75

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              +AK++I+ V+ E + + F +I G+V   +KSF  T+Q +      G+ VKW LEYEK 
Sbjct  76   AKVAKERIELVEPEKKLIKFRVIEGDVMAEYKSFLITIQVTPKEGGVGSVVKWHLEYEKI  135

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            ++NV  P + + F   + RE+DE+LL
Sbjct  136  DENVAHPENLLPFFAEMTREIDEHLL  161



>emb|CAC83580.1| major latex-like protein [Arabidopsis thaliana]
Length=162

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 87/146 (60%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE + +IK+ + KF  ++      + K  P KI+  +L EGD   VGS+  W Y+  G 
Sbjct  14   KLETDIEIKASAGKFHHMFAGRPHHVSKATPGKIQGCELHEGDWGKVGSIVFWNYVHDGE  73

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W +EYEK 
Sbjct  74   AKVAKERIEAVEPEKNLITFRVIEGDLLKEYKSFVITIQVTPKRGGPGSVVHWHVEYEKI  133

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            +D V  P + ++F + V++E+DE+LL
Sbjct  134  DDKVAHPETFLDFCVEVSKEIDEHLL  159



>gb|KHN22818.1| MLP-like protein 34 [Glycine soja]
Length=155

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 92/149 (62%), Gaps = 5/149 (3%)
 Frame = +3

Query  48   AQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYI  227
            +Q+ K+E   QIK+ +++F+D++ N    +  I P  I+SV++ +G+    GS+  W Y+
Sbjct  4    SQLQKVETSLQIKASAEQFYDVFCNKPHTIANISPENIQSVEVHKGEWGKEGSIVSWNYL  63

Query  228  LGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEYE  392
              G V +AK  ++ +D+EN  +T  +I G+V   +KSF++ LQ +    G+ V W +EYE
Sbjct  64   HEGTVCVAKQVLEGIDKENNKMTMKVIEGDVLGLYKSFKSNLQVTPKGKGSVVLWAMEYE  123

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            K  D++P  H+ ++  + V++++D YL +
Sbjct  124  KQEDHIPDAHTLLQLAVVVSKKIDAYLTQ  152



>ref|XP_010415776.1| PREDICTED: MLP-like protein 31 [Camelina sativa]
Length=171

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 88/148 (59%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE +  I++ + +F  ++      + K  P KI+  +L EGD   VGS+  W Y+  
Sbjct  21   VGKLEIDVDIRASAGQFHHMFAGRPHHVSKASPGKIQRCELHEGDWGKVGSIVFWNYVHD  80

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W +EYE
Sbjct  81   GEAKVAKERIEAVEPEKNLITFRVIEGDLLKEYKSFVITIQVTPKQGGRGSVVHWHVEYE  140

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K +D V  P + +EF ++V++E+DE+LL
Sbjct  141  KIDDKVAHPETFLEFCVHVSKEIDEHLL  168



>gb|AAD55499.1|AC008148_9 Unknown protein [Arabidopsis thaliana]
Length=167

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 87/146 (60%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE + +IK+ + KF  ++      + K  P KI+  +L EGD   VGS+  W Y+  G 
Sbjct  19   KLETDIEIKASAGKFHHMFAGRPHHVSKATPGKIQGCELHEGDWGKVGSIVFWNYVHDGE  78

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W +EYEK 
Sbjct  79   AKVAKERIEAVEPEKNLITFRVIEGDLLKEYKSFVITIQVTPKRGGPGSVVHWHVEYEKI  138

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            +D V  P + ++F + V++E+DE+LL
Sbjct  139  DDKVAHPETFLDFCVEVSKEIDEHLL  164



>ref|XP_010693433.1| PREDICTED: kirola-like [Beta vulgaris subsp. vulgaris]
Length=155

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 94/154 (61%), Gaps = 8/154 (5%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQ+ ++E + ++K  + K+FD++ +   L+  +CP KI++  L+EG    VG+V    Y
Sbjct  1    MAQLNRVEGQVELKCEADKYFDVWAHKVYLIQDMCPDKIQNTVLIEGAWHKVGAVWSGNY  60

Query  225  I---LGGNVIAKDKIDAVDEENRSVTFALIGGEVT-NYFKSFRATLQA----SGNSVKWT  380
            +   +G N   K +++ +DE+N SV ++   G +  NY+KS  + LQA     G  VKW+
Sbjct  61   VNNDIGENASLKARMNEIDEKNMSVRYSYHDGFIMDNYYKSLTSKLQAIPKDKGCIVKWS  120

Query  381  LEYEKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
             EYEK ND+ P  + H++FL+ +++++D +L + 
Sbjct  121  FEYEKINDDAPDANVHIDFLLAISKDMDAHLCRA  154



>ref|XP_009351498.1| PREDICTED: MLP-like protein 329 [Pyrus x bretschneideri]
 ref|XP_009349508.1| PREDICTED: MLP-like protein 329 [Pyrus x bretschneideri]
Length=157

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 91/145 (63%), Gaps = 7/145 (5%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            ++ E +IK+ + K + +  N    +PK    KI  V + EGD ++ GSV+LW Y L GNV
Sbjct  13   VQAEVEIKANADKLYKVISNQHHDVPKAASDKIHDVAVHEGDWETSGSVKLWKYTLDGNV  72

Query  243  IA-KDKIDAVDEENRSVTF-ALIGGEVTNYFKS----FRATLQASGNSVKWTLEYEKAND  404
               K+K++ +DE N+ V+  AL G  V + +KS    F+AT ++ G SVK TLEYEK N+
Sbjct  73   ETFKEKVE-IDEANKWVSLTALEGSHVLDNYKSYKIIFQATPKSEGGSVKITLEYEKLNE  131

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
            N P P  ++ F++NV +++D +LLK
Sbjct  132  NDPPPQKYLSFMVNVIKDIDAHLLK  156



>ref|NP_177241.3| MLP-like protein 31 [Arabidopsis thaliana]
 sp|Q941R6.2|MLP31_ARATH RecName: Full=MLP-like protein 31 [Arabidopsis thaliana]
 gb|AAL87294.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67543.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE98593.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35126.1| MLP-like protein 31 [Arabidopsis thaliana]
Length=171

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 87/146 (60%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE + +IK+ + KF  ++      + K  P KI+  +L EGD   VGS+  W Y+  G 
Sbjct  23   KLETDIEIKASAGKFHHMFAGRPHHVSKATPGKIQGCELHEGDWGKVGSIVFWNYVHDGE  82

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W +EYEK 
Sbjct  83   AKVAKERIEAVEPEKNLITFRVIEGDLLKEYKSFVITIQVTPKRGGPGSVVHWHVEYEKI  142

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            +D V  P + ++F + V++E+DE+LL
Sbjct  143  DDKVAHPETFLDFCVEVSKEIDEHLL  168



>ref|XP_010681182.1| PREDICTED: MLP-like protein 28 [Beta vulgaris subsp. vulgaris]
Length=154

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 88/152 (58%), Gaps = 8/152 (5%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQ+ +++ +  +KS + KFFD++ +   LL  +CP K   V+L EG    VG+V  WTY
Sbjct  1    MAQLQRVKGQADLKSNADKFFDVWSHKLHLLSTLCPDKFPKVELNEGQWGKVGAVCTWTY  60

Query  225  I---LGGNVIAKDKIDAVDEENRSVTFALIGGEV-TNYFKSFRATLQA----SGNSVKWT  380
                +G +   K +I+  +EE R   ++   G +  NY+K+F++  Q      G  VKW 
Sbjct  61   HCKDIGEHAFVKTRIEESNEEKRYFKYSYHDGLILKNYYKTFKSKFQVVPKEEGCIVKWR  120

Query  381  LEYEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
             +YEK N+NVP P+ +++FL+  A++VD  L 
Sbjct  121  FDYEKMNENVPEPNMYIDFLLGTAKDVDACLC  152



>ref|NP_001237398.1| uncharacterized protein LOC100500396 [Glycine max]
 gb|ACU15467.1| unknown [Glycine max]
 gb|KHN39932.1| MLP-like protein 43 [Glycine soja]
Length=155

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 95/147 (65%), Gaps = 5/147 (3%)
 Frame = +3

Query  48   AQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYI  227
            +Q+ KLE    IK+ +++F+D+  + +  +PKI P K  SV++L+G   + GS+  W Y+
Sbjct  4    SQLQKLEANVSIKASAEQFYDVLCHKTHQIPKIFPEKALSVEILKGAWGTEGSIISWNYL  63

Query  228  LGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEYE  392
              G V +AK+ I+ +D++N+ ++F +I G+V  ++KSF+  +Q +    G+ V+  +EYE
Sbjct  64   YEGKVCVAKEVIEGIDKKNKKMSFKVIEGDVLGHYKSFKFIMQVTPKEKGSVVQCVVEYE  123

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYL  473
            K  D++P PH+ ++  + + ++++ YL
Sbjct  124  KQKDHIPDPHTLLQSTVELCKKINAYL  150



>dbj|BAA83470.1| Csf-2 [Cucumis sativus]
 gb|KGN57231.1| hypothetical protein Csa_3G172370 [Cucumis sativus]
Length=151

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 89/148 (60%), Gaps = 5/148 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M+   KLE +  I++ + KF +++      +      KI  V+L EG+   VGS+  W Y
Sbjct  1    MSLCGKLEKDVPIRASASKFHEMFHKKPHHICNCSTDKIHGVELQEGEWGQVGSIICWKY  60

Query  225  IL-GGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEY  389
               G + IAK+ ++ VDEEN S+TF +I G++T ++K FR T++      G+ + W LEY
Sbjct  61   FHEGKHKIAKEIVEHVDEENNSITFKVIEGDLTEHYKDFRFTIKCIPKEKGSVIHWVLEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYL  473
            EK +D +P  H+ ++F ++V++++D+ L
Sbjct  121  EKLHDKIPDSHTLLQFCVDVSKDIDKQL  148



>ref|WP_039311017.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91165.1| hypothetical protein QW71_36240, partial [Paenibacillus sp. IHB 
B 3415]
Length=178

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 90/151 (60%), Gaps = 5/151 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M    KL  + +IKS    F +++ +    +  + P  I  V L EGD   VGSV  W Y
Sbjct  28   MGLTGKLVRQVEIKSDGDAFHELFRDKPHHVSTMSPGNIHGVDLHEGDWGHVGSVISWNY  87

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEY  389
               G   + K+ I+A+DEEN+SVTF +IGG+VT  +++F+ T+    +   N V WT EY
Sbjct  88   THDGKKKVIKEVIEAIDEENKSVTFKVIGGDVTELYRTFKITVHVDTKGENNLVTWTFEY  147

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            EK +++V  P++ ++F +NV+++++ + LK+
Sbjct  148  EKKSEDVEDPNTLMDFAINVSKDIESHHLKS  178



>ref|XP_007149299.1| hypothetical protein PHAVU_005G058600g [Phaseolus vulgaris]
 gb|ESW21293.1| hypothetical protein PHAVU_005G058600g [Phaseolus vulgaris]
Length=155

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 94/147 (64%), Gaps = 5/147 (3%)
 Frame = +3

Query  48   AQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYI  227
            +Q+ K+E +  +K+ +++F+D++ N    +  I P KI+SVQ+ +G+  + GS+  W ++
Sbjct  4    SQLQKIETKVHLKASAQQFYDVFCNRPHHIANISPQKIQSVQIHKGEWGTEGSIVSWNFM  63

Query  228  LGG-NVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEYE  392
            L G   +AK+ ++ +D+EN  ++F ++ G++   +KSF+  LQ +    G+  +W LE+E
Sbjct  64   LDGKKFVAKEVVEGIDKENCKLSFKVLEGDLLGLYKSFKFNLQVTPKENGSVAQWALEFE  123

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYL  473
            K  +++P PH+ ++  + +++ +D YL
Sbjct  124  KQENHIPAPHTLLQMGVELSKNIDSYL  150



>ref|XP_009351486.1| PREDICTED: MLP-like protein 329 isoform X2 [Pyrus x bretschneideri]
Length=173

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 87/146 (60%), Gaps = 8/146 (5%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            LE E +IK+ + K +    N     PK    KI  V + EGD ++ GSV+LW Y + GNV
Sbjct  28   LEAEVEIKANADKLYKFISNQHYEFPKAASDKIHDVTVHEGDWETSGSVKLWKYTIDGNV  87

Query  243  -IAKDKIDAVDEENRSVTFALIGGE--VTNYFKS----FRATLQASGNSVKWTLEYEKAN  401
               K+K++ +DE N+ V+   + G   + NY+KS    F  T ++ G SVK TLEYEK N
Sbjct  88   ETYKEKVE-IDEANKWVSLTALEGSHVLDNYYKSYKIIFHVTPKSEGGSVKITLEYEKLN  146

Query  402  DNVPTPHSHVEFLMNVAREVDEYLLK  479
            +N P P  ++ FL+NV ++VD +LLK
Sbjct  147  ENDPPPQKYLSFLVNVIKDVDAHLLK  172



>ref|XP_002446634.1| hypothetical protein SORBIDRAFT_06g019320 [Sorghum bicolor]
 gb|EES10962.1| hypothetical protein SORBIDRAFT_06g019320 [Sorghum bicolor]
Length=157

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 93/153 (61%), Gaps = 13/153 (8%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E   ++KSP+ K +    +++ L PKI P + +S++ +EGDGKS G+VRL  Y     
Sbjct  4    KVELVVEVKSPADKLWAALRDSTELFPKIFPEQYKSIETVEGDGKSAGTVRLLKYTEAVP  63

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL-----------QASGNSVKWT  380
            ++  AK+K++  D+EN+ V+++++ GE+ +++K+F+ TL             +G  V W+
Sbjct  64   MLTFAKEKLEVADDENKVVSYSVVDGELVDFYKNFKITLKVAKAAAAEGEGEAGAVVNWS  123

Query  381  LEYEKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            +E++KAND VP P    E       ++D+YLLK
Sbjct  124  MEFDKANDQVPDPDVIKETATKTFHDLDDYLLK  156



>gb|KGN57232.1| Csf-2 protein [Cucumis sativus]
Length=155

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 82/143 (57%), Gaps = 5/143 (3%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE +  IK+ +  F +I+      +      KI  V L EG+   VGS+  W Y   G 
Sbjct  7    KLETDVPIKASASMFHEIFHKKPHHISNASTDKIHGVDLHEGEWGQVGSIICWKYFHDGK  66

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEYEKAND  404
              IAK+ I+ VDEEN S+TF +I G++T ++K FR T+Q      G+ + W LEYEK +D
Sbjct  67   ARIAKEIIEHVDEENNSITFKVIEGDLTEHYKDFRLTIQCIPKEKGSVIHWILEYEKLHD  126

Query  405  NVPTPHSHVEFLMNVAREVDEYL  473
             +P  H+ ++F + V++++D  L
Sbjct  127  QIPDSHTLLQFCVEVSQDIDSML  149



>ref|XP_003631204.1| PREDICTED: MLP-like protein 34 [Vitis vinifera]
Length=151

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 86/151 (57%), Gaps = 5/151 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M  + KL+ ET I +P+ KF +++      +  +CP KI+ V L EG+  + G V  W Y
Sbjct  1    MGLVGKLQAETLIVAPADKFHEMFSCRPHHISNVCPEKIQKVNLHEGEWGTSGYVIEWNY  60

Query  225  ILGGN-VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEY  389
             + GN  +AK  ++  D EN+S+T+  I G++   +KSF   +Q         V WTLEY
Sbjct  61   NIDGNDHVAKQIVEITDGENKSITYKFIEGDLLKKYKSFIIVVQTIPKGDATWVHWTLEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            EK N ++PTP   +EFL+ V   VD++L++ 
Sbjct  121  EKLNKDIPTPIKELEFLVLVGEGVDDHLVQA  151



>ref|XP_004147647.1| PREDICTED: MLP-like protein 34-like [Cucumis sativus]
 ref|XP_004171074.1| PREDICTED: MLP-like protein 28-like [Cucumis sativus]
 gb|KGN57229.1| hypothetical protein Csa_3G171860 [Cucumis sativus]
Length=154

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 92/145 (63%), Gaps = 5/145 (3%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE +  I++P+ KF ++   N   L  I   K++S +L EG+   VGS+  W Y+  G 
Sbjct  7    KLETDVVIEAPAWKFHEMLHRNPHHLSNIAADKVQSCELHEGEWGKVGSIIFWNYVHDGK  66

Query  240  -VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEYEKAND  404
              +AKD I+AVDEEN S T+ +I G++ +++K+FR T+Q+     G+ + +TL YEK ++
Sbjct  67   ACVAKDVIEAVDEENNSFTWKVIEGDLLDHYKNFRVTIQSIPKDKGSVIHYTLNYEKLHE  126

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
            ++   H+ ++  +++++ +D +L+K
Sbjct  127  DIEDSHTLLDLCVSISKAIDAHLMK  151



>ref|XP_009591453.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like [Nicotiana 
tomentosiformis]
Length=299

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 86/146 (59%), Gaps = 5/146 (3%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE + +IKS    F +I+      +  +C  KI++V + EG+  +VGSV  W Y+  G 
Sbjct  152  KLESQIEIKSDGDVFHEIFRYRPHHISTMCSDKIQNVDIHEGEWGTVGSVLFWNYVHDGK  211

Query  240  -VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAND  404
              +AK+ I+ +DEE + V F +IGG++   +KSF  T+    +   N V W LEYEK N 
Sbjct  212  EKVAKEIIEVIDEEKKLVKFKVIGGDLLETYKSFYLTVHVETKGESNLVTWILEYEKQNS  271

Query  405  NVPTPHSHVEFLMNVAREVDEYLLKT  482
             VP PH+ +EF +NV ++++ + LK 
Sbjct  272  KVPDPHTLMEFCLNVTKDIETHHLKC  297


 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 84/144 (58%), Gaps = 5/144 (3%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KL  E  IKS    F +I+      +  + P KI++V + EG+  +VGSV  W +   G 
Sbjct  6    KLVSEINIKSCGDVFHEIFRYRPHHISSMSPDKIQNVDIHEGEWGTVGSVIFWNFTHDGK  65

Query  240  -VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAND  404
              +AK+ I+ +DEE + V F +IGG++ +++KS   T+    +   N V W L+YEK N 
Sbjct  66   EKVAKEIIEEIDEEKKLVKFKVIGGDLLDFYKSVYLTVHVETKGEDNLVTWILDYEKLNP  125

Query  405  NVPTPHSHVEFLMNVAREVDEYLL  476
            ++P PH+ +EF +NV ++++ + L
Sbjct  126  DIPDPHTLMEFCLNVTKDIETHHL  149



>ref|XP_002888798.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65057.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata]
Length=171

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 87/146 (60%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE + +IK+ + KF  ++      + K  P KI+  +L EG+   VGS+  W Y+  G 
Sbjct  23   KLETDVEIKASAGKFHHMFAGRPHHVSKATPGKIQGCELHEGEWGKVGSIVFWNYVHDGE  82

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W +EYEK 
Sbjct  83   AKVAKERIEAVEPEKNLITFRVIEGDLLKEYKSFVITIQVTLKRGGPGSVVHWHVEYEKI  142

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            +D V  P + ++F + V++E+DE+LL
Sbjct  143  DDKVAHPETFLDFCVQVSKEIDEHLL  168



>ref|NP_565003.3| MLP-like protein 34 [Arabidopsis thaliana]
 gb|AEE35128.1| MLP-like protein 34 [Arabidopsis thaliana]
Length=236

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 88/148 (59%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE E +IK+ + +F  ++      + K  P  I+S  L EGD  +VGS+  W Y+  
Sbjct  10   VGKLETEVEIKASAGQFHHMFAGKPHHVSKASPGNIQSCDLHEGDWGTVGSIVFWNYVHD  69

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W LEYE
Sbjct  70   GEAKVAKERIEAVEPEKNLITFRVIEGDLMKEYKSFLITIQVTPKHGGPGSIVHWHLEYE  129

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K +D V  P + ++F + V++E+DE+LL
Sbjct  130  KISDEVAHPETLLQFCVEVSQEIDEHLL  157



>ref|XP_006303389.1| hypothetical protein CARUB_v10010538mg [Capsella rubella]
 gb|EOA36287.1| hypothetical protein CARUB_v10010538mg [Capsella rubella]
Length=155

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 91/145 (63%), Gaps = 6/145 (4%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            L  E ++KSP++KF+    +  +L PK  P   +++Q+L GDG + GS+RL  Y  G  +
Sbjct  7    LHVEVEVKSPAEKFWIALGDCINLFPKAFPHDYKTIQVLAGDGNAPGSIRLIIYGEGSPL  66

Query  243  --IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEYEKAND  404
              ++ ++I+ VD E +S+++++IGGE+  Y+K+F+ T+  +    G+ +KW+ E+EK   
Sbjct  67   VKVSAERIEEVDLEKKSMSYSIIGGEMLEYYKTFKGTITVTPKDGGSLLKWSGEFEKTAH  126

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
             +  PH   +F +   +E+DEYLLK
Sbjct  127  EIDDPHVIKDFAVKNFKEIDEYLLK  151



>ref|XP_006301425.1| hypothetical protein CARUB_v10021843mg, partial [Capsella rubella]
 gb|EOA34323.1| hypothetical protein CARUB_v10021843mg, partial [Capsella rubella]
Length=157

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 87/148 (59%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE E +IK+ + KF  +++     + K  P  I S  L EGD   VGS+ +W Y+  
Sbjct  7    VGKLETEVEIKASAGKFHHMFVGKPHHVSKASPENILSCDLHEGDWGKVGSIVIWNYVHD  66

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I G++   +KSF  T+Q       SG+ V W LEYE
Sbjct  67   GETKVAKERIEAVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKQGGSGSIVHWHLEYE  126

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K +D V  P + ++F ++V+ ++D +LL
Sbjct  127  KISDEVAHPETLLQFCIDVSNQIDAHLL  154



>ref|XP_010100504.1| MLP-like protein 423 [Morus notabilis]
 gb|EXB82638.1| MLP-like protein 423 [Morus notabilis]
Length=156

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 91/146 (62%), Gaps = 6/146 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KL  E ++KS + K ++   +   + PK  P   +SV++LEGDG  VGSVRL TY  G  
Sbjct  9    KLNVEVEVKSNADKVWEALRDFIFIFPKAFPNDYKSVEVLEGDGIVVGSVRLITYGEGSP  68

Query  240  V--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAN  401
            +  ++K+KI+ VD +N++ ++ +I G++  Y+KSF+A +    +  G+ VKW+ EYEKA+
Sbjct  69   IVKVSKEKIEVVDPQNKTFSYNIIDGDLLKYYKSFKAHVTVVPKEEGSLVKWSCEYEKAS  128

Query  402  DNVPTPHSHVEFLMNVAREVDEYLLK  479
            + +P P    EF     +E+D+YL K
Sbjct  129  EEIPDPSLIKEFAEKNFKELDDYLAK  154



>emb|CDX91696.1| BnaC08g06150D [Brassica napus]
Length=157

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 87/146 (60%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            +LE E +IKSP++KF+ +Y      + K  P  +++  L +G+   VGS+  W Y+  G 
Sbjct  9    ELEVEVEIKSPAEKFYHMYAGRPHHVAKSTPRNVQACDLHDGEWGEVGSIIFWNYVHDGQ  68

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              +AK++I+ V+ E + V F ++ G++   FKSF  T+Q +      G+ VKW  EYEK 
Sbjct  69   ARVAKERIEVVEPEKKIVKFRVLEGDLMEEFKSFVITIQVTPKQGGNGSIVKWHFEYEKI  128

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            ++N+  P + + F  ++ +E+DE+LL
Sbjct  129  DENISHPETLLPFFADMIKEIDEHLL  154



>gb|ACH72969.1| major latex-like protein [Panax ginseng]
Length=151

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 90/149 (60%), Gaps = 5/149 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M    KL  +T IKS    F +++      +P I PA I+   L EG+   VGSV +W Y
Sbjct  1    MGLTGKLICQTGIKSDGDVFHELFGTRPHHVPNITPANIQGCDLHEGEFGKVGSVVIWNY  60

Query  225  ILGGN-VIAKDKIDAVDEENRSVTFALIGGEVTNYFKS--FRATLQASG--NSVKWTLEY  389
             + GN +IAK++I A+DEE++SVTF ++ G +   FKS  F   +   G  N V W+++Y
Sbjct  61   SIDGNAMIAKEEIVAIDEEDKSVTFKVVEGHLFEEFKSIVFSVHVDTKGEDNLVTWSIDY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            EK N++V  P S+++FL++V R+++ + L
Sbjct  121  EKLNESVKDPTSYLDFLLSVTRDIEAHHL  149



>gb|KDP20178.1| hypothetical protein JCGZ_00008 [Jatropha curcas]
 gb|KDP38069.1| hypothetical protein JCGZ_04712 [Jatropha curcas]
 gb|KDP38070.1| hypothetical protein JCGZ_04713 [Jatropha curcas]
Length=148

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 88/141 (62%), Gaps = 2/141 (1%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            +LE E Q+K   ++FF ++ N++  +P   P+ ++ V+L EGD ++ G +++W Y + G 
Sbjct  8    QLEAEVQLKCSPEQFFSVWKNDAQQVPNHTPSNVQGVKLHEGDWETSGCIKIWDYTIEGK  67

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASGNSVKWTLEYEKANDNVPT  416
              + K+K++ +DE N+ V    + G+V   +K +       GN  K T+EYEK NDNVP 
Sbjct  68   PGVFKEKVE-LDEANKIVKLIGLEGDVFEIYKVYNCIWHLKGNLAKVTIEYEKLNDNVPA  126

Query  417  PHSHVEFLMNVAREVDEYLLK  479
            PH +++FL+++ +++D  L+K
Sbjct  127  PHIYLDFLVSMTKDIDASLVK  147



>ref|XP_002862769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39027.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 87/146 (60%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE + +IK+ + KF  ++      + K  P  I+S  L EGD  +VGS+  W Y+  G 
Sbjct  25   KLETDVEIKASADKFHHMFAGKPHHVSKASPGNIQSCDLHEGDWGTVGSIIFWNYVHDGE  84

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W LEYEK 
Sbjct  85   AKVAKERIEAVEPEKNLITFRVIDGDLMKEYKSFLLTIQVTPKPGGPGSIVHWHLEYEKI  144

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            +D V  P + ++F + V++E+DE+LL
Sbjct  145  SDEVAHPETLLQFCVEVSKEIDEHLL  170



>ref|XP_010427894.1| PREDICTED: MLP-like protein 43 [Camelina sativa]
Length=158

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 84/148 (57%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE E +IK+ + KF  ++      + K  P KI    L EGD   VGS+ +W Y++ 
Sbjct  8    VGKLETEVEIKASASKFHHMFAERPHHVSKATPDKIHGCDLHEGDWGKVGSIVIWNYVID  67

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYE  392
            G   + KD I+AV+ E   + F +I G++   +KSF  T+Q       SG+ V W  EYE
Sbjct  68   GKASMVKDMIEAVEPEKNLIKFKVIEGDLMKEYKSFFVTIQVTPKHGGSGSVVHWLFEYE  127

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K N+ V  P + ++F + +++E+DE+LL
Sbjct  128  KINEEVAHPENLLQFAVGMSKEIDEHLL  155



>gb|ABK96619.1| unknown [Populus trichocarpa x Populus deltoides]
Length=150

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 92/151 (61%), Gaps = 6/151 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   KLE   ++K  + KFF++    +  +P     +I ++++ EGD  + GSV+LWTY
Sbjct  1    MALAGKLEINFELKCSADKFFEVLSRQAHQIPNASSGEIHAIEVHEGDWVATGSVKLWTY  60

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEY  389
             + G   + K+K++ VDE N+SV+   +GG V   +KS++ TL+    A G  VK  L+Y
Sbjct  61   TIDGKPEVFKEKVE-VDEVNKSVSLIAVGGHVLEQYKSYKITLKTVSMAEGGVVKILLDY  119

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            EK   + P P+ +++F++ V +++DE+L+K 
Sbjct  120  EKLKPDDPPPNKYLDFVIKVVKDIDEHLVKA  150



>ref|XP_007045185.1| MLP-like protein 28 [Theobroma cacao]
 gb|EOY01017.1| MLP-like protein 28 [Theobroma cacao]
Length=156

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 90/147 (61%), Gaps = 7/147 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE + +IK+ ++KF D++ N    + K    KI+   L +GD  +VGS+  W+Y+  G 
Sbjct  8    KLEADVEIKASAEKFHDMFCNRPHHVSKASSDKIQGCDLHDGDWGTVGSIVYWSYVHDGE  67

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
               AK+ ++A+D EN S+TF +I G++   +KSF   +QA+      G+ V WT EYEK 
Sbjct  68   AKKAKELVEAIDSENNSITFRVIEGDLMKEYKSFVIKIQATPKREGEGSIVHWTFEYEKL  127

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLLK  479
            ++ +  P + +EF + V++++D +L++
Sbjct  128  HEGIAHPETLLEFAVQVSKDMDTHLIQ  154



>ref|XP_004140475.1| PREDICTED: MLP-like protein 28-like [Cucumis sativus]
 ref|XP_004161192.1| PREDICTED: MLP-like protein 28-like [Cucumis sativus]
Length=152

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 89/148 (60%), Gaps = 5/148 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M+ + KLE + +I++P+ KF ++       + K    K++S +L EGD   VGS+  W Y
Sbjct  1    MSVLRKLEADVEIEAPASKFHELLHKRLHHVSKASGDKVQSCELHEGDWGKVGSIIYWNY  60

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEY  389
               G   + KD I+AVDEEN  ++F +I G++   +K+F  T+QA     G+ + WT+EY
Sbjct  61   FHDGKAKVGKDVIEAVDEENNLISFKVIDGDLLKDYKTFNYTIQAVPKGKGSVIHWTMEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYL  473
            EK ++ V   HS ++F + +++++D +L
Sbjct  121  EKLHEKVADSHSMLQFCLAISKDIDVHL  148



>ref|XP_004290369.1| PREDICTED: MLP-like protein 43-like [Fragaria vesca subsp. vesca]
Length=155

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 86/144 (60%), Gaps = 6/144 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGG-  236
            KLE E +I +P+ K+ +++      L  I P +I+S +LLEG     GSV  W Y   G 
Sbjct  8    KLETEVEINAPAAKYHELFTRRPHHLSSIRPDRIQSCELLEGQWGRQGSVIYWNYCYDGK  67

Query  237  NVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFR----ATLQASGNS-VKWTLEYEKAN  401
              +A D I+AVD+E  SVTF +I G +  ++KSFR    AT +  GNS V   +EYEK +
Sbjct  68   TTVATDLIEAVDDEKNSVTFKVIDGPLLEHYKSFRLIVEATPKGDGNSLVHLAVEYEKLH  127

Query  402  DNVPTPHSHVEFLMNVAREVDEYL  473
            D V  PHS ++F+ ++++++  +L
Sbjct  128  DQVSDPHSLLQFVADLSKDMGAHL  151



>ref|XP_006367897.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=150

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 82/145 (57%), Gaps = 5/145 (3%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KL  E  IK     F  I +     +  ICP KI+ V + EG+  ++ SVRLW +   G 
Sbjct  6    KLVSEINIKCDGDVFHQIIMYKPHHMCNICPDKIQKVDIHEGELGTIDSVRLWKFTHDGK  65

Query  240  -VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAND  404
             ++AK+ I+ +D+E + V   +I G++  Y+KSF  T+    +   N V W LEYEK N 
Sbjct  66   EMVAKEVIEEIDDEKKLVKKKMIEGDMLEYYKSFYLTIHVETKGENNLVTWILEYEKKNA  125

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
            NVP PH+ +E  +N+ ++++ Y +K
Sbjct  126  NVPDPHTFMELCINITKDIESYHIK  150



>ref|XP_009798271.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=151

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 82/142 (58%), Gaps = 5/142 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KL  + +IK     F +++ +    LP + P KI++V L EGD  +VGSV  W Y + G 
Sbjct  6    KLISQIEIKGCGDLFHEMFRHKPHHLPNVTPDKIQAVDLHEGDWGTVGSVVNWNYTIEGQ  65

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAND  404
              + K  ++A+DEE R VTF+   G +   +K+F+AT+    +   N V WT+EYEK ND
Sbjct  66   TKVVKVVVEAIDEEKRLVTFSAFEGHLIEQYKTFKATVHIENEGENNLVLWTIEYEKQND  125

Query  405  NVPTPHSHVEFLMNVAREVDEY  470
             V  P  ++EF  N+ +EVD +
Sbjct  126  EVSEPFCYLEFATNLTKEVDAH  147



>ref|XP_006300911.1| hypothetical protein CARUB_v10021281mg [Capsella rubella]
 gb|EOA33809.1| hypothetical protein CARUB_v10021281mg [Capsella rubella]
Length=160

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 87/148 (59%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE E +IK+ ++KF  +++     + K  P  + S  L EGD   VGS+  W Y+  
Sbjct  10   VGKLETEVEIKASAEKFHQMFVGKPHQVSKASPDNMLSCDLHEGDWGKVGSIVFWNYVHD  69

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I G++   +KSF  T+Q       SG+ V W LEYE
Sbjct  70   GETKVAKERIEAVEPEKNLITFKVIDGDLMKEYKSFLLTIQVTPKQGGSGSIVHWHLEYE  129

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K +D V  P + ++F ++V+ ++D +LL
Sbjct  130  KISDEVAHPETLLQFCIDVSNQIDAHLL  157



>ref|XP_003589655.1| MLP-like protein [Medicago truncatula]
 gb|AES59906.1| pathogenesis-related protein bet V I family protein [Medicago 
truncatula]
Length=147

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 87/146 (60%), Gaps = 1/146 (1%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLP-KICPAKIRSVQLLEGDGKSVGSVRLWT  221
            MAQI  LE   Q+KS  +KFF+   + S  +P K     +  V++ +GD K+ GSV++W 
Sbjct  1    MAQICVLEASVQLKSCPQKFFNFLKSQSQHIPNKAQSENVHGVEIHKGDWKTPGSVKIWK  60

Query  222  YILGGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASGNSVKWTLEYEKAN  401
            Y + G     ++   VDE N+++T+  +GG V   +K+++A +     ++K  +EYEK N
Sbjct  61   YSIEGKEETFNERIEVDEVNKTITYVAVGGNVLELYKNYKAIVNVENGNLKLRIEYEKLN  120

Query  402  DNVPTPHSHVEFLMNVAREVDEYLLK  479
            DN P P  + +F++N+ R++D  L+K
Sbjct  121  DNTPPPKKYQQFIVNIVRDLDGNLVK  146



>ref|NP_198152.1| SRPBCC ligand-binding domain-containing protein [Arabidopsis 
thaliana]
 emb|CAC83584.1| major latex-like protein [Arabidopsis thaliana]
 gb|AED93757.1| SRPBCC ligand-binding domain-containing protein [Arabidopsis 
thaliana]
Length=164

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 91/151 (60%), Gaps = 8/151 (5%)
 Frame = +3

Query  48   AQIW-KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            + +W ++E E  IKSP++KF+ +Y+     + K   +K+++  LLEG+  ++ S+  W Y
Sbjct  11   SSLWGEVEVEVDIKSPAEKFYQVYVGRPDHVAKATSSKVQACDLLEGEWGTISSIVNWNY  70

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTL  383
            +  G   +AK++I+ V+ E + + F +I G+V   +K+F  T+  +      G+  KW L
Sbjct  71   VYAGKAKVAKERIELVEPEKKLIKFRVIEGDVLAVYKNFFITISVTPKEGGVGSVAKWHL  130

Query  384  EYEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            EYEK + NVP P + + FL  + +E+DE+LL
Sbjct  131  EYEKNDVNVPDPENFLPFLAEMTKEIDEHLL  161



>ref|XP_006469314.1| PREDICTED: MLP-like protein 28-like [Citrus sinensis]
Length=301

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 95/150 (63%), Gaps = 6/150 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA + K+E E +IKSP+ KF++ + + +  +P +    +  V++ EGD +  GSV+ WT+
Sbjct  149  MALVGKMETEVEIKSPADKFYNTFSSKAHTVPNMSLGNLHGVEVHEGDWERHGSVKSWTF  208

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEY  389
               G V   K+K++ +D EN++VT  +I G++  +FKS++  +    ++ G+ VKW  EY
Sbjct  209  SADGTVEKMKEKVE-LDPENKTVTMVVIEGDLMKHFKSYKVIIKVIPKSEGSLVKWIWEY  267

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            EK  ++ PTP  +V+F+ ++ + +D +LLK
Sbjct  268  EKLQEDGPTPSKYVDFVTDLTKNIDAHLLK  297


 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 86/146 (59%), Gaps = 9/146 (6%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA + K+E + +I+ P++KF+ I+   S  +P   PA I++V + EG+    GSV+LWTY
Sbjct  1    MALVGKIEKQIEIEVPAEKFYHIWKKQSYHVPTASPANIKAVDVHEGEWHHHGSVKLWTY  60

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS-------GNSVKWT  380
             + G     K+K++  D+ N SVT   + G+V  +FKS+    + S       G+    +
Sbjct  61   SVEGRTETFKEKVEH-DDANMSVTLIGLEGDVFKHFKSWLPVYKVSPKGDGSAGSIATCS  119

Query  381  LEYEKANDNVPTPHSHVEFLMNVARE  458
            + YEK N NVP P ++V+F++++ ++
Sbjct  120  IAYEKLNANVPDPVAYVDFMVSITKD  145



>emb|CDY65619.1| BnaAnng20750D [Brassica napus]
Length=164

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 87/149 (58%), Gaps = 8/149 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE E +IK+ + KF  ++      + K  P  I+   L EGD   VGS+  W YI G
Sbjct  13   VGKLETEVEIKASAGKFHHMFAGRPHHVSKASPGNIQGCDLHEGDWGKVGSIVYWNYIHG  72

Query  234  G--NVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEY  389
               + +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W LEY
Sbjct  73   NVLSSVAKERIEAVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKHGGPGSIVHWHLEY  132

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            EK ++ V  P + ++F + V++E+DE+LL
Sbjct  133  EKISEEVAHPETLLQFCVEVSKEIDEHLL  161



>ref|NP_850976.1| MLP-like protein 34 [Arabidopsis thaliana]
 ref|NP_001031265.1| MLP-like protein 34 [Arabidopsis thaliana]
 sp|Q9SSK7.1|MLP34_ARATH RecName: Full=MLP-like protein 34 [Arabidopsis thaliana]
 gb|AAD55503.1|AC008148_13 Unknown protein [Arabidopsis thaliana]
 gb|AAK49615.1|AF372899_1 At1g70850/F15H11_10 [Arabidopsis thaliana]
 emb|CAC83579.1| major latex-like protein [Arabidopsis thaliana]
 gb|AAL15356.1| At1g70850/F15H11_10 [Arabidopsis thaliana]
 dbj|BAF02039.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35127.1| MLP-like protein 34 [Arabidopsis thaliana]
 gb|AEE35129.1| MLP-like protein 34 [Arabidopsis thaliana]
Length=316

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 88/148 (59%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE E +IK+ + +F  ++      + K  P  I+S  L EGD  +VGS+  W Y+  
Sbjct  10   VGKLETEVEIKASAGQFHHMFAGKPHHVSKASPGNIQSCDLHEGDWGTVGSIVFWNYVHD  69

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W LEYE
Sbjct  70   GEAKVAKERIEAVEPEKNLITFRVIEGDLMKEYKSFLITIQVTPKHGGPGSIVHWHLEYE  129

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K +D V  P + ++F + V++E+DE+LL
Sbjct  130  KISDEVAHPETLLQFCVEVSQEIDEHLL  157


 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 82/139 (59%), Gaps = 7/139 (5%)
 Frame = +3

Query  81   IKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV-IAKDK  257
            IK+ ++KF  ++      + K  P  I+S  L EGD  +VGS+  W Y+  G   +AK++
Sbjct  175  IKASAEKFHHMFAGKPHHVSKATPGNIQSCDLHEGDWGTVGSIVFWNYVHDGEAKVAKER  234

Query  258  IDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYEKANDNVPTP  419
            I+AVD E   +TF +I G++   +KSF  T+Q       SG+ V W  EYEK N+ V  P
Sbjct  235  IEAVDPEKNLITFRVIEGDLMKEYKSFVITIQVTPKHGGSGSVVHWHFEYEKINEEVAHP  294

Query  420  HSHVEFLMNVAREVDEYLL  476
             + ++F + V++E+DE+LL
Sbjct  295  ETLLQFAVEVSKEIDEHLL  313



>ref|XP_011038618.1| PREDICTED: MLP-like protein 43 [Populus euphratica]
Length=158

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 93/150 (62%), Gaps = 6/150 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M    K+E E +IK  ++ F DI+      +P + PAKI++V L EG+    G+V  W+Y
Sbjct  1    MTLFGKMEAEVEIKVSAETFHDIFSCRPHHIPNMSPAKIKNVDLHEGEWGKPGTVISWSY  60

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSF----RATLQASGNSV-KWTLE  386
            +  G    AKD I+A+D+E  S T+ +I G++T  +K+F    +AT +  G+ +  +TLE
Sbjct  61   VHDGVAKTAKDVIEAIDDEKLSTTYKVIEGDITTEYKNFIVIVQATPKGEGSCLAHFTLE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            YEK N+NVP P + +EF ++ +++++++ L
Sbjct  121  YEKLNENVPDPQTLLEFCIHFSKDIEDHHL  150



>gb|KDP44595.1| hypothetical protein JCGZ_22177 [Jatropha curcas]
Length=151

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 90/150 (60%), Gaps = 5/150 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M+   KLE + +IK+ + KF D++ +    L    P  ++  +L +G+    GSV  W Y
Sbjct  1    MSLTGKLEADVEIKASADKFHDVFGSRPHHLKHATPHNVQGCELHDGEFGKEGSVVCWNY  60

Query  225  ILGG-NVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEY  389
            +  G   +AKD ++ +D  N   T+ +I G++   +KSF+ T++A+    G+ V+WTL+Y
Sbjct  61   VHDGVPKVAKDIVEKIDNVNLFTTYKVIEGDILKEYKSFKFTVKATPKDTGSVVRWTLDY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            EK N N+P PHS ++ L+ +++++D +L K
Sbjct  121  EKLNKNIPDPHSILQLLIEISKDIDAHLTK  150



>ref|XP_009127830.1| PREDICTED: MLP-like protein 34 [Brassica rapa]
Length=163

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 86/148 (58%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE E +IK+ + KF  ++      + K  P  I+   L EGD   VGS+  W Y+  
Sbjct  13   VGKLETEVEIKASAGKFHHMFAGRPHHVSKASPGNIQGCDLHEGDWGKVGSIVYWNYVHD  72

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W LEYE
Sbjct  73   GEAKVAKERIEAVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKHGGPGSIVHWHLEYE  132

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K ++ V  P + ++F + V++E+DE+LL
Sbjct  133  KISEEVAHPETLLQFCVEVSKEIDEHLL  160



>ref|XP_007223651.1| hypothetical protein PRUPE_ppa012742mg [Prunus persica]
 ref|XP_008243382.1| PREDICTED: MLP-like protein 31 [Prunus mume]
 gb|AAK14060.1|AF239177_1 major latex-like protein [Prunus persica]
 gb|EMJ24850.1| hypothetical protein PRUPE_ppa012742mg [Prunus persica]
Length=156

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 89/145 (61%), Gaps = 7/145 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E + +IK+P+ KF +++ +    +  +    I+   L EG+  +VGSV  W Y   G 
Sbjct  7    KVETDVEIKAPATKFHEVFTHRPHHISNVSSNNIQGCDLHEGEWGTVGSVVYWNYFHDGK  66

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              +AK+ I+A+D E   +TF +I G++  ++KSF+ T+ A+      G+ V WT+EYEK 
Sbjct  67   AKVAKELIEAIDAEKNLITFKVIEGDLLEHYKSFKITIHATPKAHGQGSIVHWTMEYEKH  126

Query  399  NDNVPTPHSHVEFLMNVAREVDEYL  473
            + ++  PH+ ++F ++V+++VD +L
Sbjct  127  HGDIEDPHTLLQFAVDVSKDVDAHL  151



>ref|XP_010415784.1| PREDICTED: MLP-like protein 43 [Camelina sativa]
Length=158

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 86/148 (58%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE E +IK+ + KF  +++     + K  P KI   +L EG+   VGS+ +W Y+  
Sbjct  8    VGKLETEVEIKASAGKFHHMFVERPHHVSKATPDKIHGCELHEGEWGKVGSIVIWNYVFD  67

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA------SGNSVKWTLEYE  392
            G   + KD+I+AV+ E   + F +I G++   +KSF  T+Q       SG+ V W  EYE
Sbjct  68   GKARMVKDRIEAVEPEKNLIKFRVIEGDLMEEYKSFFVTIQVTPKHGESGSVVHWHFEYE  127

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K N+ V  P + ++F + +++E+DE+LL
Sbjct  128  KINEEVVHPENLLQFAVGMSKEIDEHLL  155



>ref|XP_002888797.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65056.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata]
Length=335

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 87/146 (60%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE + +IK+ + KF  ++      + K  P  I+S  L EGD  +VGS+  W Y+  G 
Sbjct  25   KLETDVEIKASADKFHHMFAGKPHHVSKASPGNIQSCDLHEGDWGTVGSIIFWNYVHDGE  84

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W LEYEK 
Sbjct  85   AKVAKERIEAVEPEKNLITFRVIDGDLMKEYKSFLLTIQVTPKPGGPGSIVHWHLEYEKI  144

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            +D V  P + ++F + V++E+DE+LL
Sbjct  145  SDEVAHPETLLQFCVEVSKEIDEHLL  170


 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 87/148 (59%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IKS ++KF  ++      + K  P  I+   L EGD   VGS+  W Y+  
Sbjct  185  VGKLETDVEIKSSAEKFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGKVGSIVFWNYVHD  244

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ +   +TF +I G++   +KSF  T+Q +      G+ V W LEYE
Sbjct  245  GEAKVAKERIEAVEPDKNLITFRVIDGDLMKEYKSFVITIQVTPKHGGLGSIVHWHLEYE  304

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K ++ V  P + ++F + V++E+DE+LL
Sbjct  305  KISEEVAHPETLLQFCVEVSKEIDEHLL  332



>ref|XP_009351485.1| PREDICTED: MLP-like protein 328 isoform X1 [Pyrus x bretschneideri]
Length=173

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 89/146 (61%), Gaps = 8/146 (5%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            LE E +IK+ + K +    N     PK    KI  V + EGD ++ GSV+LW Y + GNV
Sbjct  28   LEAEVEIKANADKLYKFISNQHYEFPKAASDKIHDVTVHEGDWETSGSVKLWKYTIDGNV  87

Query  243  -IAKDKIDAVDEENRSVTF-ALIGGEVTNYFKSFRATLQ-----ASGNSVKWTLEYEKAN  401
               K+K++ +DE N+ V+  AL G  V + +KS++ T Q     + G+SVK TLEYEK +
Sbjct  88   ETYKEKVE-IDEANKRVSLEALEGSHVLDNYKSYKVTYQVIAPNSEGSSVKITLEYEKLS  146

Query  402  DNVPTPHSHVEFLMNVAREVDEYLLK  479
            +N P P  ++ F++NV ++VD +LLK
Sbjct  147  ENDPPPQKYLSFVVNVIKDVDAHLLK  172



>ref|XP_010471086.1| PREDICTED: MLP-like protein 34 [Camelina sativa]
Length=341

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 88/148 (59%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IK+ ++KF  ++      + K  P  I+   L EGD  +VGS+  W Y+  
Sbjct  191  VGKLETDVEIKASAEKFHHMFTGKPHHVSKASPGNIQGCDLHEGDWGTVGSIIFWNYVHD  250

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W LEYE
Sbjct  251  GEAKVAKERIEAVEPEKNLITFRVIDGDLMKEYKSFLLTIQVTPKQGGPGSIVHWHLEYE  310

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K N+ V  P + ++F + V++E+DE+LL
Sbjct  311  KINEEVAHPETLLQFCVEVSKEIDEHLL  338


 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 86/148 (58%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IK+ + +F  ++      + K  P  I+   L EGD   VGS+  W Y+  
Sbjct  24   VGKLETDVEIKASAGQFHHMFAGKPHHVSKASPRNIQGCDLHEGDWGKVGSIVYWNYVHD  83

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I GE+   +KSF  T+Q +      G+ V W LEYE
Sbjct  84   GEAKVAKERIEAVEPEKNLITFRVIEGELMKEYKSFLLTIQVTPKQGGPGSIVHWHLEYE  143

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K ++ V  P + ++F + V++E+DE+LL
Sbjct  144  KISNEVAHPETLLQFCVEVSKEIDEHLL  171



>ref|XP_007149098.1| hypothetical protein PHAVU_005G041000g [Phaseolus vulgaris]
 gb|ESW21092.1| hypothetical protein PHAVU_005G041000g [Phaseolus vulgaris]
Length=155

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 89/149 (60%), Gaps = 5/149 (3%)
 Frame = +3

Query  48   AQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYI  227
            +Q+ K+E    I + +++F D+  + +  +  + P KI+SV++L+G+  + GS+  W+Y+
Sbjct  4    SQVQKVEANVHIMASAEEFHDVLCSKTHHITNMSPQKIKSVEILKGEWGTEGSIISWSYV  63

Query  228  LGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEYE  392
            L G   ++ + ++ +D+EN  V F +I G++  ++KS +  +QA+    G+ V W  EYE
Sbjct  64   LDGKASVSNNVVEGIDKENHKVNFKVIDGDILKHYKSCKFIVQATPMEKGSVVNWVAEYE  123

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            K N N P PH+ +E    + +E+  YL +
Sbjct  124  KQNANTPNPHNLLELATEMTKEIGAYLTQ  152



>emb|CDY09495.1| BnaC02g20370D [Brassica napus]
Length=158

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 89/148 (60%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IK+ + KF  ++      + K  P  I++ +L EG+   VGSV +W Y + 
Sbjct  8    VGKLETDVEIKASAGKFHHMFAGRPHHVSKATPGNIQNCELHEGNWGKVGSVVIWNYSMN  67

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++++AV+ E   +TF ++ G++   +KSF  T+Q +      G+ V W LEYE
Sbjct  68   GEAKVAKERVEAVEPEKNLITFRVVEGDLMKEYKSFVITIQVTPKHGGPGSVVHWHLEYE  127

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K +D V  P + ++F + +++E+DE+LL
Sbjct  128  KISDEVAHPETLLQFCVEISKEIDEHLL  155



>ref|WP_039311068.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
 gb|KHL91155.1| hypothetical protein QW71_36290 [Paenibacillus sp. IHB B 3415]
Length=151

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 90/149 (60%), Gaps = 6/149 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M    KLE E ++KS  +KF+     +++L PK  P + + + ++EGDG SVGSVRL  Y
Sbjct  1    MGSTGKLEVEVELKSKPEKFWHGIRESTTLFPKAMPEEYKRIDVVEGDGFSVGSVRLVHY  60

Query  225  ILGGNV--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLE  386
              G  +  +  +KI+AVDE   +  +++I G++  ++K+F+A L    +  G+ VKW  E
Sbjct  61   GEGSPLVKVTHEKIEAVDEAKMTYAYSVIDGDLLKFYKNFKAFLVVEPKGDGSLVKWACE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYL  473
            +EKA+D +P P+   +F +   +++D YL
Sbjct  121  FEKASDEIPDPNIIRDFAVKSFKDLDSYL  149



>ref|XP_006303112.1| hypothetical protein CARUB_v100206590mg, partial [Capsella rubella]
 gb|EOA36010.1| hypothetical protein CARUB_v100206590mg, partial [Capsella rubella]
Length=241

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 87/146 (60%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE + +IK+ ++KF  ++      +PK  P  ++   L EGD   VGS+ LW Y   G 
Sbjct  10   KLEADVEIKASAEKFHHMWSGKPHHVPKATPGNVQDCVLQEGDWGKVGSIYLWNYTHDGE  69

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              +AK++I+AV+ E   +TF ++ G++   +KSF  T+Q +      G+ V W LEYEK 
Sbjct  70   AKVAKERIEAVELEKNLITFRVLDGDLMKEYKSFVITIQVTNKHGEPGSIVHWHLEYEKI  129

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            +D V  P + ++F + V++E+DE+LL
Sbjct  130  SDAVAHPETLLQFCVEVSKEIDEHLL  155



>ref|NP_001238700.1| uncharacterized protein LOC100305916 [Glycine max]
 gb|ACU13827.1| unknown [Glycine max]
Length=155

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 91/149 (61%), Gaps = 5/149 (3%)
 Frame = +3

Query  48   AQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYI  227
            +Q+ K+    QIK+ +++F+D++ N    +  I P  I+SV++ +G+    GS+  W Y+
Sbjct  4    SQLQKVGTSLQIKASAEQFYDVFCNKPHTIANISPENIQSVEVHKGEWGKEGSIVSWNYL  63

Query  228  LGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEYE  392
              G V +AK  ++ +D+EN  +T  +I G+V   +KSF++ LQ +    G+ V W +EYE
Sbjct  64   HEGTVCVAKQVLEGIDKENNKMTMKVIEGDVLGLYKSFKSNLQVTPKGKGSVVLWAMEYE  123

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            K  D++P  H+ ++  + V++++D YL +
Sbjct  124  KQEDHIPDAHTLLQLAVVVSKKIDAYLTQ  152



>emb|CDY03715.1| BnaA02g15220D [Brassica napus]
Length=164

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 87/149 (58%), Gaps = 8/149 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE E +IK+ + KF  ++      + K  P  I+   L EGD   VGS+  W Y+ G
Sbjct  13   VGKLETEVEIKASAGKFHHMFAGRPHHVSKASPGNIQGCDLHEGDWGKVGSIVYWNYVHG  72

Query  234  G--NVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEY  389
               + +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W LEY
Sbjct  73   NVLSSVAKERIEAVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKHGGPGSIVHWHLEY  132

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            EK ++ V  P + ++F + V++E+DE+LL
Sbjct  133  EKISEEVAHPETLLQFCVEVSKEIDEHLL  161



>ref|XP_009105755.1| PREDICTED: MLP-like protein 31 [Brassica rapa]
Length=158

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 85/146 (58%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE + +IK+ + KF D++        K  P KI+S +LLEGD   +GSV +W Y+  G 
Sbjct  10   KLEADVEIKASAGKFHDMFAGRQGEWLKATPGKIKSCELLEGDWGKLGSVVIWNYVHDGE  69

Query  240  -VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA------SGNSVKWTLEYEKA  398
              + K +++AVD E   + F +I G++   FKSF +T+Q        G+ VKW +EYEK 
Sbjct  70   AAMTKKRVEAVDPEKNLIKFRVIEGDMMKDFKSFVSTIQVIPKHGEPGSVVKWHMEYEKI  129

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
              +   P + ++  + +++++DEYLL
Sbjct  130  IVDAGHPETFLQLAVEISKDIDEYLL  155



>ref|XP_002315876.1| Csf-2 family protein [Populus trichocarpa]
 gb|EEF02047.1| Csf-2 family protein [Populus trichocarpa]
Length=158

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 91/150 (61%), Gaps = 6/150 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M    K+E E +IK  ++ F DI+      +  + PAKI++V L EG+    G+V  W+Y
Sbjct  1    MTLFGKMEAEVEIKVSAETFHDIFSCRPHHVSNMSPAKIQNVDLHEGEWGKPGTVICWSY  60

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSF----RATLQASGNSV-KWTLE  386
            +  G    AK+ I+A+D+E  S TF +I G++T  +K+F    +AT +  G+ +  WT E
Sbjct  61   VHDGVAKTAKEVIEAIDDEKLSTTFKVIEGDITTEYKNFIIIVQATPKGEGSCLAHWTFE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            YEK N+NVP P + +EF ++ +++++++ L
Sbjct  121  YEKLNENVPDPQTLLEFCIHCSKDIEDHHL  150



>ref|XP_011038620.1| PREDICTED: MLP-like protein 43 [Populus euphratica]
Length=158

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 91/150 (61%), Gaps = 6/150 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M    K+E E +IK  ++ F DI+      +  + PAKI++V L EG+    G+V  W+Y
Sbjct  1    MTLFGKMEAEVEIKVSAETFHDIFSCRPHHVSNMSPAKIKNVDLHEGEWGKTGTVICWSY  60

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSF----RATLQASGNSV-KWTLE  386
            +  G    AK+ I+A+D+E  S T+ +I G++T  +K+F    +AT +  G+ +  WT E
Sbjct  61   VHDGVAKTAKEVIEAIDDEKLSTTYKVIEGDITTEYKNFIVIVQATPKGEGSCLAHWTFE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            YEK N+NVP P + +EF ++ +++++++ L
Sbjct  121  YEKLNENVPDPQTLLEFCIHCSKDIEDHHL  150



>gb|KHN05143.1| MLP-like protein 43 [Glycine soja]
Length=153

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 90/148 (61%), Gaps = 9/148 (6%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDG-KSVG-SVRLWTYILG  233
            KL  E  +K+ + K+F++       +  +C  ++   +L +GD    VG SV+ WTY++ 
Sbjct  6    KLSTELGVKASATKWFNLLTTQLHHVQNLCE-RVHETKLHDGDDWHGVGNSVKHWTYVID  64

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS-----GNSVKWTLEYEK  395
            G V   ++ I+A+DEEN+++ F L GG+++ ++KSF+   + +     G +VKWTLEYEK
Sbjct  65   GKVHTCQESIEAIDEENKTIKFMLFGGDISQHYKSFKLIFEVTDKNDGGAAVKWTLEYEK  124

Query  396  ANDNVPTPHSHVEFLMNVAREVDEYLLK  479
              +N+  PH ++++     +E+D YL+K
Sbjct  125  IKENIDPPHGYMDYFDKSTKEMDAYLVK  152



>ref|XP_002534267.1| Major latex protein, putative [Ricinus communis]
 gb|EEF28116.1| Major latex protein, putative [Ricinus communis]
Length=151

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 89/150 (59%), Gaps = 5/150 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   K+E + +IK+ + KF D+       +    P K+++  L +G+    GSV  W Y
Sbjct  1    MALSGKVEADVKIKTSADKFHDVMGGRPHHMTIASPQKLQTCDLHDGEFGRKGSVICWNY  60

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFR----ATLQASGNSVKWTLEY  389
            +  G   +AK+ ++ +D+ N S TF +I G++   +KSF+    AT Q  G++V W LEY
Sbjct  61   VHDGKAKVAKELVEDIDDVNMSTTFKVIEGDILKEYKSFKFVVQATPQGEGSTVHWILEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            EK N N+P P S +EF++++ +++D +L++
Sbjct  121  EKLNANIPEPTSLLEFVVDLTKDIDAHLVQ  150



>ref|XP_007225967.1| hypothetical protein PRUPE_ppa012615mg [Prunus persica]
 gb|EMJ27166.1| hypothetical protein PRUPE_ppa012615mg [Prunus persica]
Length=161

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 84/145 (58%), Gaps = 7/145 (5%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            +E E +IKS + K + ++ N     PK     +  V + EGD ++ GS++LWTY   GNV
Sbjct  17   VEAEVEIKSNADKLYKVFSNQHHAFPKASSDHVHDVVVHEGDWETSGSIKLWTYTADGNV  76

Query  243  -IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS-----GNSVKWTLEYEKAND  404
             I K+K++ +DE N+ V+F  + G V   ++S++   Q +     G  VK T+ Y K ND
Sbjct  77   EIFKEKVE-IDEANKWVSFTALEGHVLEQYRSYKIIFQVTPKSGGGGLVKITIHYGKLND  135

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
            N P PH ++ F +NV  ++D +LLK
Sbjct  136  NDPPPHKYLRFAINVVHDMDAHLLK  160



>gb|KDP38075.1| hypothetical protein JCGZ_04718 [Jatropha curcas]
Length=168

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 92/167 (55%), Gaps = 22/167 (13%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   KLE + +IK+ + KF D++ +    +    P  I+  +L +G+    GSV  W Y
Sbjct  1    MALTGKLEADVEIKASADKFHDVFGSRPHHVKHATPHNIKGCELHDGEFGKEGSVVFWNY  60

Query  225  ILGGNV------------------IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL  350
            +  G                    +AK+ ++ +D+ N S TF +I G++   +K+F+ T+
Sbjct  61   VHDGGFGKEGSVVFWNYVHDGVSKVAKEIVEKIDDVNLSTTFTVIEGDLLKEYKNFKITV  120

Query  351  QAS----GNSVKWTLEYEKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            +A+    G+   WTLEYEK N ++P PHS V+FL++V++++D +L K
Sbjct  121  KATPKGTGSVAHWTLEYEKLNKDIPDPHSLVKFLLDVSKDIDAHLTK  167



>ref|XP_007045183.1| MLP-like protein 28 [Theobroma cacao]
 gb|EOY01015.1| MLP-like protein 28 [Theobroma cacao]
Length=156

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 87/147 (59%), Gaps = 7/147 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE + +IK+ ++KF D++ N    +   C  K++  +L +GD  + GS+  W+Y+  G 
Sbjct  8    KLEGDVEIKASAEKFHDMFCNKPHHVSNTCSEKVQGCELHDGDWGTEGSIICWSYVHDGE  67

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
               AK  I+A+D E  S+TF +I G++   +KSF    QA+      G+ V WT EYEK 
Sbjct  68   AKKAKQVIEAIDSEKNSITFRMIEGDLMKEYKSFVIKFQATPKSEGEGSIVHWTFEYEKL  127

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLLK  479
            ++ +  P + +EFL++V++++  +L +
Sbjct  128  HEGIAHPETLLEFLLSVSKDISAHLTQ  154



>gb|KFK41514.1| hypothetical protein AALP_AA2G139500 [Arabis alpina]
Length=161

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 85/145 (59%), Gaps = 7/145 (5%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            LE E +IK+ + KF  ++      + K  P  I+ V+L +GD   VGS+  W Y+  G  
Sbjct  14   LETEVEIKASAGKFHHMFAGRPHHVSKASPGNIQGVELHDGDWGKVGSIIFWNYVHDGEA  73

Query  243  -IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKAN  401
             +AK++I+AV+ E   + F +I G++   +KSF  T+Q +      G+ V W LEYEK +
Sbjct  74   KVAKERIEAVEPEKNLIKFRVIEGDLMKEYKSFVLTIQVTPKHGGPGSIVHWHLEYEKIS  133

Query  402  DNVPTPHSHVEFLMNVAREVDEYLL  476
            D V  P + ++F + V++E+DE+LL
Sbjct  134  DEVAHPETLLQFCVEVSKEIDEHLL  158



>ref|XP_009115561.1| PREDICTED: MLP-like protein 43 [Brassica rapa]
Length=182

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 89/155 (57%), Gaps = 10/155 (6%)
 Frame = +3

Query  39   SIMAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLW  218
            S++ +IW    +  IK+ ++KF  ++      +    P  I  V+L EG+   VGS+ LW
Sbjct  30   SMVGEIW---IDVDIKASAEKFHHMFAKRPHHVSNATPRHIGGVELHEGEWDKVGSIVLW  86

Query  219  TYILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKW  377
             YI  G   +AKD+I+AVD E   + F ++ G+V   +K+F  TLQ       SG+  +W
Sbjct  87   NYIHEGKPKVAKDRIEAVDPEKNLIKFRVLEGDVLKEYKTFLITLQVTPKQGGSGSVARW  146

Query  378  TLEYEKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
             LEYE+ ++ V  P + + FL ++++E+DE+LL T
Sbjct  147  HLEYERIDEKVAHPETLIPFLESMSKEIDEHLLST  181



>ref|XP_004489875.1| PREDICTED: MLP-like protein 423-like [Cicer arietinum]
Length=155

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 93/151 (62%), Gaps = 7/151 (5%)
 Frame = +3

Query  42   IMAQIWKLEFET-QIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLW  218
            + A   KLE +   +KS + KF+    +++++ PK  P   +S+++L+GDGK+ GS+R +
Sbjct  1    MSANRGKLEVDIIDLKSNADKFWQTIRDSTTIFPKAFPHDYKSIEILQGDGKAPGSIRHF  60

Query  219  TYILGGNVI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWT  380
            +Y  G  +   +K+KIDA D+E ++V+++++ G++  Y+K F+  +  +    G  VKWT
Sbjct  61   SYGEGSPICKSSKEKIDAADDEKKTVSYSIVEGDLLEYYKVFKGHISVTPFGEGCDVKWT  120

Query  381  LEYEKANDNVPTPHSHVEFLMNVAREVDEYL  473
             EYEK +  VP P +  +F +    EVDEY+
Sbjct  121  AEYEKGSHEVPDPTAVKDFAVKNFFEVDEYI  151



>ref|XP_003519004.2| PREDICTED: MLP-like protein 28-like [Glycine max]
Length=181

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 93/161 (58%), Gaps = 9/161 (6%)
 Frame = +3

Query  21   FSRIEKSIMAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDG-KS  197
            F+      M    KL  E  +K+ + K+F++       +  +C  ++   +L +GD    
Sbjct  21   FTCFSLVFMVLAGKLSTELGVKASATKWFNLLTTQLHHVQNLCE-RVHETKLHDGDDWHG  79

Query  198  VG-SVRLWTYILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----  359
            VG SV+ WTY++ G V   ++ I+A+DEEN+++ F L GG+++ ++KSF+   + +    
Sbjct  80   VGNSVKHWTYVIDGKVHTCQESIEAIDEENKTIKFMLFGGDISQHYKSFKLIFEVTDKND  139

Query  360  -GNSVKWTLEYEKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
             G +VKWTLEYEK  +N+  PH ++++     +E+D YL+K
Sbjct  140  GGAAVKWTLEYEKIKENIDPPHGYMDYFDKSTKEMDAYLVK  180



>ref|XP_010682610.1| PREDICTED: MLP-like protein 423 [Beta vulgaris subsp. vulgaris]
Length=153

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 92/151 (61%), Gaps = 8/151 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            I  LE + ++KS   KF++   ++  L P+  P   +S+++LEGDGK+VGSVR   +  G
Sbjct  3    IGNLEVDVEVKSNPDKFWNSIRDSDKLFPQAFPELYKSIEILEGDGKAVGSVRFVKFAEG  62

Query  234  ---GNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYE  392
                   +K+K++ VDE  ++V ++++ GEV +++KSF+A L    +  G+ VKW+ E+E
Sbjct  63   LPFPVTKSKEKVEVVDEAKKTVGYSVLEGEVLDFYKSFKAQLVVEPKGEGSLVKWSCEFE  122

Query  393  KANDNVPTPH-SHVEFLMNVAREVDEYLLKT  482
            KA ++ P P     EF +    ++DE+LLK 
Sbjct  123  KAKEDAPNPEIIFKEFAVKTFMDLDEHLLKA  153



>pdb|2I9Y|A Chain A, Solution Structure Of Arabidopsis Thaliana Protein At1g70830, 
A Member Of The Major Latex Protein Family
Length=166

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 90/156 (58%), Gaps = 7/156 (4%)
 Frame = +3

Query  30   IEKSIMAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSV  209
            +E    + + KLE + +IK+ + KF  ++      + K  P  I+   L EGD  +VGS+
Sbjct  8    LETEASSLVGKLETDVEIKASADKFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGTVGSI  67

Query  210  RLWTYILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNS  368
              W Y+  G   +AK++I+AV+ +   +TF +I G++   +KSF  T+Q +      G+ 
Sbjct  68   VFWNYVHDGEAKVAKERIEAVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPKPGGPGSI  127

Query  369  VKWTLEYEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            V W LEYEK ++ V  P + ++F + V++E+DE+LL
Sbjct  128  VHWHLEYEKISEEVAHPETLLQFCVEVSKEIDEHLL  163



>ref|XP_006303098.1| hypothetical protein CARUB_v100206591mg, partial [Capsella rubella]
 gb|EOA35996.1| hypothetical protein CARUB_v100206591mg, partial [Capsella rubella]
Length=279

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 90/148 (61%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IK+ ++KF  ++      + K  P  I++  L EGD  +VGS+ LW Y+  
Sbjct  129  VGKLETDVEIKASAEKFHHMFTGKPHHVSKASPGNIQACDLHEGDWGTVGSIILWNYVHD  188

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W LEYE
Sbjct  189  GEPKVAKERIEAVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKQGGPGSIVHWHLEYE  248

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K ++ V  P + ++F + V++E+DE+LL
Sbjct  249  KISNEVAHPETLLQFCVEVSKEIDEHLL  276


 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 69/113 (61%), Gaps = 7/113 (6%)
 Frame = +3

Query  159  IRSVQLLEGDGKSVGSVRLWTYILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKS  335
            I+   L EGD   VGS+  W Y+  G   +AK++I+AV+ +   +TF +I G++   +KS
Sbjct  2    IQGCDLHEGDWGKVGSIVYWNYVHDGEAKVAKERIEAVEPDKNLITFRVIDGDLMKEYKS  61

Query  336  FRATLQAS------GNSVKWTLEYEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            F  T+Q +      G+ V W LEYEK ++ V  P + ++F + V++E+DE+LL
Sbjct  62   FLLTIQVTPKQGGPGSIVHWHLEYEKISNEVAHPETLLQFCVEVSKEIDEHLL  114



>gb|KFK44401.1| hypothetical protein AALP_AA1G252600 [Arabis alpina]
Length=161

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 86/146 (59%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            +LE E +IK+P+ KF+ +Y      + K  P  +++  L +G+  +VGS+  W Y+  G 
Sbjct  13   ELEVEVEIKAPAAKFYHMYAGRPHHVAKATPRNVQACDLHDGEWGTVGSIIFWNYVHDGE  72

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              +AK++I+ V+ E + + F ++ G++   +KSF  T+Q +      G+ V+W  EYEK 
Sbjct  73   AKVAKERIEVVEPEKKLIKFRVLEGDLMKEYKSFVITIQVTPKQGGHGSIVRWHFEYEKT  132

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            ++NV  P + + F   + +E+DE+LL
Sbjct  133  DENVAHPETLLPFFAEMVKEIDEHLL  158



>ref|XP_006302942.1| hypothetical protein CARUB_v10021082mg [Capsella rubella]
 gb|EOA35840.1| hypothetical protein CARUB_v10021082mg [Capsella rubella]
Length=158

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 85/148 (57%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE E +IK+ + KF  ++      + K  P KI   +L EGD   VGS+ +W Y++ 
Sbjct  8    VGKLETEVEIKASAGKFHHMFAERPHHVSKATPDKIHGCELHEGDWGKVGSIVVWNYVID  67

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYE  392
            G   + KD+I+AV+ E   + F +I G++   + +F  T+Q       SG+ V W  EYE
Sbjct  68   GKASVVKDRIEAVEPEKNLIRFRVIEGDLMKEYNNFVITIQVTPKHGGSGSVVHWHFEYE  127

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K N+ V  P + ++F + +++E+DE+LL
Sbjct  128  KINEEVAHPENLLQFAVGMSKEIDEHLL  155



>emb|CDY21418.1| BnaA09g30090D [Brassica napus]
Length=182

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 89/155 (57%), Gaps = 10/155 (6%)
 Frame = +3

Query  39   SIMAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLW  218
            S++ +IW    +  IK+ ++KF  ++      +    P  I  V+L EG+   VGS+ LW
Sbjct  30   SMVGEIW---IDVDIKASAEKFHHMFAKRPHHVSNATPRHIGGVELHEGEWDKVGSIVLW  86

Query  219  TYILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKW  377
             YI  G   +AKD+I+AVD E   + F ++ G+V   +K+F  TLQ       SG+  +W
Sbjct  87   NYIHEGKPKVAKDRIEAVDPEKNLIKFRVLEGDVLKEYKTFLITLQVTPKQGGSGSVARW  146

Query  378  TLEYEKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
             LEYE+ ++ V  P + + FL ++++E+DE+LL T
Sbjct  147  HLEYERIDEKVAHPETLIPFLESMSKEIDEHLLST  181



>gb|AFK47321.1| unknown [Lotus japonicus]
Length=151

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 91/146 (62%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KL  E ++KSP+ KF++++        KI  + +   ++ EGD   +GSV+ WTY++ G 
Sbjct  6    KLITEIELKSPAVKFYNLFAKQLHDAQKISDS-VHETKVHEGDWHGIGSVKQWTYVVDGK  64

Query  240  VI-AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASGN-----SVKWTLEYEKAN  401
            VI   ++I+A+DE+N++  + L GG+V++++K F    Q   N     +VKWT+EYEK  
Sbjct  65   VITCLERIEAIDEQNKTNKYTLFGGDVSSHYKKFTLIFQVIENNDGHDAVKWTVEYEKLR  124

Query  402  DNVPTPHSHVEFLMNVAREVDEYLLK  479
            +++  P+ ++++   + R+VD +L+K
Sbjct  125  EDIEPPNGYMDYFNKLTRDVDAHLIK  150



>ref|XP_004147670.1| PREDICTED: MLP-like protein 28-like [Cucumis sativus]
 ref|XP_004170314.1| PREDICTED: MLP-like protein 28-like [Cucumis sativus]
Length=320

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 89/148 (60%), Gaps = 5/148 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M+   KLE +  I++ + KF +++      +      KI  V+L EG+   VGS+  W Y
Sbjct  1    MSLCGKLEKDVPIRASASKFHEMFHKKPHHICNCSTDKIHGVELQEGEWGQVGSIICWKY  60

Query  225  IL-GGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEY  389
               G + IAK+ ++ VDEEN S+TF +I G++T ++K FR T++      G+ + W LEY
Sbjct  61   FHEGKHKIAKEIVEHVDEENNSITFKVIEGDLTEHYKDFRFTIKCIPKEKGSVIHWVLEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYL  473
            EK +D +P  H+ ++F ++V++++D+ L
Sbjct  121  EKLHDKIPDSHTLLQFCVDVSKDIDKQL  148


 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 82/143 (57%), Gaps = 5/143 (3%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE +  IK+ +  F +I+      +      KI  V L EG+   VGS+  W Y   G 
Sbjct  172  KLETDVPIKASASMFHEIFHKKPHHISNASTDKIHGVDLHEGEWGQVGSIICWKYFHDGK  231

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEYEKAND  404
              IAK+ I+ VDEEN S+TF +I G++T ++K FR T+Q      G+ + W LEYEK +D
Sbjct  232  ARIAKEIIEHVDEENNSITFKVIEGDLTEHYKDFRLTIQCIPKEKGSVIHWILEYEKLHD  291

Query  405  NVPTPHSHVEFLMNVAREVDEYL  473
             +P  H+ ++F + V++++D  L
Sbjct  292  QIPDSHTLLQFCVEVSQDIDSML  314



>gb|EYU31817.1| hypothetical protein MIMGU_mgv1a015578mg [Erythranthe guttata]
Length=152

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 84/144 (58%), Gaps = 5/144 (3%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KL  +T IKS    F +I+      +P + P  I++  L  G+  +VGSV  W Y   G 
Sbjct  6    KLVSKTNIKSDGDVFHEIFRERPHHVPDMSPDLIQNCDLHHGEWGTVGSVIFWNYTHDGK  65

Query  240  -VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEYEKAND  404
              +AK+ I+A+DEE +SVTF ++ G++   +K+F+AT+        N V WT  YEK N+
Sbjct  66   ECVAKEIIEAIDEEKKSVTFNIVEGDLMELYKTFKATVHVDTVGEDNLVTWTFVYEKLNE  125

Query  405  NVPTPHSHVEFLMNVAREVDEYLL  476
            +VP PH+ +EF + + ++++ + L
Sbjct  126  DVPDPHTLMEFCVKLTKDIESHHL  149



>ref|XP_009803723.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=299

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 85/146 (58%), Gaps = 5/146 (3%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE + +IKS    F +I+      +  +C  KI++V + EG+  +VGSV  W Y+  G 
Sbjct  152  KLESQIEIKSDGDVFHEIFRYRPHHISTMCSDKIQNVDIHEGEWGTVGSVIFWNYVHDGK  211

Query  240  -VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEYEKAND  404
              +AK+ I+A+DEE + V F +IGG++   + SF  T+        N V W LEYEK N 
Sbjct  212  EKVAKEIIEAIDEEKKLVKFKVIGGDLLETYNSFYLTVHVETTGENNLVTWILEYEKKNS  271

Query  405  NVPTPHSHVEFLMNVAREVDEYLLKT  482
             VP PH+ +EF ++V ++++ + LK 
Sbjct  272  KVPDPHTLMEFCLSVTKDIETHHLKC  297


 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 84/144 (58%), Gaps = 5/144 (3%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KL  E  IKS    F +I+      +  + P KI++V + EGD  +VGSV  W +   G 
Sbjct  6    KLVSEINIKSCGDVFHEIFRYRPHHISTMSPDKIQNVDIHEGDWGTVGSVIFWNFTHDGK  65

Query  240  -VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAND  404
              +AK+ I+ +DEE + V F +IGG++ +++KS   T+    +   N V W L+YEK N 
Sbjct  66   EKVAKEIIEEIDEEKKLVKFKVIGGDLLDFYKSLYLTVHVETKGEDNLVTWILDYEKLNP  125

Query  405  NVPTPHSHVEFLMNVAREVDEYLL  476
            ++P PH+ +EF +NV ++++ + L
Sbjct  126  DIPDPHTLMEFCLNVTKDIETHHL  149



>ref|XP_003613297.1| MLP-like protein [Medicago truncatula]
 gb|ACJ85185.1| unknown [Medicago truncatula]
 gb|AES96255.1| polyketide cyclase/dehydrase and lipid transporter [Medicago 
truncatula]
 gb|AFK45401.1| unknown [Medicago truncatula]
Length=156

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 86/144 (60%), Gaps = 6/144 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE + ++KS   K++    +++++ PK  P   +S++++EGDGK+ GS+R +TY  G  
Sbjct  8    KLEVDIELKSNVDKYWQTIRDSTTIFPKAFPHDYKSIEIIEGDGKAPGSIRHFTYAEGSQ  67

Query  240  VI--AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEYEKAN  401
            +   + +KIDA D+E R+ T+ +I G++  Y+KSF+  L       G  +KW  EY K +
Sbjct  68   LAKSSTEKIDAADDEKRTATYCIIEGDLLQYYKSFKGHLALIPVGEGCEMKWCAEYVKVS  127

Query  402  DNVPTPHSHVEFLMNVAREVDEYL  473
            +++P P     F +    EVDEY+
Sbjct  128  NDIPDPSIVKNFAVKNFIEVDEYV  151



>gb|KFK41510.1| hypothetical protein AALP_AA2G139000 [Arabis alpina]
Length=213

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 86/148 (58%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IKS +  F  ++      + K  P  I+   L EGD  +VGS+  W Y+  
Sbjct  63   VGKLETDVEIKSSADMFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGTVGSIIYWNYVHD  122

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I G++   +KSF  T+Q       +G+ V W LEYE
Sbjct  123  GEAKVAKERIEAVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKEGGTGSIVHWHLEYE  182

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K +D V  P + ++F + V++E+DE+LL
Sbjct  183  KISDEVAHPETLLQFCVEVSKEIDEHLL  210



>gb|KFK41512.1| hypothetical protein AALP_AA2G139300 [Arabis alpina]
Length=171

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 86/145 (59%), Gaps = 7/145 (5%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGG-N  239
            LE +  I++ + KF  ++      + K  P KIR  +L EGD   VGS+  W Y+  G  
Sbjct  24   LEIDVDIRASAGKFHHMFAGKPHHVSKATPGKIRGCELHEGDWGKVGSIIFWNYVHDGEE  83

Query  240  VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYEKAN  401
             +AK++I+AV+ E   +TF +I G++   +KSF  T+Q       SG+ V W +EYEK +
Sbjct  84   KVAKERIEAVEPEKNLITFRVIEGDLLKEYKSFVITIQVTPKHGGSGSVVHWHVEYEKID  143

Query  402  DNVPTPHSHVEFLMNVAREVDEYLL  476
            + V  P + ++F ++V++++DE+L+
Sbjct  144  EKVAHPETFLQFCVHVSKDLDEHLM  168



>ref|XP_010427877.1| PREDICTED: MLP-like protein 34 [Camelina sativa]
Length=336

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 89/148 (60%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IK+ ++KF  ++      + K  P  I+  +L EGD  +VGS+  W Y+  
Sbjct  186  VGKLETDVEIKASAEKFHHMFTGKPHHVSKASPGNIQGCELHEGDWGTVGSIIFWNYVHD  245

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W LEYE
Sbjct  246  GEAKVAKERIEAVEPEKNLITFRVIDGDLMKEYKSFLLTIQVTPKQGGPGSIVHWHLEYE  305

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K ++ V  P + ++F + V++E+DE+LL
Sbjct  306  KISNEVAHPETLLQFCVEVSKEIDEHLL  333


 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 86/148 (58%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +I++ + +F  ++      + K  P  I+   L EGD   VGS+  W Y+  
Sbjct  24   VGKLETDVEIEASAGQFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGKVGSIVYWNYVHD  83

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I GE+   +KSF  T+Q +      G+ V W LEYE
Sbjct  84   GEAKVAKERIEAVEPEKNLITFRVIEGELMKEYKSFLLTIQVTPKQGGPGSIVHWHLEYE  143

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K ++ V  P + ++F + V++E+DE+LL
Sbjct  144  KISNEVAHPETLLQFCVEVSKEIDEHLL  171



>ref|XP_004240135.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=150

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 82/145 (57%), Gaps = 5/145 (3%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KL  E  IK     F +  +     +  ICP KI++V + +GD  ++GSVR W +   G 
Sbjct  6    KLVSEINIKCDGDVFHETIMYKPHYMCNICPDKIQNVDIHKGDLGTIGSVRFWKFTHDGK  65

Query  240  -VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEYEKAND  404
             ++AK+ I+ +DEE + V   +I G++  Y++SF  T+        N V W LEYEK N 
Sbjct  66   EMVAKEVIEKIDEEKKLVKKKMIEGDMLEYYESFYLTIHVETKDENNLVTWILEYEKKNV  125

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
            +VP PH+ +E  +N+ ++++ Y +K
Sbjct  126  HVPDPHTFMELCINITKDIESYHIK  150



>ref|XP_006390831.1| hypothetical protein EUTSA_v10019454mg [Eutrema salsugineum]
 gb|ESQ28117.1| hypothetical protein EUTSA_v10019454mg [Eutrema salsugineum]
Length=367

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 88/150 (59%), Gaps = 7/150 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE E +IK+ + +F  ++      + K  P  I+   L EGD   VGS+  W Y+  
Sbjct  8    VGKLETEVEIKASAGQFHHMFAGRPHHVSKASPGNIQGCDLHEGDWGKVGSIVYWNYVHD  67

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W LEYE
Sbjct  68   GEAKVAKERIEAVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKHGGPGSIVHWHLEYE  127

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            K +D V  P + ++F + V++E+DE+LL++
Sbjct  128  KISDEVAHPETLLQFCVEVSKEIDEHLLQS  157


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 87/161 (54%), Gaps = 20/161 (12%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE +  I++ + KF  ++      + K  P  I+   L EGD   VGS+  W Y+ G
Sbjct  204  VGKLEIDVDIRASAGKFHHMFAGRPHHVSKASPGNIQGCDLHEGDWGKVGSIVYWNYVHG  263

Query  234  GN--------------VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----  359
             +               +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +    
Sbjct  264  KSKTNIDHIDSQNGEAKVAKERIEAVEPEKNMITFRVIEGDLLKEYKSFVITIQVTPKQG  323

Query  360  --GNSVKWTLEYEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
              G++V W +EYEK ++ V  P + +EF + V++E+DE+LL
Sbjct  324  GPGSTVHWHVEYEKIDEKVAHPETFLEFCVQVSKEIDEHLL  364



>gb|AFZ93654.1| major latex protein [Euphorbia lathyris]
 gb|AGC94750.1| putative major latex protein [Euphorbia lathyris]
Length=156

 Score = 99.0 bits (245),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 84/150 (56%), Gaps = 6/150 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M+ + K+E   +IKSP+ KF D++      +  + P  + +  L EGD    G+V  W+Y
Sbjct  1    MSSVEKVEINVEIKSPADKFHDVFSCRPHHVNTMSPDTVHACDLHEGDFGKQGTVVCWSY  60

Query  225  ILGG-NVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS-----GNSVKWTLE  386
               G   IAK+ ++ +D+ N S TF +I G++   +K FR  ++A+     G+ V WTLE
Sbjct  61   THDGEKKIAKELVEEIDDVNNSTTFKVIEGDLLKDYKFFRFIVKATPKGEGGSVVNWTLE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            YEK N     PH+ ++FL    R++D +L+
Sbjct  121  YEKMNPQTSPPHTLLDFLAQCTRDIDSHLV  150



>ref|XP_004240136.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=150

 Score = 99.0 bits (245),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 88/150 (59%), Gaps = 5/150 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M+   KL  E +IK     F+++Y +    +  + P  I++V + EG+  +V SV  W +
Sbjct  1    MSLHGKLVSEIEIKCDGDIFYEVYRHRPHHISTMSPNNIQNVDVHEGEWGTVDSVIFWNF  60

Query  225  ILGG-NVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEY  389
            I  G  V+AK+K++ +DEEN+ +   +I G++  Y+KSF  T+    +   N V   +EY
Sbjct  61   IHDGKEVVAKEKVEEIDEENKLIKKKIIEGDILEYYKSFYITVHVETKGENNLVTLIIEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            EK N NVP PH+ +E ++NV ++++ Y +K
Sbjct  121  EKKNANVPDPHTFMELILNVTKDIENYHIK  150



>ref|NP_001117579.1| MLP-like protein 28 [Arabidopsis thaliana]
 gb|AEE35125.1| MLP-like protein 28 [Arabidopsis thaliana]
Length=173

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 87/148 (59%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IK+ + KF  ++      + K  P  I+   L EGD  +VGS+  W Y+  
Sbjct  23   VGKLETDVEIKASADKFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGTVGSIVFWNYVHD  82

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ +   +TF +I G++   +KSF  T+Q +      G+ V W LEYE
Sbjct  83   GEAKVAKERIEAVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPKPGGPGSIVHWHLEYE  142

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K ++ V  P + ++F + V++E+DE+LL
Sbjct  143  KISEEVAHPETLLQFCVEVSKEIDEHLL  170



>ref|XP_008340261.1| PREDICTED: MLP-like protein 329 [Malus domestica]
Length=161

 Score = 99.0 bits (245),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 89/145 (61%), Gaps = 7/145 (5%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            +E E +IK+ + K + +  N    +PK    KI  V + EGD ++ GSV+LW Y L GNV
Sbjct  17   VEVEVEIKANADKLYKVISNQHHDVPKAASDKIHDVAVHEGDWETSGSVKLWKYTLDGNV  76

Query  243  -IAKDKIDAVDEENRSVTF-ALIGGEVTNYFKS----FRATLQASGNSVKWTLEYEKAND  404
               K+K++ +DE N+ V+  AL G  V + +KS    F+ T ++ G  VK TLEYEK N+
Sbjct  77   ETFKEKVE-IDEVNKWVSLTALEGSHVLDNYKSYKIIFQVTPKSEGGFVKITLEYEKLNE  135

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
            N P P  ++ F++NV +++D +LLK
Sbjct  136  NDPPPQKYLSFMVNVIKDIDAHLLK  160



>gb|AFK45085.1| unknown [Lotus japonicus]
Length=151

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 90/151 (60%), Gaps = 7/151 (5%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M    K+  E  I+SPS KFF +Y      +  +   ++   ++ EGD   +GSV++WT 
Sbjct  1    MVLTGKVVHEFGIQSPSDKFFKVYTTQLHSVQNVA-QRVHETKVHEGDWHDIGSVKIWTI  59

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA-----SGNSVKWTLE  386
             + G V   K+ I+ +DE+++ +TF +  GEV+  +K+F+ TLQ      +G  +K TLE
Sbjct  60   TIDGKVETCKENIEVIDEQSKLITFNVFDGEVSKKYKTFKFTLQVIDVENAGGVLKLTLE  119

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            YEK ++++  P+ +++F+   A++VD +LLK
Sbjct  120  YEKLSEDITPPYGYLDFVTEAAKDVDAHLLK  150



>ref|XP_002888804.1| hypothetical protein ARALYDRAFT_894909 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65063.1| hypothetical protein ARALYDRAFT_894909 [Arabidopsis lyrata subsp. 
lyrata]
Length=150

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 84/147 (57%), Gaps = 13/147 (9%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE E +IK+ + KF  +++     + K  P+KI+   L EGD   VGS+ +W Y++G
Sbjct  8    VGKLETEVEIKASAGKFHHMFVERPHHVSKATPSKIQGCDLHEGDWGKVGSIVIWNYVIG  67

Query  234  GNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYEK  395
                   KI+AV+ E   +TF +I G++   + SF  T+Q       SG+ V W  EYEK
Sbjct  68   -------KIEAVEPEKNLITFKVIEGDLMKEYTSFVITIQVTPKHKGSGSVVHWHFEYEK  120

Query  396  ANDNVPTPHSHVEFLMNVAREVDEYLL  476
             N+ V  P + ++F   +++E+DE+LL
Sbjct  121  INEEVAHPENLLQFAAEMSKEIDEHLL  147



>emb|CBI26882.3| unnamed protein product [Vitis vinifera]
Length=311

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 86/151 (57%), Gaps = 5/151 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M  + KL+ ET I +P+ KF +++      +  +CP KI+ V L EG+  + G V  W Y
Sbjct  161  MGLVGKLQAETLIVAPADKFHEMFSCRPHHISNVCPEKIQKVNLHEGEWGTSGYVIEWNY  220

Query  225  ILGGN-VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEY  389
             + GN  +AK  ++  D EN+S+T+  I G++   +KSF   +Q         V WTLEY
Sbjct  221  NIDGNDHVAKQIVEITDGENKSITYKFIEGDLLKKYKSFIIVVQTIPKGDATWVHWTLEY  280

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            EK N ++PTP   +EFL+ V   VD++L++ 
Sbjct  281  EKLNKDIPTPIKELEFLVLVGEGVDDHLVQA  311


 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 81/142 (57%), Gaps = 5/142 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M  + KLE E  I +P+ KF +++      +  + P K++ V L EGD  +VGSV  W+Y
Sbjct  1    MGLVGKLEAEILILAPADKFHEVWGGRPHHMSSVSPGKVQKVDLHEGDWGNVGSVIEWSY  60

Query  225  ILGG-NVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA----SGNSVKWTLEY  389
            ++ G N + KD ++A++ EN++VTF +I G++   +KSF+A +QA        V+W +EY
Sbjct  61   VIDGKNHVTKDIVEAIERENKTVTFKVIEGDILKEYKSFKAIVQAISKGEATWVRWIIEY  120

Query  390  EKANDNVPTPHSHVEFLMNVAR  455
            EK N       + +  L  V R
Sbjct  121  EKLNKKSLLLVAPIGLLARVCR  142



>ref|XP_008358813.1| PREDICTED: MLP-like protein 329 [Malus domestica]
Length=157

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 89/145 (61%), Gaps = 7/145 (5%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            +E E +IK+ + K + +  N    +PK    KI  V + EGD ++ GSV+LW Y L GNV
Sbjct  13   VEAEVEIKANADKLYKVISNQHHDVPKAASDKIHDVAVHEGDWETSGSVKLWKYTLDGNV  72

Query  243  IA-KDKIDAVDEENRSVTF-ALIGGEVTNYFKS----FRATLQASGNSVKWTLEYEKAND  404
               K+K++ +DE N+ V+  AL G  V + +KS    F+ T ++ G  VK TLEYEK N+
Sbjct  73   ETFKEKVE-IDEVNKWVSLTALEGSHVLDNYKSYKIIFQVTPKSEGGFVKITLEYEKLNE  131

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
            N P P  ++ F++NV +++D +LLK
Sbjct  132  NDPPPQKYLSFMVNVIKDIDAHLLK  156



>gb|KCW64564.1| hypothetical protein EUGRSUZ_G02169, partial [Eucalyptus grandis]
Length=152

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 89/146 (61%), Gaps = 6/146 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E + +I++P+ KF D++      +  +   KI  V L +GD    GSV  W+Y   G 
Sbjct  6    KMEIDLEIRAPADKFHDVFSCRPHHISNMSTDKIHGVDLHDGDWGKAGSVVSWSYTHDGE  65

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS-----GNSVKWTLEYEKAN  401
              +AK+ I+A+D+E  S TF +I G++   +K+F   +QA+     G+ V WTLEYEK +
Sbjct  66   TKVAKEVIEAIDDEKNSTTFRVIEGDLMKLYKNFVLVVQATPKEGGGSVVHWTLEYEKLS  125

Query  402  DNVPTPHSHVEFLMNVAREVDEYLLK  479
            + V  P+S ++F ++V++++D +L++
Sbjct  126  EEVTEPYSLLQFCVHVSKDMDLHLME  151



>ref|NP_001077806.1| MLP-like protein 28 [Arabidopsis thaliana]
 gb|AEE35123.1| MLP-like protein 28 [Arabidopsis thaliana]
Length=201

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 87/148 (59%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IK+ + KF  ++      + K  P  I+   L EGD  +VGS+  W Y+  
Sbjct  23   VGKLETDVEIKASADKFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGTVGSIVFWNYVHD  82

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ +   +TF +I G++   +KSF  T+Q +      G+ V W LEYE
Sbjct  83   GEAKVAKERIEAVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPKPGGPGSIVHWHLEYE  142

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K ++ V  P + ++F + V++E+DE+LL
Sbjct  143  KISEEVAHPETLLQFCVEVSKEIDEHLL  170



>ref|XP_006367968.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=151

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 83/142 (58%), Gaps = 5/142 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KL  ET+IK     F +++      LP + P  I++V L EGD  +VGSV  W YI+ G+
Sbjct  6    KLISETEIKGCKDLFHEMFCEKPHHLPNVVPQTIQAVDLHEGDWGTVGSVVNWKYIIEGD  65

Query  240  -VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLEYEKAND  404
              + K  ID +++E R VTF    G +   +K+F+AT+    +   N V WT+EYEK N+
Sbjct  66   EKVVKVIIDEINKEKRLVTFKAFEGHLIEEYKAFKATIHIENEGDNNLVIWTIEYEKQNE  125

Query  405  NVPTPHSHVEFLMNVAREVDEY  470
            ++P P S+++   N+ ++VD +
Sbjct  126  DIPEPFSYLQLATNLTKDVDTH  147



>ref|XP_010066609.1| PREDICTED: MLP-like protein 28 [Eucalyptus grandis]
Length=159

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 89/146 (61%), Gaps = 6/146 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E + +I++P+ KF D++      +  +   KI  V L +GD    GSV  W+Y   G 
Sbjct  6    KMEIDLEIRAPADKFHDVFSCRPHHISNMSTDKIHGVDLHDGDWGKAGSVVSWSYTHDGE  65

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS-----GNSVKWTLEYEKAN  401
              +AK+ I+A+D+E  S TF +I G++   +K+F   +QA+     G+ V WTLEYEK +
Sbjct  66   TKVAKEVIEAIDDEKNSTTFRVIEGDLMKLYKNFVLVVQATPKEGGGSVVHWTLEYEKLS  125

Query  402  DNVPTPHSHVEFLMNVAREVDEYLLK  479
            + V  P+S ++F ++V++++D +L++
Sbjct  126  EEVTEPYSLLQFCVHVSKDMDLHLME  151



>ref|XP_002862770.1| hypothetical protein ARALYDRAFT_497301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39028.1| hypothetical protein ARALYDRAFT_497301 [Arabidopsis lyrata subsp. 
lyrata]
Length=151

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 87/148 (59%), Gaps = 10/148 (7%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG---  233
            LE + +IK+ + KF  ++      + K  P KI+  +L EG+   VGS+  W Y+ G   
Sbjct  1    LETDVEIKASAGKFHHMFAGRPHHVSKATPGKIQGCELHEGEWGKVGSIVFWNYVHGKID  60

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W +EYE
Sbjct  61   GEAKVAKERIEAVEPEKNLITFRVIEGDLLKEYKSFVITIQVTLKRGGPGSVVHWHVEYE  120

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K +D V  P + ++F + V++E+DE+LL
Sbjct  121  KIDDKVAHPETFLDFCVQVSKEIDEHLL  148



>ref|XP_010248963.1| PREDICTED: kirola-like [Nelumbo nucifera]
Length=152

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 89/152 (59%), Gaps = 6/152 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQ  KLE E +IKSP++++F  +L+++    K+ P   R V +LEGDGKSVGS+  W Y
Sbjct  1    MAQTSKLESEIEIKSPAREYFKHFLDHTIHFHKVTPHDSRRVHILEGDGKSVGSITSWNY  60

Query  225  IL-GGNVI-AKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASGNS----VKWTLE  386
            +   G V+ AK +++A+DEEN S+T     G++   +K ++  +Q   N     VK  +E
Sbjct  61   LSDDGKVLSAKAELEALDEENMSLTLRFFQGDIAQLYKYYKLNVQVIENKEKSFVKCCIE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYLLKT  482
            YEK ++ V   + +++    +   +D Y L+ 
Sbjct  121  YEKVDEGVADSNMYMDAACRLVNWMDSYALQA  152



>ref|XP_011075467.1| PREDICTED: kirola-like [Sesamum indicum]
Length=155

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 83/142 (58%), Gaps = 5/142 (4%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KL  +  IK     F +I+      +  + P  I++  L EG   +VGSV  W Y   G 
Sbjct  6    KLVSQIDIKCDGDVFHEIFRERPHHISGMTPHNIQNCDLHEGQWGTVGSVIYWNYTHDGK  65

Query  240  -VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASGNS----VKWTLEYEKAND  404
              +AK+ I+A+DEE +SVTF +I G++   +K+F+ T+    N     V WTLEYEK ++
Sbjct  66   EKVAKEIIEAIDEEKKSVTFKVIEGDLMELYKTFKLTVHVDTNGDDNLVTWTLEYEKLSE  125

Query  405  NVPTPHSHVEFLMNVAREVDEY  470
            +VP PH+ +EF +NV ++++++
Sbjct  126  DVPDPHTLMEFCLNVTKDIEKH  147



>gb|ACJ11748.1| major latex-like protein [Gossypium hirsutum]
 gb|KHG22952.1| MLP protein [Gossypium arboreum]
Length=153

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 92/149 (62%), Gaps = 6/149 (4%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   +L  + ++KSP++K +    +++++ P+      +S+Q+LEGDGK+ GSVRL  Y
Sbjct  1    MASSGQLHVDFELKSPAEKVWGTIRDSTTIFPQALSHDYKSIQVLEGDGKAPGSVRLINY  60

Query  225  ILGGNV--IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATL----QASGNSVKWTLE  386
              G  +  ++K++I++VDE  +   +++I G++  Y+K+F   +    +   + VKW+ E
Sbjct  61   AEGSPIVKVSKERIESVDEAEKKYVYSIIDGDLLKYYKTFIGKIIVVPKGESSLVKWSCE  120

Query  387  YEKANDNVPTPHSHVEFLMNVAREVDEYL  473
            +EKA++ +P P    EF +   +E+D+YL
Sbjct  121  FEKASEEIPDPSVIKEFAVKNFKEIDDYL  149



>ref|XP_009349506.1| PREDICTED: MLP-like protein 34 [Pyrus x bretschneideri]
Length=159

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 89/146 (61%), Gaps = 8/146 (5%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            LE E +IK+ + + +    N    +PK    KI  V + EGD ++  SV+LW Y + GNV
Sbjct  14   LEAEVEIKAKADQLYKFISNKHHDVPKAASDKIYDVTVHEGDWETSDSVKLWKYAVDGNV  73

Query  243  -IAKDKIDAVDEENRSVTF-ALIGGEVTNYFKSFRATLQ-----ASGNSVKWTLEYEKAN  401
               K+K++ +DE N+ V+  AL G  V + +KS++ T Q     + G+SVK TLEYEK +
Sbjct  74   ETYKEKVE-IDEANKRVSLEALEGSHVLDNYKSYKVTYQVITPNSEGSSVKITLEYEKLS  132

Query  402  DNVPTPHSHVEFLMNVAREVDEYLLK  479
            +N P P  ++ FL+NV ++VD +LLK
Sbjct  133  ENDPPPQKYLSFLVNVIKDVDAHLLK  158



>ref|XP_010415777.1| PREDICTED: MLP-like protein 28 [Camelina sativa]
Length=163

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 84/145 (58%), Gaps = 7/145 (5%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            LE E +IK+ + +F  ++      + K  P  I+   L EGD   VGS+  W Y+  G  
Sbjct  16   LETEVEIKASAGQFHHMFAGRPHHVSKASPGNIQGCDLHEGDWGKVGSIVYWNYVHDGEA  75

Query  243  -IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKAN  401
             +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W LE+EK N
Sbjct  76   KVAKERIEAVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKQGGPGSIVHWHLEFEKIN  135

Query  402  DNVPTPHSHVEFLMNVAREVDEYLL  476
            + V  P + ++F + V++E+DE+LL
Sbjct  136  EEVAHPETLLQFCIEVSKEIDEHLL  160



>ref|XP_008465556.1| PREDICTED: MLP-like protein 28 [Cucumis melo]
Length=153

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 89/151 (59%), Gaps = 7/151 (5%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MAQI K+  + Q+KS  +KFF+ + N +   P++ P  I+S + +EG+  S GSV +W Y
Sbjct  1    MAQIAKIAEKVQLKSSGEKFFEFFKNKADYFPRMFPGNIKSYKFVEGNSFSHGSVSIWKY  60

Query  225  ILGGNVIAKDKID-AVDEENRSVTFALIGGEVTNYFKSFRATLQ-----ASGN-SVKWTL  383
             LG     + K+   +DE N+++ +  + G++   F  F+  ++     +SGN SV W L
Sbjct  61   DLGFGRAVEVKVKLLLDEANKTIIYECLEGDLFKDFDMFKVKIEVTDGGSSGNSSVNWCL  120

Query  384  EYEKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            E+ K+N+NV  P+ +++F   + ++VD YL 
Sbjct  121  EFVKSNENVAPPNDYLQFGAKICKDVDAYLC  151



>ref|XP_009127828.1| PREDICTED: MLP-like protein 31 [Brassica rapa]
Length=218

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 86/148 (58%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IK+ + +F  ++      + K  P  I+   L EGD    GS+ LW Y+  
Sbjct  68   VGKLETDVEIKASAGQFHHMFTGKPHHVSKASPGNIQGCDLHEGDWGKPGSIILWNYVHD  127

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I G++   +KSF  T+Q       +G+ V W LEYE
Sbjct  128  GEAKVAKERIEAVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKHGGAGSIVHWHLEYE  187

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K +D V  P + ++F + V++E+DE+LL
Sbjct  188  KISDEVAHPETLLQFCVEVSKEIDEHLL  215



>ref|XP_008221417.1| PREDICTED: MLP-like protein 31 [Prunus mume]
Length=156

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 89/145 (61%), Gaps = 7/145 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E + +IK+P+ KF ++  +    +  + P  I+   L EG+  +VGSV  W Y   G 
Sbjct  7    KVETDVEIKAPATKFHEVLTHRPHHISNVSPNNIQGCDLHEGEWGTVGSVVYWNYFHDGK  66

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              +AK  I+A+D E   +TF +I G++  ++KSF+ T+QA+      G+ V  T+EYEK 
Sbjct  67   AKVAKALIEAIDAEKNLITFKVIEGDLLEHYKSFKITIQATPKAHGQGSIVHCTMEYEKH  126

Query  399  NDNVPTPHSHVEFLMNVAREVDEYL  473
            + ++  PH+ ++F+++V++++D +L
Sbjct  127  HGDIEDPHTLLQFVVDVSKDLDAHL  151



>ref|XP_007223642.1| hypothetical protein PRUPE_ppa012705mg [Prunus persica]
 gb|EMJ24841.1| hypothetical protein PRUPE_ppa012705mg [Prunus persica]
Length=158

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 87/145 (60%), Gaps = 7/145 (5%)
 Frame = +3

Query  63   LEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV  242
            +E E +IKS S K F +  N    +PK     +  V + EGD ++ GSV+LW Y L GNV
Sbjct  14   VEAEVEIKSNSGKLFKLISNQHHDVPKASSDNVHDVAVHEGDWETSGSVKLWKYTLDGNV  73

Query  243  -IAKDKIDAVDEENRSVTF-ALIGGEVTNYFKS----FRATLQASGNSVKWTLEYEKAND  404
               K+K++ +DE N+ V+  AL G  V   +KS    F+ T ++ G  VK TL Y++ N+
Sbjct  74   ETLKEKVE-IDEANKLVSLTALEGSHVLEKYKSCKIIFQVTPKSEGGLVKITLGYQRLNE  132

Query  405  NVPTPHSHVEFLMNVAREVDEYLLK  479
            N P PH ++ FL+NV +++D +LLK
Sbjct  133  NDPPPHKYLRFLVNVIQDIDAHLLK  157



>ref|XP_006304267.1| hypothetical protein CARUB_v10010497mg [Capsella rubella]
 gb|EOA37165.1| hypothetical protein CARUB_v10010497mg [Capsella rubella]
Length=164

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 86/146 (59%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            +L  + +I++P+ KF  +       + K  P  I+   L EG+   VG++  W Y+L G 
Sbjct  16   ELVLDVEIRAPAGKFHHMLAGRPHHMSKATPNNIQRCDLHEGEWGKVGTIVTWNYVLDGQ  75

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              IAKD+I+AV+ E  S+TF++I G++ N FKSF   +Q +      G+ V W  +YEK 
Sbjct  76   PKIAKDRIEAVEPEKNSITFSVIEGDLMNEFKSFVLKIQVTPKQGGPGSVVNWHGKYEKI  135

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            ++NV  P + + F  ++++E+DE+LL
Sbjct  136  DENVAHPENMLPFFKSMSKEIDEHLL  161



>ref|XP_010427878.1| PREDICTED: MLP-like protein 34 isoform X1 [Camelina sativa]
Length=320

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 87/146 (60%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGG-  236
            KLE + +IK+ ++KF  ++      + K  P  I+   L EGD   VGS+ +W Y+  G 
Sbjct  10   KLETDVEIKASAEKFHHMWAGKPHHVSKATPGNIQDCVLHEGDWGKVGSIIIWNYVHDGK  69

Query  237  NVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              +AK++I+AV+ EN  +TF ++ G++   + SF  T+Q +      G+ V W LEYEK 
Sbjct  70   EQVAKERIEAVEPENNLITFRVLDGDLMKEYTSFVTTIQVTPKHGGPGSIVHWHLEYEKI  129

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            +D V  P + ++F + +++E+DE+LL
Sbjct  130  SDEVAHPETLLQFCIEISKEIDEHLL  155


 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 88/146 (60%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE + +IK+ +++F  ++      + K  P  I+   L EGD   VGS+ +W Y+  G 
Sbjct  172  KLETDVEIKASAEEFHHMWSGRPHHVSKATPGNIQDCVLHEGDWGKVGSIIIWNYVHDGE  231

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYEKA  398
              +AK++I+AV+ +   +TF +I G++   +KSF  T+Q       SG++V W LEYEK 
Sbjct  232  AKVAKERIEAVEPDKNLITFRVIDGDLMTEYKSFVCTIQVTPKDGGSGSNVHWHLEYEKI  291

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            ++ V  P + ++F + V++E+DE+LL
Sbjct  292  SEEVAHPETLLQFCVEVSKEIDEHLL  317



>ref|XP_010415772.1| PREDICTED: MLP-like protein 34 [Camelina sativa]
Length=498

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 89/148 (60%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IK+ ++KF  ++      + K  P  I+  +L EGD  +VGS+  W Y+  
Sbjct  186  VGKLETDVEIKASAEKFHHMFTGKPHHVSKASPGNIQGCELHEGDWGTVGSIIFWNYVHD  245

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W LEYE
Sbjct  246  GEAKVAKERIEAVEPEKNLITFRVIDGDLMKEYKSFLLTIQVTPKQGGPGSIVHWHLEYE  305

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K ++ V  P + ++F + V++E+DE+LL
Sbjct  306  KISNEVAHPETLLQFCVEVSKEIDEHLL  333


 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 89/148 (60%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IK+ ++KF  ++      + K  P  I+  +L EGD  +VGS+  W Y+  
Sbjct  348  VGKLETDVEIKASAEKFHHMFTGKPHHVSKASPGNIQGCELHEGDWGTVGSIIFWNYVHD  407

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I G++   +KSF  T+Q +      G+ V W LE+E
Sbjct  408  GEAKVAKERIEAVEPEKNLITFRVIDGDLMKEYKSFLLTIQVTPKQGGPGSIVHWHLEFE  467

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K ++ V  P + ++F + V++E+DE+LL
Sbjct  468  KISEEVAHPETLLQFCVEVSKEIDEHLL  495


 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 86/148 (58%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IK+ + +F  ++      + K  P  I+   L EGD   VGS+  W Y+  
Sbjct  24   VGKLETDVEIKASAGQFHHMFAGKPHHVSKASPGNIQGCDLHEGDWGKVGSIVYWNYVHD  83

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYE  392
            G   +AK++I+AV+ E   +TF +I GE+   +KSF  T+Q +      G+ V W LEYE
Sbjct  84   GEAKVAKERIEAVEPEKNLITFRVIEGELMKEYKSFLLTIQVTPKQGGPGSIVHWHLEYE  143

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K ++ V  P + ++F + V++E+DE+LL
Sbjct  144  KISNEVAHPETLLQFCVEVSKEIDEHLL  171



>gb|EPS70333.1| hypothetical protein M569_04429 [Genlisea aurea]
Length=154

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 91/147 (62%), Gaps = 8/147 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            K+E   ++KS + K ++    +++  PK  P +  S+++LEGDGKS+GSVRL  +  G +
Sbjct  4    KIEVSVELKSDANKIWESIKESANFFPKALPHQYDSIEVLEGDGKSIGSVRLVKFKNGLS  63

Query  240  VIA--KDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQA------SGNSVKWTLEYEK  395
             I+  K+KI   DEE +++++ +I G + NY+ +F+A+L        SG+SVKW+ E+EK
Sbjct  64   EISTTKEKIVDFDEETKTISYTVIDGSLVNYYNNFKASLSVSSINGESGSSVKWSAEFEK  123

Query  396  ANDNVPTPHSHVEFLMNVAREVDEYLL  476
             ++ VP P     F +   +++D +LL
Sbjct  124  TSEQVPDPELIKGFAVKSFQDLDAFLL  150



>ref|XP_010427880.1| PREDICTED: MLP-like protein 43 isoform X2 [Camelina sativa]
Length=290

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 89/148 (60%), Gaps = 7/148 (5%)
 Frame = +3

Query  54   IWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILG  233
            + KLE + +IK+ +++F  ++      + K  P  I+   L EGD   VGS+ +W Y+  
Sbjct  140  VGKLETDVEIKASAEEFHHMWSGRPHHVSKATPGNIQDCVLHEGDWGKVGSIIIWNYVHD  199

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYE  392
            G   +AK++I+AV+ +   +TF +I G++   +KSF  T+Q       SG++V W LEYE
Sbjct  200  GEAKVAKERIEAVEPDKNLITFRVIDGDLMTEYKSFVCTIQVTPKDGGSGSNVHWHLEYE  259

Query  393  KANDNVPTPHSHVEFLMNVAREVDEYLL  476
            K ++ V  P + ++F + V++E+DE+LL
Sbjct  260  KISEEVAHPETLLQFCVEVSKEIDEHLL  287


 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 70/125 (56%), Gaps = 10/125 (8%)
 Frame = +3

Query  132  LLPKICPAKIRSVQLLEGDGKSVG---SVRLWTYI-LGGNVIAKDKIDAVDEENRSVTFA  299
            + PK   A  ++V   +  G  +    S   +T I  G   +AK++I+AV+ EN  +TF 
Sbjct  1    MFPKQLQATFKTVCCTKATGAKLALSSSGTTFTVIQYGKEQVAKERIEAVEPENNLITFR  60

Query  300  LIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKANDNVPTPHSHVEFLMNVAREV  461
            ++ G++   + SF  T+Q +      G+ V W LEYEK +D V  P + ++F + +++E+
Sbjct  61   VLDGDLMKEYTSFVTTIQVTPKHGGPGSIVHWHLEYEKISDEVAHPETLLQFCIEISKEI  120

Query  462  DEYLL  476
            DE+LL
Sbjct  121  DEHLL  125



>ref|XP_010676168.1| PREDICTED: MLP-like protein 31 [Beta vulgaris subsp. vulgaris]
Length=151

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 84/150 (56%), Gaps = 5/150 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M  + K+E E  IK     F  ++      +  I P KI+  Q+ EGD    GS+ LW Y
Sbjct  1    MGVLGKMEVEVDIKCSGDVFHQLWGTKPHHICSITPHKIQGCQVHEGDFGQPGSIVLWNY  60

Query  225  IL-GGNVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEY  389
             L G N  AK  ++A++EEN+ V F +I G +   +KSF  TLQ    A   +VKWT+E+
Sbjct  61   SLEGENCTAKVIVEAIEEENKLVRFKMIEGSILKEYKSFTTTLQVVDKAEITAVKWTVEF  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLLK  479
            EK +D  P P+  ++F++ + R+++ + LK
Sbjct  121  EKFDDYGPYPNKIMDFIIAITRDIEAHHLK  150



>ref|XP_004160106.1| PREDICTED: MLP-like protein 31-like [Cucumis sativus]
Length=125

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 78/119 (66%), Gaps = 6/119 (5%)
 Frame = +3

Query  135  LPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNVIAKDKIDAVDEENRSVTFALIGGE  314
            L ++ P  + + + LEG+  + G++  W+Y + G    K K+D VDE+N+S+T+  + G+
Sbjct  4    LAQMFPKNLHACEFLEGNDFTTGALMQWSYDIVGPAKVKAKVDDVDEQNKSITYEAVEGD  63

Query  315  VTNYFKSFRATLQASGN------SVKWTLEYEKANDNVPTPHSHVEFLMNVAREVDEYL  473
            + +++  FRA  QAS N      +VKWT+E+EKA++N+PTP ++++F+  ++  +D YL
Sbjct  64   ILSHYNFFRAKFQASPNGESGSATVKWTIEFEKADENIPTPEAYLDFVSKLSLGLDAYL  122



>gb|EYU34509.1| hypothetical protein MIMGU_mgv1a026388mg [Erythranthe guttata]
Length=152

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 83/149 (56%), Gaps = 5/149 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            M  I KL   T IKS    F +I+      +P + P  +++  L EG   +VGSV  W Y
Sbjct  1    MGLIGKLVSGTNIKSDGDVFHEIFRERPHHVPDMSPDLVQNCDLHEGQWGTVGSVIFWNY  60

Query  225  ILGGN-VIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ----ASGNSVKWTLEY  389
               G   +AKD I+A+DEE R VTF ++ G++   +K+F+AT+        N V WT +Y
Sbjct  61   THDGKECVAKDIIEAIDEEKRLVTFNMVEGDLMELYKTFKATVHVDTVGEDNLVTWTFDY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYLL  476
            EK N++V  PH+ ++  + + ++++ + L
Sbjct  121  EKLNEDVTEPHTLMDLCIKMTKDIESHHL  149



>ref|XP_002535412.1| Major latex protein, putative [Ricinus communis]
 gb|EEF26971.1| Major latex protein, putative [Ricinus communis]
Length=151

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 85/148 (57%), Gaps = 5/148 (3%)
 Frame = +3

Query  45   MAQIWKLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTY  224
            MA   K+E + +IK+ + KF D+       +    P  I++  L EG+    GSV  W Y
Sbjct  1    MALSGKMEVDVEIKTSADKFHDVMGGRPHHMTIASPQNIQTCDLHEGEFGKKGSVLYWNY  60

Query  225  ILGGNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS----GNSVKWTLEY  389
            +  G   +AK+ ++ +D+ N S TF +I G++   +KSF+  +QA+    G+ V WTL Y
Sbjct  61   VHDGKAKVAKEVVEDIDDVNMSTTFKVIEGDLLKEYKSFKFVVQATPKGKGSIVHWTLVY  120

Query  390  EKANDNVPTPHSHVEFLMNVAREVDEYL  473
            EK N N+P P S +EF ++V +++D +L
Sbjct  121  EKLNANIPEPTSMLEFAVDVTKDIDAHL  148



>ref|XP_010415773.1| PREDICTED: MLP-like protein 28 isoform X1 [Camelina sativa]
Length=320

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 87/146 (60%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGG-  236
            KLE + +IK+ ++KF  ++      + K  P+ I+   L EGD   VGS+ +W Y+  G 
Sbjct  10   KLEIDVEIKASAEKFHHMWAGKPHHVSKATPSNIQDCVLHEGDWGKVGSILIWNYVHDGK  69

Query  237  NVIAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQAS------GNSVKWTLEYEKA  398
              +A ++I+AV+ EN  +TF ++ G++   + SF  T+Q +      G+ V W LEYEK 
Sbjct  70   EQVAHERIEAVEPENNLITFRVLDGDLMKEYTSFVTTIQVTPKHGGPGSIVHWHLEYEKI  129

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            +D V  P + ++F + +++E+DE+LL
Sbjct  130  SDEVAHPETLLQFCIEISKEIDEHLL  155


 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 87/146 (60%), Gaps = 7/146 (5%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGN  239
            KLE + +IK+ ++KF  ++      + K  P  I+   L EGD   VGS+ +W Y+  G 
Sbjct  172  KLETDVEIKASAEKFHHMWSGKPHHVSKATPGNIQDCVLHEGDWGKVGSILIWNYVHDGE  231

Query  240  V-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYEKA  398
              +AK+KI+AV+ +   +TF +I G++   +KSF  T+Q       SG++V W LEYEK 
Sbjct  232  AKVAKEKIEAVEPDKNLITFRVIDGDLMKEYKSFVFTIQVTPKDGGSGSNVHWHLEYEKI  291

Query  399  NDNVPTPHSHVEFLMNVAREVDEYLL  476
            ++ V  P + ++  + +++E+DE+LL
Sbjct  292  SEEVAHPETLLQLCVEISKEIDEHLL  317



>ref|XP_002862771.1| hypothetical protein ARALYDRAFT_497302 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39029.1| hypothetical protein ARALYDRAFT_497302 [Arabidopsis lyrata subsp. 
lyrata]
Length=245

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 83/147 (56%), Gaps = 15/147 (10%)
 Frame = +3

Query  81   IKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEGDGKSVGSVRLWTYILGGNV------  242
            IK+ ++KF  ++      + K  P KI+S  L EGD  +VGSV  W YI G         
Sbjct  96   IKASAQKFHHMFAGKPHHVSKATPDKIQSCDLHEGDWGTVGSVVFWNYIHGKPTLYTCYG  155

Query  243  ---IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYEK  395
               +AK++I+AVD E   +TF +I G++   +KSF  T+Q       SG+ V W  EYEK
Sbjct  156  EAKVAKERIEAVDPEKNLITFRVIEGDLMKEYKSFVITIQVTPKHGGSGSVVHWHFEYEK  215

Query  396  ANDNVPTPHSHVEFLMNVAREVDEYLL  476
             N+ V  P + ++F + +++E+DE+LL
Sbjct  216  INEEVAHPETLLQFAVEISKEIDEHLL  242


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 44/69 (64%), Gaps = 6/69 (9%)
 Frame = +3

Query  288  VTFALIGGEVTNYFKSFRATLQ------ASGNSVKWTLEYEKANDNVPTPHSHVEFLMNV  449
            +TF +I G++   +KSF  T+Q       SG+ V W LEYEK +D V  P + ++F + V
Sbjct  10   ITFRVIEGDLMKEYKSFVITIQVTPKHGGSGSIVHWHLEYEKISDEVAHPETLLQFCVEV  69

Query  450  AREVDEYLL  476
            ++E+DE+LL
Sbjct  70   SKEIDEHLL  78



>gb|AFK42542.1| unknown [Lotus japonicus]
Length=153

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 88/148 (59%), Gaps = 9/148 (6%)
 Frame = +3

Query  60   KLEFETQIKSPSKKFFDIYLNNSSLLPKICPAKIRSVQLLEG-DGKSVGS-VRLWTYILG  233
            KL  E  IK+P+ KF+D++      +   C  ++   +L EG D   VGS +R WTY++ 
Sbjct  6    KLSTEIGIKAPAAKFYDLFAKQLHDVQNHCE-RVHHTKLHEGEDWHEVGSALRHWTYVID  64

Query  234  GNV-IAKDKIDAVDEENRSVTFALIGGEVTNYFKSFRATLQASGN-----SVKWTLEYEK  395
            G V   +++I++VDEEN+++ ++L  G++  ++K+F  TLQ   N     +VKWT+EYE 
Sbjct  65   GEVHTCQERIESVDEENKTIKYSLFDGDIGQHYKTFLLTLQVIENKDGHDTVKWTVEYEM  124

Query  396  ANDNVPTPHSHVEFLMNVAREVDEYLLK  479
             ++    PH  +E++    R++D  LLK
Sbjct  125  HHEEKEPPHGWMEYVHKCTRDIDANLLK  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1450662993712