BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15742_g1_i1 len=177 path=[440:0-24 465:25-49 1505:50-176]

Length=177
                                                                      Score     E

ref|XP_009805061.1|  PREDICTED: uncharacterized protein LOC104250...  46.6    2e-04   
ref|XP_009805062.1|  PREDICTED: uncharacterized protein LOC104250...  46.6    3e-04   



>ref|XP_009805061.1| PREDICTED: uncharacterized protein LOC104250190 isoform X1 [Nicotiana 
sylvestris]
Length=275

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 5/58 (9%)
 Frame = +1

Query  1    LPSPSWGHCQRRSKPTTSTSRKKGSRWKYRHV*PVSPTTPLSYTSGAASPSDGDFDES  174
            LP  SWGH Q RSKP++ + +K      Y      SP TPLS++ GA SPSD  +DES
Sbjct  60   LPLSSWGHRQPRSKPSSMSVKKA-----YTSTTRCSPITPLSWSGGAGSPSDDGYDES  112



>ref|XP_009805062.1| PREDICTED: uncharacterized protein LOC104250190 isoform X2 [Nicotiana 
sylvestris]
Length=274

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 5/58 (9%)
 Frame = +1

Query  1    LPSPSWGHCQRRSKPTTSTSRKKGSRWKYRHV*PVSPTTPLSYTSGAASPSDGDFDES  174
            LP  SWGH Q RSKP++ + +K      Y      SP TPLS++ GA SPSD  +DES
Sbjct  60   LPLSSWGHRQPRSKPSSMSVKKA-----YTSTTRCSPITPLSWSGGAGSPSDDGYDES  112



Lambda      K        H        a         alpha
   0.317    0.129    0.432    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509996894868