BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15726_g1_i1 len=677 path=[655:0-676]

Length=677
                                                                      Score     E

ref|XP_010322147.1|  PREDICTED: uncharacterized protein LOC104647946  94.7    3e-20   
ref|XP_009759688.1|  PREDICTED: uncharacterized protein LOC104212178  89.0    6e-18   
ref|XP_009606475.1|  PREDICTED: uncharacterized protein LOC104100834  88.2    1e-17   
ref|XP_006361307.1|  PREDICTED: probable protein phosphatase DDB_...  86.7    3e-17   
ref|XP_011013260.1|  PREDICTED: uncharacterized protein LOC105117337  77.8    4e-14   
ref|XP_006376022.1|  hypothetical protein POPTR_0013s08070g           77.0    4e-14   
ref|XP_006387606.1|  hypothetical protein POPTR_0785s00200g           77.4    7e-14   
ref|XP_006435865.1|  hypothetical protein CICLE_v10033390mg           73.9    1e-12   
gb|KDO44310.1|  hypothetical protein CISIN_1g026911mg                 73.6    1e-12   
emb|CDP13930.1|  unnamed protein product                              72.8    2e-12   
ref|XP_002274295.1|  PREDICTED: uncharacterized protein LOC100245000  72.4    3e-12   Vitis vinifera
gb|KDP21679.1|  hypothetical protein JCGZ_03350                       70.1    2e-11   
ref|XP_002520838.1|  conserved hypothetical protein                   70.1    3e-11   Ricinus communis
ref|XP_007011231.1|  Uncharacterized protein TCM_045439               68.6    8e-11   
ref|XP_007033579.1|  Uncharacterized protein TCM_019750               67.8    9e-11   
gb|KGN45825.1|  hypothetical protein Csa_6G014460                     67.0    3e-10   
gb|KDO49651.1|  hypothetical protein CISIN_1g047557mg                 66.2    5e-10   
ref|XP_008782626.1|  PREDICTED: uncharacterized protein LOC103702108  65.5    7e-10   
ref|XP_010256943.1|  PREDICTED: uncharacterized serine-rich prote...  65.1    1e-09   
ref|XP_008456766.1|  PREDICTED: uncharacterized serine-rich prote...  65.1    1e-09   
ref|XP_010264463.1|  PREDICTED: putative protein TPRXL                64.7    1e-09   
ref|XP_008456767.1|  PREDICTED: uncharacterized serine-rich prote...  65.1    1e-09   
ref|XP_006843738.1|  hypothetical protein AMTR_s00007p00226200        63.9    2e-09   
ref|XP_006429545.1|  hypothetical protein CICLE_v10012858mg           63.9    2e-09   
ref|XP_009406881.1|  PREDICTED: uncharacterized protein LOC103989...  63.5    2e-09   
gb|EAY72678.1|  hypothetical protein OsI_00544                        62.0    3e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_009406880.1|  PREDICTED: uncharacterized protein LOC103989...  63.5    3e-09   
ref|XP_010937980.1|  PREDICTED: protein MTL1-like                     63.5    4e-09   
ref|XP_010653357.1|  PREDICTED: uncharacterized protein LOC100253378  62.8    6e-09   
ref|XP_010068926.1|  PREDICTED: putative protein TPRXL                62.8    7e-09   
ref|XP_011095231.1|  PREDICTED: uncharacterized protein LOC105174742  62.4    1e-08   
emb|CDP06405.1|  unnamed protein product                              63.2    1e-08   
ref|XP_009403858.1|  PREDICTED: uncharacterized protein LOC103987319  61.6    1e-08   
ref|XP_010042241.1|  PREDICTED: uncharacterized protein LOC104431244  62.0    1e-08   
gb|EEE53930.1|  hypothetical protein OsJ_00509                        62.0    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010087060.1|  hypothetical protein L484_012305                 62.4    1e-08   
ref|XP_008810578.1|  PREDICTED: uncharacterized serine-rich prote...  61.6    2e-08   
ref|XP_007141707.1|  hypothetical protein PHAVU_008G218400g           61.2    2e-08   
gb|AFK35843.1|  unknown                                               60.8    2e-08   
ref|NP_001042116.1|  Os01g0166500                                     62.0    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009402406.1|  PREDICTED: uncharacterized protein LOC103986202  60.5    3e-08   
ref|XP_008776454.1|  PREDICTED: putative protein TPRXL                60.5    5e-08   
ref|XP_009386942.1|  PREDICTED: putative protein TPRXL                59.7    6e-08   
ref|XP_010922694.1|  PREDICTED: uncharacterized protein LOC105045945  59.7    7e-08   
gb|EMT07122.1|  hypothetical protein F775_10211                       60.1    7e-08   
gb|KDP22787.1|  hypothetical protein JCGZ_00374                       59.7    7e-08   
ref|XP_003616759.1|  hypothetical protein MTR_5g083970                60.5    9e-08   
ref|XP_009414267.1|  PREDICTED: uncharacterized protein LOC103995411  58.9    9e-08   
ref|XP_002309177.1|  hypothetical protein POPTR_0006s10780g           59.3    1e-07   Populus trichocarpa [western balsam poplar]
gb|AES99717.2|  hypothetical protein MTR_5g083970                     59.7    1e-07   
ref|XP_011003591.1|  PREDICTED: uncharacterized protein LOC105110296  59.3    1e-07   
ref|XP_010921103.1|  PREDICTED: uncharacterized protein LOC105044792  59.3    1e-07   
ref|XP_003545646.1|  PREDICTED: uncharacterized protein LOC100791876  58.9    1e-07   
ref|XP_002323658.1|  hypothetical protein POPTR_0016s14070g           59.3    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011019026.1|  PREDICTED: uncharacterized protein LOC105121874  58.9    1e-07   
ref|NP_001235112.1|  uncharacterized protein LOC100527370             58.2    2e-07   
ref|XP_009391685.1|  PREDICTED: putative protein TPRXL                58.5    2e-07   
ref|XP_009392749.1|  PREDICTED: uncharacterized protein LOC103978626  57.4    3e-07   
ref|XP_007163613.1|  hypothetical protein PHAVU_001G249100g           57.4    4e-07   
ref|XP_006645533.1|  PREDICTED: trinucleotide repeat-containing g...  58.5    4e-07   
ref|XP_010104234.1|  hypothetical protein L484_016377                 57.0    8e-07   
ref|NP_001146509.1|  uncharacterized protein LOC100280099             57.4    9e-07   Zea mays [maize]
gb|AES71291.2|  hypothetical protein MTR_3g072360                     56.6    1e-06   
gb|KHN31333.1|  hypothetical protein glysoja_022987                   56.6    1e-06   
ref|XP_008245149.1|  PREDICTED: uncharacterized serine-rich prote...  56.6    1e-06   
ref|XP_007207869.1|  hypothetical protein PRUPE_ppa022321mg           56.2    1e-06   
gb|EYU41995.1|  hypothetical protein MIMGU_mgv1a012823mg              57.4    1e-06   
ref|NP_001236778.1|  uncharacterized protein LOC100526978             56.2    1e-06   
gb|EEC70004.1|  hypothetical protein OsI_00543                        55.8    1e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_008464261.1|  PREDICTED: uncharacterized protein LOC103502186  55.5    2e-06   
ref|XP_009775411.1|  PREDICTED: YLP motif-containing protein 1-like   55.8    2e-06   
ref|XP_004500549.1|  PREDICTED: uncharacterized protein LOC101491046  55.5    2e-06   
ref|XP_004977137.1|  PREDICTED: uncharacterized protein LOC101778331  56.2    2e-06   
ref|XP_003623569.1|  hypothetical protein MTR_7g072540                56.2    2e-06   
gb|AFK35441.1|  unknown                                               55.5    3e-06   
gb|ABK22853.1|  unknown                                               54.7    5e-06   Picea sitchensis
ref|XP_003601040.1|  hypothetical protein MTR_3g072360                56.2    5e-06   
ref|XP_011076818.1|  PREDICTED: uncharacterized protein LOC105160970  55.1    5e-06   
gb|ACG36243.1|  hypothetical protein                                  54.7    7e-06   Zea mays [maize]
ref|XP_009385271.1|  PREDICTED: uncharacterized protein LOC103972652  54.3    8e-06   
gb|KGN54437.1|  hypothetical protein Csa_4G329820                     53.5    8e-06   
ref|XP_008656136.1|  PREDICTED: proteasomal ubiquitin receptor AD...  54.7    9e-06   
ref|NP_001167907.1|  hypothetical protein                             54.7    9e-06   Zea mays [maize]
gb|AFK46428.1|  unknown                                               52.4    1e-05   
ref|NP_001142437.1|  uncharacterized protein LOC100274624             54.7    1e-05   Zea mays [maize]
emb|CDM81447.1|  unnamed protein product                              54.3    1e-05   
ref|XP_010650827.1|  PREDICTED: uncharacterized protein LOC104879517  53.5    1e-05   
ref|XP_010683548.1|  PREDICTED: uncharacterized protein LOC104898203  53.5    1e-05   
ref|XP_003568850.1|  PREDICTED: uncharacterized protein LOC100826757  53.5    2e-05   
ref|XP_009371987.1|  PREDICTED: uncharacterized protein LOC103961183  53.1    2e-05   
ref|XP_004506443.1|  PREDICTED: uncharacterized protein LOC101509538  53.1    2e-05   
ref|XP_006591399.1|  PREDICTED: putative protein TPRXL-like isofo...  53.1    2e-05   
gb|EAY96676.1|  hypothetical protein OsI_18595                        53.5    2e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001054746.1|  Os05g0165500                                     53.5    2e-05   Oryza sativa Japonica Group [Japonica rice]
gb|KHN04811.1|  hypothetical protein glysoja_031911                   52.8    3e-05   
ref|XP_003538503.1|  PREDICTED: putative protein TPRXL-like isofo...  52.8    3e-05   
ref|XP_004492540.1|  PREDICTED: uncharacterized protein LOC101490888  52.4    3e-05   
ref|XP_003552301.1|  PREDICTED: uncharacterized protein LOC100801292  52.4    4e-05   
ref|XP_009419814.1|  PREDICTED: uncharacterized protein LOC103999714  52.0    4e-05   
ref|NP_001144660.1|  uncharacterized protein LOC100277685             52.8    4e-05   Zea mays [maize]
ref|NP_001044668.1|  Os01g0824900                                     52.0    7e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007134683.1|  hypothetical protein PHAVU_010G067300g           50.8    8e-05   
ref|XP_006655407.1|  PREDICTED: uncharacterized protein LOC102721368  51.2    1e-04   
ref|XP_003534652.2|  PREDICTED: uncharacterized protein LOC100813546  50.8    2e-04   
ref|XP_007140133.1|  hypothetical protein PHAVU_008G086700g           49.7    3e-04   
ref|XP_004511125.1|  PREDICTED: uncharacterized protein LOC101502082  49.7    3e-04   
ref|XP_010451937.1|  PREDICTED: uncharacterized protein LOC104734127  49.7    3e-04   
ref|XP_003522007.1|  PREDICTED: uncharacterized protein LOC100789329  49.7    3e-04   
ref|XP_010490509.1|  PREDICTED: uncharacterized protein LOC104768279  49.7    4e-04   
ref|NP_001145159.1|  uncharacterized protein LOC100278394             50.1    4e-04   Zea mays [maize]
ref|XP_006288717.1|  hypothetical protein CARUB_v10002028mg           49.7    4e-04   
ref|XP_008663495.1|  PREDICTED: uncharacterized protein LOC103641970  50.1    4e-04   
ref|XP_003516426.1|  PREDICTED: uncharacterized protein LOC100783232  49.3    4e-04   
ref|XP_002440677.1|  hypothetical protein SORBIDRAFT_09g004950        50.1    4e-04   Sorghum bicolor [broomcorn]
gb|AFG46799.1|  hypothetical protein 0_6473_01                        48.5    4e-04   
gb|AFG46802.1|  hypothetical protein 0_6473_01                        48.5    4e-04   
ref|XP_008674877.1|  PREDICTED: uncharacterized protein LOC103651058  50.1    4e-04   
emb|CDX70623.1|  BnaC03g07070D                                        49.3    5e-04   
ref|XP_002456559.1|  hypothetical protein SORBIDRAFT_03g038400        49.7    5e-04   Sorghum bicolor [broomcorn]
gb|KHN29525.1|  hypothetical protein glysoja_005249                   49.3    5e-04   
gb|AFG46798.1|  hypothetical protein 0_6473_01                        48.5    5e-04   
ref|XP_006644930.1|  PREDICTED: uncharacterized protein LOC102711483  49.3    5e-04   
dbj|BAK01315.1|  predicted protein                                    49.7    5e-04   
ref|NP_001145319.1|  hypothetical protein                             49.7    6e-04   Zea mays [maize]
ref|XP_007149871.1|  hypothetical protein PHAVU_005G105700g           47.8    7e-04   
gb|EMS64810.1|  hypothetical protein TRIUR3_20305                     47.4    8e-04   
emb|CDM84790.1|  unnamed protein product                              47.8    8e-04   
ref|XP_007221127.1|  hypothetical protein PRUPE_ppa018358mg           48.9    9e-04   
gb|ACU23630.1|  unknown                                               48.5    0.001   Glycine max [soybeans]
ref|XP_004970406.1|  PREDICTED: uncharacterized protein LOC101777604  48.5    0.001   



>ref|XP_010322147.1| PREDICTED: uncharacterized protein LOC104647946 [Solanum lycopersicum]
Length=184

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +2

Query  35   HGEQEFLIIKPDDKFFSRLLSKEK-AKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPK  211
            H   +FL+IK DDKFFSRLLSKE  AKGGG G+SS R+YY  G SGSIPF WESQPGTPK
Sbjct  12   HHSADFLLIKQDDKFFSRLLSKETSAKGGGVGESSFRYYYCGGSSGSIPFVWESQPGTPK  71

Query  212  HALPD  226
            H   D
Sbjct  72   HKFSD  76



>ref|XP_009759688.1| PREDICTED: uncharacterized protein LOC104212178 [Nicotiana sylvestris]
Length=205

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M S GSH   +FL+IK DDKFFSRLLSKE       G+SS R+YY  G SGSIPF WESQ
Sbjct  1    MVSGGSHHPADFLLIKQDDKFFSRLLSKENT---ARGESSFRYYYCGGSSGSIPFVWESQ  57

Query  197  PGTPKHALPD  226
            PGTPKH   D
Sbjct  58   PGTPKHKFSD  67



>ref|XP_009606475.1| PREDICTED: uncharacterized protein LOC104100834 [Nicotiana tomentosiformis]
Length=205

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M + GSH   +FL+IK DDKFFSRLLSKE       G+SS R+YY  G SGSIPF WESQ
Sbjct  1    MVNGGSHHPADFLLIKQDDKFFSRLLSKENT---ARGESSFRYYYCGGSSGSIPFVWESQ  57

Query  197  PGTPKHALPD  226
            PGTPKH   D
Sbjct  58   PGTPKHKFSD  67



>ref|XP_006361307.1| PREDICTED: probable protein phosphatase DDB_G0282105-like [Solanum 
tuberosum]
Length=195

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +2

Query  35   HGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
            H   +FL+IK DDKFFSRLLSKE      GG+SS R+YY  G SGSIPF WESQPGTPKH
Sbjct  11   HHSADFLLIKQDDKFFSRLLSKEST--AKGGESSFRYYYCGGSSGSIPFVWESQPGTPKH  68

Query  215  ALPD  226
               D
Sbjct  69   KFSD  72



>ref|XP_011013260.1| PREDICTED: uncharacterized protein LOC105117337 [Populus euphratica]
Length=199

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 52/79 (66%), Gaps = 7/79 (9%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M S G    Q+ L IK +DKFF+R++SKE +      +SS R YY  G SG+IPF WES+
Sbjct  1    MQSDGQEVSQQSLEIKQNDKFFTRIMSKESSMA----NSSNRVYY-GGASGAIPFMWESR  55

Query  197  PGTPKHALPDSCIFNPPLT  253
            PGTPKH   D+CI  PPLT
Sbjct  56   PGTPKHTFADACI--PPLT  72



>ref|XP_006376022.1| hypothetical protein POPTR_0013s08070g [Populus trichocarpa]
 gb|ERP53819.1| hypothetical protein POPTR_0013s08070g [Populus trichocarpa]
Length=150

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 53/79 (67%), Gaps = 7/79 (9%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M S G    Q+ L IK +DKFF+R++SKE +      +SS R YY  G SG+IPF WES+
Sbjct  1    MPSDGQEVSQQSLEIKQNDKFFTRIMSKESSMA----NSSNRVYY-GGASGAIPFMWESR  55

Query  197  PGTPKHALPDSCIFNPPLT  253
            PGTPKH L D+C+  PPLT
Sbjct  56   PGTPKHTLADACL--PPLT  72



>ref|XP_006387606.1| hypothetical protein POPTR_0785s00200g [Populus trichocarpa]
 gb|ERP46520.1| hypothetical protein POPTR_0785s00200g [Populus trichocarpa]
Length=222

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 53/79 (67%), Gaps = 7/79 (9%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M S G    Q+ L IK +DKFF+R++SKE +      +SS R YY  G SG+IPF WES+
Sbjct  1    MPSDGQEVSQQSLEIKQNDKFFTRIMSKESSMA----NSSNRVYY-GGASGAIPFMWESR  55

Query  197  PGTPKHALPDSCIFNPPLT  253
            PGTPKH L D+C+  PPLT
Sbjct  56   PGTPKHTLADACL--PPLT  72



>ref|XP_006435865.1| hypothetical protein CICLE_v10033390mg [Citrus clementina]
 ref|XP_006486516.1| PREDICTED: RNA-binding protein MEX3B-like [Citrus sinensis]
 gb|ESR49105.1| hypothetical protein CICLE_v10033390mg [Citrus clementina]
Length=231

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 6/65 (9%)
 Frame = +2

Query  41   EQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHAL  220
            + + L IK DDKFFSRL+SKE +K     +SS R YY  G SGS+PF WESQPGTPKH L
Sbjct  12   QDQSLQIKQDDKFFSRLMSKESSKA----NSSSRVYY-GGASGSVPFTWESQPGTPKHTL  66

Query  221  -PDSC  232
              D+C
Sbjct  67   FNDNC  71



>gb|KDO44310.1| hypothetical protein CISIN_1g026911mg [Citrus sinensis]
Length=231

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 66/112 (59%), Gaps = 12/112 (11%)
 Frame = +2

Query  41   EQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHAL  220
            + + L IK DDKFFSRL+SKE +K     +SS R YY  G SGS+PF WESQPGTPKH L
Sbjct  12   QDQSLQIKQDDKFFSRLMSKESSKA----NSSSRVYY-GGASGSVPFTWESQPGTPKHTL  66

Query  221  -PDSCIFNPPLTpppsfhssaaaahpksMQK--QPSKTKLFLSNFPGKLARS  367
              D+C     L P     S  + +   ++QK  +P+ T   LSN   +L RS
Sbjct  67   FNDNC----TLPPLTPPPSYQSISKSNTLQKSDKPNNTNSLLSNIFPRLIRS  114



>emb|CDP13930.1| unnamed protein product [Coffea canephora]
Length=206

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 61/115 (53%), Gaps = 8/115 (7%)
 Frame = +2

Query  47   EFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPD  226
             FL IK DDKFFSRLLSKE +K     ++S R  Y  G SGSIPF WESQPGTPKH   D
Sbjct  12   RFLQIKQDDKFFSRLLSKESSKRE---EASFRVLYYGGNSGSIPFMWESQPGTPKHTFSD  68

Query  227  SCIFNPPLTpppsfhssaaaahpksMQKQPSKTKLFLSNFPGKLARSSSTPAGDF  391
                N      P      +    K+MQK  SK   F S FP   ++ S+  +  F
Sbjct  69   ----NSLPPLTPPPSYQLSTPRMKTMQKH-SKPNFFYSIFPRASSKKSAGKSASF  118



>ref|XP_002274295.1| PREDICTED: uncharacterized protein LOC100245000 [Vitis vinifera]
Length=206

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 47/73 (64%), Gaps = 5/73 (7%)
 Frame = +2

Query  35   HGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
            H  QE L IK + + FSRLLSKE +      +SS R  Y AG SG++PF WE QPGTPKH
Sbjct  8    HLPQESLQIKEEGRLFSRLLSKESSMA----NSSYRVLYYAGASGAVPFMWEIQPGTPKH  63

Query  215  ALPDSCIFNPPLT  253
             L D+ +  PPLT
Sbjct  64   TLSDTSLI-PPLT  75



>gb|KDP21679.1| hypothetical protein JCGZ_03350 [Jatropha curcas]
Length=229

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 47/72 (65%), Gaps = 7/72 (10%)
 Frame = +2

Query  38   GEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHA  217
              Q+ L IK DDKFF+R++SKE +      +SS R YYR   S +IPF WES+PGTPKH 
Sbjct  9    ASQKSLQIKQDDKFFTRIMSKEISIA----NSSSRVYYR-DVSSAIPFDWESRPGTPKHT  63

Query  218  LPDSCIFNPPLT  253
              D+ I  PPLT
Sbjct  64   FSDTSI--PPLT  73



>ref|XP_002520838.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41547.1| conserved hypothetical protein [Ricinus communis]
Length=233

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 55/83 (66%), Gaps = 9/83 (11%)
 Frame = +2

Query  17   MFSSG-SHGE--QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHW  187
            M SSG SH E  QE L IK D+KFF+R++SKE +      +SS R YY  G SG++PF W
Sbjct  1    MQSSGRSHDELNQESLEIKKDEKFFTRIMSKETSMA----NSSCRVYY-GGASGAVPFTW  55

Query  188  ESQPGTPKH-ALPDSCIFNPPLT  253
            ES+PGTPKH +  D+    PPLT
Sbjct  56   ESRPGTPKHTSFADNTSNIPPLT  78



>ref|XP_007011231.1| Uncharacterized protein TCM_045439 [Theobroma cacao]
 gb|EOY20041.1| Uncharacterized protein TCM_045439 [Theobroma cacao]
Length=217

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 42/61 (69%), Gaps = 5/61 (8%)
 Frame = +2

Query  44   QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALP  223
            Q+ L IK DDKFFSRL+SKE +      +SS R YY  G SG++PF WESQPGTPKH   
Sbjct  12   QKGLQIKQDDKFFSRLMSKETSMA----NSSCRVYY-GGASGAVPFMWESQPGTPKHPCS  66

Query  224  D  226
            D
Sbjct  67   D  67



>ref|XP_007033579.1| Uncharacterized protein TCM_019750 [Theobroma cacao]
 gb|EOY04505.1| Uncharacterized protein TCM_019750 [Theobroma cacao]
Length=186

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 47/72 (65%), Gaps = 6/72 (8%)
 Frame = +2

Query  17   MFSSG-SHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWES  193
            MFS+   H ++  L IK DDKFFSRLLSKE +      + S R YY  G SG++PF WES
Sbjct  1    MFSTSPDHPQKSTLQIKRDDKFFSRLLSKENSVA----NPSFRVYY-GGVSGAVPFMWES  55

Query  194  QPGTPKHALPDS  229
            QPGTPK+   D+
Sbjct  56   QPGTPKYTFSDA  67



>gb|KGN45825.1| hypothetical protein Csa_6G014460 [Cucumis sativus]
Length=232

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 46/71 (65%), Gaps = 6/71 (8%)
 Frame = +2

Query  41   EQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHAL  220
            ++ F I K +DKFF+R LSKE        +SS R YY  G +G+IPF WES+PGTPKH  
Sbjct  11   QKSFPITKHEDKFFTRALSKEL---NSTTNSSFRVYY-GGATGAIPFRWESRPGTPKHTF  66

Query  221  PDSCIFNPPLT  253
             D+ I  PPLT
Sbjct  67   SDTSI--PPLT  75



>gb|KDO49651.1| hypothetical protein CISIN_1g047557mg, partial [Citrus sinensis]
Length=223

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 46/76 (61%), Gaps = 11/76 (14%)
 Frame = +2

Query  14   KMFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWES  193
            KMFS+     Q  + IK DDKFF RLLSKE +      + SLR YY  G +G++PF WES
Sbjct  33   KMFSASQDHSQNLIQIKQDDKFFLRLLSKESSM----ANPSLRVYYGEG-AGAVPFMWES  87

Query  194  QPGTPKHALPDSCIFN  241
            +PGTPK      C FN
Sbjct  88   RPGTPK------CSFN  97



>ref|XP_008782626.1| PREDICTED: uncharacterized protein LOC103702108 [Phoenix dactylifera]
Length=205

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 5/68 (7%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M S  S   QE L I+ DDKF++RLLSKE +      +SSLR YY    +GS+PF WES+
Sbjct  1    MLSKSSDIAQESLQIRQDDKFYTRLLSKESSPA----NSSLRVYYGVA-TGSVPFLWESR  55

Query  197  PGTPKHAL  220
            PGTPK+ +
Sbjct  56   PGTPKNTI  63



>ref|XP_010256943.1| PREDICTED: uncharacterized serine-rich protein C215.13 [Nelumbo 
nucifera]
Length=218

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 4/58 (7%)
 Frame = +2

Query  53   LIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPD  226
            L IK DDKFF+RLLSKE +       SS R YY  G +G++PF WESQPGTPK+   D
Sbjct  13   LQIKQDDKFFTRLLSKESSMANS---SSFRVYY-GGATGAVPFMWESQPGTPKYTFSD  66



>ref|XP_008456766.1| PREDICTED: uncharacterized serine-rich protein C215.13 isoform 
X1 [Cucumis melo]
Length=232

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 6/66 (9%)
 Frame = +2

Query  56   IIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPDSCI  235
            I K +D+FF+R LSKE        +SS R YY  G +G+IPF WES+PGTPKH   D+ I
Sbjct  16   ITKHEDRFFTRALSKEL---NSTTNSSFRVYY-GGATGAIPFRWESRPGTPKHTFSDTSI  71

Query  236  FNPPLT  253
              PPLT
Sbjct  72   --PPLT  75



>ref|XP_010264463.1| PREDICTED: putative protein TPRXL [Nelumbo nucifera]
Length=196

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 40/61 (66%), Gaps = 5/61 (8%)
 Frame = +2

Query  44   QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALP  223
            Q+ L IK D+KFF+RLLSKE +      +SS R YY  G  G +PF WESQPGTPKH   
Sbjct  10   QKSLQIKQDNKFFTRLLSKENSMT----NSSFRVYY-GGAKGEVPFMWESQPGTPKHTFS  64

Query  224  D  226
            D
Sbjct  65   D  65



>ref|XP_008456767.1| PREDICTED: uncharacterized serine-rich protein C215.13 isoform 
X2 [Cucumis melo]
Length=229

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 6/66 (9%)
 Frame = +2

Query  56   IIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPDSCI  235
            I K +D+FF+R LSKE        +SS R YY  G +G+IPF WES+PGTPKH   D+ I
Sbjct  16   ITKHEDRFFTRALSKEL---NSTTNSSFRVYY-GGATGAIPFRWESRPGTPKHTFSDTSI  71

Query  236  FNPPLT  253
              PPLT
Sbjct  72   --PPLT  75



>ref|XP_006843738.1| hypothetical protein AMTR_s00007p00226200 [Amborella trichopoda]
 gb|ERN05413.1| hypothetical protein AMTR_s00007p00226200 [Amborella trichopoda]
Length=180

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 48/71 (68%), Gaps = 7/71 (10%)
 Frame = +2

Query  41   EQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHAL  220
            +Q  L I+ +DKF++RLLS++ +      +SS R YY  G +GSIPF+WESQPGTPKH+ 
Sbjct  9    DQRKLEIRENDKFYNRLLSRDTSIR----NSSFRVYY-GGATGSIPFNWESQPGTPKHSF  63

Query  221  PDSCIFNPPLT  253
                +  PPLT
Sbjct  64   TSDKL--PPLT  72



>ref|XP_006429545.1| hypothetical protein CICLE_v10012858mg [Citrus clementina]
 ref|XP_006481159.1| PREDICTED: ran-binding protein 10-like [Citrus sinensis]
 gb|ESR42785.1| hypothetical protein CICLE_v10012858mg [Citrus clementina]
Length=190

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 11/75 (15%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            MFS+     Q  + IK DDKFF RLLSKE +      + SLR YY  G +G++PF WES+
Sbjct  1    MFSASQDHSQNLIQIKQDDKFFLRLLSKESSM----ANPSLRVYYGEG-AGAVPFMWESR  55

Query  197  PGTPKHALPDSCIFN  241
            PGTPK      C FN
Sbjct  56   PGTPK------CSFN  64



>ref|XP_009406881.1| PREDICTED: uncharacterized protein LOC103989679 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=171

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 48/82 (59%), Gaps = 7/82 (9%)
 Frame = +2

Query  8    KKKMFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHW  187
            K +M SS S   +  L IK D K +SRLLS E +      +SS R YY    SG++PF W
Sbjct  16   KLRMISSSSELPKPCLQIKQDGKVYSRLLSTESSMA----NSSFRVYYGVA-SGAVPFLW  70

Query  188  ESQPGTPKHALPDSCIFNPPLT  253
            ESQPGTPKH +  S    PPLT
Sbjct  71   ESQPGTPKHTI--SVADLPPLT  90



>gb|EAY72678.1| hypothetical protein OsI_00544 [Oryza sativa Indica Group]
Length=104

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 7/68 (10%)
 Frame = +2

Query  53   LIIKPD-DKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPDS  229
            L +KP   K FS+LLS+E A        S R YY    +GS+PF WESQPGTPK+A+ D+
Sbjct  16   LQLKPAGSKVFSKLLSRESAAAA----PSFRVYYGVASAGSVPFLWESQPGTPKNAMSDA  71

Query  230  CIFNPPLT  253
             +  PPLT
Sbjct  72   VL--PPLT  77



>ref|XP_009406880.1| PREDICTED: uncharacterized protein LOC103989679 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=198

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 48/82 (59%), Gaps = 7/82 (9%)
 Frame = +2

Query  8    KKKMFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHW  187
            K +M SS S   +  L IK D K +SRLLS E +      +SS R YY    SG++PF W
Sbjct  16   KLRMISSSSELPKPCLQIKQDGKVYSRLLSTESSMA----NSSFRVYYGVA-SGAVPFLW  70

Query  188  ESQPGTPKHALPDSCIFNPPLT  253
            ESQPGTPKH +  S    PPLT
Sbjct  71   ESQPGTPKHTI--SVADLPPLT  90



>ref|XP_010937980.1| PREDICTED: protein MTL1-like [Elaeis guineensis]
Length=209

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 43/68 (63%), Gaps = 5/68 (7%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M S  S   Q+ L I+ DDKF+SRLLSKE +      +SS R YY    SGS+PF WESQ
Sbjct  1    MLSKSSDLPQKSLQIRQDDKFYSRLLSKESSPA----NSSFRVYYGVA-SGSVPFLWESQ  55

Query  197  PGTPKHAL  220
            PGTPK  +
Sbjct  56   PGTPKSTI  63



>ref|XP_010653357.1| PREDICTED: uncharacterized protein LOC100253378 [Vitis vinifera]
Length=208

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 5/70 (7%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M  S     Q+ L IK DDKFFSRLLSKE +      + S R YY  G +G++PF WESQ
Sbjct  1    MLRSEQDVPQKRLQIKEDDKFFSRLLSKESSMA----NPSSRVYY-GGVTGAVPFTWESQ  55

Query  197  PGTPKHALPD  226
            PGTPK+   +
Sbjct  56   PGTPKYTFSE  65



>ref|XP_010068926.1| PREDICTED: putative protein TPRXL [Eucalyptus grandis]
Length=218

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 42/69 (61%), Gaps = 6/69 (9%)
 Frame = +2

Query  47   EFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPD  226
            E   IK D KFFSRLLS+E    G   ++S R  Y  G + S+PF WESQPGTPKH   D
Sbjct  13   ETFQIKQDGKFFSRLLSRE----GSVANTSSRLPYYGGAARSVPFTWESQPGTPKHVFSD  68

Query  227  SCIFNPPLT  253
            + +   PLT
Sbjct  69   ASL--RPLT  75



>ref|XP_011095231.1| PREDICTED: uncharacterized protein LOC105174742 [Sesamum indicum]
Length=197

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 5/73 (7%)
 Frame = +2

Query  35   HGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
            H ++ F I   DDKFF+RLLSKE +K     + S R YY      ++PF WE++PGTPKH
Sbjct  10   HHQKSFRIKHDDDKFFTRLLSKESSKS----NPSFRVYYGDHVPSAVPFMWETRPGTPKH  65

Query  215  ALPDSCIFNPPLT  253
                +    PPLT
Sbjct  66   TSSHNSHI-PPLT  77



>emb|CDP06405.1| unnamed protein product [Coffea canephora]
Length=265

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 45/74 (61%), Gaps = 7/74 (9%)
 Frame = +2

Query  2    KKKKKMFSSGSH--GEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSI  175
            K K KM S+G     +     I+PDDKFFSRL+SKE A      + S R YY    SG++
Sbjct  32   KDKIKMLSNGPDFPKKMSLFHIQPDDKFFSRLVSKENA----SANPSFRVYY-GDLSGAV  86

Query  176  PFHWESQPGTPKHA  217
            PF WE++PGTPKH 
Sbjct  87   PFTWETRPGTPKHT  100



>ref|XP_009403858.1| PREDICTED: uncharacterized protein LOC103987319 [Musa acuminata 
subsp. malaccensis]
Length=161

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 43/70 (61%), Gaps = 5/70 (7%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M S  S    + L+ K DDKF SRLLS+E +      + SLR YY    +G++PF WES+
Sbjct  1    MLSRCSELSDDDLLFKQDDKFHSRLLSRENS----SANPSLRVYYGVA-AGAVPFLWESE  55

Query  197  PGTPKHALPD  226
            PGTPK+ + D
Sbjct  56   PGTPKNIISD  65



>ref|XP_010042241.1| PREDICTED: uncharacterized protein LOC104431244 [Eucalyptus grandis]
Length=190

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 44/67 (66%), Gaps = 6/67 (9%)
 Frame = +2

Query  17   MFSSGSHGEQE-FLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWES  193
            MF+ GS   Q+ F +IK DDKFFSRLLSKE +      + S R  Y  G S S+PF WE+
Sbjct  1    MFNGGSDLPQKPFQLIKQDDKFFSRLLSKENS----ASNPSFRVDY-GGVSSSVPFMWET  55

Query  194  QPGTPKH  214
            +PGTPKH
Sbjct  56   RPGTPKH  62



>gb|EEE53930.1| hypothetical protein OsJ_00509 [Oryza sativa Japonica Group]
Length=207

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 7/68 (10%)
 Frame = +2

Query  53   LIIKPD-DKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPDS  229
            L +KP   K FS+LLS+E A        S R YY    +GS+PF WESQPGTPK+A+ D+
Sbjct  17   LQLKPAGSKVFSKLLSRESAAAA----PSFRVYYGVASAGSVPFLWESQPGTPKNAMSDA  72

Query  230  CIFNPPLT  253
             +  PPLT
Sbjct  73   VL--PPLT  78



>ref|XP_010087060.1| hypothetical protein L484_012305 [Morus notabilis]
 gb|EXB25878.1| hypothetical protein L484_012305 [Morus notabilis]
Length=237

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 39/54 (72%), Gaps = 5/54 (9%)
 Frame = +2

Query  59   IKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHAL  220
            IK DDKFFSRLLSKE ++     +SS R YY    +G+IPF WESQPGTPKH L
Sbjct  22   IKQDDKFFSRLLSKETSQP----NSSHRVYY-GEAAGAIPFVWESQPGTPKHTL  70



>ref|XP_008810578.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Phoenix 
dactylifera]
Length=200

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 40/68 (59%), Gaps = 5/68 (7%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M S  S   Q  L IK DDKF+SRLLSKE        + S R YY     GS+PF WESQ
Sbjct  1    MLSRTSSRPQSPLHIKQDDKFYSRLLSKE----SSLANPSFRVYY-GVAPGSVPFRWESQ  55

Query  197  PGTPKHAL  220
            PGTPK A+
Sbjct  56   PGTPKDAV  63



>ref|XP_007141707.1| hypothetical protein PHAVU_008G218400g [Phaseolus vulgaris]
 gb|ESW13701.1| hypothetical protein PHAVU_008G218400g [Phaseolus vulgaris]
Length=193

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 37/52 (71%), Gaps = 4/52 (8%)
 Frame = +2

Query  59   IKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
            IK DD+FFSRL+SKE +K     +SS R +Y    S ++PF WE+QPGTPKH
Sbjct  21   IKEDDRFFSRLMSKETSKA----NSSSRVFYYGETSIAVPFTWEAQPGTPKH  68



>gb|AFK35843.1| unknown [Medicago truncatula]
 gb|KEH29220.1| hypothetical protein MTR_4g029130 [Medicago truncatula]
Length=190

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 48/79 (61%), Gaps = 14/79 (18%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            MF+S    E+  L IK DDKFFSRLLSKE        +S++   +R   S ++PF WESQ
Sbjct  1    MFNSTC--EKSVLQIKQDDKFFSRLLSKE--------NSNIHPSFRV--SLAVPFVWESQ  48

Query  197  PGTPKHALPDSCIFNPPLT  253
            PGTPKH   +  I  PPLT
Sbjct  49   PGTPKHTFSNDTI--PPLT  65



>ref|NP_001042116.1| Os01g0166500 [Oryza sativa Japonica Group]
 dbj|BAB39898.1| P0028E10.1 [Oryza sativa Japonica Group]
 dbj|BAB64804.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04030.1| Os01g0166500 [Oryza sativa Japonica Group]
 dbj|BAG95193.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00786.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 7/68 (10%)
 Frame = +2

Query  53   LIIKPD-DKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPDS  229
            L +KP   K FS+LLS+E A        S R YY    +GS+PF WESQPGTPK+A+ D+
Sbjct  17   LQLKPAGSKVFSKLLSRESA----AAAPSFRVYYGVASAGSVPFLWESQPGTPKNAMSDA  72

Query  230  CIFNPPLT  253
             +  PPLT
Sbjct  73   VL--PPLT  78



>ref|XP_009402406.1| PREDICTED: uncharacterized protein LOC103986202 [Musa acuminata 
subsp. malaccensis]
Length=192

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 40/67 (60%), Gaps = 5/67 (7%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M SS S   +  L IK DDKF+ RLLSKE    G     S R YY    SG++PF WESQ
Sbjct  1    MLSSSSELPRPSLQIKQDDKFYCRLLSKE----GSLTHPSFRVYYGVA-SGAVPFLWESQ  55

Query  197  PGTPKHA  217
            PGTPKH 
Sbjct  56   PGTPKHT  62



>ref|XP_008776454.1| PREDICTED: putative protein TPRXL [Phoenix dactylifera]
Length=207

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 42/66 (64%), Gaps = 5/66 (8%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M S  S   Q+   I+ DDKF++RLLSKE +      +SS R YY    SGS+PF WESQ
Sbjct  1    MLSKSSDLPQKSFQIRQDDKFYTRLLSKESSPA----NSSFRVYYGVA-SGSVPFLWESQ  55

Query  197  PGTPKH  214
            PGTPK+
Sbjct  56   PGTPKN  61



>ref|XP_009386942.1| PREDICTED: putative protein TPRXL [Musa acuminata subsp. malaccensis]
Length=187

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 7/65 (11%)
 Frame = +2

Query  59   IKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPDSCIF  238
            IK DDKF+ RLLSKE +      + SLR YY    + ++PF WESQPGTPKH+  +S   
Sbjct  15   IKEDDKFYGRLLSKESS----AANPSLRAYYGVA-TVAVPFVWESQPGTPKHS--NSAAA  67

Query  239  NPPLT  253
             PPLT
Sbjct  68   MPPLT  72



>ref|XP_010922694.1| PREDICTED: uncharacterized protein LOC105045945 [Elaeis guineensis]
Length=193

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 41/68 (60%), Gaps = 5/68 (7%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M S+ S   Q  L IK DDKF+SRLLSKE        + S R YY     GS+PF WES+
Sbjct  1    MLSNTSSRPQSPLRIKQDDKFYSRLLSKE----SSLANPSFRVYY-GVAPGSVPFLWESE  55

Query  197  PGTPKHAL  220
            PGTPK A+
Sbjct  56   PGTPKAAV  63



>gb|EMT07122.1| hypothetical protein F775_10211 [Aegilops tauschii]
Length=217

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +2

Query  41   EQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHAL  220
            E+E  ++ P+ +   +LLS+   +       S R YY    +G++PF WESQPGTPK+A+
Sbjct  8    EREEAVVHPNARQGGKLLSRLLTRDSSAAAPSFRVYYGVSSAGAVPFLWESQPGTPKNAI  67

Query  221  PDSCIFNPPLT  253
             D+ +  PPLT
Sbjct  68   SDAAM--PPLT  76



>gb|KDP22787.1| hypothetical protein JCGZ_00374 [Jatropha curcas]
Length=192

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 5/56 (9%)
 Frame = +2

Query  53   LIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHAL  220
            L IK DDKFFSRLLSKE        + S R YY  G + ++PF WESQPGTPK++ 
Sbjct  14   LQIKEDDKFFSRLLSKE----SSNANPSFRVYY-GGVNVAVPFIWESQPGTPKYSF  64



>ref|XP_003616759.1| hypothetical protein MTR_5g083970 [Medicago truncatula]
Length=247

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 40/65 (62%), Gaps = 6/65 (9%)
 Frame = +2

Query  59   IKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPDSCIF  238
            IK DDKFF RL SKE        ++S R  Y    S +IPF WE+QPGTPKH L ++ I 
Sbjct  17   IKQDDKFFLRLKSKE----ASSANASSRVMYYGERSVAIPFVWEAQPGTPKHPLSETSI-  71

Query  239  NPPLT  253
             PPLT
Sbjct  72   -PPLT  75



>ref|XP_009414267.1| PREDICTED: uncharacterized protein LOC103995411 [Musa acuminata 
subsp. malaccensis]
Length=166

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 5/54 (9%)
 Frame = +2

Query  53   LIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
            L IK  D+F+SRLLSKE ++     + S R YY A  SG++PF WESQPGTPKH
Sbjct  13   LQIKQGDEFYSRLLSKESSEA----NPSFRVYY-AVASGTVPFLWESQPGTPKH  61



>ref|XP_002309177.1| hypothetical protein POPTR_0006s10780g [Populus trichocarpa]
 gb|EEE92700.1| hypothetical protein POPTR_0006s10780g [Populus trichocarpa]
Length=197

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 40/62 (65%), Gaps = 5/62 (8%)
 Frame = +2

Query  44   QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALP  223
            Q+ L IK DDKFFSRLLS+E +      + S R YY  G S  +PF WESQPGTPK+   
Sbjct  14   QKALQIKQDDKFFSRLLSRESSMA----NPSFRVYY-GGVSVGVPFVWESQPGTPKYTFC  68

Query  224  DS  229
            ++
Sbjct  69   EN  70



>gb|AES99717.2| hypothetical protein MTR_5g083970 [Medicago truncatula]
Length=218

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 40/65 (62%), Gaps = 6/65 (9%)
 Frame = +2

Query  59   IKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPDSCIF  238
            IK DDKFF RL SKE        ++S R  Y    S +IPF WE+QPGTPKH L ++ I 
Sbjct  17   IKQDDKFFLRLKSKE----ASSANASSRVMYYGERSVAIPFVWEAQPGTPKHPLSETSI-  71

Query  239  NPPLT  253
             PPLT
Sbjct  72   -PPLT  75



>ref|XP_011003591.1| PREDICTED: uncharacterized protein LOC105110296 [Populus euphratica]
Length=202

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
 Frame = +2

Query  44   QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHAL  220
            Q+ L +K DDKFFSRL+SKE +      + S R YY  G S ++PF WESQPGTPK+  
Sbjct  13   QKALQMKQDDKFFSRLMSKENSMA----NPSFRVYY-GGVSVAVPFVWESQPGTPKYTF  66



>ref|XP_010921103.1| PREDICTED: uncharacterized protein LOC105044792 [Elaeis guineensis]
Length=209

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 5/65 (8%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M S  S   QE L I+ DDKF++RLLSKE +      + S R YY    +GS+PF WES+
Sbjct  1    MLSKSSDLPQESLEIRQDDKFYTRLLSKESSMA----NPSFRVYYGVA-TGSVPFLWESR  55

Query  197  PGTPK  211
            PGTPK
Sbjct  56   PGTPK  60



>ref|XP_003545646.1| PREDICTED: uncharacterized protein LOC100791876 [Glycine max]
 gb|KHN44725.1| hypothetical protein glysoja_032064 [Glycine soja]
Length=188

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = +2

Query  59   IKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
            IK DD+FFSRL+SKE +      +SS R +Y    S ++PF WE+QPGTPKH
Sbjct  18   IKEDDRFFSRLMSKEISMA----NSSSRVFYYGETSIAVPFMWEAQPGTPKH  65



>ref|XP_002323658.1| hypothetical protein POPTR_0016s14070g [Populus trichocarpa]
 gb|EEF05419.1| hypothetical protein POPTR_0016s14070g [Populus trichocarpa]
Length=202

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
 Frame = +2

Query  44   QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHAL  220
            Q+ L +K DDKFFSRL+SKE +      + S R YY  G S ++PF WESQPGTPK+  
Sbjct  13   QKALEMKQDDKFFSRLMSKENSMA----NPSFRVYY-GGVSVAVPFVWESQPGTPKYTF  66



>ref|XP_011019026.1| PREDICTED: uncharacterized protein LOC105121874 [Populus euphratica]
Length=197

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 5/59 (8%)
 Frame = +2

Query  44   QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHAL  220
            Q+ L IK DDKFFSRLLS+E +      + S R YY  G S  +PF WESQPGTPK+  
Sbjct  14   QKALQIKHDDKFFSRLLSRESSMA----NPSFRVYY-GGVSVGVPFVWESQPGTPKYTF  67



>ref|NP_001235112.1| uncharacterized protein LOC100527370 [Glycine max]
 gb|ACU16458.1| unknown [Glycine max]
Length=168

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 4/52 (8%)
 Frame = +2

Query  59   IKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
            I+ DD+FFSRL+SKE +      +SS R +Y    S ++PF WE+QPGTPKH
Sbjct  18   IEEDDRFFSRLMSKETSMA----NSSSRVFYYGETSIAVPFMWEAQPGTPKH  65



>ref|XP_009391685.1| PREDICTED: putative protein TPRXL [Musa acuminata subsp. malaccensis]
Length=192

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 5/52 (10%)
 Frame = +2

Query  59   IKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
            IK DDKF++R+LSKE +      + S R YY    +G++PF+WESQPGTPKH
Sbjct  15   IKQDDKFYTRILSKESSVA----NPSFRVYY-GMATGAVPFYWESQPGTPKH  61



>ref|XP_009392749.1| PREDICTED: uncharacterized protein LOC103978626 [Musa acuminata 
subsp. malaccensis]
Length=158

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 44/70 (63%), Gaps = 5/70 (7%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M SS S   ++F+ +K DDKF++ L+S+E +      + SL  YY     G++PF WESQ
Sbjct  1    MISSSSEICKDFIQMKQDDKFYTTLISRESS----SANPSLGVYY-GDAKGAVPFLWESQ  55

Query  197  PGTPKHALPD  226
            PGTPK+ + +
Sbjct  56   PGTPKNTISN  65



>ref|XP_007163613.1| hypothetical protein PHAVU_001G249100g [Phaseolus vulgaris]
 gb|ESW35607.1| hypothetical protein PHAVU_001G249100g [Phaseolus vulgaris]
Length=188

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 4/58 (7%)
 Frame = +2

Query  53   LIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPD  226
              I  DD+FFSRL++KE        +SS R  Y  G S ++PF WE+QPGTPKH L +
Sbjct  15   FTITKDDRFFSRLMAKEATTP----NSSSRILYYGGTSVAVPFTWEAQPGTPKHPLSE  68



>ref|XP_006645533.1| PREDICTED: trinucleotide repeat-containing gene 18 protein-like 
[Oryza brachyantha]
Length=249

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 6/61 (10%)
 Frame = +2

Query  71   DKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPDSCIFNPPL  250
             K FS+LLS+E +        S R YY    +GS+PF WESQPGTPK+A+ D+ +  PPL
Sbjct  29   SKVFSKLLSRESSVAA----PSFRVYYGVASAGSVPFMWESQPGTPKNAICDAVL--PPL  82

Query  251  T  253
            T
Sbjct  83   T  83



>ref|XP_010104234.1| hypothetical protein L484_016377 [Morus notabilis]
 gb|EXB99401.1| hypothetical protein L484_016377 [Morus notabilis]
Length=196

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 43/73 (59%), Gaps = 10/73 (14%)
 Frame = +2

Query  44   QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALP  223
            Q+ L I+ DDKFFSRLLSKE +        S R  Y  G  GS+PF WES+PGTPK    
Sbjct  12   QKSLQIEQDDKFFSRLLSKESSMA----YPSSRVLYYGGRPGSVPFLWESEPGTPKS---  64

Query  224  DSCIFN---PPLT  253
             SC +    PPLT
Sbjct  65   KSCGYESLVPPLT  77



>ref|NP_001146509.1| uncharacterized protein LOC100280099 [Zea mays]
 gb|ACL54178.1| unknown [Zea mays]
 gb|AFW77167.1| hypothetical protein ZEAMMB73_499952 [Zea mays]
Length=227

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 45/81 (56%), Gaps = 5/81 (6%)
 Frame = +2

Query  17   MFSSGSHG--EQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWE  190
            MF+  S G  E+  L++K   K  +++LSKE A        S R YY    +G++PF WE
Sbjct  1    MFAMASAGGKEEPGLLVKQGTKLHAKMLSKEAA--AQLAVPSFRVYYSVASAGAVPFLWE  58

Query  191  SQPGTPKHALPDSCIFNPPLT  253
            SQPGTPKH    S    PPLT
Sbjct  59   SQPGTPKHD-SSSAAELPPLT  78



>gb|AES71291.2| hypothetical protein MTR_3g072360 [Medicago truncatula]
Length=183

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (61%), Gaps = 4/62 (6%)
 Frame = +2

Query  41   EQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHAL  220
            E  F I + D +FFSRL+SKE +       SS R +Y    S ++PF WE+QPGTPKH L
Sbjct  16   EMSFRITQ-DGRFFSRLMSKETSNAN---SSSRRVFYYGETSVAVPFMWEAQPGTPKHPL  71

Query  221  PD  226
             +
Sbjct  72   SE  73



>gb|KHN31333.1| hypothetical protein glysoja_022987 [Glycine soja]
Length=191

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 41/74 (55%), Gaps = 8/74 (11%)
 Frame = +2

Query  17   MFSSGS----HGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFH  184
            M S GS    H  +    I  DD FFSRL++KE        +SS R +Y    S ++PF 
Sbjct  1    MLSEGSNNNNHSSKMSFRITKDDGFFSRLMAKEATTP----NSSSRIFYYGETSVAVPFT  56

Query  185  WESQPGTPKHALPD  226
            WE+QPGTPKH L +
Sbjct  57   WEAQPGTPKHPLSE  70



>ref|XP_008245149.1| PREDICTED: uncharacterized serine-rich protein C215.13 [Prunus 
mume]
Length=189

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = +2

Query  68   DDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPD  226
            ++KFFSRLLSKE +      + S + YY  G +GS+PF WESQPGTPKH   D
Sbjct  16   ENKFFSRLLSKESSIA----NPSFKVYY-GGLAGSVPFIWESQPGTPKHTFSD  63



>ref|XP_007207869.1| hypothetical protein PRUPE_ppa022321mg [Prunus persica]
 gb|EMJ09068.1| hypothetical protein PRUPE_ppa022321mg [Prunus persica]
Length=182

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = +2

Query  68   DDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPD  226
            ++KFFSRLLSKE +      + S + YY  G +GS+PF WESQPGTPKH   D
Sbjct  16   ENKFFSRLLSKESSIA----NPSFKVYY-GGLAGSVPFIWESQPGTPKHTFSD  63



>gb|EYU41995.1| hypothetical protein MIMGU_mgv1a012823mg [Erythranthe guttata]
Length=239

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 37/59 (63%), Gaps = 7/59 (12%)
 Frame = +2

Query  38   GEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
             ++ F I   DDKFF+RLLSKE +K      SS R YY    S ++PF WE+ PGTPKH
Sbjct  12   NQKSFRIKHEDDKFFTRLLSKENSK------SSFRVYY-GDVSSAVPFTWETCPGTPKH  63



>ref|NP_001236778.1| uncharacterized protein LOC100526978 [Glycine max]
 gb|ACU16014.1| unknown [Glycine max]
Length=191

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 41/74 (55%), Gaps = 8/74 (11%)
 Frame = +2

Query  17   MFSSGS----HGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFH  184
            M S GS    H  +    I  DD FFSRL++KE        +SS R +Y    S ++PF 
Sbjct  1    MLSEGSNNNNHSSKMSFRITKDDGFFSRLMAKEATTP----NSSSRIFYYGETSVAVPFT  56

Query  185  WESQPGTPKHALPD  226
            WE+QPGTPKH L +
Sbjct  57   WEAQPGTPKHPLSE  70



>gb|EEC70004.1| hypothetical protein OsI_00543 [Oryza sativa Indica Group]
Length=160

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 36/57 (63%), Gaps = 5/57 (9%)
 Frame = +2

Query  53   LIIKPD-DKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHAL  220
            L +KP   K FS+LLS+E A        S R YY    +GS+PF WESQPGTPK+A+
Sbjct  16   LQLKPAGSKVFSKLLSRESA----AAAPSFRVYYGVASAGSVPFLWESQPGTPKNAM  68



>ref|XP_008464261.1| PREDICTED: uncharacterized protein LOC103502186 [Cucumis melo]
Length=166

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 5/66 (8%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M    S   Q+ L  K +DKFFS++LS+E ++     + S R YY  G +G++PF WESQ
Sbjct  1    MVCETSDYPQKSLQFKQNDKFFSKILSRESSRA----NYSSRIYY-GGLAGAVPFVWESQ  55

Query  197  PGTPKH  214
            PGTP H
Sbjct  56   PGTPIH  61



>ref|XP_009775411.1| PREDICTED: YLP motif-containing protein 1-like [Nicotiana sylvestris]
Length=192

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 46/82 (56%), Gaps = 5/82 (6%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDD--KFFS-RLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHW  187
            M SS S   Q+   IK D   KFF+ +LLSKE +K      S  R YY      S+PF W
Sbjct  1    MVSSCSDFLQKSFQIKQDQDTKFFTNKLLSKENSKLANAIPS-FRVYY-GDVPSSVPFIW  58

Query  188  ESQPGTPKHALPDSCIFNPPLT  253
            ESQPGTPKH+L  +    PPLT
Sbjct  59   ESQPGTPKHSLSQTSYNLPPLT  80



>ref|XP_004500549.1| PREDICTED: uncharacterized protein LOC101491046 [Cicer arietinum]
Length=186

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 37/64 (58%), Gaps = 3/64 (5%)
 Frame = +2

Query  35   HGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
            H  +    I  D +FFSR+++KE +       SS R +Y    S ++PF WE+QPGTPKH
Sbjct  10   HSSEMSFRITQDGRFFSRIMAKETSNAN---SSSRRVFYYGESSVAVPFMWEAQPGTPKH  66

Query  215  ALPD  226
             L +
Sbjct  67   PLSE  70



>ref|XP_004977137.1| PREDICTED: uncharacterized protein LOC101778331 [Setaria italica]
Length=219

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 45/81 (56%), Gaps = 5/81 (6%)
 Frame = +2

Query  17   MFSSGSHG--EQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWE  190
            M++  S G  E+  L +K   K  S++LSKE A        S R YY    +G++PF WE
Sbjct  1    MYAMASAGGTEEPALFVKQGSKLHSKMLSKEAA--AQLAVPSFRVYYSVASAGAVPFLWE  58

Query  191  SQPGTPKHALPDSCIFNPPLT  253
            SQPGTPK+  P +    PPLT
Sbjct  59   SQPGTPKNDSPSASAL-PPLT  78



>ref|XP_003623569.1| hypothetical protein MTR_7g072540 [Medicago truncatula]
 gb|AES79787.1| hypothetical protein MTR_7g072540 [Medicago truncatula]
Length=226

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 45/80 (56%), Gaps = 13/80 (16%)
 Frame = +2

Query  17   MFSSGSHGEQEFLI-IKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWES  193
            MFSS S   Q+ ++ IK DDKFF RLL+KE +             +R   +  +PF WES
Sbjct  1    MFSSKSEQPQKTILQIKQDDKFFCRLLTKESSISNPS--------FRVAVT--VPFVWES  50

Query  194  QPGTPKHALPDSCIFNPPLT  253
            QPGTPK+   +  +  PPLT
Sbjct  51   QPGTPKYTFSEKNL--PPLT  68



>gb|AFK35441.1| unknown [Medicago truncatula]
Length=190

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 45/80 (56%), Gaps = 13/80 (16%)
 Frame = +2

Query  17   MFSSGSHGEQEFLI-IKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWES  193
            MFSS S   Q+ ++ IK DDKFF RLL+KE +             +R   +  +PF WES
Sbjct  1    MFSSKSEQPQKTILQIKQDDKFFCRLLTKESSISNPS--------FRVAVT--VPFVWES  50

Query  194  QPGTPKHALPDSCIFNPPLT  253
            QPGTPK+   +  +  PPLT
Sbjct  51   QPGTPKYTFSEKNL--PPLT  68



>gb|ABK22853.1| unknown [Picea sitchensis]
Length=189

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 7/52 (13%)
 Frame = +2

Query  77   FFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPDSC  232
            FFSRLLS+E+A G      S R YYRA   G +PF WE++PG PK A  DSC
Sbjct  81   FFSRLLSREEATG-----YSSRIYYRAPAMGRVPFKWEAEPGKPKTA--DSC  125



>ref|XP_003601040.1| hypothetical protein MTR_3g072360 [Medicago truncatula]
Length=336

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (61%), Gaps = 4/62 (6%)
 Frame = +2

Query  41   EQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHAL  220
            E  F I + D +FFSRL+SKE +       SS R +Y    S ++PF WE+QPGTPKH L
Sbjct  16   EMSFRITQ-DGRFFSRLMSKETS---NANSSSRRVFYYGETSVAVPFMWEAQPGTPKHPL  71

Query  221  PD  226
             +
Sbjct  72   SE  73



>ref|XP_011076818.1| PREDICTED: uncharacterized protein LOC105160970 [Sesamum indicum]
Length=221

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  92   LSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPD  226
            LS+EK      G++S R  Y  G +GS+PF WESQPGTPKH   D
Sbjct  28   LSREKYNSSKQGEASFRVLYYGGAAGSVPFLWESQPGTPKHTFND  72



>gb|ACG36243.1| hypothetical protein [Zea mays]
Length=230

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 45/81 (56%), Gaps = 5/81 (6%)
 Frame = +2

Query  17   MFSSGSHG--EQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWE  190
            MF+  S G   +  L+ K   K  +++LSKE A        S R YY    +G++PF WE
Sbjct  1    MFAMSSAGCKAEPGLLAKQGSKLHAKMLSKEAA--AQLAVPSFRVYYSVASAGAVPFLWE  58

Query  191  SQPGTPKHALPDSCIFNPPLT  253
            SQPGTPK+  P + +  PPLT
Sbjct  59   SQPGTPKNDSPSAAVL-PPLT  78



>ref|XP_009385271.1| PREDICTED: uncharacterized protein LOC103972652 [Musa acuminata 
subsp. malaccensis]
Length=206

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 45/84 (54%), Gaps = 6/84 (7%)
 Frame = +2

Query  2    KKKKKMFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPF  181
            K+ + M +  S      L IK +  F++RLLSKE          S R YY    SGS+PF
Sbjct  3    KRGRDMLAKSSDRPLSPLRIKQEGNFYARLLSKE---SSLSATPSFRVYY-GVSSGSVPF  58

Query  182  HWESQPGTPKHALPDSCIFNPPLT  253
             WESQPGTPK  +  + +  PPLT
Sbjct  59   VWESQPGTPKATVAAAGL--PPLT  80



>gb|KGN54437.1| hypothetical protein Csa_4G329820 [Cucumis sativus]
Length=166

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 40/66 (61%), Gaps = 5/66 (8%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M    S   Q+ L  K +DKF S++LS+E ++     + S R YY  G +G++PF WESQ
Sbjct  1    MVCETSEYPQKSLQFKQNDKFISKILSRESSRA----NYSSRIYY-GGLAGAVPFVWESQ  55

Query  197  PGTPKH  214
            PGTP H
Sbjct  56   PGTPIH  61



>ref|XP_008656136.1| PREDICTED: proteasomal ubiquitin receptor ADRM1-like [Zea mays]
 gb|AFW81421.1| hypothetical protein ZEAMMB73_432518 [Zea mays]
Length=228

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 45/81 (56%), Gaps = 5/81 (6%)
 Frame = +2

Query  17   MFSSGSHG--EQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWE  190
            MF+  S G   +  L+ K   K  +++LSKE A        S R YY    +G++PF WE
Sbjct  1    MFAMSSAGCKAEPGLLAKQGSKLHAKMLSKEAA--AQLAVPSFRVYYSMASAGAVPFLWE  58

Query  191  SQPGTPKHALPDSCIFNPPLT  253
            SQPGTPK+  P + +  PPLT
Sbjct  59   SQPGTPKNDSPSAAVL-PPLT  78



>ref|NP_001167907.1| hypothetical protein [Zea mays]
 gb|ACN26470.1| unknown [Zea mays]
 gb|AFW80118.1| hypothetical protein ZEAMMB73_193442 [Zea mays]
Length=249

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 4/49 (8%)
 Frame = +2

Query  68   DDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
            + K FSRL ++E +        SLR YY    +GS+PF WESQPGTPKH
Sbjct  24   ESKVFSRLFTRESSAAA----PSLRVYYGVASAGSVPFLWESQPGTPKH  68



>gb|AFK46428.1| unknown [Lotus japonicus]
Length=123

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 37/71 (52%), Gaps = 9/71 (13%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            MF      +   L IK DDKFF RLL+KE +             +R   + ++PF WESQ
Sbjct  1    MFKKSEPSQNTVLQIKQDDKFFCRLLTKESSMTNPS--------FRVA-AVTVPFVWESQ  51

Query  197  PGTPKHALPDS  229
            PGTPK+   ++
Sbjct  52   PGTPKYTFSEN  62



>ref|NP_001142437.1| uncharacterized protein LOC100274624 [Zea mays]
 gb|ACG23985.1| hypothetical protein [Zea mays]
Length=254

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 4/49 (8%)
 Frame = +2

Query  68   DDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
            + K FSRL ++E +        SLR YY    +GS+PF WESQPGTPKH
Sbjct  22   ESKVFSRLFTRESSAAA----PSLRVYYGVASAGSVPFLWESQPGTPKH  66



>emb|CDM81447.1| unnamed protein product [Triticum aestivum]
Length=226

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +2

Query  29   GSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTP  208
            G+  ++E  ++ P+ +   +LLS+   +       S R YY    +G++PF WESQPGTP
Sbjct  6    GNGKDREEAVVHPNPRQGGKLLSRLLTRDSSAAAPSFRVYYGVASAGAVPFLWESQPGTP  65

Query  209  KHALPD  226
            K+A+ D
Sbjct  66   KNAVSD  71



>ref|XP_010650827.1| PREDICTED: uncharacterized protein LOC104879517 [Vitis vinifera]
Length=200

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 5/60 (8%)
 Frame = +2

Query  32   SHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPK  211
            S+  Q+ L I+ DD+FFSRLL+KE + G    +SS   Y+    +G +PF WESQPGTPK
Sbjct  7    SNVSQKTLQIEQDDRFFSRLLAKEVSVG----NSSFGVYHGEASAG-VPFTWESQPGTPK  61



>ref|XP_010683548.1| PREDICTED: uncharacterized protein LOC104898203 [Beta vulgaris 
subsp. vulgaris]
Length=207

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 5/56 (9%)
 Frame = +2

Query  50   FLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHA  217
             L IK D+KFFSR L+KE +      + S R YY  G S ++PF WE++PGTPKH 
Sbjct  1    MLPIKEDNKFFSRFLTKESSTA----NPSFRVYY-GGNSVAVPFVWEAKPGTPKHT  51



>ref|XP_003568850.1| PREDICTED: uncharacterized protein LOC100826757 [Brachypodium 
distachyon]
Length=199

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 36/64 (56%), Gaps = 2/64 (3%)
 Frame = +2

Query  62   KPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPDSCIFN  241
            K   K +S++LSK+ A        S R YY    +GS+PF WESQPGTPK +   +    
Sbjct  16   KQGGKVYSKMLSKDAA--AALAVPSFRVYYGVASAGSVPFLWESQPGTPKSSPSAAGALQ  73

Query  242  PPLT  253
            PPLT
Sbjct  74   PPLT  77



>ref|XP_009371987.1| PREDICTED: uncharacterized protein LOC103961183 [Pyrus x bretschneideri]
Length=189

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 7/75 (9%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDD--KFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWE  190
            MFS      ++ L  K DD  KFFS+ LSKE +      + SLR YY  G   ++PF WE
Sbjct  1    MFSGNPDPPKKSLTTKQDDENKFFSKHLSKESSVA----NPSLRVYY-GGLPANVPFVWE  55

Query  191  SQPGTPKHALPDSCI  235
            SQPGTPK+A+ +  +
Sbjct  56   SQPGTPKYAVREDTV  70



>ref|XP_004506443.1| PREDICTED: uncharacterized protein LOC101509538 [Cicer arietinum]
Length=196

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 41/73 (56%), Gaps = 13/73 (18%)
 Frame = +2

Query  17   MFSSGSHGE---QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHW  187
            M SS S  E   +  L IK DDKFFSRLLSKE +      + S R       S ++PF W
Sbjct  1    MLSSNSTREIHQKNVLQIKQDDKFFSRLLSKESS----NCNPSFR------VSVAVPFVW  50

Query  188  ESQPGTPKHALPD  226
            ESQPGTPK+   +
Sbjct  51   ESQPGTPKYTFSE  63



>ref|XP_006591399.1| PREDICTED: putative protein TPRXL-like isoform X2 [Glycine max]
Length=197

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = +2

Query  23   SSGSHGEQEF-LIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQP  199
            SS +H   +    I  +D FFSRL++KE        +SS R +Y    S ++PF WE+QP
Sbjct  5    SSNTHNSSKMSFRITKEDGFFSRLIAKETTTP----NSSSRIFYYGETSVAVPFTWEAQP  60

Query  200  GTPKHALPD  226
            GTPKH L +
Sbjct  61   GTPKHPLSE  69



>gb|EAY96676.1| hypothetical protein OsI_18595 [Oryza sativa Indica Group]
Length=227

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 4/77 (5%)
 Frame = +2

Query  26   SGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGG-GGDSSLRFYYRAGCSGSIPFHWESQPG  202
            + ++G++E + +K   K +SR++SKE A         S R YY    +GS+PF WESQPG
Sbjct  2    ASTNGKEE-VYVKEGSKLYSRMMSKEAAAAAAPLAVPSFRVYYGVASAGSVPFLWESQPG  60

Query  203  TPKHALPDSCIFNPPLT  253
            TPK + P + +  PPLT
Sbjct  61   TPKSS-PSTAVL-PPLT  75



>ref|NP_001054746.1| Os05g0165500 [Oryza sativa Japonica Group]
 gb|AAT69632.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16660.1| Os05g0165500 [Oryza sativa Japonica Group]
 dbj|BAG98594.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62460.1| hypothetical protein OsJ_17256 [Oryza sativa Japonica Group]
Length=227

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 4/77 (5%)
 Frame = +2

Query  26   SGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGG-GDSSLRFYYRAGCSGSIPFHWESQPG  202
            + ++G++E + +K   K +SR++SKE A         S R YY    +GS+PF WESQPG
Sbjct  2    ASTNGKEE-VYVKEGSKLYSRMMSKEAAAAAAPLAVPSFRVYYGVASAGSVPFLWESQPG  60

Query  203  TPKHALPDSCIFNPPLT  253
            TPK + P + +  PPLT
Sbjct  61   TPKSS-PSTAVL-PPLT  75



>gb|KHN04811.1| hypothetical protein glysoja_031911 [Glycine soja]
Length=206

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = +2

Query  23   SSGSHGEQEF-LIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQP  199
            SS +H   +    I  +D FFSRL++KE        +SS R +Y    S ++PF WE+QP
Sbjct  5    SSNTHNSSKMSFRITKEDGFFSRLIAKETTTP----NSSSRIFYYGETSVAVPFTWEAQP  60

Query  200  GTPKHALPD  226
            GTPKH L +
Sbjct  61   GTPKHPLSE  69



>ref|XP_003538503.1| PREDICTED: putative protein TPRXL-like isoform X1 [Glycine max]
Length=203

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = +2

Query  23   SSGSHGEQEF-LIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQP  199
            SS +H   +    I  +D FFSRL++KE        +SS R +Y    S ++PF WE+QP
Sbjct  5    SSNTHNSSKMSFRITKEDGFFSRLIAKETTTP----NSSSRIFYYGETSVAVPFTWEAQP  60

Query  200  GTPKHALPD  226
            GTPKH L +
Sbjct  61   GTPKHPLSE  69



>ref|XP_004492540.1| PREDICTED: uncharacterized protein LOC101490888 [Cicer arietinum]
Length=194

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 39/69 (57%), Gaps = 11/69 (16%)
 Frame = +2

Query  17   MFSSGSHGEQEFLI-IKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWES  193
            MFSS S   Q+ ++ IK DDKFF RLL+KE +             +R   +  +PF WES
Sbjct  1    MFSSKSEQPQKTILQIKQDDKFFCRLLTKESSITNPS--------FRVAIT--VPFVWES  50

Query  194  QPGTPKHAL  220
            QPGTPK+  
Sbjct  51   QPGTPKYTF  59



>ref|XP_003552301.1| PREDICTED: uncharacterized protein LOC100801292 [Glycine max]
 gb|KHN40652.1| hypothetical protein glysoja_001150 [Glycine soja]
Length=194

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 36/64 (56%), Gaps = 10/64 (16%)
 Frame = +2

Query  35   HGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
            H +   L IK DDKFFSRLLSKE    G     S R       + ++PF WESQPGTPK+
Sbjct  10   HPQNTVLQIKQDDKFFSRLLSKE----GSMSKPSFR------MAVAVPFVWESQPGTPKY  59

Query  215  ALPD  226
               +
Sbjct  60   TFSE  63



>ref|XP_009419814.1| PREDICTED: uncharacterized protein LOC103999714 [Musa acuminata 
subsp. malaccensis]
Length=175

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 32/52 (62%), Gaps = 5/52 (10%)
 Frame = +2

Query  62   KPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHA  217
            K DDK   RLL KE++      + S R YY    SG++PF WESQPGTPKH 
Sbjct  16   KQDDKLCCRLLFKERSVA----NPSFRVYYGVA-SGAVPFQWESQPGTPKHV  62



>ref|NP_001144660.1| uncharacterized protein LOC100277685 [Zea mays]
 gb|ACG42120.1| hypothetical protein [Zea mays]
Length=232

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 4/79 (5%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M S+G   E   L+ K   K  +++LSKE A        S R YY    +G++PF WE Q
Sbjct  1    MSSAGCKAE-PGLLAKQGSKLHAKMLSKEAA--AQLAVPSFRVYYSVASAGAVPFLWEXQ  57

Query  197  PGTPKHALPDSCIFNPPLT  253
            PGTPK+  P + +  PPLT
Sbjct  58   PGTPKNDSPSAAVL-PPLT  75



>ref|NP_001044668.1| Os01g0824900 [Oryza sativa Japonica Group]
 dbj|BAD73443.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD87089.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF06582.1| Os01g0824900 [Oryza sativa Japonica Group]
 gb|EAY76331.1| hypothetical protein OsI_04264 [Oryza sativa Indica Group]
 gb|EAZ13992.1| hypothetical protein OsJ_03917 [Oryza sativa Japonica Group]
 dbj|BAG87908.1| unnamed protein product [Oryza sativa Japonica Group]
Length=224

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 35/56 (63%), Gaps = 5/56 (9%)
 Frame = +2

Query  44   QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPK  211
            Q  L IK D KF+ RLL+KE++        S R Y+ A   GS+PF WESQPGTPK
Sbjct  21   QSPLRIKQDGKFYERLLAKERS----AASRSFRHYW-AAEPGSVPFVWESQPGTPK  71



>ref|XP_007134683.1| hypothetical protein PHAVU_010G067300g [Phaseolus vulgaris]
 gb|ESW06677.1| hypothetical protein PHAVU_010G067300g [Phaseolus vulgaris]
Length=165

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (59%), Gaps = 10/63 (16%)
 Frame = +2

Query  41   EQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHAL  220
            ++  L IK DDKFF RLLSKE +      + S R       + ++PF WESQPGTPKH  
Sbjct  10   QKSVLQIKQDDKFFCRLLSKESSMS----NPSFRI------ALAVPFVWESQPGTPKHTF  59

Query  221  PDS  229
             ++
Sbjct  60   SEN  62



>ref|XP_006655407.1| PREDICTED: uncharacterized protein LOC102721368 [Oryza brachyantha]
Length=222

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 38/65 (58%), Gaps = 6/65 (9%)
 Frame = +2

Query  44   QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALP  223
            Q  L I  D +F++RLL+KE ++G      +  F Y A  +G++PF WES PGTPK    
Sbjct  13   QSPLRITHDGEFYARLLTKESSQG------TPSFRYCAAGAGAVPFVWESHPGTPKVDAT  66

Query  224  DSCIF  238
             SC+ 
Sbjct  67   SSCML  71



>ref|XP_003534652.2| PREDICTED: uncharacterized protein LOC100813546 [Glycine max]
Length=257

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 40/74 (54%), Gaps = 13/74 (18%)
 Frame = +2

Query  14   KMFSSGS---HGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFH  184
            KMFS+     H  +  L IK DDKFFSRLLSKE +             +R     ++PF 
Sbjct  60   KMFSAKKAELHPPKTVLQIKQDDKFFSRLLSKESSMSKPS--------FRMAV--AVPFV  109

Query  185  WESQPGTPKHALPD  226
            WESQPGTPK+   +
Sbjct  110  WESQPGTPKYTFSE  123



>ref|XP_007140133.1| hypothetical protein PHAVU_008G086700g [Phaseolus vulgaris]
 gb|ESW12127.1| hypothetical protein PHAVU_008G086700g [Phaseolus vulgaris]
Length=185

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 39/69 (57%), Gaps = 11/69 (16%)
 Frame = +2

Query  17   MFSSGSHGEQEFLI-IKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWES  193
            MFS  +   Q+ ++ IK DDKFFSRLLSKE +             +R     ++PF WES
Sbjct  1    MFSGKTELPQKTVLQIKQDDKFFSRLLSKENSMSKPS--------FRMAV--AVPFVWES  50

Query  194  QPGTPKHAL  220
            QPGTPK+  
Sbjct  51   QPGTPKYTF  59



>ref|XP_004511125.1| PREDICTED: uncharacterized protein LOC101502082 [Cicer arietinum]
Length=190

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 40/71 (56%), Gaps = 13/71 (18%)
 Frame = +2

Query  17   MFSSGSHGE---QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHW  187
            M SS S  E   +  L IK DDKFFS+LLSKE +      + S R       S ++PF W
Sbjct  1    MLSSTSTREIHQKSVLQIKQDDKFFSKLLSKESS----NCNPSFR------VSVAVPFVW  50

Query  188  ESQPGTPKHAL  220
            ESQPGTPK+  
Sbjct  51   ESQPGTPKYTF  61



>ref|XP_010451937.1| PREDICTED: uncharacterized protein LOC104734127 [Camelina sativa]
Length=191

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 32/67 (48%), Gaps = 5/67 (7%)
 Frame = +2

Query  29   GSHGEQEFLIIKPDDKFFSRLLSKEKAK-----GGGGGDSSLRFYYRAGCSGSIPFHWES  193
             S  E+   +I+ D   FS  LS  K +            S R YY  G  GS+PF WES
Sbjct  3    NSGSERAAPVIRQDTATFSSKLSSTKQRFSSETAAASACPSFRIYYYDGAVGSVPFEWES  62

Query  194  QPGTPKH  214
             PGTPKH
Sbjct  63   HPGTPKH  69



>ref|XP_003522007.1| PREDICTED: uncharacterized protein LOC100789329 [Glycine max]
 gb|KHN33212.1| hypothetical protein glysoja_027899 [Glycine soja]
Length=178

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 10/58 (17%)
 Frame = +2

Query  41   EQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
            ++  L IK DDKFF RLLSKE +      + S R         ++PF WES+PGTPKH
Sbjct  10   QKSVLSIKQDDKFFCRLLSKESSMS----NPSFRIAL------AVPFVWESEPGTPKH  57



>ref|XP_010490509.1| PREDICTED: uncharacterized protein LOC104768279 [Camelina sativa]
Length=192

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 30/59 (51%), Gaps = 5/59 (8%)
 Frame = +2

Query  56   IIKPDDKFFSRLLSKEKAK-----GGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHA  217
            + K D   FS  LS  K +            S R YY  G +GS+PF WES PGTPKH+
Sbjct  12   VRKQDTAIFSSKLSSTKQRFSSQTAAASACPSFRIYYYDGAAGSVPFEWESHPGTPKHS  70



>ref|NP_001145159.1| uncharacterized protein LOC100278394 [Zea mays]
 gb|ACG45496.1| hypothetical protein [Zea mays]
Length=226

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 16/75 (21%)
 Frame = +2

Query  23   SSGSHGE----------QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGS  172
            S G+HG           Q  L I  D +F++RLL++E + G    + S R YY AG SG+
Sbjct  6    SPGAHGASGAATPPSKPQSPLRITHDGEFYARLLTRESSLG----NPSFR-YYGAG-SGA  59

Query  173  IPFHWESQPGTPKHA  217
            +PF WESQPGTPK A
Sbjct  60   VPFVWESQPGTPKDA  74



>ref|XP_006288717.1| hypothetical protein CARUB_v10002028mg [Capsella rubella]
 gb|EOA21615.1| hypothetical protein CARUB_v10002028mg [Capsella rubella]
Length=193

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 34/67 (51%), Gaps = 5/67 (7%)
 Frame = +2

Query  29   GSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDS-----SLRFYYRAGCSGSIPFHWES  193
             S  E++  + K D   FS  LS  K +      +     S R YY  G +GS+PF WES
Sbjct  3    NSGSERDASVRKQDTATFSSKLSSTKQRFSSQATAAPACPSFRIYYYDGAAGSVPFEWES  62

Query  194  QPGTPKH  214
             PGTPKH
Sbjct  63   HPGTPKH  69



>ref|XP_008663495.1| PREDICTED: uncharacterized protein LOC103641970 [Zea mays]
 gb|AFW59182.1| hypothetical protein ZEAMMB73_639052 [Zea mays]
Length=234

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 6/62 (10%)
 Frame = +2

Query  26   SGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGT  205
            +G+   Q  L IK D KF+ RLL++E +      + S R+Y+     G++PF WESQPGT
Sbjct  21   NGAMPPQSPLRIKQDGKFYERLLTRESS----AANLSFRYYW--AEPGAVPFVWESQPGT  74

Query  206  PK  211
            PK
Sbjct  75   PK  76



>ref|XP_003516426.1| PREDICTED: uncharacterized protein LOC100783232 [Glycine max]
 gb|KHN44816.1| hypothetical protein glysoja_024387 [Glycine soja]
Length=178

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 10/58 (17%)
 Frame = +2

Query  41   EQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
             +  L IK DDKFF RLLSKE +      + S R         ++PF WES+PGTPKH
Sbjct  10   HKSVLSIKQDDKFFCRLLSKESSMA----NPSFRIAL------AVPFVWESEPGTPKH  57



>ref|XP_002440677.1| hypothetical protein SORBIDRAFT_09g004950 [Sorghum bicolor]
 gb|EES19107.1| hypothetical protein SORBIDRAFT_09g004950 [Sorghum bicolor]
Length=267

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = +2

Query  41   EQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHAL  220
            E+  L++K   K  +++LSKE A        S R YY    +G++PF WESQPGTPK+  
Sbjct  15   EEPGLLVKQGSKLHAKMLSKEAA--AQLAVPSFRVYYPVASAGAVPFLWESQPGTPKNDS  72

Query  221  PD  226
            P 
Sbjct  73   PS  74



>gb|AFG46799.1| hypothetical protein 0_6473_01, partial [Pinus taeda]
Length=147

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 41/86 (48%), Gaps = 12/86 (14%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M  S     ++ L ++ +  FFSRLLS+E+  G      S R YYR    G +PF WE++
Sbjct  18   MLPSVEENNEDLLQLETNGGFFSRLLSREETTG-----HSSRIYYRPSNLGRVPFRWEAE  72

Query  197  PGTP-------KHALPDSCIFNPPLT  253
            PG         K  L D  +   PL+
Sbjct  73   PGKRRSSGRYLKEELVDHEMITRPLS  98



>gb|AFG46802.1| hypothetical protein 0_6473_01, partial [Pinus taeda]
Length=147

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 41/86 (48%), Gaps = 12/86 (14%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M  S     ++ L ++ +  FFSRLLS+E+  G      S R YYR    G +PF WE++
Sbjct  18   MLPSVEENNEDLLQLETNGGFFSRLLSREETAG-----HSSRIYYRPSNLGRVPFRWEAE  72

Query  197  PGTP-------KHALPDSCIFNPPLT  253
            PG         K  L D  +   PL+
Sbjct  73   PGKRRSSGRYLKEELVDHEMITRPLS  98



>ref|XP_008674877.1| PREDICTED: uncharacterized protein LOC103651058 [Zea mays]
 tpg|DAA57041.1| TPA: hypothetical protein ZEAMMB73_343739 [Zea mays]
Length=234

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 6/65 (9%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            +  +G+   Q  L IK D KF+ RLL++E +      + S R+Y+     G++PF WESQ
Sbjct  18   LRGNGAMPPQSPLRIKQDGKFYERLLTRESS----AANLSFRYYW--AEPGAVPFVWESQ  71

Query  197  PGTPK  211
            PGTPK
Sbjct  72   PGTPK  76



>emb|CDX70623.1| BnaC03g07070D [Brassica napus]
Length=195

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
 Frame = +2

Query  53   LIIKPDDKFFSRLL--SKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPD  226
            L+ K D   FS  +  +K++         S R YY  G +GSIPF WES PGTPKH  P 
Sbjct  12   LLRKQDTAIFSDKIPSTKQRLSSQAPACPSFRIYYYDGAAGSIPFGWESHPGTPKHKHPS  71

Query  227  S  229
            S
Sbjct  72   S  72



>ref|XP_002456559.1| hypothetical protein SORBIDRAFT_03g038400 [Sorghum bicolor]
 gb|EES01679.1| hypothetical protein SORBIDRAFT_03g038400 [Sorghum bicolor]
Length=209

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 6/56 (11%)
 Frame = +2

Query  44   QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPK  211
            Q  L IK D KF+ RLL+KE +      + S R+Y+     G++PF WESQPGTPK
Sbjct  5    QSPLRIKQDGKFYERLLTKESS----AANLSFRYYW--AEPGAVPFVWESQPGTPK  54



>gb|KHN29525.1| hypothetical protein glysoja_005249 [Glycine soja]
Length=197

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 35/64 (55%), Gaps = 10/64 (16%)
 Frame = +2

Query  35   HGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
            H  +  L IK DDKFFSRLLSKE +             +R     ++PF WESQPGTPK+
Sbjct  10   HPPKTVLQIKQDDKFFSRLLSKESSMSKPS--------FRMAV--AVPFVWESQPGTPKY  59

Query  215  ALPD  226
               +
Sbjct  60   TFSE  63



>gb|AFG46798.1| hypothetical protein 0_6473_01, partial [Pinus taeda]
 gb|AFG46800.1| hypothetical protein 0_6473_01, partial [Pinus taeda]
 gb|AFG46801.1| hypothetical protein 0_6473_01, partial [Pinus taeda]
Length=147

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 41/86 (48%), Gaps = 12/86 (14%)
 Frame = +2

Query  17   MFSSGSHGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQ  196
            M  S     ++ L ++ +  FFSRLLS+E+  G      S R YYR    G +PF WE++
Sbjct  18   MLPSVEENNEDLLQLETNGGFFSRLLSREETTG-----HSSRIYYRPSNLGRVPFRWEAE  72

Query  197  PGTP-------KHALPDSCIFNPPLT  253
            PG         K  L D  +   PL+
Sbjct  73   PGKRRSSGRYFKEELVDHEMITRPLS  98



>ref|XP_006644930.1| PREDICTED: uncharacterized protein LOC102711483 [Oryza brachyantha]
Length=201

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 4/56 (7%)
 Frame = +2

Query  44   QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPK  211
            Q  L IK   KF+ RLL+KE++      + S R Y+ A   GS+PF WESQPGTPK
Sbjct  21   QSPLRIKQHGKFYERLLAKERS---ASTNRSFRHYW-ATEPGSVPFVWESQPGTPK  72



>dbj|BAK01315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=216

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 4/46 (9%)
 Frame = +2

Query  74   KFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPK  211
            K +SR+LSKE A        S R YY    +GS+PF WESQPGTPK
Sbjct  24   KLYSRMLSKEAAIA----VPSFRVYYGVASAGSVPFLWESQPGTPK  65



>ref|NP_001145319.1| hypothetical protein [Zea mays]
 gb|ACG46763.1| hypothetical protein [Zea mays]
 gb|AFW78371.1| hypothetical protein ZEAMMB73_994532 [Zea mays]
Length=231

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = +2

Query  44   QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHA  217
            Q  L I  D +F++RLL++E + G    + S R YY AG +G++PF WESQPGTPK A
Sbjct  23   QSPLRITHDGEFYARLLTRESSLG----NPSFR-YYGAG-TGAVPFVWESQPGTPKDA  74



>ref|XP_007149871.1| hypothetical protein PHAVU_005G105700g [Phaseolus vulgaris]
 gb|ESW21865.1| hypothetical protein PHAVU_005G105700g [Phaseolus vulgaris]
Length=123

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 36/67 (54%), Gaps = 12/67 (18%)
 Frame = +2

Query  53   LIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHALPDSC  232
            L IK DDKFFS+LLSKE +             +R   +  +PF WESQPGTPK+      
Sbjct  54   LQIKQDDKFFSKLLSKENSMSKPS--------FRMVVA--VPFVWESQPGTPKYTFFHDT  103

Query  233  IFNPPLT  253
               PPLT
Sbjct  104  F--PPLT  108



>gb|EMS64810.1| hypothetical protein TRIUR3_20305 [Triticum urartu]
Length=125

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 6/58 (10%)
 Frame = +2

Query  44   QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHA  217
            Q  L IK   KF+ RLL+KE +    G + S R+Y      GS+PF WES+PGTP+ A
Sbjct  21   QSPLRIKQGGKFYERLLTKESS----GANPSFRYY--GSEPGSVPFVWESEPGTPRDA  72



>emb|CDM84790.1| unnamed protein product [Triticum aestivum]
Length=152

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 6/58 (10%)
 Frame = +2

Query  44   QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKHA  217
            Q  L IK   KF+ RLL+KE +    G + S R+Y      GS+PF WES+PGTP+ A
Sbjct  21   QSPLRIKQGGKFYERLLTKESS----GANPSFRYY--GSEPGSVPFVWESEPGTPRDA  72



>ref|XP_007221127.1| hypothetical protein PRUPE_ppa018358mg [Prunus persica]
 gb|EMJ22326.1| hypothetical protein PRUPE_ppa018358mg [Prunus persica]
Length=226

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 5/50 (10%)
 Frame = +2

Query  68   DDKFFS-RLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
            D+K+ S +L+SKE+A      ++S R YY    +G+IPF WESQPGTPKH
Sbjct  4    DNKYLSSKLVSKEEA---SMANASCRVYY-GEAAGAIPFMWESQPGTPKH  49



>gb|ACU23630.1| unknown [Glycine max]
Length=197

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 34/64 (53%), Gaps = 10/64 (16%)
 Frame = +2

Query  35   HGEQEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPKH  214
            H  +  L IK DDKFFSRLLSKE +             +R      +PF WESQPGTPK+
Sbjct  10   HPPKTVLQIKQDDKFFSRLLSKESSMSKPS--------FRMAV--VVPFVWESQPGTPKY  59

Query  215  ALPD  226
               +
Sbjct  60   TFSE  63



>ref|XP_004970406.1| PREDICTED: uncharacterized protein LOC101777604 [Setaria italica]
Length=206

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 6/56 (11%)
 Frame = +2

Query  44   QEFLIIKPDDKFFSRLLSKEKAKGGGGGDSSLRFYYRAGCSGSIPFHWESQPGTPK  211
            Q  L I+ D KF+ RLL+KE +      + S R+Y+     G++PF WESQPGTPK
Sbjct  3    QSPLRIRQDGKFYERLLTKESS----AANLSFRYYW--AEPGAVPFVWESQPGTPK  52



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028968069338