BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15721_g3_i1 len=1619 path=[5125:0-1153 3991:1154-1618]

Length=1619
                                                                      Score     E

ref|XP_009767018.1|  PREDICTED: uncharacterized protein LOC104218270    470   2e-158   
ref|XP_009615449.1|  PREDICTED: uncharacterized protein LOC104108167    467   3e-157   
ref|XP_011070777.1|  PREDICTED: uncharacterized protein LOC105156363    452   3e-151   
ref|XP_006344154.1|  PREDICTED: uncharacterized protein LOC102583596    449   2e-150   
ref|XP_004238911.1|  PREDICTED: uncharacterized protein LOC101249358    446   3e-149   
gb|KHN20747.1|  hypothetical protein glysoja_019064                     439   1e-147   
emb|CDO98417.1|  unnamed protein product                                439   2e-146   
ref|XP_006344302.1|  PREDICTED: uncharacterized protein LOC102604936    438   2e-146   
ref|XP_007044265.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    438   5e-146   
ref|XP_003530022.2|  PREDICTED: uncharacterized protein LOC100791882    437   7e-146   
ref|XP_010066702.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    435   3e-144   
emb|CBI15481.3|  unnamed protein product                                431   5e-144   
ref|XP_002276828.1|  PREDICTED: uncharacterized protein LOC100247520    431   1e-143   Vitis vinifera
ref|XP_009357077.1|  PREDICTED: uncharacterized protein LOC103947833    431   2e-143   
ref|XP_007152746.1|  hypothetical protein PHAVU_004G156000g             433   2e-143   
ref|XP_010265065.1|  PREDICTED: uncharacterized protein LOC104602904    431   2e-143   
ref|XP_006468735.1|  PREDICTED: uncharacterized protein LOC102627900    429   1e-142   
ref|XP_009348209.1|  PREDICTED: uncharacterized protein LOC103939820    429   1e-142   
ref|XP_006448426.1|  hypothetical protein CICLE_v10015505mg             429   2e-142   
ref|XP_008374777.1|  PREDICTED: uncharacterized protein LOC103438016    429   3e-142   
ref|XP_007222895.1|  hypothetical protein PRUPE_ppa006723mg             428   3e-142   
ref|XP_008339646.1|  PREDICTED: uncharacterized protein LOC103402673    428   5e-142   
ref|XP_008240316.1|  PREDICTED: uncharacterized protein LOC103338837    428   6e-142   
ref|XP_006485819.1|  PREDICTED: uncharacterized protein LOC102611796    428   6e-142   
ref|XP_006442617.1|  hypothetical protein CICLE_v10020320mg             428   7e-142   
ref|XP_003533360.1|  PREDICTED: uncharacterized protein LOC100803748    429   1e-141   
gb|EYU30001.1|  hypothetical protein MIMGU_mgv1a007596mg                426   3e-141   
ref|XP_007160392.1|  hypothetical protein PHAVU_002G318000g             425   6e-141   
ref|XP_011007454.1|  PREDICTED: uncharacterized protein LOC105113...    424   1e-140   
ref|XP_003524367.1|  PREDICTED: uncharacterized protein LOC100815747    423   1e-140   
gb|AES76651.2|  core-2/I-branching enzyme                               425   1e-140   
ref|XP_010264609.1|  PREDICTED: uncharacterized protein LOC104602574    424   2e-140   
ref|XP_003620433.1|  hypothetical protein MTR_6g083830                  424   2e-140   
ref|XP_009624653.1|  PREDICTED: uncharacterized protein LOC104115679    424   2e-140   
ref|XP_011007447.1|  PREDICTED: uncharacterized protein LOC105113...    423   2e-140   
ref|XP_009763003.1|  PREDICTED: uncharacterized protein LOC104214...    424   3e-140   
emb|CDP00653.1|  unnamed protein product                                419   4e-140   
gb|KHN21596.1|  hypothetical protein glysoja_023448                     421   8e-140   
ref|XP_007044266.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    422   9e-140   
ref|XP_002315928.1|  hypothetical protein POPTR_0010s13150g             422   9e-140   Populus trichocarpa [western balsam poplar]
ref|XP_008393326.1|  PREDICTED: uncharacterized protein LOC103455513    423   1e-139   
ref|XP_010644813.1|  PREDICTED: uncharacterized protein LOC100245576    422   1e-139   
ref|XP_010094729.1|  hypothetical protein L484_019938                   422   2e-139   
ref|XP_009356238.1|  PREDICTED: uncharacterized protein LOC103947108    421   3e-139   
ref|XP_009360137.1|  PREDICTED: uncharacterized protein LOC103950632    422   3e-139   
ref|XP_007208909.1|  hypothetical protein PRUPE_ppa027107mg             416   8e-139   
ref|XP_011008309.1|  PREDICTED: uncharacterized protein LOC105113714    419   1e-138   
ref|XP_004512994.1|  PREDICTED: uncharacterized protein LOC101496836    419   2e-138   
ref|XP_008243270.1|  PREDICTED: uncharacterized protein LOC103341513    419   2e-138   
ref|XP_003614560.1|  hypothetical protein MTR_5g055480                  416   1e-137   
gb|KEH44200.1|  core-2/I-branching enzyme                               417   1e-137   
gb|KHN16548.1|  hypothetical protein glysoja_002645                     414   4e-137   
ref|XP_010663889.1|  PREDICTED: uncharacterized protein LOC100252627    414   6e-137   
ref|XP_003532515.1|  PREDICTED: uncharacterized protein LOC100782511    414   8e-137   
ref|XP_002321483.2|  hypothetical protein POPTR_0015s03850g             414   1e-136   Populus trichocarpa [western balsam poplar]
gb|KHN06677.1|  hypothetical protein glysoja_021223                     414   3e-136   
ref|XP_011022393.1|  PREDICTED: uncharacterized protein LOC105124187    412   5e-136   
ref|XP_003536674.1|  PREDICTED: uncharacterized protein LOC100810724    412   1e-135   
gb|EYU41282.1|  hypothetical protein MIMGU_mgv1a010939mg                405   9e-135   
ref|XP_009105384.1|  PREDICTED: uncharacterized protein LOC103831252    410   1e-134   
gb|KCW83891.1|  hypothetical protein EUGRSUZ_B00742                     405   1e-134   
ref|XP_004301820.1|  PREDICTED: uncharacterized protein LOC101311102    409   2e-134   
ref|XP_011097027.1|  PREDICTED: uncharacterized protein LOC105176048    409   3e-134   
ref|XP_002311468.2|  hypothetical protein POPTR_0008s12260g             407   3e-134   Populus trichocarpa [western balsam poplar]
ref|XP_011072929.1|  PREDICTED: uncharacterized protein LOC105158025    408   4e-134   
gb|KEH27363.1|  core-2/I-branching enzyme                               407   5e-134   
ref|XP_010045650.1|  PREDICTED: uncharacterized protein LOC104434412    407   5e-134   
ref|XP_004497066.1|  PREDICTED: uncharacterized protein LOC101490811    407   6e-134   
ref|XP_003555913.1|  PREDICTED: uncharacterized protein LOC100779041    407   8e-134   
ref|XP_007142937.1|  hypothetical protein PHAVU_007G029800g             407   1e-133   
ref|XP_010099264.1|  hypothetical protein L484_015454                   407   2e-133   
ref|XP_004516650.1|  PREDICTED: uncharacterized protein LOC101496316    405   2e-133   
ref|XP_006302341.1|  hypothetical protein CARUB_v10020398mg             405   3e-133   
ref|XP_006391143.1|  hypothetical protein EUTSA_v10019817mg             405   4e-133   
emb|CBI15480.3|  unnamed protein product                                401   5e-133   
gb|KFK41255.1|  hypothetical protein AALP_AA2G105500                    404   7e-133   
ref|XP_004299045.1|  PREDICTED: uncharacterized protein LOC101307203    404   1e-132   
emb|CDY59035.1|  BnaCnng34190D                                          404   1e-132   
emb|CDX81507.1|  BnaC02g18110D                                          404   1e-132   
ref|XP_009589451.1|  PREDICTED: uncharacterized protein LOC104086812    404   2e-132   
ref|XP_009413609.1|  PREDICTED: uncharacterized protein LOC103994882    402   3e-132   
gb|ACU18543.1|  unknown                                                 403   4e-132   Glycine max [soybeans]
ref|XP_003535134.1|  PREDICTED: uncharacterized protein LOC100811590    404   5e-132   
ref|XP_004299046.1|  PREDICTED: uncharacterized protein LOC101307491    402   5e-132   
ref|XP_010916432.1|  PREDICTED: uncharacterized protein LOC105041249    402   7e-132   
ref|XP_003610779.1|  hypothetical protein MTR_5g006920                  402   9e-132   
ref|XP_009127627.1|  PREDICTED: uncharacterized protein LOC103852476    401   1e-131   
ref|XP_002887179.1|  hypothetical protein ARALYDRAFT_475958             401   2e-131   
ref|XP_010470788.1|  PREDICTED: uncharacterized protein LOC104750...    401   2e-131   
ref|XP_010415458.1|  PREDICTED: uncharacterized protein LOC104701464    401   2e-131   
emb|CBI26988.3|  unnamed protein product                                397   2e-131   
ref|XP_009768969.1|  PREDICTED: uncharacterized protein LOC104219898    401   2e-131   
ref|XP_010470787.1|  PREDICTED: uncharacterized protein LOC104750...    402   3e-131   
ref|NP_177006.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    400   5e-131   Arabidopsis thaliana [mouse-ear cress]
gb|AHL38887.1|  glycosyltransferase                                     399   9e-131   
ref|XP_008812373.1|  PREDICTED: uncharacterized protein LOC103723273    399   1e-130   
ref|XP_007036567.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    399   2e-130   
ref|XP_006341708.1|  PREDICTED: uncharacterized protein LOC102599552    398   2e-130   
ref|XP_010926004.1|  PREDICTED: uncharacterized protein LOC105048408    398   3e-130   
ref|XP_008806040.1|  PREDICTED: uncharacterized protein LOC103718829    397   4e-130   
ref|XP_002535241.1|  conserved hypothetical protein                     393   4e-130   Ricinus communis
ref|XP_004252429.1|  PREDICTED: uncharacterized protein LOC101255566    393   1e-129   
ref|XP_010513660.1|  PREDICTED: uncharacterized protein LOC104789704    396   2e-129   
ref|XP_009403975.1|  PREDICTED: uncharacterized protein LOC103987406    394   8e-129   
ref|XP_008453432.1|  PREDICTED: uncharacterized protein LOC103494140    388   5e-128   
ref|XP_004160451.1|  PREDICTED: uncharacterized protein LOC101227205    391   7e-128   
ref|XP_006353820.1|  PREDICTED: uncharacterized protein LOC102581987    387   2e-127   
gb|EPS62381.1|  hypothetical protein M569_12413                         389   3e-127   
gb|AFK35806.1|  unknown                                                 388   1e-126   
ref|XP_010916430.1|  PREDICTED: uncharacterized protein LOC105041248    388   2e-126   
ref|XP_004236422.2|  PREDICTED: uncharacterized protein LOC101267...    389   3e-126   
ref|XP_008812383.1|  PREDICTED: uncharacterized protein LOC103723284    386   4e-126   
ref|XP_008467193.1|  PREDICTED: uncharacterized protein LOC103504601    386   6e-126   
gb|KDP20145.1|  hypothetical protein JCGZ_05914                         386   1e-125   
ref|XP_002276791.2|  PREDICTED: uncharacterized protein LOC100257764    384   9e-125   Vitis vinifera
ref|XP_004137544.1|  PREDICTED: uncharacterized protein LOC101209845    378   6e-124   
emb|CBI15479.3|  unnamed protein product                                377   7e-124   
ref|XP_007224741.1|  hypothetical protein PRUPE_ppa024535mg             382   7e-124   
ref|XP_004147140.1|  PREDICTED: uncharacterized protein LOC101202787    380   1e-123   
gb|EYU40777.1|  hypothetical protein MIMGU_mgv1a007709mg                378   9e-123   
ref|XP_009356310.1|  PREDICTED: uncharacterized protein LOC103947180    379   1e-122   
ref|XP_011076478.1|  PREDICTED: uncharacterized protein LOC105160693    377   3e-122   
ref|XP_010537457.1|  PREDICTED: uncharacterized protein LOC104812147    377   3e-122   
ref|XP_010678016.1|  PREDICTED: uncharacterized protein LOC104893585    375   8e-122   
ref|XP_009356309.1|  PREDICTED: uncharacterized protein LOC103947179    375   3e-121   
ref|XP_011007501.1|  PREDICTED: uncharacterized protein LOC105113...    375   4e-121   
ref|XP_002315929.2|  hypothetical protein POPTR_0010s13160g             374   5e-121   Populus trichocarpa [western balsam poplar]
emb|CDP00652.1|  unnamed protein product                                370   5e-121   
ref|XP_004161853.1|  PREDICTED: uncharacterized LOC101207079            374   6e-121   
ref|XP_004167307.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    371   7e-121   
ref|XP_009358798.1|  PREDICTED: uncharacterized protein LOC103949407    371   1e-120   
ref|XP_008244554.1|  PREDICTED: uncharacterized protein LOC103342693    371   1e-120   
ref|XP_009615448.1|  PREDICTED: uncharacterized protein LOC104108166    372   3e-120   
ref|XP_008243418.1|  PREDICTED: uncharacterized protein LOC103341652    372   3e-120   
ref|XP_008340286.1|  PREDICTED: uncharacterized protein LOC103403235    372   4e-120   
ref|XP_007036566.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    374   5e-120   
gb|KDP29448.1|  hypothetical protein JCGZ_18369                         366   5e-120   
gb|EPS59287.1|  hypothetical protein M569_15522                         370   8e-120   
ref|XP_002279551.2|  PREDICTED: uncharacterized protein LOC100250702    371   1e-119   Vitis vinifera
ref|XP_009767015.1|  PREDICTED: uncharacterized protein LOC104218...    367   2e-119   
ref|XP_002524909.1|  conserved hypothetical protein                     369   3e-119   Ricinus communis
ref|XP_008240317.1|  PREDICTED: uncharacterized protein LOC103338839    368   5e-119   
ref|XP_009767014.1|  PREDICTED: uncharacterized protein LOC104218...    369   5e-119   
ref|XP_011007493.1|  PREDICTED: uncharacterized protein LOC105113...    369   6e-119   
gb|KDP29447.1|  hypothetical protein JCGZ_18368                         367   7e-119   
ref|XP_008459135.1|  PREDICTED: uncharacterized protein LOC103498310    369   7e-119   
ref|XP_002280674.1|  PREDICTED: uncharacterized protein LOC100244641    369   7e-119   Vitis vinifera
ref|XP_007208880.1|  hypothetical protein PRUPE_ppa026447mg             369   8e-119   
ref|XP_004300973.1|  PREDICTED: uncharacterized protein LOC101293399    368   1e-118   
ref|XP_010046585.1|  PREDICTED: uncharacterized protein LOC104435558    367   3e-118   
emb|CBI26990.3|  unnamed protein product                                362   5e-118   
ref|XP_007033224.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    367   5e-118   
ref|XP_006448428.1|  hypothetical protein CICLE_v10017943mg             366   6e-118   
emb|CBI33634.3|  unnamed protein product                                362   7e-118   
ref|XP_006469090.1|  PREDICTED: uncharacterized protein LOC102627718    364   1e-117   
gb|KDO76927.1|  hypothetical protein CISIN_1g046575mg                   365   1e-117   
ref|XP_010694626.1|  PREDICTED: uncharacterized protein LOC104907403    363   2e-117   
ref|XP_007226202.1|  hypothetical protein PRUPE_ppa016185mg             364   3e-117   
gb|KCW86302.1|  hypothetical protein EUGRSUZ_B02994                     360   4e-117   
ref|XP_007044267.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    363   1e-116   
ref|XP_008351009.1|  PREDICTED: uncharacterized protein LOC103414400    359   2e-116   
ref|XP_003603189.1|  hypothetical protein MTR_3g104840                  362   2e-116   
ref|XP_006344151.1|  PREDICTED: uncharacterized protein LOC102582712    358   3e-116   
ref|XP_010108861.1|  hypothetical protein L484_027054                   361   5e-116   
ref|XP_004238913.2|  PREDICTED: uncharacterized protein LOC101249916    358   1e-115   
ref|XP_010681643.1|  PREDICTED: uncharacterized protein LOC104896576    359   2e-115   
ref|XP_008350857.1|  PREDICTED: uncharacterized protein LOC103414237    358   6e-115   
ref|XP_004300972.1|  PREDICTED: uncharacterized protein LOC101293100    357   6e-115   
ref|XP_009344746.1|  PREDICTED: uncharacterized protein LOC103936628    363   7e-115   
ref|XP_007227633.1|  hypothetical protein PRUPE_ppa022907mg             357   8e-115   
ref|XP_009345696.1|  PREDICTED: uncharacterized protein LOC103937474    358   1e-114   
ref|XP_009360140.1|  PREDICTED: uncharacterized protein LOC103950635    357   2e-114   
ref|XP_010265068.1|  PREDICTED: uncharacterized protein LOC104602905    356   7e-114   
ref|XP_006842356.1|  hypothetical protein AMTR_s00079p00179880          354   9e-114   
ref|XP_010099263.1|  hypothetical protein L484_015453                   354   9e-114   
ref|XP_004301821.1|  PREDICTED: uncharacterized protein LOC101311681    355   1e-113   
gb|KDP34129.1|  hypothetical protein JCGZ_07700                         353   3e-113   
ref|XP_006651782.1|  PREDICTED: uncharacterized protein LOC102702183    350   5e-113   
emb|CDP02764.1|  unnamed protein product                                349   6e-113   
ref|XP_008459241.1|  PREDICTED: uncharacterized protein LOC103498396    352   8e-113   
ref|XP_002321482.2|  hypothetical protein POPTR_0015s03840g             353   9e-113   Populus trichocarpa [western balsam poplar]
emb|CDO98418.1|  unnamed protein product                                348   1e-112   
dbj|BAK05476.1|  predicted protein                                      352   1e-112   
ref|XP_004981886.1|  PREDICTED: uncharacterized protein LOC101780921    351   2e-112   
gb|EEE59868.1|  hypothetical protein OsJ_12453                          351   2e-112   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002305172.2|  hypothetical protein POPTR_0004s09690g             350   3e-112   Populus trichocarpa [western balsam poplar]
ref|XP_006286517.1|  hypothetical protein CARUB_v10001158mg             350   6e-112   
ref|XP_007160978.1|  hypothetical protein PHAVU_001G033200g             350   7e-112   
ref|XP_010682059.1|  PREDICTED: uncharacterized protein LOC104896962    351   1e-111   
ref|XP_010519868.1|  PREDICTED: uncharacterized protein LOC104799181    349   1e-111   
gb|KHN37013.1|  hypothetical protein glysoja_009041                     347   1e-111   
ref|NP_001143764.1|  uncharacterized protein LOC100276526               349   1e-111   Zea mays [maize]
tpg|DAA51164.1|  TPA: hypothetical protein ZEAMMB73_778026              349   2e-111   
gb|AAT77886.1|  expressed protein                                       349   2e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011035090.1|  PREDICTED: uncharacterized protein LOC105133011    348   2e-111   
ref|XP_010230469.1|  PREDICTED: uncharacterized protein LOC100843610    348   2e-111   
ref|XP_002466520.1|  hypothetical protein SORBIDRAFT_01g009220          348   3e-111   Sorghum bicolor [broomcorn]
ref|XP_002466518.1|  hypothetical protein SORBIDRAFT_01g009200          348   3e-111   Sorghum bicolor [broomcorn]
ref|XP_009337144.1|  PREDICTED: uncharacterized protein LOC103929645    348   3e-111   
ref|XP_003550286.1|  PREDICTED: uncharacterized protein LOC100785919    348   3e-111   
ref|XP_010049161.1|  PREDICTED: uncharacterized protein LOC104437817    348   4e-111   
ref|XP_009357886.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    352   5e-111   
ref|XP_008645560.1|  PREDICTED: uncharacterized protein LOC103626979    350   5e-111   
ref|NP_177522.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    348   6e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010244357.1|  PREDICTED: uncharacterized protein LOC104588211    347   7e-111   
ref|XP_002516477.1|  conserved hypothetical protein                     346   1e-110   Ricinus communis
ref|XP_010553652.1|  PREDICTED: uncharacterized protein LOC104823674    347   1e-110   
gb|KEH39949.1|  core-2/I-branching enzyme                               346   1e-110   
ref|XP_006853920.1|  hypothetical protein AMTR_s00036p00191120          344   2e-110   
emb|CDX69735.1|  BnaA10g20840D                                          346   2e-110   
emb|CDX97141.1|  BnaC09g44840D                                          346   2e-110   
ref|XP_006390505.1|  hypothetical protein EUTSA_v10018603mg             347   2e-110   
ref|NP_001130080.1|  uncharacterized protein LOC100191173               345   2e-110   Zea mays [maize]
ref|NP_196734.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    346   3e-110   Arabidopsis thaliana [mouse-ear cress]
gb|ACF85887.1|  unknown                                                 345   3e-110   Zea mays [maize]
emb|CDX97139.1|  BnaC09g44860D                                          346   3e-110   
ref|XP_006836850.1|  hypothetical protein AMTR_s00099p00078200          346   3e-110   
ref|XP_011100115.1|  PREDICTED: uncharacterized protein LOC105178347    346   3e-110   
ref|XP_010318628.1|  PREDICTED: uncharacterized protein LOC101267...    341   6e-110   
ref|XP_010669159.1|  PREDICTED: uncharacterized protein LOC104886401    345   6e-110   
ref|XP_010693288.1|  PREDICTED: uncharacterized protein LOC104906249    345   8e-110   
emb|CDX70416.1|  BnaC03g05000D                                          346   8e-110   
ref|XP_010942037.1|  PREDICTED: uncharacterized protein LOC105060...    344   8e-110   
ref|XP_008796992.1|  PREDICTED: uncharacterized protein LOC103712290    344   9e-110   
ref|XP_006391144.1|  hypothetical protein EUTSA_v10018660mg             345   1e-109   
gb|AAL38356.1|  unknown protein                                         345   1e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010942042.1|  PREDICTED: uncharacterized protein LOC105060...    341   1e-109   
ref|XP_002888947.1|  DNA binding protein                                345   1e-109   
ref|XP_006399687.1|  hypothetical protein EUTSA_v10013787mg             344   2e-109   
gb|KHG10617.1|  Putative non-structural 4                               344   2e-109   
ref|XP_009105383.1|  PREDICTED: uncharacterized protein LOC103831251    344   2e-109   
ref|XP_009106038.1|  PREDICTED: uncharacterized protein LOC103831856    344   2e-109   
ref|XP_009601239.1|  PREDICTED: uncharacterized protein LOC104096562    343   3e-109   
ref|XP_007012231.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    343   4e-109   
ref|XP_011081713.1|  PREDICTED: uncharacterized protein LOC105164695    343   4e-109   
ref|XP_010428318.1|  PREDICTED: uncharacterized protein LOC104712...    343   5e-109   
ref|XP_009414639.1|  PREDICTED: uncharacterized protein LOC103995706    342   5e-109   
gb|KHG05757.1|  hypothetical protein F383_31190                         342   5e-109   
emb|CDX96026.1|  BnaA07g27050D                                          342   7e-109   
ref|XP_008393325.1|  PREDICTED: uncharacterized protein LOC103455512    343   7e-109   
ref|XP_004498923.1|  PREDICTED: uncharacterized protein LOC101515236    342   7e-109   
ref|XP_010941940.1|  PREDICTED: uncharacterized protein LOC105060052    342   8e-109   
gb|AFO66494.1|  hypothetical protein                                    342   8e-109   
ref|XP_007222675.1|  hypothetical protein PRUPE_ppa008602mg             340   9e-109   
ref|XP_002871492.1|  hypothetical protein ARALYDRAFT_909140             342   1e-108   
ref|XP_010536211.1|  PREDICTED: uncharacterized protein LOC104811254    342   1e-108   
ref|XP_010471453.1|  PREDICTED: uncharacterized protein LOC104751239    342   1e-108   
ref|XP_010491917.1|  PREDICTED: uncharacterized protein LOC104769408    341   1e-108   
ref|XP_010273586.1|  PREDICTED: uncharacterized protein LOC104609074    342   2e-108   
ref|XP_006450782.1|  hypothetical protein CICLE_v10008613mg             341   2e-108   
ref|XP_009131226.1|  PREDICTED: uncharacterized protein LOC103855927    341   2e-108   
ref|XP_009361651.1|  PREDICTED: uncharacterized protein LOC103951891    341   2e-108   
ref|XP_010453221.1|  PREDICTED: uncharacterized protein LOC104735185    341   2e-108   
ref|XP_003545368.1|  PREDICTED: uncharacterized protein LOC100819890    340   2e-108   
ref|XP_006355313.1|  PREDICTED: uncharacterized protein LOC102601627    341   2e-108   
ref|XP_009772023.1|  PREDICTED: uncharacterized protein LOC104222493    340   3e-108   
emb|CDX78439.1|  BnaA03g03510D                                          341   3e-108   
ref|XP_010419754.1|  PREDICTED: uncharacterized protein LOC104705440    340   3e-108   
ref|XP_004245124.1|  PREDICTED: uncharacterized protein LOC101267146    340   4e-108   
ref|XP_006394845.1|  hypothetical protein EUTSA_v10004382mg             340   4e-108   
ref|XP_007221893.1|  hypothetical protein PRUPE_ppa016090mg             340   5e-108   
ref|XP_010094730.1|  hypothetical protein L484_019940                   339   5e-108   
gb|KHG11266.1|  Insulin-degrading enzyme                                338   6e-108   
ref|XP_004291015.1|  PREDICTED: uncharacterized protein LOC101301742    339   9e-108   
ref|XP_008218660.1|  PREDICTED: uncharacterized protein LOC103318965    339   1e-107   
gb|KFK25431.1|  hypothetical protein AALP_AA8G114400                    339   1e-107   
ref|XP_008393663.1|  PREDICTED: uncharacterized protein LOC103455...    339   1e-107   
ref|XP_008393665.1|  PREDICTED: uncharacterized protein LOC103455...    339   1e-107   
ref|XP_008220437.1|  PREDICTED: uncharacterized protein LOC103320525    339   1e-107   
dbj|BAF00442.1|  hypothetical protein                                   339   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002516755.1|  conserved hypothetical protein                     338   1e-107   Ricinus communis
ref|XP_008452696.1|  PREDICTED: uncharacterized protein LOC103493641    338   1e-107   
ref|XP_004972519.1|  PREDICTED: uncharacterized protein LOC101756391    341   1e-107   
ref|XP_004161852.1|  PREDICTED: uncharacterized LOC101207320            338   2e-107   
gb|KDP40817.1|  hypothetical protein JCGZ_24816                         338   2e-107   
ref|XP_008812111.1|  PREDICTED: uncharacterized protein LOC103723082    338   2e-107   
ref|XP_011014143.1|  PREDICTED: uncharacterized protein LOC105118003    338   3e-107   
ref|XP_010267069.1|  PREDICTED: uncharacterized protein LOC104604...    338   3e-107   
ref|XP_006430742.1|  hypothetical protein CICLE_v10013811mg             335   4e-107   
ref|XP_007022850.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    337   5e-107   
ref|XP_010648315.1|  PREDICTED: uncharacterized protein LOC100249300    337   6e-107   
ref|XP_008389264.1|  PREDICTED: uncharacterized protein LOC103451628    335   6e-107   
ref|XP_008812747.1|  PREDICTED: uncharacterized protein LOC103723571    337   6e-107   
ref|XP_011011841.1|  PREDICTED: uncharacterized protein LOC105116265    337   7e-107   
emb|CAN70606.1|  hypothetical protein VITISV_040196                     337   8e-107   
ref|XP_004146835.1|  PREDICTED: uncharacterized protein LOC101208492    337   8e-107   
ref|XP_010927836.1|  PREDICTED: uncharacterized protein LOC105049787    337   8e-107   
ref|XP_004154808.1|  PREDICTED: uncharacterized protein LOC101228236    337   9e-107   
gb|KDO59065.1|  hypothetical protein CISIN_1g042794mg                   334   1e-106   
ref|XP_006647208.1|  PREDICTED: uncharacterized protein LOC102715175    338   1e-106   
ref|XP_006302252.1|  hypothetical protein CARUB_v10020289mg             338   1e-106   
ref|XP_008790242.1|  PREDICTED: uncharacterized protein LOC103707505    336   1e-106   
ref|XP_009415010.1|  PREDICTED: uncharacterized protein LOC103995962    337   1e-106   
ref|XP_008447582.1|  PREDICTED: uncharacterized protein LOC103489998    336   2e-106   
ref|XP_009625225.1|  PREDICTED: uncharacterized protein LOC104116132    335   3e-106   
ref|XP_006417407.1|  hypothetical protein EUTSA_v10009677mg             335   3e-106   
ref|XP_007024391.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    335   4e-106   
ref|XP_009355369.1|  PREDICTED: uncharacterized protein LOC103946396    335   4e-106   
ref|XP_006482399.1|  PREDICTED: uncharacterized protein LOC102630459    332   4e-106   
gb|AFO66521.1|  putative clathrin binding protein                       348   6e-106   
ref|XP_002324745.2|  hypothetical protein POPTR_0018s04680g             334   6e-106   
ref|XP_002268014.1|  PREDICTED: uncharacterized protein LOC100250508    334   6e-106   
ref|XP_007148589.1|  hypothetical protein PHAVU_006G221200g             335   7e-106   
emb|CDX97140.1|  BnaC09g44850D                                          335   8e-106   
ref|XP_011019540.1|  PREDICTED: uncharacterized protein LOC105122240    334   9e-106   
ref|XP_010106109.1|  hypothetical protein L484_003112                   334   1e-105   
ref|XP_006392995.1|  hypothetical protein EUTSA_v10012322mg             334   1e-105   
gb|AFW60050.1|  hypothetical protein ZEAMMB73_108408                    335   2e-105   
emb|CDO97949.1|  unnamed protein product                                333   2e-105   
ref|XP_010065247.1|  PREDICTED: uncharacterized protein LOC104452469    333   2e-105   
ref|XP_008663766.1|  PREDICTED: uncharacterized protein LOC103642231    335   2e-105   
emb|CDP08214.1|  unnamed protein product                                330   2e-105   
ref|XP_009402165.1|  PREDICTED: uncharacterized protein LOC103986...    333   2e-105   
ref|XP_006385195.1|  hypothetical protein POPTR_0003s00960g             333   2e-105   
emb|CBI29648.3|  unnamed protein product                                334   2e-105   
ref|XP_010099779.1|  hypothetical protein L484_010966                   333   3e-105   
emb|CDY31036.1|  BnaA08g25860D                                          332   3e-105   
emb|CAH67921.1|  OSIGBa0138E08-OSIGBa0161L23.2                          333   3e-105   
ref|XP_008244747.1|  PREDICTED: uncharacterized protein LOC103342870    333   3e-105   
ref|NP_001052347.1|  Os04g0272400                                       333   3e-105   
ref|XP_002891661.1|  hypothetical protein ARALYDRAFT_337332             333   4e-105   
emb|CDY19328.1|  BnaC05g08370D                                          332   4e-105   
ref|NP_177005.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    332   5e-105   
ref|XP_007215514.1|  hypothetical protein PRUPE_ppa007018mg             332   5e-105   
ref|XP_009144462.1|  PREDICTED: uncharacterized protein LOC103868...    333   6e-105   
ref|XP_008357658.1|  PREDICTED: uncharacterized protein LOC103421405    332   6e-105   
ref|XP_006349290.1|  PREDICTED: uncharacterized protein LOC102579219    332   6e-105   
gb|ADE76813.1|  unknown                                                 330   7e-105   
ref|XP_009630467.1|  PREDICTED: uncharacterized protein LOC104120416    332   7e-105   
ref|NP_001143222.1|  uncharacterized protein LOC100275738               333   8e-105   
ref|XP_006466159.1|  PREDICTED: uncharacterized protein LOC102619633    332   8e-105   
ref|XP_002444900.1|  hypothetical protein SORBIDRAFT_07g001090          332   8e-105   
ref|XP_011047853.1|  PREDICTED: uncharacterized protein LOC105142093    332   9e-105   
gb|EYU21409.1|  hypothetical protein MIMGU_mgv1a007990mg                332   1e-104   
gb|KDO58674.1|  hypothetical protein CISIN_1g040146mg                   331   1e-104   
gb|AAM63616.1|  unknown                                                 331   1e-104   
ref|XP_004972466.1|  PREDICTED: uncharacterized protein LOC101769924    332   1e-104   
gb|AAG50880.1|AC025294_18  hypothetical protein                         332   1e-104   
ref|NP_566682.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    331   1e-104   
ref|XP_002309520.1|  hypothetical protein POPTR_0006s24970g             331   2e-104   
ref|NP_175588.2|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    332   2e-104   
gb|KFK43315.1|  hypothetical protein AALP_AA1G108500                    332   2e-104   
ref|XP_009148352.1|  PREDICTED: uncharacterized protein LOC103871798    332   2e-104   
emb|CDX93443.1|  BnaA06g06050D                                          330   2e-104   
ref|XP_010097098.1|  hypothetical protein L484_019537                   330   2e-104   
ref|XP_010533932.1|  PREDICTED: uncharacterized protein LOC104809...    330   3e-104   
ref|XP_004141306.1|  PREDICTED: uncharacterized protein LOC101205668    330   3e-104   
ref|XP_011028389.1|  PREDICTED: uncharacterized protein LOC105128426    330   3e-104   
ref|XP_011097225.1|  PREDICTED: uncharacterized protein LOC105176192    327   3e-104   
ref|XP_002883297.1|  hypothetical protein ARALYDRAFT_479651             330   4e-104   
ref|NP_001143215.1|  uncharacterized protein LOC100275720               331   4e-104   
ref|XP_006385074.1|  hypothetical protein POPTR_0004s23660g             330   4e-104   
ref|XP_004165595.1|  PREDICTED: uncharacterized protein LOC101231487    330   5e-104   
ref|XP_008461555.1|  PREDICTED: uncharacterized protein LOC103500127    331   5e-104   
ref|XP_008452226.1|  PREDICTED: uncharacterized protein LOC103493...    330   5e-104   
ref|XP_004230423.1|  PREDICTED: uncharacterized protein LOC101259085    330   5e-104   
ref|XP_006286838.1|  hypothetical protein CARUB_v10003837mg             329   6e-104   
ref|XP_009778079.1|  PREDICTED: uncharacterized protein LOC104227520    329   6e-104   
ref|XP_009399147.1|  PREDICTED: uncharacterized protein LOC103983624    329   6e-104   
ref|XP_010500763.1|  PREDICTED: uncharacterized protein LOC104778093    330   6e-104   
ref|XP_006598780.1|  PREDICTED: uncharacterized protein LOC100796...    330   6e-104   
ref|XP_009122883.1|  PREDICTED: LOW QUALITY PROTEIN: clathrin int...    346   7e-104   
gb|ABE91847.1|  Protein of unknown function DUF266, plant               331   7e-104   
ref|XP_006299117.1|  hypothetical protein CARUB_v10015258mg             329   7e-104   
ref|XP_008452225.1|  PREDICTED: uncharacterized protein LOC103493...    329   7e-104   
emb|CDX87842.1|  BnaC06g09040D                                          329   8e-104   
ref|XP_010524350.1|  PREDICTED: uncharacterized protein LOC104802437    329   9e-104   
ref|XP_009410706.1|  PREDICTED: uncharacterized protein LOC103992641    329   1e-103   
ref|XP_002977635.1|  hypothetical protein SELMODRAFT_107168             327   1e-103   
ref|XP_006406285.1|  hypothetical protein EUTSA_v10021956mg             328   1e-103   
emb|CDY20644.1|  BnaC08g14140D                                          329   1e-103   
gb|EYU44621.1|  hypothetical protein MIMGU_mgv1a022423mg                325   1e-103   
ref|XP_009786387.1|  PREDICTED: uncharacterized protein LOC104234513    328   1e-103   
ref|XP_010936142.1|  PREDICTED: uncharacterized protein LOC105055840    328   1e-103   
ref|XP_010475888.1|  PREDICTED: uncharacterized protein LOC104755237    329   2e-103   
ref|XP_002466519.1|  hypothetical protein SORBIDRAFT_01g009210          329   2e-103   
ref|XP_006431491.1|  hypothetical protein CICLE_v10001419mg             328   2e-103   
ref|XP_009145487.1|  PREDICTED: uncharacterized protein LOC103869...    328   2e-103   
gb|KHN11046.1|  hypothetical protein glysoja_044070                     325   3e-103   
ref|XP_002453631.1|  hypothetical protein SORBIDRAFT_04g009360          330   3e-103   
ref|XP_004297621.1|  PREDICTED: uncharacterized protein LOC101304278    327   3e-103   
ref|XP_002442608.1|  hypothetical protein SORBIDRAFT_08g022900          328   3e-103   
gb|EPS68648.1|  hypothetical protein M569_06120                         326   3e-103   
ref|XP_002515894.1|  conserved hypothetical protein                     327   4e-103   
ref|XP_010458365.1|  PREDICTED: uncharacterized protein LOC104739637    328   4e-103   
ref|XP_002872192.1|  hypothetical protein ARALYDRAFT_910666             327   4e-103   
ref|XP_006659748.1|  PREDICTED: uncharacterized protein LOC102714034    327   4e-103   
emb|CDX94911.1|  BnaC05g07600D                                          327   4e-103   
ref|XP_004141671.1|  PREDICTED: uncharacterized protein LOC101216165    327   4e-103   
ref|XP_003573284.1|  PREDICTED: uncharacterized protein LOC100833185    328   4e-103   
ref|XP_009144879.1|  PREDICTED: uncharacterized protein LOC103868547    327   4e-103   
emb|CDX73016.1|  BnaC06g34640D                                          326   4e-103   
ref|XP_006357367.1|  PREDICTED: uncharacterized protein LOC102582902    327   5e-103   
ref|XP_004236394.1|  PREDICTED: uncharacterized protein LOC101257059    327   5e-103   
ref|XP_010479681.1|  PREDICTED: uncharacterized protein LOC104758496    328   5e-103   
ref|XP_002975225.1|  hypothetical protein SELMODRAFT_102845             325   5e-103   
ref|XP_004986256.1|  PREDICTED: uncharacterized protein LOC101760830    328   5e-103   
ref|XP_006369242.1|  hypothetical protein POPTR_0001s20050g             327   6e-103   
ref|XP_010490863.1|  PREDICTED: uncharacterized protein LOC104768...    328   6e-103   
ref|XP_009411881.1|  PREDICTED: uncharacterized protein LOC103993515    327   6e-103   
emb|CDY51451.1|  BnaA05g36680D                                          326   9e-103   
ref|XP_010490870.1|  PREDICTED: uncharacterized protein LOC104768...    327   9e-103   
ref|XP_004163997.1|  PREDICTED: uncharacterized LOC101215808            327   9e-103   
gb|KDP42488.1|  hypothetical protein JCGZ_00285                         327   1e-102   
ref|XP_006343019.1|  PREDICTED: uncharacterized protein LOC102599337    326   1e-102   
ref|XP_010681644.1|  PREDICTED: uncharacterized protein LOC104896577    326   1e-102   
ref|XP_008380827.1|  PREDICTED: uncharacterized protein LOC103443716    326   1e-102   
gb|KHG14930.1|  Putative DNA helicase ino80                             325   2e-102   
ref|XP_002888660.1|  hypothetical protein ARALYDRAFT_475957             326   2e-102   
ref|XP_010999299.1|  PREDICTED: uncharacterized protein LOC105107168    325   2e-102   
ref|XP_003560217.1|  PREDICTED: uncharacterized protein LOC100835983    325   2e-102   
emb|CDY56916.1|  BnaCnng31370D                                          325   2e-102   
ref|XP_003540132.1|  PREDICTED: uncharacterized protein LOC100793763    325   2e-102   
ref|XP_002447391.1|  hypothetical protein SORBIDRAFT_06g034240          327   2e-102   
ref|XP_009151114.1|  PREDICTED: uncharacterized protein LOC103874440    325   3e-102   
ref|XP_004241946.1|  PREDICTED: uncharacterized protein LOC101261829    324   3e-102   
ref|XP_011072465.1|  PREDICTED: uncharacterized protein LOC105157713    325   4e-102   
ref|XP_006417483.1|  hypothetical protein EUTSA_v10007760mg             325   4e-102   
ref|NP_172499.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    325   4e-102   
ref|XP_009144461.1|  PREDICTED: uncharacterized protein LOC103868...    325   5e-102   
ref|XP_004959909.1|  PREDICTED: uncharacterized protein LOC101775358    325   5e-102   
ref|XP_010907977.1|  PREDICTED: uncharacterized protein LOC105034483    324   5e-102   
ref|XP_002892557.1|  predicted protein                                  325   6e-102   
ref|XP_009780294.1|  PREDICTED: uncharacterized protein LOC104229...    322   6e-102   
ref|XP_010690090.1|  PREDICTED: uncharacterized protein LOC104903696    324   7e-102   
ref|XP_006303228.1|  hypothetical protein CARUB_v10012092mg             325   7e-102   
ref|XP_004161338.1|  PREDICTED: uncharacterized protein LOC101228706    325   8e-102   
ref|XP_002872191.1|  hypothetical protein ARALYDRAFT_351610             323   1e-101   
gb|EMS61782.1|  hypothetical protein TRIUR3_23279                       320   1e-101   
gb|KGN57704.1|  hypothetical protein Csa_3G257090                       325   1e-101   
ref|XP_010062561.1|  PREDICTED: uncharacterized protein LOC104449935    323   1e-101   
ref|XP_008775897.1|  PREDICTED: uncharacterized protein LOC103696141    323   1e-101   
ref|XP_009780287.1|  PREDICTED: uncharacterized protein LOC104229...    323   2e-101   
ref|NP_001169393.1|  uncharacterized protein LOC100383262               324   2e-101   
ref|XP_010033803.1|  PREDICTED: uncharacterized protein LOC104423043    323   2e-101   
ref|XP_004503748.1|  PREDICTED: uncharacterized protein LOC101509...    324   2e-101   
ref|XP_006470991.1|  PREDICTED: uncharacterized protein LOC102625...    323   2e-101   
gb|EAZ05353.1|  hypothetical protein OsI_27557                          323   3e-101   
ref|XP_010466367.1|  PREDICTED: uncharacterized protein LOC104746558    322   3e-101   
gb|EEC73057.1|  hypothetical protein OsI_07014                          324   3e-101   
ref|NP_001060819.1|  Os08g0110400                                       323   3e-101   
ref|XP_011081610.1|  PREDICTED: uncharacterized protein LOC105164614    322   4e-101   
ref|XP_008786442.1|  PREDICTED: uncharacterized protein LOC103704784    318   6e-101   
ref|NP_001046711.1|  Os02g0327500                                       323   7e-101   
ref|XP_006470990.1|  PREDICTED: uncharacterized protein LOC102625...    322   8e-101   
ref|XP_011092268.1|  PREDICTED: uncharacterized protein LOC105172507    324   9e-101   
ref|XP_009601960.1|  PREDICTED: uncharacterized protein LOC104097139    321   9e-101   
ref|XP_009367505.1|  PREDICTED: uncharacterized protein LOC103957137    321   1e-100   
ref|XP_010535201.1|  PREDICTED: uncharacterized protein LOC104810555    321   1e-100   
ref|NP_197969.2|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    321   1e-100   
gb|ABK28713.1|  unknown                                                 321   2e-100   
ref|XP_008391294.1|  PREDICTED: uncharacterized protein LOC103453537    320   2e-100   
ref|XP_010227722.1|  PREDICTED: uncharacterized protein LOC104581568    321   2e-100   
ref|XP_010493855.1|  PREDICTED: uncharacterized protein LOC104771079    320   2e-100   
ref|XP_011095814.1|  PREDICTED: uncharacterized protein LOC105175...    319   2e-100   
ref|XP_008381486.1|  PREDICTED: uncharacterized protein LOC103444326    337   2e-100   
dbj|BAJ98929.1|  predicted protein                                      323   2e-100   
ref|XP_002276490.2|  PREDICTED: uncharacterized protein LOC100266878    320   2e-100   
ref|XP_006645101.1|  PREDICTED: uncharacterized protein LOC102713419    320   3e-100   
ref|XP_010545645.1|  PREDICTED: uncharacterized protein LOC104817942    320   3e-100   
gb|AAD40142.1|AF149413_23  contains similarity to several Arabido...    321   4e-100   
ref|XP_010682058.1|  PREDICTED: uncharacterized protein LOC104896961    321   4e-100   
ref|XP_004134258.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    320   5e-100   
ref|XP_003529742.1|  PREDICTED: uncharacterized protein LOC100793448    319   5e-100   
ref|XP_011095742.1|  PREDICTED: uncharacterized protein LOC105175...    319   5e-100   
ref|XP_008462376.1|  PREDICTED: uncharacterized protein LOC103500748    319   6e-100   
ref|XP_009415632.1|  PREDICTED: uncharacterized protein LOC103996435    317   6e-100   
dbj|BAJ98037.1|  predicted protein                                      322   7e-100   
ref|XP_009791972.1|  PREDICTED: uncharacterized protein LOC104239130    319   1e-99    
ref|XP_009338135.1|  PREDICTED: uncharacterized protein LOC103930517    318   1e-99    
ref|XP_010488146.1|  PREDICTED: uncharacterized protein LOC104766030    318   2e-99    
ref|XP_010510112.1|  PREDICTED: uncharacterized protein LOC104786396    318   2e-99    
gb|EYU45841.1|  hypothetical protein MIMGU_mgv1a018710mg                318   2e-99    
ref|XP_004510336.1|  PREDICTED: uncharacterized protein LOC101496152    318   2e-99    
gb|KHN11325.1|  hypothetical protein glysoja_023389                     315   2e-99    
ref|XP_004137618.1|  PREDICTED: uncharacterized protein LOC101207079    317   2e-99    
gb|KHN39275.1|  hypothetical protein glysoja_018047                     316   2e-99    
ref|XP_009393005.1|  PREDICTED: uncharacterized protein LOC103978798    318   2e-99    
gb|ACU18530.1|  unknown                                                 317   3e-99    
ref|XP_009601484.1|  PREDICTED: uncharacterized protein LOC104096770    318   3e-99    
gb|EAZ41277.1|  hypothetical protein OsJ_25784                          314   3e-99    
gb|KEH18271.1|  core-2/I-branching enzyme                               318   5e-99    
gb|EPS70397.1|  hypothetical protein M569_04361                         316   7e-99    
gb|KFK35824.1|  hypothetical protein AALP_AA4G041900                    317   7e-99    
ref|XP_010421452.1|  PREDICTED: uncharacterized protein LOC104706914    316   8e-99    
ref|NP_172557.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    324   1e-98    
ref|XP_004301567.1|  PREDICTED: uncharacterized protein LOC101308879    317   1e-98    
ref|XP_008361859.1|  PREDICTED: uncharacterized protein LOC103425546    315   1e-98    
ref|XP_003533024.1|  PREDICTED: uncharacterized protein LOC100819579    316   1e-98    
ref|XP_010551624.1|  PREDICTED: uncharacterized protein LOC104822176    315   2e-98    
ref|XP_007135597.1|  hypothetical protein PHAVU_010G142800g             315   2e-98    
emb|CAN60261.1|  hypothetical protein VITISV_020168                     316   3e-98    
gb|EMS55277.1|  hypothetical protein TRIUR3_33067                       317   3e-98    
ref|XP_003567325.1|  PREDICTED: uncharacterized protein LOC100845991    314   7e-98    
gb|KHF98579.1|  hypothetical protein F383_37748                         308   2e-97    
gb|KHN24919.1|  hypothetical protein glysoja_027033                     309   4e-97    
ref|XP_009800325.1|  PREDICTED: uncharacterized protein LOC104246...    312   4e-97    
gb|AFW65878.1|  hypothetical protein ZEAMMB73_865081                    313   9e-97    
ref|XP_004145648.1|  PREDICTED: uncharacterized protein LOC101210199    312   1e-96    
ref|XP_002892607.1|  hypothetical protein ARALYDRAFT_312133             318   1e-96    



>ref|XP_009767018.1| PREDICTED: uncharacterized protein LOC104218270 [Nicotiana sylvestris]
Length=411

 Score =   470 bits (1209),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 226/312 (72%), Positives = 264/312 (85%), Gaps = 1/312 (0%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGL E +  P    H++SDEELLWRASM PKI E PF++VPKVAFMFLTRG + L+PLWE
Sbjct  100   VGLNEYIKPPSLLQHDMSDEELLWRASMVPKIQEFPFKKVPKVAFMFLTRGPVLLSPLWE  159

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
             MFF+GN G +SIYVHS DPSYN+++P   +FHGRRIPSK VEWGK NM+EAE+RLLANAL
Sbjct  160   MFFKGNEGFYSIYVHS-DPSYNQSQPESPIFHGRRIPSKEVEWGKVNMVEAEKRLLANAL  218

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SN+RF+LLSEACIPLFNFSTIY+YVMNS ++F+E YDLPGPVGRGRY  QM+P IK 
Sbjct  219   LDISNQRFVLLSEACIPLFNFSTIYTYVMNSTKSFVETYDLPGPVGRGRYRPQMSPTIKS  278

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
               W KGSQWFEMDR LA+EVISD+TYFPLFQ YCTG CY+DEHYLPT +++K G+ NS R
Sbjct  279   QQWMKGSQWFEMDRDLAIEVISDKTYFPLFQKYCTGSCYADEHYLPTFVSMKFGKRNSGR  338

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW+KGGPHP +F R+DVTV+FL KLR+ + C YNGEKT +C+LFARKFT HALSR
Sbjct  339   TLTWVDWSKGGPHPARFHRSDVTVEFLEKLRSESQCVYNGEKTNVCYLFARKFTTHALSR  398

Query  249   LLILAPKLMQFN  214
             LLI APK+M FN
Sbjct  399   LLIFAPKVMHFN  410



>ref|XP_009615449.1| PREDICTED: uncharacterized protein LOC104108167 [Nicotiana tomentosiformis]
Length=408

 Score =   467 bits (1202),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 224/312 (72%), Positives = 263/312 (84%), Gaps = 1/312 (0%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGL E +  P    H++SD+ELLWRASM PKI E PF+RVPKVAFMFLTRG + L+PLWE
Sbjct  97    VGLNEYIKPPSLLQHDMSDKELLWRASMVPKIQEFPFKRVPKVAFMFLTRGPVLLSPLWE  156

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
             MFF+GN G +SIYVHS DPSYN+++P   +FHGRRIPSK VEWGK NM+EAE+RLLANAL
Sbjct  157   MFFKGNEGFYSIYVHS-DPSYNQSQPESPIFHGRRIPSKEVEWGKVNMVEAEKRLLANAL  215

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SN+RF+LLSEACIPLFNFSTIY+Y+MNS + F+E YDLPGPVGRGRY  QM+P I +
Sbjct  216   LDISNQRFVLLSEACIPLFNFSTIYTYLMNSTKNFVETYDLPGPVGRGRYRHQMSPTINI  275

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
               W KGSQWFEMDR LA+EVISD+TYFP FQ YCTG CY+DEHYLPT +++K G+ NS R
Sbjct  276   QQWMKGSQWFEMDRNLAIEVISDKTYFPAFQKYCTGSCYADEHYLPTFVSMKFGKMNSGR  335

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW+KGGPHPT+F R+DVTV+FL KLR+ + C YNGEKT +C+LFARKFT HALSR
Sbjct  336   TLTWVDWSKGGPHPTRFHRSDVTVEFLEKLRSESQCVYNGEKTNVCYLFARKFTTHALSR  395

Query  249   LLILAPKLMQFN  214
             LLI APK+M FN
Sbjct  396   LLIFAPKVMHFN  407



>ref|XP_011070777.1| PREDICTED: uncharacterized protein LOC105156363 [Sesamum indicum]
Length=408

 Score =   452 bits (1162),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 217/306 (71%), Positives = 258/306 (84%), Gaps = 1/306 (0%)
 Frame = -3

Query  1131  LMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGN  952
              + PP   H ++D+ELLWRASM+PKI E PF+RVPKVAFMFLTRG + LAPLWE FF+G+
Sbjct  103   FLQPPTVMHEMTDQELLWRASMAPKIQEFPFKRVPKVAFMFLTRGPVVLAPLWEKFFKGH  162

Query  951   AGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNE  772
              GL+S+YVHS DPS+N +EP  SVFHGRRIPSK V+WG  NMIEAERRLLANALLDFSN+
Sbjct  163   DGLYSVYVHS-DPSFNGSEPEGSVFHGRRIPSKEVQWGNVNMIEAERRLLANALLDFSNQ  221

Query  771   RFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKG  592
              F+LLSE+CIPL+NFSTIYSY++NS + F+E YDLPGPVGRGRYS QM P+IKL  WRKG
Sbjct  222   HFVLLSESCIPLYNFSTIYSYLINSTQNFVEAYDLPGPVGRGRYSHQMGPMIKLEQWRKG  281

Query  591   SQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVD  412
             SQWF MDR LALEVI+D+ YFP+FQ YC G CY+DEHYLPT +++K G+ NSNRTLTWVD
Sbjct  282   SQWFGMDRDLALEVIADKNYFPVFQHYCNGSCYADEHYLPTFVSMKFGERNSNRTLTWVD  341

Query  411   WAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAP  232
             W++GGPHP+KF R DVT +FL KLR G +CEYNG+KT +C LFARKFT +AL RLL  AP
Sbjct  342   WSRGGPHPSKFIRTDVTPEFLEKLRRGGSCEYNGKKTNVCVLFARKFTYNALDRLLRFAP  401

Query  231   KLMQFN  214
             ++MQFN
Sbjct  402   QVMQFN  407



>ref|XP_006344154.1| PREDICTED: uncharacterized protein LOC102583596 [Solanum tuberosum]
Length=395

 Score =   449 bits (1154),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 215/313 (69%), Positives = 265/313 (85%), Gaps = 3/313 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL E +  P    H++SDEEL WR+SM PK+ E PF+RVPKVAFMFLTRG + L+PLWE
Sbjct  84    LGLNEYI-KPINVEHDMSDEELFWRSSMVPKVKEFPFKRVPKVAFMFLTRGPILLSPLWE  142

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllana  793
             +FF+GN G +SIY+HS DPSYN++   ES +FHGRRIPSK VEWGK NM+EAE+RLLANA
Sbjct  143   LFFKGNEGFYSIYIHS-DPSYNQSHIDESSIFHGRRIPSKEVEWGKINMVEAEKRLLANA  201

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SN+RF+LLSEACIPLFNFSTIY+++MNS + F+E YD PGPVGRGRY  QM+P IK
Sbjct  202   LLDISNQRFVLLSEACIPLFNFSTIYTHLMNSTKNFVETYDQPGPVGRGRYHPQMSPTIK  261

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             L  WRKGSQWFEMDR LALEV+SDQTYF +F+ +C G CY+DEH+LPT +++K  + N+ 
Sbjct  262   LPQWRKGSQWFEMDRDLALEVVSDQTYFSVFKKHCKGSCYADEHFLPTFVSMKFEKRNTG  321

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             RTLTWVDW+KGGPHPT++ R+D++V+FL KLR+ ++CEYNGEKT++CHLFARKFT HALS
Sbjct  322   RTLTWVDWSKGGPHPTRYYRSDISVEFLKKLRSESSCEYNGEKTSVCHLFARKFTPHALS  381

Query  252   RLLILAPKLMQFN  214
             RLLI APK+MQFN
Sbjct  382   RLLIFAPKVMQFN  394



>ref|XP_004238911.1| PREDICTED: uncharacterized protein LOC101249358 [Solanum lycopersicum]
Length=400

 Score =   446 bits (1148),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 212/313 (68%), Positives = 266/313 (85%), Gaps = 3/313 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL E +  P    H++SDEELLWR+SM PK+ + PF+  PKVAFMFLTRG + L+PLWE
Sbjct  89    LGLNEYI-KPINVEHDMSDEELLWRSSMVPKVKDFPFKIQPKVAFMFLTRGPILLSPLWE  147

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllana  793
             +FF+GN G +SIY+HS +PSYN+++  ES +FHGRRIPSK VEWGK NM+EAE+RLLANA
Sbjct  148   LFFKGNEGFYSIYIHS-NPSYNQSQVDESSIFHGRRIPSKEVEWGKINMVEAEKRLLANA  206

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             L+D SN+RF+LLSEACIPLFNFSTIY+++MNS + F+E YDLPGPVGRGRY  +M+P IK
Sbjct  207   LVDISNQRFVLLSEACIPLFNFSTIYTHLMNSTKNFVETYDLPGPVGRGRYHPRMSPTIK  266

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             L  WRKGSQWFEMDR LALEV+SDQTYF +F+ +C G CY+DEH+LPT +++K  + N+ 
Sbjct  267   LAQWRKGSQWFEMDRDLALEVVSDQTYFSVFKKHCKGSCYADEHFLPTFVSMKFEKRNTG  326

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             RTLTWVDW+KGGPHPT+F R+D++V+FL KLR+ ++CEYNGEKT++CHLFARKFT HALS
Sbjct  327   RTLTWVDWSKGGPHPTRFYRSDISVEFLKKLRSESSCEYNGEKTSICHLFARKFTPHALS  386

Query  252   RLLILAPKLMQFN  214
             RLLI APK+MQFN
Sbjct  387   RLLIFAPKVMQFN  399



>gb|KHN20747.1| hypothetical protein glysoja_019064 [Glycine soja]
Length=315

 Score =   439 bits (1129),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 211/312 (68%), Positives = 260/312 (83%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGL+E L  PP A H++SDEELLWRASM P + ++PF++ PK+AFMFLT+G + LAPLW+
Sbjct  6     VGLREFL-KPPMAMHDMSDEELLWRASMVPMVHKLPFKQTPKIAFMFLTKGPVLLAPLWQ  64

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+GN GL+SIYVHS  PS+NET P  SVFHGR IPS+ V WG+ +MIEAERRLLANAL
Sbjct  65    RFFKGNEGLYSIYVHSY-PSFNETVPESSVFHGRNIPSQEVRWGENSMIEAERRLLANAL  123

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             +DF+N+RF+LLSE+CIPLFNFSTIY+Y+MNS +TF+E YDLPG VGRGRYS QM P I+L
Sbjct  124   VDFTNQRFVLLSESCIPLFNFSTIYTYLMNSTKTFVEAYDLPGEVGRGRYSPQMRPQIRL  183

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWF++DR LAL+++SD  YF +F+ YC   CYSDEHYLPTL++IK  + NSNR
Sbjct  184   SQWRKGSQWFQIDRSLALQIVSDHQYFSVFKKYCKPSCYSDEHYLPTLVSIKFWKRNSNR  243

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW++GGPHP+++ R DVT++F NKLR G +CEYNG  T +CHLFARKFT HAL R
Sbjct  244   TLTWVDWSRGGPHPSRYFRTDVTIEFFNKLRFGRSCEYNGRTTNICHLFARKFTPHALDR  303

Query  249   LLILAPKLMQFN  214
             LL  APK+MQFN
Sbjct  304   LLRFAPKIMQFN  315



>emb|CDO98417.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   439 bits (1129),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 208/304 (68%), Positives = 253/304 (83%), Gaps = 1/304 (0%)
 Frame = -3

Query  1125  APPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAG  946
              P    H ++DE+LLWRASM P+I E PF+R PKVAFMFL RG LPLA LWE FF+G+ G
Sbjct  103   TPKNLTHQMTDEQLLWRASMVPRINEYPFKRTPKVAFMFLVRGELPLARLWERFFKGHEG  162

Query  945   LFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERF  766
             L+SIY+HSS PSYN T P  SVFHGR IPSK VEWGK NMIEAERRLLANALLDFSN+RF
Sbjct  163   LYSIYIHSS-PSYNGTTPDGSVFHGRNIPSKDVEWGKVNMIEAERRLLANALLDFSNQRF  221

Query  765   ILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQ  586
             +LLSE+CIPLFNFSTIYSY++NS ETF++ YDLPGP G+GRY+ +M P+I  +DWRKG+Q
Sbjct  222   VLLSESCIPLFNFSTIYSYLINSTETFVDSYDLPGPTGQGRYNKKMKPVINKSDWRKGAQ  281

Query  585   WFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWA  406
             WFEMDR LA++V+SD+ YFPLF+ +C   CY+DEHYLPT + +K G+ NS+RTLTWVDW+
Sbjct  282   WFEMDRELAIQVVSDRIYFPLFKRHCKSSCYADEHYLPTFVGMKYGRKNSDRTLTWVDWS  341

Query  405   KGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKL  226
             KGG HP +F+R ++T DFLN++RNG TCEYNG KT +CHLFARKF+  AL RLL+ APK+
Sbjct  342   KGGAHPHRFSRYEITPDFLNRMRNGQTCEYNGRKTNICHLFARKFSWTALDRLLMYAPKV  401

Query  225   MQFN  214
             M+FN
Sbjct  402   MEFN  405



>ref|XP_006344302.1| PREDICTED: uncharacterized protein LOC102604936 [Solanum tuberosum]
Length=376

 Score =   438 bits (1126),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 213/314 (68%), Positives = 262/314 (83%), Gaps = 4/314 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL E +  P    H++SDEELLWR+SM PK+ E+PF+  PKVAFMFLT+G + L+PLWE
Sbjct  64    LGLNEYI-KPINVEHDMSDEELLWRSSMVPKVKELPFKIQPKVAFMFLTKGPVLLSPLWE  122

Query  969   MFFRGNAGLFSIYVHSSDPSYN-ETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllan  796
             +FF+G+ G +SIYVHS  PSYN ++   ES +FHGRRIPSK V+WGK NM+EAE+RLLAN
Sbjct  123   LFFKGHEGFYSIYVHS-HPSYNNKSNIDESFIFHGRRIPSKEVDWGKVNMVEAEKRLLAN  181

Query  795   alLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPII  616
             ALLD SN+RF+LLSEACIPLFNFSTIY+++MNSNE F+E YD PGP+GRGRY  QM+P+I
Sbjct  182   ALLDSSNQRFVLLSEACIPLFNFSTIYTHLMNSNENFVETYDQPGPLGRGRYRPQMSPMI  241

Query  615   KLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNS  436
             KL+ WRKGSQWFEMDR LALEV+SD+TYF +FQ YC G CY+DEHYLPT +N+K    NS
Sbjct  242   KLSQWRKGSQWFEMDRDLALEVVSDKTYFSIFQKYCKGSCYADEHYLPTFVNMKFKNRNS  301

Query  435   NRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHAL  256
              RTLTWVDW+KGG HP +F R D+T +FL KLR+ ++CEYNG+KT++CHLFARKFT HAL
Sbjct  302   GRTLTWVDWSKGGAHPARFNRQDITKEFLKKLRSESSCEYNGKKTSICHLFARKFTSHAL  361

Query  255   SRLLILAPKLMQFN  214
             SRLL+ APK+MQFN
Sbjct  362   SRLLMFAPKVMQFN  375



>ref|XP_007044265.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 1 [Theobroma cacao]
 gb|EOY00097.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 1 [Theobroma cacao]
Length=399

 Score =   438 bits (1126),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 211/312 (68%), Positives = 257/312 (82%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL E L  PP   H + D+ELLWRASM P+I + PF RVPKVAFMFLT+G L LAPLWE
Sbjct  89    IGLTEFL-KPPDVMHGMDDKELLWRASMVPRIPQYPFDRVPKVAFMFLTKGPLLLAPLWE  147

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF G+ G++SIYVHS +PS+N ++P  SVF+GRRIPSK VEWGK NMIEAERRLLANAL
Sbjct  148   KFFEGHEGMYSIYVHS-NPSFNLSDPKSSVFYGRRIPSKEVEWGKVNMIEAERRLLANAL  206

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+RF+LLSE+CIP+FNFST+YSY++NS+++F+E YDL GPVGRGRYS +M+P + L
Sbjct  207   LDFSNQRFVLLSESCIPIFNFSTVYSYLINSSQSFVESYDLEGPVGRGRYSRRMSPRVTL  266

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKG+QWFEMDR LA+ V+SDQ YFP+FQ YC G CY+DEHYLPT + +K G  NSNR
Sbjct  267   DQWRKGAQWFEMDRELAIGVVSDQEYFPVFQKYCKGACYADEHYLPTFVTMKFGHKNSNR  326

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW+KGGPHP KF R +VTV+FL +LR+G+ C+YNG  T +CHLFARKF+  AL R
Sbjct  327   TLTWVDWSKGGPHPAKFLRTEVTVEFLERLRSGSQCQYNGNTTDICHLFARKFSPDALYR  386

Query  249   LLILAPKLMQFN  214
             LL  APKLM F+
Sbjct  387   LLKFAPKLMHFH  398



>ref|XP_003530022.2| PREDICTED: uncharacterized protein LOC100791882 [Glycine max]
Length=377

 Score =   437 bits (1123),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 209/312 (67%), Positives = 259/312 (83%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGL+E L  PP A H++SDEELLWRASM P + ++PF++ PK+AFMFLT+G + LAPLW+
Sbjct  68    VGLREFL-KPPMAMHDMSDEELLWRASMVPMVHKLPFKQTPKIAFMFLTKGPVLLAPLWQ  126

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+GN GL+S+YVHS  PS+NET P  SVFHGR IPS+ V WG+ +MIEAERRLLANAL
Sbjct  127   RFFKGNEGLYSMYVHSY-PSFNETVPESSVFHGRNIPSQEVRWGENSMIEAERRLLANAL  185

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             +DF+N+RF+LLSE+CIPLFNFSTIY+Y+MNS +TF+E YDLPG VG GRYS QM P I+L
Sbjct  186   VDFTNQRFVLLSESCIPLFNFSTIYTYLMNSTKTFVEAYDLPGEVGHGRYSPQMRPQIRL  245

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWF++DR LAL+++SD  YF +F+ YC   CYSDEHYLPTL++IK  + NSNR
Sbjct  246   SQWRKGSQWFQIDRSLALQIVSDHQYFSVFKKYCKPSCYSDEHYLPTLVSIKFWKRNSNR  305

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW++GGPHP+++ R DVT++F NKLR G +CEYNG  T +CHLFARKFT HAL R
Sbjct  306   TLTWVDWSRGGPHPSRYFRTDVTIEFFNKLRFGRSCEYNGRTTNICHLFARKFTPHALDR  365

Query  249   LLILAPKLMQFN  214
             LL  APK+MQFN
Sbjct  366   LLRFAPKIMQFN  377



>ref|XP_010066702.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104453777 
[Eucalyptus grandis]
Length=451

 Score =   435 bits (1119),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 212/309 (69%), Positives = 258/309 (83%), Gaps = 4/309 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGL E L   P   H++ D+ELLWRASMSP+I E PF R PKVAF+FL +G +PLAPLWE
Sbjct  83    VGLAEYLKPAP-VTHDMEDDELLWRASMSPRIREYPFERTPKVAFLFLAKGPVPLAPLWE  141

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G  GL+S+YVHS +P +NETEP +SVFHGRRIPSKGV WG  NMIEAERRLLANAL
Sbjct  142   KFFKGQEGLYSVYVHS-NPPWNETEPEDSVFHGRRIPSKGVSWGNVNMIEAERRLLANAL  200

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD +NERF+L+SE CIPLFNFST+YSY++NS +TF++ YDLPGPVGRGRYSS M+P IK+
Sbjct  201   LDVANERFVLVSETCIPLFNFSTVYSYLVNSTQTFVQSYDLPGPVGRGRYSSGMSPHIKI  260

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKG+QWFEMDRRLA+EV+SD+TYFPLFQ +C   CY+DEHYLPTL+N+K G  NSNR
Sbjct  261   HHWRKGAQWFEMDRRLAIEVVSDRTYFPLFQRHCRHNCYADEHYLPTLVNMKFGASNSNR  320

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGN--TCEYNGEKTTMCHLFARKFTLHAL  256
             TLTWVDW+KGGPHP +F RN++TV+FL +LR+GN   CEYNG+ T++C+LFARKF   +L
Sbjct  321   TLTWVDWSKGGPHPNRFVRNEITVEFLERLRDGNGMRCEYNGKATSVCYLFARKFLPSSL  380

Query  255   SRLLILAPK  229
              RLL  AP+
Sbjct  381   DRLLRFAPQ  389



>emb|CBI15481.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   431 bits (1109),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 212/313 (68%), Positives = 259/313 (83%), Gaps = 3/313 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLKE L  PP  AH+++DEELLWRASM P++G  PF+RVPKVAF+FLTRG LPLAP WE
Sbjct  55    IGLKEYL-KPPKVAHDMTDEELLWRASMVPRVGGFPFKRVPKVAFLFLTRGPLPLAPFWE  113

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllana  793
             +FF+G+ G +SIYVHS  PS+N T  P+S VFHGRRIPSK V+WGK NM+EAERRLLANA
Sbjct  114   LFFKGHEGRYSIYVHS-HPSFNATLVPQSSVFHGRRIPSKEVQWGKFNMVEAERRLLANA  172

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SN+RF+LLSE+CIPL+NFSTIYSY+M S ++F+E YDLPGPVGRGRY+ +M P+IK
Sbjct  173   LLDISNQRFVLLSESCIPLYNFSTIYSYLMGSKKSFVESYDLPGPVGRGRYNPRMKPLIK  232

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             +  WRKGSQWFEMDR LA++VISD+ YFP+FQ +CT PCY+DEHYLPTL+++K  + NSN
Sbjct  233   MEQWRKGSQWFEMDRGLAIQVISDRKYFPVFQKFCTPPCYADEHYLPTLVSVKFWRRNSN  292

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             R+LTWVDW+ GG HP +F R  VTVDFL KLRNG+ C YNG+ +  C +FARKF  +AL 
Sbjct  293   RSLTWVDWSHGGAHPARFWRVAVTVDFLKKLRNGSHCHYNGKSSNTCFMFARKFLPNALD  352

Query  252   RLLILAPKLMQFN  214
             RLL   PKLM+FN
Sbjct  353   RLLRFGPKLMKFN  365



>ref|XP_002276828.1| PREDICTED: uncharacterized protein LOC100247520 [Vitis vinifera]
Length=390

 Score =   431 bits (1109),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 212/313 (68%), Positives = 259/313 (83%), Gaps = 3/313 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLKE L  PP  AH+++DEELLWRASM P++G  PF+RVPKVAF+FLTRG LPLAP WE
Sbjct  80    IGLKEYL-KPPKVAHDMTDEELLWRASMVPRVGGFPFKRVPKVAFLFLTRGPLPLAPFWE  138

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllana  793
             +FF+G+ G +SIYVHS  PS+N T  P+S VFHGRRIPSK V+WGK NM+EAERRLLANA
Sbjct  139   LFFKGHEGRYSIYVHS-HPSFNATLVPQSSVFHGRRIPSKEVQWGKFNMVEAERRLLANA  197

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SN+RF+LLSE+CIPL+NFSTIYSY+M S ++F+E YDLPGPVGRGRY+ +M P+IK
Sbjct  198   LLDISNQRFVLLSESCIPLYNFSTIYSYLMGSKKSFVESYDLPGPVGRGRYNPRMKPLIK  257

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             +  WRKGSQWFEMDR LA++VISD+ YFP+FQ +CT PCY+DEHYLPTL+++K  + NSN
Sbjct  258   MEQWRKGSQWFEMDRGLAIQVISDRKYFPVFQKFCTPPCYADEHYLPTLVSVKFWRRNSN  317

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             R+LTWVDW+ GG HP +F R  VTVDFL KLRNG+ C YNG+ +  C +FARKF  +AL 
Sbjct  318   RSLTWVDWSHGGAHPARFWRVAVTVDFLKKLRNGSHCHYNGKSSNTCFMFARKFLPNALD  377

Query  252   RLLILAPKLMQFN  214
             RLL   PKLM+FN
Sbjct  378   RLLRFGPKLMKFN  390



>ref|XP_009357077.1| PREDICTED: uncharacterized protein LOC103947833 [Pyrus x bretschneideri]
Length=400

 Score =   431 bits (1109),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 215/312 (69%), Positives = 251/312 (80%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLKE L  PP   H++ D ELLWRASMSP+I + PF RVPKVAF+FL +G + LAPLWE
Sbjct  90    IGLKEYL-KPPEVFHDMDDVELLWRASMSPRISDYPFPRVPKVAFLFLVKGPVLLAPLWE  148

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ GL+SIYVHS +PSYN + P   VFHGRRIPS+ VEWG  NMIEAERRLLANAL
Sbjct  149   KFFKGHQGLYSIYVHS-NPSYNGSHPETPVFHGRRIPSQEVEWGNVNMIEAERRLLANAL  207

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SNERF+LLSEACIPL NFST+Y+YV+ SNETF++VYD P  VGRGRYS  M P + L
Sbjct  208   LDISNERFVLLSEACIPLHNFSTVYNYVIRSNETFVQVYDDPSSVGRGRYSFNMYPQVWL  267

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             N WRKGSQWFEMDR LA+EV+SD+ YFP+FQSYC G CY+DEHYLPT +N+K G+ NSNR
Sbjct  268   NQWRKGSQWFEMDRSLAIEVVSDRKYFPVFQSYCKGSCYADEHYLPTFVNMKFGKKNSNR  327

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW++GGPHP KFTR DVTVD LN LRNG +C YNG  + +C+LFARKF    L R
Sbjct  328   SLTWVDWSRGGPHPAKFTRTDVTVDVLNSLRNGTSCIYNGRVSNVCYLFARKFGPETLER  387

Query  249   LLILAPKLMQFN  214
             LL  APKLM FN
Sbjct  388   LLKFAPKLMGFN  399



>ref|XP_007152746.1| hypothetical protein PHAVU_004G156000g [Phaseolus vulgaris]
 gb|ESW24740.1| hypothetical protein PHAVU_004G156000g [Phaseolus vulgaris]
Length=449

 Score =   433 bits (1114),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 215/312 (69%), Positives = 255/312 (82%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL E L +P  A H++SDEELLW+ASM P I ++PF++ PKVAFMFLT+G + LAPLWE
Sbjct  140   IGLSEFLKSP-MAMHDMSDEELLWKASMVPMIHKLPFKQTPKVAFMFLTKGPVLLAPLWE  198

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+GN GL+SIYVHS  PS NET P  SVFHGR IPSK V WG+ +MIEAERRLLANAL
Sbjct  199   RFFKGNEGLYSIYVHSY-PSSNETVPKNSVFHGRNIPSKEVRWGENSMIEAERRLLANAL  257

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+RF+LLSE+CIPLFNFSTIY+Y+MNS +TF+E YDLPG VGRGRY +QM P I+L
Sbjct  258   LDFSNQRFVLLSESCIPLFNFSTIYTYLMNSTKTFVEAYDLPGEVGRGRYRTQMRPQIRL  317

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWF++DR LAL+ +SD  YFP+F  YC   CYSDEHYLPT ++IK  + NSNR
Sbjct  318   SQWRKGSQWFQIDRFLALQTVSDYHYFPVFLKYCNPNCYSDEHYLPTFVSIKFWKRNSNR  377

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDWAKGG HP+++ RNDV  +FLNKLR G +C+YNG  T +CHLFARKFT HAL R
Sbjct  378   TLTWVDWAKGGAHPSRYYRNDVNNEFLNKLRFGTSCDYNGHTTNICHLFARKFTTHALDR  437

Query  249   LLILAPKLMQFN  214
             LL  APKLMQFN
Sbjct  438   LLRFAPKLMQFN  449



>ref|XP_010265065.1| PREDICTED: uncharacterized protein LOC104602904 [Nelumbo nucifera]
 ref|XP_010265066.1| PREDICTED: uncharacterized protein LOC104602904 [Nelumbo nucifera]
 ref|XP_010265067.1| PREDICTED: uncharacterized protein LOC104602904 [Nelumbo nucifera]
Length=411

 Score =   431 bits (1109),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 210/312 (67%), Positives = 258/312 (83%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLKE L  PP   H+++D+ELLWRASM P+I E P++RVPKVAFMFLTRG L LAPLWE
Sbjct  102   IGLKEYL-KPPTVMHDMNDDELLWRASMVPRIHEFPYKRVPKVAFMFLTRGRLALAPLWE  160

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ GL+SIYVHSS PS+N+TEP   VF GRRIPSK V+WGK +MIEAERRLLANAL
Sbjct  161   KFFKGHEGLYSIYVHSS-PSFNDTEPESPVFQGRRIPSKDVQWGKFSMIEAERRLLANAL  219

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+RF+LLS+ACIPLFNFST+Y+Y++ S ++F+E YD PGPVGRGRYS +M P IKL
Sbjct  220   LDFSNQRFVLLSDACIPLFNFSTVYNYLIGSTKSFVEAYDEPGPVGRGRYSPRMKPDIKL  279

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWFEMDR LA+E+ SD+ YF LF  YC   CYSDEHY+PTL+++K  + NSNR
Sbjct  280   SQWRKGSQWFEMDRDLAIEIASDRKYFSLFGRYCKPSCYSDEHYIPTLVSLKFWEKNSNR  339

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW++GGPHPT+F R DVTV+ L ++R+G TCEYNG+ T +C LFARKF  + L R
Sbjct  340   SLTWVDWSRGGPHPTRFMRTDVTVELLERMRSGRTCEYNGKTTNVCSLFARKFYPNTLDR  399

Query  249   LLILAPKLMQFN  214
             LL  APK+M+FN
Sbjct  400   LLRFAPKVMKFN  411



>ref|XP_006468735.1| PREDICTED: uncharacterized protein LOC102627900 [Citrus sinensis]
 gb|KDO76925.1| hypothetical protein CISIN_1g015876mg [Citrus sinensis]
Length=399

 Score =   429 bits (1104),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 212/312 (68%), Positives = 253/312 (81%), Gaps = 4/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGL E L  PP   H++ D ELLWRAS+ PKI E PF+RVPKVAF+FLTRG + LAPLWE
Sbjct  88    VGLAEFL-KPPNTTHDMEDAELLWRASVVPKIPEYPFKRVPKVAFLFLTRGPVLLAPLWE  146

Query  969   MFFRGNAGLFSIYVHSSDPSYNET--EPPESVFHGRRIPSKGVEWGKANMIeaerrllan  796
              FF+G+ G +SIYVHSS PS+N++  EP  SVF+GRRIPS+ V+WG  NMIEAERRLLAN
Sbjct  147   KFFKGHEGFYSIYVHSS-PSFNQSDAEPEGSVFYGRRIPSREVKWGGVNMIEAERRLLAN  205

Query  795   alLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPII  616
             ALLDFSNERF+LLSE+CIPLFNFS IYS++MNS + F+EVYDL GPVGRGRYS +M P I
Sbjct  206   ALLDFSNERFVLLSESCIPLFNFSVIYSHLMNSTQNFVEVYDLEGPVGRGRYSFRMAPKI  265

Query  615   KLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNS  436
             K+  WRKGSQWF+MDR LA EV+SD TYFPLFQ YC G CY+DEHYLPT +N+K G  N+
Sbjct  266   KIFQWRKGSQWFQMDRNLATEVVSDTTYFPLFQKYCKGSCYADEHYLPTFVNMKFGAKNA  325

Query  435   NRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHAL  256
             NRTLTWVDW+ GGPHPT+F R+ +TV FL KLR+G+ CEYNG++T +CHLFARKF  + L
Sbjct  326   NRTLTWVDWSHGGPHPTRFVRSSITVQFLQKLRSGSRCEYNGKRTNICHLFARKFLPNTL  385

Query  255   SRLLILAPKLMQ  220
              RLL  AP ++ 
Sbjct  386   DRLLRYAPTVLH  397



>ref|XP_009348209.1| PREDICTED: uncharacterized protein LOC103939820 [Pyrus x bretschneideri]
Length=410

 Score =   429 bits (1104),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 205/312 (66%), Positives = 257/312 (82%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLKE   +P    H + D+ELLWRAS+ P+   +PF+R PKVAFMFLTRG L LAPLWE
Sbjct  101   IGLKEYTKSP-NILHEMDDDELLWRASLVPRRRGLPFKRTPKVAFMFLTRGRLALAPLWE  159

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
             MFF+G+ GL+SIYVH+ +P +N+T P  SVF+GRR+PSK V WG+ NM++AERRLLANAL
Sbjct  160   MFFKGHEGLYSIYVHA-NPGFNDTMPENSVFYGRRVPSKNVTWGEPNMVKAERRLLANAL  218

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+RF+LLSE+CIPLFNF+ +YSY+M+SN+TF+E YDLPGPVGR RY  +M P I L
Sbjct  219   LDFSNQRFVLLSESCIPLFNFNVVYSYLMDSNQTFVEAYDLPGPVGRERYRHKMRPQITL  278

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWFE+DR +A EV+SD+ YFP+F  YCT  CYSDEHYLPT ++IK  + NSNR
Sbjct  279   DQWRKGSQWFEVDREIATEVVSDEKYFPVFTKYCTPSCYSDEHYLPTYVSIKFWKKNSNR  338

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW+KGGPHP+KF R DVT+DFL KLR+G+ CEYNG++T +C+LFARKF  ++L R
Sbjct  339   TLTWVDWSKGGPHPSKFMRTDVTIDFLKKLRHGSKCEYNGKRTNICYLFARKFLPNSLDR  398

Query  249   LLILAPKLMQFN  214
             LL  APK+M+FN
Sbjct  399   LLRFAPKIMKFN  410



>ref|XP_006448426.1| hypothetical protein CICLE_v10015505mg [Citrus clementina]
 gb|ESR61666.1| hypothetical protein CICLE_v10015505mg [Citrus clementina]
Length=397

 Score =   429 bits (1103),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 212/314 (68%), Positives = 254/314 (81%), Gaps = 4/314 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGL E L  PP   H++ D ELLWRAS+ PKI E PF+RVPKVAF+FLTRG + LAPLWE
Sbjct  86    VGLAEFL-KPPNTTHDMEDAELLWRASVVPKIPEYPFKRVPKVAFLFLTRGPVLLAPLWE  144

Query  969   MFFRGNAGLFSIYVHSSDPSYNET--EPPESVFHGRRIPSKGVEWGKANMIeaerrllan  796
              FF+G+ G +SIYVHSS PS+N++  EP  SVF+GRRIPS+ V+WG  NMIEAERRLLAN
Sbjct  145   KFFKGHGGFYSIYVHSS-PSFNQSDAEPEGSVFYGRRIPSREVKWGGVNMIEAERRLLAN  203

Query  795   alLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPII  616
             ALLDFSNERF+LLSE+CIPLFNFS IYS++MNS + F+EVYDL GPVGRGRYS +M P I
Sbjct  204   ALLDFSNERFVLLSESCIPLFNFSVIYSHLMNSTQNFVEVYDLEGPVGRGRYSFRMAPKI  263

Query  615   KLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNS  436
             K+  WRKGSQWF+MDR LA EV+SD+TYFPLFQ YC G CY+DEHYLPT +N+K G  N+
Sbjct  264   KIFQWRKGSQWFQMDRNLATEVVSDRTYFPLFQKYCKGSCYADEHYLPTFVNMKFGAKNA  323

Query  435   NRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHAL  256
             NRTLTWVDW+ GGPHPT+F R+ +TV FL KLR+G+ CEYNG+ T +CHLFARKF  + L
Sbjct  324   NRTLTWVDWSHGGPHPTRFLRSSITVQFLQKLRSGSRCEYNGKSTNICHLFARKFLPNTL  383

Query  255   SRLLILAPKLMQFN  214
              RLL  AP ++  +
Sbjct  384   DRLLRYAPTVLHIS  397



>ref|XP_008374777.1| PREDICTED: uncharacterized protein LOC103438016 [Malus domestica]
Length=410

 Score =   429 bits (1102),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 257/312 (82%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLKE   +P    H + D+ELLWRAS+ P+   +PF+R PKVAFMFLTRG L LAPLWE
Sbjct  101   IGLKEYTKSP-NILHEMDDDELLWRASLVPRRRGLPFKRTPKVAFMFLTRGRLALAPLWE  159

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
             MFF+G+ G++S+YVH+ +P +N+T P  SVF+GRR+PSK V WG+ NM++AERRLLANAL
Sbjct  160   MFFKGHEGMYSVYVHA-NPDFNDTMPENSVFYGRRVPSKNVTWGEPNMVQAERRLLANAL  218

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+RF+LLSE+CIPLFNF+ +YSY+M+SN+TF+E YDLPGPVGR RY  +M P I L
Sbjct  219   LDFSNQRFVLLSESCIPLFNFNVVYSYLMDSNQTFVEAYDLPGPVGRERYRDKMRPQITL  278

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWFE+DR +A EV+SD+ YFP+F  YCT  CYSDEHYLPT ++IK  + NSNR
Sbjct  279   DKWRKGSQWFEVDREIATEVVSDEKYFPVFTKYCTPSCYSDEHYLPTYVSIKFWKKNSNR  338

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW+KGGPHP+KF R DVT+DFL KLR+G+ CEYNG++T +C+LFARKF  ++L R
Sbjct  339   TLTWVDWSKGGPHPSKFMRTDVTIDFLKKLRHGSKCEYNGKRTNICYLFARKFLPNSLDR  398

Query  249   LLILAPKLMQFN  214
             LL  APK+M+FN
Sbjct  399   LLRFAPKIMKFN  410



>ref|XP_007222895.1| hypothetical protein PRUPE_ppa006723mg [Prunus persica]
 gb|EMJ24094.1| hypothetical protein PRUPE_ppa006723mg [Prunus persica]
Length=398

 Score =   428 bits (1101),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/312 (67%), Positives = 249/312 (80%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLKE L  PP   H++ D+ELLWRASM P+I E PFRRVPKVAFMFLT+G + LAPLWE
Sbjct  88    IGLKEYL-KPPNVLHDMDDQELLWRASMIPRIPEYPFRRVPKVAFMFLTKGPVLLAPLWE  146

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ GL+SIYVHS +PSYN ++P   VFH RRIPS+ VEWG  NMIEAERRLLANAL
Sbjct  147   KFFKGHRGLYSIYVHS-NPSYNGSDPESPVFHDRRIPSREVEWGNVNMIEAERRLLANAL  205

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SN+RF+LLSE+CIPL NFST+YSY++ S E+F++VYD P  VGRGRY+S M P I L
Sbjct  206   LDISNQRFVLLSESCIPLHNFSTVYSYLVRSRESFVQVYDDPSSVGRGRYNSHMYPKISL  265

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWFEMDRR A+E++SD+ YFP FQ YC G CY+DEHYLPT  NI  G  NSNR
Sbjct  266   SQWRKGSQWFEMDRRHAIEIVSDKKYFPAFQKYCRGSCYADEHYLPTFANINFGAKNSNR  325

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW++GGPHP KFTR DVTV+ L++LRNG  C YNG+ T +C LFARKF    L R
Sbjct  326   SLTWVDWSRGGPHPAKFTRTDVTVELLSRLRNGTACVYNGKSTNVCFLFARKFGPDTLER  385

Query  249   LLILAPKLMQFN  214
             LL  APKLM+FN
Sbjct  386   LLRFAPKLMRFN  397



>ref|XP_008339646.1| PREDICTED: uncharacterized protein LOC103402673 [Malus domestica]
Length=400

 Score =   428 bits (1100),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 212/311 (68%), Positives = 249/311 (80%), Gaps = 2/311 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLKE L  PP   H++ D ELLWRASMSP+I E PF R PKVAF+FL +G + LAPLWE
Sbjct  90    IGLKEYL-KPPEVFHDMDDVELLWRASMSPRISEYPFPRXPKVAFLFLVKGPVLLAPLWE  148

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ GL+SIYVHS +PSYN + P   VFHGRRIPS+ VEWG  NMIEAERRLLANAL
Sbjct  149   KFFKGHQGLYSIYVHS-NPSYNGSHPETPVFHGRRIPSQEVEWGNVNMIEAERRLLANAL  207

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SNERF+LLSE+CIPL NFST+Y+Y++ SNETF++VYD P  VGRGRYS  M P + L
Sbjct  208   LDISNERFVLLSESCIPLHNFSTVYNYIIRSNETFVQVYDDPSSVGRGRYSFNMYPQVWL  267

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             N WRKGSQWFEMDR LA+EV+SD+ YFP+FQSYC G CY+DEHYLPT +N+K G+ NSNR
Sbjct  268   NQWRKGSQWFEMDRSLAIEVVSDRKYFPVFQSYCKGSCYADEHYLPTFVNMKFGKKNSNR  327

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW++GGPHP KFTR DVT+D LN LRNG +C YNG  + +C+LFARKF    L R
Sbjct  328   TLTWVDWSRGGPHPAKFTRTDVTIDVLNSLRNGTSCIYNGRVSNVCYLFARKFGPETLER  387

Query  249   LLILAPKLMQF  217
             LL  APKLM F
Sbjct  388   LLKFAPKLMGF  398



>ref|XP_008240316.1| PREDICTED: uncharacterized protein LOC103338837 [Prunus mume]
Length=411

 Score =   428 bits (1100),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 207/312 (66%), Positives = 250/312 (80%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLKE    PP   H++ D ELLWRAS+ P+   +PF+R PKVAFMFLTRG L LAP WE
Sbjct  102   IGLKEY-TKPPNIMHDMDDAELLWRASLVPRRPGLPFKRTPKVAFMFLTRGPLALAPFWE  160

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
             MFF+G+ GL+SIYVH+ +P +N+T P  SVF+GRR+PSK V WG+ NM++AERRLLANAL
Sbjct  161   MFFKGHEGLYSIYVHA-NPDFNDTMPQNSVFYGRRVPSKNVTWGEPNMVQAERRLLANAL  219

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+RF+LLSE+CIPLFNFS IY+Y+M S +TF+EVYDLPGPVGR RY  +M+P I L
Sbjct  220   LDFSNQRFVLLSESCIPLFNFSVIYNYLMGSTQTFVEVYDLPGPVGRDRYRPKMSPQITL  279

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
               WRKGSQWFE+DR +A+E++SDQ YFPLF  YC   CYSDEHYLPT +NIK    NSNR
Sbjct  280   GQWRKGSQWFEVDRVIAVEMVSDQKYFPLFTKYCKPSCYSDEHYLPTYVNIKFRNKNSNR  339

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW++GGPHP+KF R DVTV+FL KLR+G  CEYNG+ T +CHLFARKF  + L R
Sbjct  340   TLTWVDWSRGGPHPSKFMRTDVTVEFLEKLRHGTKCEYNGKSTDVCHLFARKFLPNTLDR  399

Query  249   LLILAPKLMQFN  214
             LL   PKLM+FN
Sbjct  400   LLRFGPKLMKFN  411



>ref|XP_006485819.1| PREDICTED: uncharacterized protein LOC102611796 [Citrus sinensis]
Length=419

 Score =   428 bits (1101),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 209/315 (66%), Positives = 259/315 (82%), Gaps = 4/315 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPG---AAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAP  979
              GL + +   P    A H++++EELLWRASM+P+I E PF+RVPKVAF+FLTRGA+ LAP
Sbjct  106   TGLNDYVSLRPNNNNAMHDMTEEELLWRASMAPRIHEYPFKRVPKVAFLFLTRGAVTLAP  165

Query  978   LWEMFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrlla  799
             LWE FF G+ GL+SIYVHSS PS+NET P  SVFHGRRIPSK V+WGK +M+EAERRLLA
Sbjct  166   LWEKFFHGHEGLYSIYVHSS-PSFNETVPQSSVFHGRRIPSKEVQWGKFSMLEAERRLLA  224

Query  798   nalLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPI  619
             NALLD +N+RF+LLSE+CIPLFNFSTIY+Y++NS++ F+E YDLPGPVGRGRY+ +M P+
Sbjct  225   NALLDITNQRFVLLSESCIPLFNFSTIYNYLINSSKAFVEAYDLPGPVGRGRYNRRMRPV  284

Query  618   IKLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGN  439
             I+L  WRKGSQWFEMDR LALEVISD+ YF  F+ +C   CY+DEHYLPT ++ K  + N
Sbjct  285   IRLEQWRKGSQWFEMDRALALEVISDKKYFVTFKRHCKASCYADEHYLPTFVSAKFWKRN  344

Query  438   SNRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHA  259
             SNR+LTWVDW+KGGPHP KF R DVT++FL +LR+G+ CEYNG++T +C LFARKF  +A
Sbjct  345   SNRSLTWVDWSKGGPHPAKFQRRDVTIEFLKRLRSGSHCEYNGKRTNICFLFARKFLPNA  404

Query  258   LSRLLILAPKLMQFN  214
             L RLL  APK+M FN
Sbjct  405   LDRLLRFAPKVMGFN  419



>ref|XP_006442617.1| hypothetical protein CICLE_v10020320mg [Citrus clementina]
 gb|ESR55857.1| hypothetical protein CICLE_v10020320mg [Citrus clementina]
Length=419

 Score =   428 bits (1100),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 207/301 (69%), Positives = 253/301 (84%), Gaps = 1/301 (0%)
 Frame = -3

Query  1116  GAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFS  937
              A H++++EELLWRASM+P+I E PF+RVPKVAF+FLTRGA+ LAPLWE FF G+ GL+S
Sbjct  120   NAMHDMTEEELLWRASMAPRIHEYPFKRVPKVAFLFLTRGAVTLAPLWEKFFHGHEGLYS  179

Query  936   IYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILL  757
             IYVHSS PS+NET P  SVFHGRRIPSK V+WGK +M+EAERRLLANALLD +N+RF+LL
Sbjct  180   IYVHSS-PSFNETVPQSSVFHGRRIPSKEVQWGKFSMLEAERRLLANALLDITNQRFVLL  238

Query  756   SEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFE  577
             SE+CIPLFNFSTIY+Y++NS++ FIE YDLPGPVGRGRY+  M P+I+L  WRKGSQWFE
Sbjct  239   SESCIPLFNFSTIYNYLINSSKAFIEAYDLPGPVGRGRYNRPMRPVIRLEQWRKGSQWFE  298

Query  576   MDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGG  397
             MDR LALEVISD+ YF  F+ +C   CY+DEHYLPT +++K  + NSNR+LTWVDW+KGG
Sbjct  299   MDRALALEVISDKKYFVTFKRHCKASCYADEHYLPTFVSVKFWKRNSNRSLTWVDWSKGG  358

Query  396   PHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQF  217
             PHP KF R DVT++FL +LR+G+ CEYNG+ T +C LFARKF  +AL RLL  APK+M F
Sbjct  359   PHPAKFQRRDVTIEFLKRLRSGSHCEYNGKSTNICFLFARKFLPNALDRLLRFAPKVMGF  418

Query  216   N  214
             N
Sbjct  419   N  419



>ref|XP_003533360.1| PREDICTED: uncharacterized protein LOC100803748 [Glycine max]
 gb|KHN42531.1| hypothetical protein glysoja_047605 [Glycine soja]
Length=451

 Score =   429 bits (1103),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 210/313 (67%), Positives = 258/313 (82%), Gaps = 3/313 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRV-PKVAFMFLTRGALPLAPLW  973
             VGL+E L  PP A H++SDEELLWRASM P + ++PF++   KVAFMFLT+G + LAPLW
Sbjct  141   VGLREFL-KPPMAMHDMSDEELLWRASMVPMVHKLPFKQTTAKVAFMFLTKGPVLLAPLW  199

Query  972   EMFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllana  793
             E FF+GN  L+SIYVHS +PS+NET P  SVFHGR IPS+ V WG+ +MIEAERRLLANA
Sbjct  200   ERFFKGNERLYSIYVHS-NPSFNETVPESSVFHGRNIPSQEVRWGENSMIEAERRLLANA  258

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLDFSN+RF+L+SE+CIPLFNFSTIY+Y+MNS +TF+E YDLPG VGRGRY+  M P I+
Sbjct  259   LLDFSNQRFVLVSESCIPLFNFSTIYTYLMNSTKTFVEAYDLPGEVGRGRYTPHMRPHIR  318

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             L+ WRKGSQWF++DR LAL++ISD  YFP+F+ YC   C  DEHYLPT ++IK  + NSN
Sbjct  319   LSQWRKGSQWFQIDRYLALQIISDHQYFPVFKKYCNPSCSCDEHYLPTFVSIKFWKRNSN  378

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             RTLTWVDW++GGPHP+++ R DVT++FLNKLR G++CEYNG  T +CHLFARKFT HAL 
Sbjct  379   RTLTWVDWSRGGPHPSRYFRTDVTIEFLNKLRYGSSCEYNGRTTNICHLFARKFTPHALD  438

Query  252   RLLILAPKLMQFN  214
             RLL  APK+MQFN
Sbjct  439   RLLRFAPKIMQFN  451



>gb|EYU30001.1| hypothetical protein MIMGU_mgv1a007596mg [Erythranthe guttata]
Length=402

 Score =   426 bits (1095),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 211/305 (69%), Positives = 252/305 (83%), Gaps = 8/305 (3%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYV  928
             H +S+ EL+WRASM+PKI E PF R PKVAFMFLTRG + LAPLWE FFRG+ GL+SIYV
Sbjct  98    HGMSERELMWRASMAPKIKEFPFERAPKVAFMFLTRGPVILAPLWERFFRGHRGLYSIYV  157

Query  927   HSSDPSYNETEPP-ESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSE  751
             HS DPS+N +EP  +S+FHGRRIPSK V+WG  NMIEAERRLLANALLDFSN+RF+L+SE
Sbjct  158   HS-DPSFNGSEPDRDSIFHGRRIPSKVVQWGNVNMIEAERRLLANALLDFSNQRFVLISE  216

Query  750   ACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMD  571
             +CIPL+NFSTIYSY++NS + F+E YDL GPVGRGRYS +M P +KL+DWRKGSQWF +D
Sbjct  217   SCIPLYNFSTIYSYLINSTQNFVESYDLAGPVGRGRYSHKMGPTVKLHDWRKGSQWFGID  276

Query  570   RRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPH  391
             R LALEVISD +YFP+FQ YC G CY+DEHYLPT +++K G  NSNRTLTWVDW++GGPH
Sbjct  277   RSLALEVISDTSYFPVFQKYCDGSCYADEHYLPTFVSMKFGGRNSNRTLTWVDWSRGGPH  336

Query  390   PTKFTRNDVTVDFLNKLRN------GNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPK  229
             P KF R DVT +FL +LR+      G  CEYNGE+T +C+LFARKFT +AL RLL  APK
Sbjct  337   PAKFVRTDVTPEFLERLRSGGGGGGGGGCEYNGERTNVCYLFARKFTYNALDRLLRFAPK  396

Query  228   LMQFN  214
             +M FN
Sbjct  397   VMHFN  401



>ref|XP_007160392.1| hypothetical protein PHAVU_002G318000g [Phaseolus vulgaris]
 gb|ESW32386.1| hypothetical protein PHAVU_002G318000g [Phaseolus vulgaris]
Length=397

 Score =   425 bits (1092),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 250/306 (82%), Gaps = 1/306 (0%)
 Frame = -3

Query  1131  LMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGN  952
              + P  A H +++EELLWRASM P+I E+P+++ PKVAFMFLT+G + L PLWE FF+GN
Sbjct  93    FLRPTMAMHGMTEEELLWRASMVPRIEELPYKQTPKVAFMFLTKGPVFLGPLWERFFKGN  152

Query  951   AGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNE  772
              G +SIYVHS  PS+N+T P  SVF+GRRIPSK   WG+ N++ AERRLLANALLDFSN+
Sbjct  153   EGFYSIYVHS-HPSFNDTLPQSSVFYGRRIPSKEARWGEFNIVGAERRLLANALLDFSNQ  211

Query  771   RFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKG  592
             RF+LLSE+CIPLFNFST+YSY+MNS +TF+E YDLPG VGRGRYS +M P+++L+ WRKG
Sbjct  212   RFVLLSESCIPLFNFSTVYSYLMNSTKTFVEAYDLPGAVGRGRYSPRMRPLVRLSQWRKG  271

Query  591   SQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVD  412
             SQWF++DR LA E++SDQ YFPLF  +C   CY DEHYLPT ++IK  Q NS+RTLTWVD
Sbjct  272   SQWFQIDRALATEIVSDQLYFPLFNKHCKNGCYGDEHYLPTFVSIKFWQNNSDRTLTWVD  331

Query  411   WAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAP  232
             W+KGGPHPT+F R +VT++FL +LR+G TC+YNG+ T +CHLFARKF   AL RLL  AP
Sbjct  332   WSKGGPHPTRFMRRNVTIEFLKRLRHGRTCQYNGKSTNICHLFARKFMPQALDRLLRFAP  391

Query  231   KLMQFN  214
             ++MQFN
Sbjct  392   QIMQFN  397



>ref|XP_011007454.1| PREDICTED: uncharacterized protein LOC105113114 isoform X2 [Populus 
euphratica]
Length=387

 Score =   424 bits (1090),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 206/313 (66%), Positives = 254/313 (81%), Gaps = 2/313 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLKE L  P    H++ ++ELLWRAS++P I E PF RVPKVAFMFLT+G + +APLWE
Sbjct  77    VGLKEYLKVP-DVKHDMDEKELLWRASVTPNIREFPFDRVPKVAFMFLTKGLVLMAPLWE  135

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ GL+SIYVHSS PSYNE+EP   VFHGRRIPSK V+WG ANMIEAERRLLANAL
Sbjct  136   KFFKGHKGLYSIYVHSS-PSYNESEPESPVFHGRRIPSKEVQWGNANMIEAERRLLANAL  194

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD +N+RF+LLSE+CIP+FNFST+YSY+MNS ++ +E Y L GPVG GRYS +M P IK+
Sbjct  195   LDIANQRFVLLSESCIPIFNFSTVYSYLMNSTKSHVESYVLEGPVGNGRYSPRMRPGIKI  254

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWFE+DR LA+E++SD+ YFPLFQ YCTG CY+DEHYLPT + +K  + NSNR
Sbjct  255   DQWRKGSQWFEIDRDLAIEIVSDRKYFPLFQKYCTGQCYADEHYLPTFVTMKHSKRNSNR  314

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW++GGPHP KF+R +VT++FL ++R+G+ C YNG  T  C LFARKF  +AL R
Sbjct  315   TLTWVDWSRGGPHPAKFSRTEVTIEFLQRMRSGSKCVYNGNHTNTCFLFARKFWPNALDR  374

Query  249   LLILAPKLMQFNG  211
             LL  APK+M FN 
Sbjct  375   LLRFAPKIMHFNS  387



>ref|XP_003524367.1| PREDICTED: uncharacterized protein LOC100815747 [Glycine max]
Length=376

 Score =   423 bits (1088),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 198/300 (66%), Positives = 244/300 (81%), Gaps = 1/300 (0%)
 Frame = -3

Query  1113  AAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSI  934
             A H++++EELLWRASM P I EMP++  PKVAFMFLT+G + L PLWE FF+GN G +SI
Sbjct  78    AMHDMTEEELLWRASMVPTIKEMPYKHTPKVAFMFLTKGPVLLGPLWERFFKGNEGFYSI  137

Query  933   YVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLS  754
             YVHS  PS+N+T P  SVFH RRIPSK V WG  N++ AERRLLANALLDFSN+RF+LLS
Sbjct  138   YVHS-HPSFNDTVPQSSVFHRRRIPSKEVRWGDFNIVGAERRLLANALLDFSNQRFVLLS  196

Query  753   EACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEM  574
             E+CIPLFNFSTIY+Y+MNS ETF+E YD+PG VGRGRYS +M P++ L+ WRKGSQWF++
Sbjct  197   ESCIPLFNFSTIYNYLMNSTETFVEAYDMPGAVGRGRYSPRMRPLVNLSQWRKGSQWFQI  256

Query  573   DRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGP  394
             DR LA+E++SDQ YFP+F+ YC   CY DEHYLPT ++I   + NSNRTLTWVDW++GGP
Sbjct  257   DRALAIEIVSDQQYFPVFKKYCRNGCYGDEHYLPTFVSIMFWKRNSNRTLTWVDWSRGGP  316

Query  393   HPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             HP +F R DVT+DFL +LR+G TC+YNG+ T +CHLFARKF    L RLL  AP++MQFN
Sbjct  317   HPARFMRQDVTIDFLKRLRHGRTCQYNGKSTNICHLFARKFNPQGLDRLLRFAPRIMQFN  376



>gb|AES76651.2| core-2/I-branching enzyme [Medicago truncatula]
Length=420

 Score =   425 bits (1092),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/312 (67%), Positives = 262/312 (84%), Gaps = 3/312 (1%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL+E L  P  A H++++EEL WRASM P I + PF+++PKVAFMFLT+G + LAPLWE 
Sbjct  111   GLEEFLKIP-MAMHDMNEEELFWRASMIPMIHKPPFKQIPKVAFMFLTKGHVLLAPLWEK  169

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllanal  790
             FF+GN GL+SIY+H  +PS+NET   +S VFHGRRIPSK V+WG+ +MIEAERRLLANAL
Sbjct  170   FFKGNEGLYSIYIHP-NPSFNETVYDQSSVFHGRRIPSKEVKWGENSMIEAERRLLANAL  228

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+RF+LLSE+CIPLFNFSTIY+Y+MNS +TF+E YDL G VGRGRY+ +M+P+IKL
Sbjct  229   LDFSNQRFVLLSESCIPLFNFSTIYTYLMNSEKTFVEAYDLEGAVGRGRYNYKMSPLIKL  288

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWF++DR LAL ++SD+ YF +F++YC  PCYSDEHY+PT+++IK  + NSNR
Sbjct  289   SQWRKGSQWFQIDRSLALHIVSDKLYFSMFKNYCDPPCYSDEHYMPTMVSIKFWKRNSNR  348

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW+KGGPHP+KF R  +T+DFL +LR G+TCEYNG+   +CHLFARKFT HAL R
Sbjct  349   TLTWVDWSKGGPHPSKFFRQHLTIDFLERLRFGSTCEYNGKTINVCHLFARKFTPHALDR  408

Query  249   LLILAPKLMQFN  214
             LL  APKLMQFN
Sbjct  409   LLRFAPKLMQFN  420



>ref|XP_010264609.1| PREDICTED: uncharacterized protein LOC104602574 [Nelumbo nucifera]
Length=404

 Score =   424 bits (1090),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 202/312 (65%), Positives = 253/312 (81%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLKE L  PP   H++ DEELLW+ASM+P + + P++RVPKVAFMFLTRG L +APLWE
Sbjct  94    IGLKEYL-KPPTVMHDMDDEELLWKASMTPGVRKYPYKRVPKVAFMFLTRGRLAMAPLWE  152

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
             MFF+G+ GL+SIYVHS +P++NE+E    VF GRRIPSK V+WGK NMI+AERRLLANAL
Sbjct  153   MFFKGHEGLYSIYVHS-NPNFNESEAESPVFQGRRIPSKEVQWGKFNMIQAERRLLANAL  211

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+RFILLSEACIPLFNFST+Y+Y++ SN TF+E YD PGPVGRGRY+ +M P+I L
Sbjct  212   LDFSNQRFILLSEACIPLFNFSTVYNYLIGSNMTFVEAYDEPGPVGRGRYNHRMKPLITL  271

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKG+QWFEMDR LA+E++SD  YF +F  YC G CYSDEHY+PT +++   + NSNR
Sbjct  272   DQWRKGAQWFEMDRDLAIEIVSDVKYFSVFGKYCKGSCYSDEHYIPTFVSVNFWEKNSNR  331

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW++GGPHPT+F R DVT++ L  +R   TC+YNG  T +C+LFARKF  ++L R
Sbjct  332   TLTWVDWSRGGPHPTRFIRTDVTIELLEMMRTATTCKYNGNTTNICYLFARKFYPNSLDR  391

Query  249   LLILAPKLMQFN  214
             LL  APK+M FN
Sbjct  392   LLRFAPKVMMFN  403



>ref|XP_003620433.1| hypothetical protein MTR_6g083830 [Medicago truncatula]
Length=418

 Score =   424 bits (1091),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 209/312 (67%), Positives = 262/312 (84%), Gaps = 3/312 (1%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL+E L  P  A H++++EEL WRASM P I + PF+++PKVAFMFLT+G + LAPLWE 
Sbjct  109   GLEEFLKIP-MAMHDMNEEELFWRASMIPMIHKPPFKQIPKVAFMFLTKGHVLLAPLWEK  167

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllanal  790
             FF+GN GL+SIY+H  +PS+NET   +S VFHGRRIPSK V+WG+ +MIEAERRLLANAL
Sbjct  168   FFKGNEGLYSIYIHP-NPSFNETVYDQSSVFHGRRIPSKEVKWGENSMIEAERRLLANAL  226

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+RF+LLSE+CIPLFNFSTIY+Y+MNS +TF+E YDL G VGRGRY+ +M+P+IKL
Sbjct  227   LDFSNQRFVLLSESCIPLFNFSTIYTYLMNSEKTFVEAYDLEGAVGRGRYNYKMSPLIKL  286

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWF++DR LAL ++SD+ YF +F++YC  PCYSDEHY+PT+++IK  + NSNR
Sbjct  287   SQWRKGSQWFQIDRSLALHIVSDKLYFSMFKNYCDPPCYSDEHYMPTMVSIKFWKRNSNR  346

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW+KGGPHP+KF R  +T+DFL +LR G+TCEYNG+   +CHLFARKFT HAL R
Sbjct  347   TLTWVDWSKGGPHPSKFFRQHLTIDFLERLRFGSTCEYNGKTINVCHLFARKFTPHALDR  406

Query  249   LLILAPKLMQFN  214
             LL  APKLMQFN
Sbjct  407   LLRFAPKLMQFN  418



>ref|XP_009624653.1| PREDICTED: uncharacterized protein LOC104115679 [Nicotiana tomentosiformis]
Length=408

 Score =   424 bits (1090),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 249/312 (80%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL++ L  P    H++ DEEL+WRASM P++  +PF+R PK+AFMFLTRG+LPLAPLWE
Sbjct  97    IGLRDYLKPPKSCKHDMKDEELIWRASMVPRVRVLPFKRTPKIAFMFLTRGSLPLAPLWE  156

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllana  793
              FFRG  GL+SIY+HS  PS+N   P E  +FHGRRIPSK VEWGK NM+EAERRLLANA
Sbjct  157   RFFRGYEGLYSIYIHS-QPSFNGNAPEEGPIFHGRRIPSKRVEWGKFNMVEAERRLLANA  215

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SNERF+LLSE+CIPL+NF+TIY+Y+MNS +TF+E YDLP PVGRGRY+ +M P I 
Sbjct  216   LLDLSNERFVLLSESCIPLYNFTTIYNYIMNSTKTFMESYDLPSPVGRGRYNKKMRPWIT  275

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             L+ WRKGSQWFE+DR +A+++ISDQ YF LF+ YC   CYSDEHYLPT+  ++    N N
Sbjct  276   LDQWRKGSQWFEVDREMAIDIISDQKYFQLFKRYCKPACYSDEHYLPTVATMRYWWKNGN  335

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             RTLTWVDW+KGGPHPT+F R +VT D LN++RNG  CEYNGE T MC+LFARKF    L 
Sbjct  336   RTLTWVDWSKGGPHPTRFIRTEVTADLLNRMRNGTKCEYNGEPTNMCYLFARKFLPSTLD  395

Query  252   RLLILAPKLMQF  217
             RLL  APK+M+F
Sbjct  396   RLLRFAPKIMKF  407



>ref|XP_011007447.1| PREDICTED: uncharacterized protein LOC105113114 isoform X1 [Populus 
euphratica]
Length=387

 Score =   423 bits (1087),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/313 (65%), Positives = 254/313 (81%), Gaps = 2/313 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLKE L  P    H++ ++ELLWRAS++P I E PF RVPKVAFMFLT+G + +APLWE
Sbjct  77    VGLKEYLKVP-DVKHDMDEKELLWRASVTPNIREFPFDRVPKVAFMFLTKGLVLMAPLWE  135

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ GL+SIYVHSS PSYNE+EP   VFHGRRIPSK ++WG ANMIEAERRLLANAL
Sbjct  136   KFFKGHKGLYSIYVHSS-PSYNESEPESPVFHGRRIPSKVIQWGNANMIEAERRLLANAL  194

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD +N+RF+LLSE+CIP+FNFST+YSY+MNS ++ +E Y L GPVG GRYS +M P IK+
Sbjct  195   LDIANQRFVLLSESCIPIFNFSTVYSYLMNSTKSHVESYVLEGPVGNGRYSPRMRPGIKI  254

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWFE+DR LA+E++SD+ YFPLFQ YCTG CY+DEHYLPT + +K  + NSNR
Sbjct  255   DQWRKGSQWFEIDRDLAIEIVSDRKYFPLFQKYCTGQCYADEHYLPTFVTMKHSKRNSNR  314

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW++GGPHP KF+R +VT++FL ++R+G+ C YNG  T  C LFARKF  +AL R
Sbjct  315   TLTWVDWSRGGPHPAKFSRTEVTIEFLQRMRSGSKCVYNGNHTNTCFLFARKFWPNALDR  374

Query  249   LLILAPKLMQFNG  211
             LL  APK+M FN 
Sbjct  375   LLRFAPKIMHFNS  387



>ref|XP_009763003.1| PREDICTED: uncharacterized protein LOC104214963 isoform X1 [Nicotiana 
sylvestris]
Length=409

 Score =   424 bits (1089),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 248/312 (79%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL++ L  P    H++ DEEL+WRASM P++  +PF+R PK+AFMFLTRG+LPLAPLWE
Sbjct  98    IGLRDYLKPPKSCKHDMKDEELIWRASMVPRVRVLPFKRTPKIAFMFLTRGSLPLAPLWE  157

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllana  793
              FFRG  GL+SIY+HS  PS+N   P E  +FHGRRIPSK VEWGK NM+EAERRLLANA
Sbjct  158   RFFRGYEGLYSIYIHSQ-PSFNGNAPEEGPIFHGRRIPSKRVEWGKFNMVEAERRLLANA  216

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SNERF+LLSE+CIPL+NF+TIY+Y+MNS +TF+E YDLP PVGRGRY+ +M P I 
Sbjct  217   LLDLSNERFVLLSESCIPLYNFTTIYNYIMNSTKTFMESYDLPSPVGRGRYNKKMQPWIT  276

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             L+ WRKGSQWFE+DR +A+++I+DQ YF LF+ YC   CYSDEHYLPT + ++    N N
Sbjct  277   LDQWRKGSQWFEVDREIAIDIITDQKYFQLFKRYCKPACYSDEHYLPTFVTMRYWWKNGN  336

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             RTLTWVDW KGGPHPT+F R DVT D LN++RNG  CEYNG+ T MC+LFARKF    L 
Sbjct  337   RTLTWVDWTKGGPHPTRFIRTDVTADLLNRMRNGTQCEYNGDPTNMCYLFARKFLPSTLD  396

Query  252   RLLILAPKLMQF  217
             RLL  APK+M+F
Sbjct  397   RLLRFAPKIMKF  408



>emb|CDP00653.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   419 bits (1076),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 206/296 (70%), Positives = 241/296 (81%), Gaps = 1/296 (0%)
 Frame = -3

Query  1101  LSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHS  922
             ++DEELLW+ASM+PKI E PF+RVPKVAFMFLTRG + LAPLWE FF+G+ GL+SIYVH 
Sbjct  1     MNDEELLWKASMTPKIQEFPFKRVPKVAFMFLTRGPVSLAPLWEKFFKGHKGLYSIYVHP  60

Query  921   SDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEACI  742
              +PSYN +EP  SVFHGRRIPSK V+WG  NMIEAERRLLANALLD SN+RF+L+SEACI
Sbjct  61    -NPSYNGSEPEGSVFHGRRIPSKEVQWGNVNMIEAERRLLANALLDVSNQRFVLVSEACI  119

Query  741   PLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRL  562
             PLFNFS +Y+Y+MNS  + +EVYD  GPVGRGRYS QM P+IKL DWRKGSQWFEMDR L
Sbjct  120   PLFNFSIVYNYLMNSTLSHVEVYDQAGPVGRGRYSRQMQPLIKLEDWRKGSQWFEMDRDL  179

Query  561   ALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTK  382
             ALEVISD+TYFP FQ YC G CY+DEHYLPT +N+K G+  S RTLT VDW+KGGPHP  
Sbjct  180   ALEVISDKTYFPAFQHYCKGSCYADEHYLPTFVNMKFGKKTSKRTLTHVDWSKGGPHPMS  239

Query  381   FTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             F R+ VT + L K+R+G+ C +NG K   CHLFARKF   +L RL+  APKLM FN
Sbjct  240   FYRDRVTAELLEKMRSGSNCVHNGSKNDTCHLFARKFPPQSLDRLVRFAPKLMHFN  295



>gb|KHN21596.1| hypothetical protein glysoja_023448 [Glycine soja]
Length=376

 Score =   421 bits (1083),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 197/300 (66%), Positives = 243/300 (81%), Gaps = 1/300 (0%)
 Frame = -3

Query  1113  AAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSI  934
             A H++++EELLWRASM P I EMP++  PKVAFMFLT+G + L PLWE FF+GN G +SI
Sbjct  78    AMHDMTEEELLWRASMVPTIKEMPYKHTPKVAFMFLTKGPVLLGPLWERFFKGNEGFYSI  137

Query  933   YVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLS  754
             YVHS  PS+N+T P  SVFH RRIPSK V WG  N++ AERRLLANALLDFSN+RF+LLS
Sbjct  138   YVHS-HPSFNDTVPQSSVFHRRRIPSKEVRWGDFNIVGAERRLLANALLDFSNQRFVLLS  196

Query  753   EACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEM  574
             E+CIPLFNFSTIY+Y+MNS E F+E YD+PG VGRGRYS +M P++ L+ WRKGSQWF++
Sbjct  197   ESCIPLFNFSTIYNYLMNSTENFVEAYDMPGAVGRGRYSPRMRPLVNLSQWRKGSQWFQI  256

Query  573   DRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGP  394
             DR LA+E++SDQ YFP+F+ YC   CY DEHYLPT ++I   + NSNRTLTWVDW++GGP
Sbjct  257   DRALAIEIVSDQQYFPVFKKYCRNGCYGDEHYLPTFVSIMFWKRNSNRTLTWVDWSRGGP  316

Query  393   HPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             HP +F R DVT+DFL +LR+G TC+YNG+ T +CHLFARKF    L RLL  AP++MQFN
Sbjct  317   HPARFMRQDVTIDFLKRLRHGRTCQYNGKSTNICHLFARKFNPQGLDRLLRFAPRIMQFN  376



>ref|XP_007044266.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 2 [Theobroma cacao]
 gb|EOY00098.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 2 [Theobroma cacao]
Length=394

 Score =   422 bits (1084),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 203/301 (67%), Positives = 248/301 (82%), Gaps = 2/301 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL E L  PP   H + D+ELLWRASM P+I + PF RVPKVAFMFLT+G L LAPLWE
Sbjct  89    IGLTEFL-KPPDVMHGMDDKELLWRASMVPRIPQYPFDRVPKVAFMFLTKGPLLLAPLWE  147

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF G+ G++SIYVHS +PS+N ++P  SVF+GRRIPSK VEWGK NMIEAERRLLANAL
Sbjct  148   KFFEGHEGMYSIYVHS-NPSFNLSDPKSSVFYGRRIPSKEVEWGKVNMIEAERRLLANAL  206

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+RF+LLSE+CIP+FNFST+YSY++NS+++F+E YDL GPVGRGRYS +M+P + L
Sbjct  207   LDFSNQRFVLLSESCIPIFNFSTVYSYLINSSQSFVESYDLEGPVGRGRYSRRMSPRVTL  266

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKG+QWFEMDR LA+ V+SDQ YFP+FQ YC G CY+DEHYLPT + +K G  NSNR
Sbjct  267   DQWRKGAQWFEMDRELAIGVVSDQEYFPVFQKYCKGACYADEHYLPTFVTMKFGHKNSNR  326

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW+KGGPHP KF R +VTV+FL +LR+G+ C+YNG  T +CHLFARKF+  AL R
Sbjct  327   TLTWVDWSKGGPHPAKFLRTEVTVEFLERLRSGSQCQYNGNTTDICHLFARKFSPDALYR  386

Query  249   L  247
              
Sbjct  387   F  387



>ref|XP_002315928.1| hypothetical protein POPTR_0010s13150g [Populus trichocarpa]
 gb|EEF02099.1| hypothetical protein POPTR_0010s13150g [Populus trichocarpa]
Length=389

 Score =   422 bits (1084),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 253/313 (81%), Gaps = 2/313 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLKE L  P    H++ ++ELLWRAS++P I E PF RVPKVAFMFLT+G + +APLWE
Sbjct  79    VGLKEYLKVP-DVKHDMDEKELLWRASVTPNIREFPFDRVPKVAFMFLTKGPVLMAPLWE  137

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ GL+SIYVHSS PSYNE+EP   VFHGRRIPSK V+WG ANMIEAERRLLANAL
Sbjct  138   KFFKGHDGLYSIYVHSS-PSYNESEPESPVFHGRRIPSKVVQWGNANMIEAERRLLANAL  196

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD +N+RF+LLSE+CIPLFNFST+Y+Y+MNS ++ +E Y L GPVG GRYS +M P IK+
Sbjct  197   LDIANQRFVLLSESCIPLFNFSTVYTYLMNSTKSHVESYVLEGPVGNGRYSPRMRPGIKI  256

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWFE+DR LA+E++SD+ YFPLFQ YCTG CYSDEHYLPT + +K  + NSNR
Sbjct  257   DQWRKGSQWFEIDRDLAIEIVSDRKYFPLFQKYCTGQCYSDEHYLPTFVTMKHSKRNSNR  316

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW++GGPHP KF R +VT++FL ++R+G+ C YNG  T  C LFARKF  +AL R
Sbjct  317   TLTWVDWSRGGPHPAKFLRTEVTIEFLERMRSGSKCVYNGNHTNTCFLFARKFWPNALDR  376

Query  249   LLILAPKLMQFNG  211
             LL  APK+M FN 
Sbjct  377   LLRFAPKIMHFNS  389



>ref|XP_008393326.1| PREDICTED: uncharacterized protein LOC103455513 [Malus domestica]
Length=430

 Score =   423 bits (1087),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 202/312 (65%), Positives = 254/312 (81%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLKE   +P    H + D+ELLWRAS+ P    +PF+R PKVAFMFLTRG+L +APLWE
Sbjct  121   IGLKEYTKSP-NILHEMDDDELLWRASLVPLRRGLPFKRTPKVAFMFLTRGSLAMAPLWE  179

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
             MFF+G+ GL+SIYVH+ +P +N+T P  SVF+GRR+PSK V WG+ NM++AERRLLANAL
Sbjct  180   MFFKGHEGLYSIYVHA-NPDFNDTIPENSVFYGRRVPSKNVTWGQPNMVQAERRLLANAL  238

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+RF+LLSE+CIPLFNF+ +Y+Y+M+SN+TF+E YDLPGPVGR RY  +M P I L
Sbjct  239   LDFSNQRFVLLSESCIPLFNFNXVYNYLMDSNQTFVEAYDLPGPVGRDRYRHKMRPHIIL  298

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWFE+DR +A  ++SD+ YFPLF  YC  PCYSDEHYLPT ++IK  + NSNR
Sbjct  299   DQWRKGSQWFEVDREIATAMVSDEKYFPLFTRYCKPPCYSDEHYLPTYVSIKFWKKNSNR  358

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW++GGPHP+KF R DVT+DFL KLR+G+ CEYNG+ T +C LFARKF  H+L R
Sbjct  359   TLTWVDWSRGGPHPSKFMRTDVTIDFLKKLRHGSNCEYNGKPTNICFLFARKFLPHSLDR  418

Query  249   LLILAPKLMQFN  214
             LL  APK+M+FN
Sbjct  419   LLRFAPKIMRFN  430



>ref|XP_010644813.1| PREDICTED: uncharacterized protein LOC100245576 [Vitis vinifera]
Length=405

 Score =   422 bits (1084),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 207/315 (66%), Positives = 248/315 (79%), Gaps = 2/315 (1%)
 Frame = -3

Query  1155  RVVGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPL  976
             R +GL E  M PP A H++ DEEL WRASM+P+I E PF+RVPKVAFMFLT+G LPLAPL
Sbjct  93    RRIGLSEY-MKPPNAMHDMDDEELPWRASMAPQIREFPFKRVPKVAFMFLTKGPLPLAPL  151

Query  975   WEMFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllan  796
             WE+FF+G+ GL+SIYVHS  PS+NETEP  SVFH RRIPSK V+WGK NMIEAERRLLAN
Sbjct  152   WELFFKGHEGLYSIYVHS-HPSFNETEPENSVFHDRRIPSKEVQWGKFNMIEAERRLLAN  210

Query  795   alLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPII  616
             ALLDFSN  F+LLSE+CIPLFNFSTIYSY+MNS   +++ YD PGPVGRGRY  QM P I
Sbjct  211   ALLDFSNYHFVLLSESCIPLFNFSTIYSYLMNSTRNYVQTYDFPGPVGRGRYKEQMYPTI  270

Query  615   KLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNS  436
              +  WRKGSQWF +DR LA E+ISDQTYFP+FQ +C   CY+DEHYLPT + IK  + ++
Sbjct  271   TIEQWRKGSQWFAVDRNLATEIISDQTYFPIFQKHCKSSCYADEHYLPTFVGIKFWERSA  330

Query  435   NRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHAL  256
             NR+LTWVDW++GG HP +F R DVT++ L +LR+   C+YNG+ T +C LFARK    AL
Sbjct  331   NRSLTWVDWSRGGAHPARFMRWDVTIESLKRLRSEGRCDYNGKSTNICFLFARKVMPSAL  390

Query  255   SRLLILAPKLMQFNG  211
              RLL  APK+M FN 
Sbjct  391   ERLLRFAPKVMHFNS  405



>ref|XP_010094729.1| hypothetical protein L484_019938 [Morus notabilis]
 gb|EXB56894.1| hypothetical protein L484_019938 [Morus notabilis]
Length=437

 Score =   422 bits (1086),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 250/312 (80%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL E L  PP   H++ DEELLWRASM PK G +P    PK+AF+FL RG + +APLW+
Sbjct  127   IGLIEFL-KPPTVRHDMDDEELLWRASMVPKAGRVPLEFTPKIAFLFLARGDVTMAPLWD  185

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+GN G FS+YVHS + S+N T   +S F+GR IPS+ V WG  NM+EAERRLLANAL
Sbjct  186   RFFKGNEGFFSVYVHS-NLSFNATVSQDSAFYGRWIPSQDVRWGNPNMVEAERRLLANAL  244

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDF+NERF+LLSEACIPLFNFST+Y Y+M S ++F+E YDL GPVGRGRYSS+M P IKL
Sbjct  245   LDFTNERFVLLSEACIPLFNFSTVYEYLMGSTKSFVEAYDLIGPVGRGRYSSRMRPQIKL  304

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWFEMDR LA+EV++DQ YFP+F+ +C   CY+DEHYLPT ++IK  + NSNR
Sbjct  305   DQWRKGSQWFEMDRALAIEVVADQKYFPIFRRFCRSSCYTDEHYLPTFVSIKFWKKNSNR  364

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW+KGGPHPTKF R DVT++ L KLR+G++CEYNG++T +CHLFARKF  + L R
Sbjct  365   TLTWVDWSKGGPHPTKFMRQDVTIELLEKLRHGHSCEYNGKRTNICHLFARKFLPNTLGR  424

Query  249   LLILAPKLMQFN  214
             LL  APKLMQFN
Sbjct  425   LLRFAPKLMQFN  436



>ref|XP_009356238.1| PREDICTED: uncharacterized protein LOC103947108 [Pyrus x bretschneideri]
Length=400

 Score =   421 bits (1081),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 212/312 (68%), Positives = 247/312 (79%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLKE L  PP   H++ D ELLWRASMSP+I E PF RVPKVAFMFL +G + LAPLWE
Sbjct  90    VGLKEYL-KPPEVFHDMDDVELLWRASMSPQISEYPFPRVPKVAFMFLVKGPVFLAPLWE  148

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ GL+SIYVHS +PSYN + P   VFHGRRIPS+ VEWGK NMIEAERRLLANAL
Sbjct  149   KFFKGHKGLYSIYVHS-NPSYNGSHPESPVFHGRRIPSQEVEWGKVNMIEAERRLLANAL  207

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SN+RFILLSE+C+PL NF T+Y+Y++ SNETF+ VYD P  VGRGRYSS M P I L
Sbjct  208   LDISNQRFILLSESCVPLHNFPTVYNYLIRSNETFVGVYDDPSSVGRGRYSSHMYPQISL  267

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWFE+DR LA+EV+SD+ YFP+FQ+YC G CY+DEHYLPT +NIK  Q NSNR
Sbjct  268   SQWRKGSQWFEIDRSLAIEVVSDKKYFPVFQTYCRGSCYADEHYLPTYVNIKFAQKNSNR  327

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW++GG HP KFTR DVTV+ L  LRNG  C YNG  + +C LFARKF    L R
Sbjct  328   SLTWVDWSRGGAHPAKFTRTDVTVEVLKSLRNGTACIYNGRVSNVCFLFARKFGPGTLER  387

Query  249   LLILAPKLMQFN  214
             LL  APKLM+FN
Sbjct  388   LLRFAPKLMRFN  399



>ref|XP_009360137.1| PREDICTED: uncharacterized protein LOC103950632 [Pyrus x bretschneideri]
 ref|XP_009345486.1| PREDICTED: uncharacterized protein LOC103937283 [Pyrus x bretschneideri]
Length=429

 Score =   422 bits (1084),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 201/312 (64%), Positives = 253/312 (81%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLKE   +P    H + D+ELLWRAS+ P    +PF+R PKVAFMFLTRG+L +APLWE
Sbjct  120   IGLKEYTKSP-NILHEMDDDELLWRASLVPLRQGLPFKRTPKVAFMFLTRGSLAMAPLWE  178

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
             MFF+G+ GL+SIYVH+ +P +N+T P  SVF+GRR+PSK V WG+ NM++AERRLLANAL
Sbjct  179   MFFKGHEGLYSIYVHA-NPDFNDTMPENSVFYGRRVPSKNVTWGQPNMVQAERRLLANAL  237

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+RF+LLSE+CIPLFNF+ +Y+Y+ +SN+TF+E YDLPGPVGR RY  +M P I L
Sbjct  238   LDFSNQRFVLLSESCIPLFNFNIVYNYLKDSNQTFVEAYDLPGPVGRDRYRHKMRPHIIL  297

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWFE+DR +A  ++SD  YFPLF  YC  PCYSDEHYLPT ++IK  + NSNR
Sbjct  298   DQWRKGSQWFEVDREIATAMVSDDKYFPLFTRYCKPPCYSDEHYLPTYVSIKFWKKNSNR  357

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW++GGPHP+KF R DVT+DFL KLR+G+ CEYNG+ T +C+LFARKF  H+L R
Sbjct  358   TLTWVDWSRGGPHPSKFMRTDVTIDFLKKLRHGSNCEYNGKPTNICYLFARKFLPHSLDR  417

Query  249   LLILAPKLMQFN  214
             LL  APK+M+FN
Sbjct  418   LLRFAPKIMRFN  429



>ref|XP_007208909.1| hypothetical protein PRUPE_ppa027107mg [Prunus persica]
 gb|EMJ10108.1| hypothetical protein PRUPE_ppa027107mg [Prunus persica]
Length=298

 Score =   416 bits (1068),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 200/298 (67%), Positives = 242/298 (81%), Gaps = 1/298 (0%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYV  928
             H++ D ELLWRAS+ P+   +PF+R PKVAFMFLTRG L LAP WEMFF+G+ GL+SIYV
Sbjct  2     HDMDDAELLWRASLVPRRRGLPFKRTPKVAFMFLTRGPLALAPFWEMFFKGHEGLYSIYV  61

Query  927   HSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEA  748
             H+ +P +N+T P  SVF+GRR+PSK V WG+ NM++AERRLLANALLDFSN+RF+LLSE+
Sbjct  62    HA-NPDFNDTMPQNSVFYGRRVPSKNVTWGEPNMVQAERRLLANALLDFSNQRFVLLSES  120

Query  747   CIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDR  568
             CIPLFNF  IY Y+M S +TF+EVYDLPGPVGR RY  +M+P I L  WRKGSQWFE+DR
Sbjct  121   CIPLFNFKVIYDYLMGSTQTFVEVYDLPGPVGRDRYRPKMSPQITLGQWRKGSQWFEVDR  180

Query  567   RLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHP  388
              +A+EV+SDQ YFPLF  +C   CYSDEHYLPT +NIK  + NSNRTLTWVDW++GGPHP
Sbjct  181   VIAVEVVSDQKYFPLFTKHCKPSCYSDEHYLPTYVNIKFRKKNSNRTLTWVDWSRGGPHP  240

Query  387   TKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             +KF R DVTV+FL KLR+G  CEYNG+ T +CHLFARKF  + L RLL   PKLM+FN
Sbjct  241   SKFMRTDVTVEFLEKLRHGTKCEYNGKTTDVCHLFARKFLPNTLDRLLRFGPKLMKFN  298



>ref|XP_011008309.1| PREDICTED: uncharacterized protein LOC105113714 [Populus euphratica]
Length=396

 Score =   419 bits (1076),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 262/313 (84%), Gaps = 4/313 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL+E L AP   +H++++EELLWRASM+P++   PF+RVPKVAF+FLT+G LPLAPLW+
Sbjct  86    LGLEEFLRAP-NVSHDMNEEELLWRASMAPRLPNYPFQRVPKVAFLFLTKGPLPLAPLWD  144

Query  969   MFFRGNAGLFSIYVHSSDPSYN--ETEPPESVFHGRRIPSKGVEWGKANMIeaerrllan  796
             +FFRG+ GL+SI+VHS +PS+N   TE  +SVF GR+IPSK V+WGK +M+EAERRLLAN
Sbjct  145   LFFRGHQGLYSIFVHS-NPSFNGNYTEEEDSVFRGRKIPSKEVQWGKFSMVEAERRLLAN  203

Query  795   alLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPII  616
             ALLDFSN+RF+LLSE+CIPLFNFSTIYSY+M S  TFIEVYDLPGPVGRGRY+ +M P+I
Sbjct  204   ALLDFSNQRFVLLSESCIPLFNFSTIYSYLMGSTTTFIEVYDLPGPVGRGRYNHRMRPVI  263

Query  615   KLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNS  436
             +L+ WRKGSQW EMDR+LA+EV+SD+ YFP F+ +C   CYSDEHYLPT +N+K  + NS
Sbjct  264   QLDKWRKGSQWVEMDRQLAVEVVSDRKYFPTFRKFCKVSCYSDEHYLPTFVNMKSRKKNS  323

Query  435   NRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHAL  256
             NR+LTWVDW++GGPHP KF R D+TV+FL +LR  + C+ NG  T +C+LFARKFTL AL
Sbjct  324   NRSLTWVDWSRGGPHPRKFGRLDITVNFLERLRKWSHCKNNGRWTDICYLFARKFTLDAL  383

Query  255   SRLLILAPKLMQF  217
              RL+  APK+MQF
Sbjct  384   DRLMRFAPKVMQF  396



>ref|XP_004512994.1| PREDICTED: uncharacterized protein LOC101496836 [Cicer arietinum]
Length=417

 Score =   419 bits (1078),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/309 (66%), Positives = 254/309 (82%), Gaps = 2/309 (1%)
 Frame = -3

Query  1137  ELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFR  958
             E  +  P A H+++++EL WRAS++P I ++PF++  KVAFMFLT+G + LAPLWE FF+
Sbjct  110   EDFLKIPSAMHDMNEKELFWRASLAPMIHKIPFKQTSKVAFMFLTKGPVLLAPLWEKFFK  169

Query  957   GNAGLFSIYVHSSDPSYNET-EPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDF  781
             GN GLFSIY+H  +PS+NET     SVFHGRRIPSK V WG+ +MIEAERRLLANALLDF
Sbjct  170   GNEGLFSIYIHP-NPSFNETIYDQSSVFHGRRIPSKKVHWGENSMIEAERRLLANALLDF  228

Query  780   SNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDW  601
             SN RF+LLSE+CIPLFNFSTIY+Y+MNS +T++E YDL   VGRGRYS +M P+I ++ W
Sbjct  229   SNTRFVLLSESCIPLFNFSTIYNYLMNSKKTYVEAYDLASSVGRGRYSKKMMPLINISQW  288

Query  600   RKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLT  421
             RKGSQWF++DR LAL+VISD++YF +++ +C  PCYSDEHYLPTL++IK  + NSNRTLT
Sbjct  289   RKGSQWFQIDRYLALQVISDKSYFSIYKKHCNPPCYSDEHYLPTLVSIKFWKRNSNRTLT  348

Query  420   WVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLI  241
             WVDW+KGGPHP KF R  VT+DFL KLR G+TCEYNG+ T +C+LFARKFT HAL RLL 
Sbjct  349   WVDWSKGGPHPAKFVRPHVTIDFLEKLRFGSTCEYNGKTTNVCYLFARKFTRHALGRLLR  408

Query  240   LAPKLMQFN  214
              APKLMQFN
Sbjct  409   FAPKLMQFN  417



>ref|XP_008243270.1| PREDICTED: uncharacterized protein LOC103341513 [Prunus mume]
Length=398

 Score =   419 bits (1076),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 207/312 (66%), Positives = 246/312 (79%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLKE L  PP   H++ D+ELLWRASM P+I E PFRRVPKVAFMFLT+G + LAPLWE
Sbjct  88    IGLKEYL-KPPNVLHDMDDQELLWRASMIPRITEYPFRRVPKVAFMFLTKGPVLLAPLWE  146

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ GL+SIYVHS +PSYN + P   VF  RRIPS+ V WG  NMIEAERRLLANAL
Sbjct  147   KFFKGHQGLYSIYVHS-NPSYNGSYPESPVFRDRRIPSREVGWGNVNMIEAERRLLANAL  205

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SNERF+LLSE+CIPL NFST+YSY+++S E+F++VYD P  VGRGRY+S M P I L
Sbjct  206   LDISNERFVLLSESCIPLHNFSTVYSYLVHSRESFVQVYDDPSSVGRGRYNSHMYPKISL  265

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWFEM RR A++++SD+ YFP FQ YC G CY+DEHYLPT  NI  G  NSNR
Sbjct  266   SQWRKGSQWFEMHRRHAIDIVSDKKYFPAFQKYCRGSCYADEHYLPTFANINFGAKNSNR  325

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW++GGPHP KFTR DVTV+ L++LRNG  C YNG+ T +C LFARKF    L R
Sbjct  326   SLTWVDWSRGGPHPAKFTRTDVTVEVLSRLRNGTACVYNGKSTNVCFLFARKFGPDTLER  385

Query  249   LLILAPKLMQFN  214
             LL  APKLM+FN
Sbjct  386   LLRFAPKLMRFN  397



>ref|XP_003614560.1| hypothetical protein MTR_5g055480 [Medicago truncatula]
 gb|AES97518.1| core-2/I-branching enzyme [Medicago truncatula]
Length=390

 Score =   416 bits (1070),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 206/310 (66%), Positives = 250/310 (81%), Gaps = 3/310 (1%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GLK+ +  P    H+LSDEELLWRAS+SPKI E PF RVPKVAF+FL RG +PLAPLWE 
Sbjct  84    GLKKFI-EPSQVVHDLSDEELLWRASLSPKINEYPFDRVPKVAFLFLVRGPVPLAPLWEK  142

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FF+G+ G +SIYVHS +PSYN +E    VFHGRRIPSK VEWGK NMIEAERRLLANALL
Sbjct  143   FFKGHKGYYSIYVHS-NPSYNGSEVESPVFHGRRIPSKKVEWGKFNMIEAERRLLANALL  201

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             DFSN+RF+L+SE+CIPLFNFST+YSY+MNS ++++  YD    VGRGRY  +M+P IKL 
Sbjct  202   DFSNQRFVLISESCIPLFNFSTVYSYLMNSTKSYVMAYDQASSVGRGRYRIKMSPTIKLR  261

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
             +WRKGSQWFEMDR LALEVISD+TY+P+F  YC G CY+DEHYLPTL++IK  + N+NR+
Sbjct  262   EWRKGSQWFEMDRNLALEVISDRTYYPVFGKYCNGSCYADEHYLPTLVSIKFWKSNTNRS  321

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             LTWVDW+KGGPHP K+ R +VT +FL  LRN  TC+YNG  T +C+LFARKF   +L+RL
Sbjct  322   LTWVDWSKGGPHPVKYVRPEVTCEFLENLRN-QTCKYNGNSTNVCYLFARKFLPTSLTRL  380

Query  246   LILAPKLMQF  217
             +  APK+M  
Sbjct  381   MRFAPKVMHL  390



>gb|KEH44200.1| core-2/I-branching enzyme [Medicago truncatula]
Length=411

 Score =   417 bits (1072),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 209/315 (66%), Positives = 250/315 (79%), Gaps = 4/315 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLK+ L  PP   H++ DEELLWRASM+ KI E PF RVPKVAFMFLTRGA+ LAPLWE
Sbjct  85    VGLKDFLKPPP-IMHDMDDEELLWRASMTAKIAEYPFERVPKVAFMFLTRGAVFLAPLWE  143

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+   +SIYVHS +PSYN + P   VFHGRRIPSK VEWG  NMIEAERRLL+NAL
Sbjct  144   QFFKGHEVYYSIYVHS-NPSYNGSHPESPVFHGRRIPSKEVEWGNVNMIEAERRLLSNAL  202

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SN+RF+L+SE+CIPLFNFSTIYSY++NS + ++  YD P  VGRGRY+ QM P + L
Sbjct  203   LDISNQRFVLISESCIPLFNFSTIYSYLINSTQNYVMSYDDPSSVGRGRYNIQMLPEVSL  262

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             N+WRKGSQWFE+DR LAL V+SD+ YFP+FQ YC G CY+DEHYLPTL++IK G+GNSNR
Sbjct  263   NEWRKGSQWFEIDRELALGVVSDRIYFPVFQEYCKGSCYADEHYLPTLVSIKFGEGNSNR  322

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEY-NGEKTTMCHLFARKFTLHALS  253
             +LTWVDW++GGPHP  F R+DV V FL +LR+   C+Y NGE T  C LFARKF    LS
Sbjct  323   SLTWVDWSRGGPHPAHFLRSDVNVKFLERLRS-KKCKYNNGESTNACFLFARKFLPSTLS  381

Query  252   RLLILAPKLMQFNGY  208
             +LL +APK+MQF  Y
Sbjct  382   KLLKIAPKVMQFEHY  396



>gb|KHN16548.1| hypothetical protein glysoja_002645 [Glycine soja]
Length=372

 Score =   414 bits (1064),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 197/312 (63%), Positives = 246/312 (79%), Gaps = 1/312 (0%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             V +  +L     A H++++EELLWRASM P I E+P+   PKVAFMFLT+G++ LAPLWE
Sbjct  62    VTIHSILRPTKAAMHDMTEEELLWRASMVPMIKELPYNHTPKVAFMFLTKGSVLLAPLWE  121

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+GN   +SIYVHS  PS+N+T P  SVFHGRRIPSK V WG  N++ AERRLLANAL
Sbjct  122   RFFKGNEAFYSIYVHSL-PSFNDTVPQTSVFHGRRIPSKEVRWGDFNIVGAERRLLANAL  180

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+ F+LLSE+CIPLFNFSTIY+Y+MNS +TF+E YD+PG VGRGRYS +M P++ L
Sbjct  181   LDFSNQHFVLLSESCIPLFNFSTIYNYLMNSTKTFVEAYDMPGAVGRGRYSPRMRPLVNL  240

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + W+KGSQWF++DR LA++++SDQ YFPLF  YC   CY DEHYLPT ++IK  + NSNR
Sbjct  241   SQWKKGSQWFQIDRALAIDIVSDQQYFPLFNKYCKNRCYGDEHYLPTFVSIKFWKRNSNR  300

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLT+VDW++GG HP +F R  VTVDFL +LR+G TC YNG+ T +CHLFARKF   AL R
Sbjct  301   TLTFVDWSRGGAHPARFMRQHVTVDFLKRLRHGRTCLYNGKTTNICHLFARKFMPQALDR  360

Query  249   LLILAPKLMQFN  214
             LL  AP++MQFN
Sbjct  361   LLRFAPRIMQFN  372



>ref|XP_010663889.1| PREDICTED: uncharacterized protein LOC100252627 [Vitis vinifera]
Length=380

 Score =   414 bits (1064),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 248/312 (79%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLKE +  PP   H++ D ELLWRASM P++GE PF+RVPK+AF+FLTRG+LPLAPLWE
Sbjct  71    IGLKEYV-KPPNVIHDMKDAELLWRASMVPRVGEFPFKRVPKIAFLFLTRGSLPLAPLWE  129

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
             MFFRG+  L+SIYVHS DPS+N T P  SVF+GR IPS+ V+WG  +M+EAERRLLANAL
Sbjct  130   MFFRGHEALYSIYVHS-DPSFNRTVPKSSVFYGRSIPSQEVQWGNFSMLEAERRLLANAL  188

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SN RF+LLSE+CIPLFNFSTIYSY+M S ++FIE YDLPGPVGR RY  +M PI+ +
Sbjct  189   LDISNHRFVLLSESCIPLFNFSTIYSYLMASTKSFIEAYDLPGPVGRARYDHRMKPIVTI  248

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
               WRKGSQWFEMDR LA+EVISD+ YF +F+  C   CY+DEHYLPTL++I+  + N+NR
Sbjct  249   GQWRKGSQWFEMDRGLAIEVISDRKYFAVFRECCEASCYADEHYLPTLVSIEFWRRNANR  308

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW+ GG HP  F R DVTV+FL  LR  + C+YNG  T +C LFARKF    L+R
Sbjct  309   SLTWVDWSNGGAHPAGFWRRDVTVEFLQSLRTESHCQYNGNNTDICFLFARKFLPGTLNR  368

Query  249   LLILAPKLMQFN  214
             LL +APKLM+FN
Sbjct  369   LLRVAPKLMKFN  380



>ref|XP_003532515.1| PREDICTED: uncharacterized protein LOC100782511 [Glycine max]
Length=390

 Score =   414 bits (1064),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 196/312 (63%), Positives = 246/312 (79%), Gaps = 1/312 (0%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             V +  +L     A H++++EELLWRASM P I E+P+   PKVAFMFLT+G++ LAPLWE
Sbjct  80    VTIHSILRPTKAAMHDMTEEELLWRASMVPMIKELPYNHTPKVAFMFLTKGSVLLAPLWE  139

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+GN   +SIYVHS  PS+N+T P  SVFHGRRIPSK V WG  N++ AERRLLANAL
Sbjct  140   RFFKGNEAFYSIYVHSL-PSFNDTVPQTSVFHGRRIPSKEVRWGDFNIVGAERRLLANAL  198

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+ F+LLSE+CIPLFNFSTIY+Y+MNS +TF+E YD+PG VGRGRYS +M P++ L
Sbjct  199   LDFSNQHFVLLSESCIPLFNFSTIYNYLMNSTKTFVEAYDMPGAVGRGRYSPRMRPLVNL  258

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + W+KGSQWF++DR LA++++SDQ YFPLF  YC   CY DEHYLPT ++I+  + NSNR
Sbjct  259   SQWKKGSQWFQIDRALAIDIVSDQQYFPLFNKYCKNRCYGDEHYLPTFVSIRFWKRNSNR  318

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLT+VDW++GG HP +F R  VTVDFL +LR+G TC YNG+ T +CHLFARKF   AL R
Sbjct  319   TLTFVDWSRGGAHPARFMRQHVTVDFLKRLRHGRTCLYNGKTTNICHLFARKFMPQALDR  378

Query  249   LLILAPKLMQFN  214
             LL  AP++MQFN
Sbjct  379   LLRFAPRIMQFN  390



>ref|XP_002321483.2| hypothetical protein POPTR_0015s03850g [Populus trichocarpa]
 gb|EEF05610.2| hypothetical protein POPTR_0015s03850g [Populus trichocarpa]
Length=396

 Score =   414 bits (1063),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 206/313 (66%), Positives = 258/313 (82%), Gaps = 4/313 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL+E L AP   +H++++EELLWRASM P++   PF+ VPKVAF+FLT+G LPLAPLW+
Sbjct  86    IGLEEFLRAP-NVSHDMNEEELLWRASMVPRLPNYPFQLVPKVAFLFLTKGPLPLAPLWD  144

Query  969   MFFRGNAGLFSIYVHSSDPSYN--ETEPPESVFHGRRIPSKGVEWGKANMIeaerrllan  796
             +FF+G+ GL+SI+VHS +PS+N   TE  +SVF GR+IPSK V+WGK +M+EAERRLLAN
Sbjct  145   LFFKGHQGLYSIFVHS-NPSFNGNYTEEEDSVFRGRKIPSKEVQWGKFSMVEAERRLLAN  203

Query  795   alLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPII  616
             ALLDFSN+RF+LLSE+CIPLFNFSTIYSY+M S  TFIEVYDLPGPVGRGRY+ +M P+I
Sbjct  204   ALLDFSNQRFVLLSESCIPLFNFSTIYSYLMGSTTTFIEVYDLPGPVGRGRYNHRMRPVI  263

Query  615   KLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNS  436
             +L+ WRKGSQW EMDR+LA+EV+SD+ YFP F+ +C   CYSDEHYLPT +N+K  + NS
Sbjct  264   QLDKWRKGSQWVEMDRQLAVEVVSDRKYFPTFRKFCKVSCYSDEHYLPTFVNMKSRKKNS  323

Query  435   NRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHAL  256
             NR+LTWVDW++GGPHP KF R D+TVDFL +LR    CE NG  T +C+LFARKFT  AL
Sbjct  324   NRSLTWVDWSRGGPHPRKFGRLDITVDFLERLRKWRRCENNGRWTNICYLFARKFTPAAL  383

Query  255   SRLLILAPKLMQF  217
              RL+  APK+MQF
Sbjct  384   DRLMRFAPKVMQF  396



>gb|KHN06677.1| hypothetical protein glysoja_021223 [Glycine soja]
Length=415

 Score =   414 bits (1063),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 207/311 (67%), Positives = 246/311 (79%), Gaps = 3/311 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLKE L  PP   H++ DEELLWRASM+ KI + PF RVPKVAFMFLTRG + LAPLWE
Sbjct  108   VGLKEFLKPPP-VVHDMDDEELLWRASMTAKIPDYPFDRVPKVAFMFLTRGPVFLAPLWE  166

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ G +SIYVHS +PSYN + P   VF GRRIPSK VEWG  NMIEAERRLLANAL
Sbjct  167   QFFKGHEGFYSIYVHS-NPSYNGSRPESPVFKGRRIPSKEVEWGNVNMIEAERRLLANAL  225

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             +D SN+RF+LLSE+CIPLFNFSTIY+Y+MNS + ++  +D P  VGRGRYS QM P I L
Sbjct  226   VDISNQRFVLLSESCIPLFNFSTIYTYLMNSTQNYVMAFDDPSSVGRGRYSIQMLPEISL  285

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             N WRKGSQWFEMDR LALEV+SD+ YFP+FQ YC G CY+DEHYLPT ++IK  +GNSNR
Sbjct  286   NQWRKGSQWFEMDRDLALEVVSDRKYFPVFQDYCKGSCYADEHYLPTYVSIKFWEGNSNR  345

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW+KGGPHPTKF R+++TV FL  LR+   CEYNG+   +C LFARKF   +LS+
Sbjct  346   SLTWVDWSKGGPHPTKFLRSEITVKFLESLRD-QKCEYNGDSINVCFLFARKFAPGSLSK  404

Query  249   LLILAPKLMQF  217
             L  +AP +M F
Sbjct  405   LTKIAPMVMHF  415



>ref|XP_011022393.1| PREDICTED: uncharacterized protein LOC105124187 [Populus euphratica]
Length=391

 Score =   412 bits (1059),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 201/313 (64%), Positives = 249/313 (80%), Gaps = 2/313 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLKE L  P    H++ ++ELLWRASM+P+I E PF RVPKVAFMFLT+G + +APLWE
Sbjct  81    IGLKEHLKVP-DVKHDMDEKELLWRASMTPRIREYPFDRVPKVAFMFLTKGPVLMAPLWE  139

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ GL+SIYVHSS PSYNE+EP   VFHGRRIPSK V+WG  N+IEAERRLLANAL
Sbjct  140   RFFQGHEGLYSIYVHSS-PSYNESEPESPVFHGRRIPSKDVQWGNTNIIEAERRLLANAL  198

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SN+RF+LLSE+CIP+F+FST+Y+Y+MNS +  +E Y L GPVG GRY+ +M P+IK+
Sbjct  199   LDISNQRFVLLSESCIPIFDFSTVYTYLMNSTKNHVESYVLDGPVGNGRYNPRMRPVIKI  258

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
               WRKGSQWFEMDR LA+EV+SDQ YFP+FQ YC G CY+DEHYLPT +++K  + NSNR
Sbjct  259   EQWRKGSQWFEMDRDLAIEVVSDQEYFPVFQKYCKGQCYADEHYLPTFVSMKHSERNSNR  318

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW++GG HP KF R +VTV+FL ++R+G+ C YNG  T  C LFARKF   AL R
Sbjct  319   SLTWVDWSRGGAHPAKFLRREVTVEFLERMRSGSKCVYNGNSTNTCFLFARKFWPTALER  378

Query  249   LLILAPKLMQFNG  211
             LL  AP +M FN 
Sbjct  379   LLRFAPNVMHFNS  391



>ref|XP_003536674.1| PREDICTED: uncharacterized protein LOC100810724 [Glycine max]
Length=415

 Score =   412 bits (1058),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 205/311 (66%), Positives = 246/311 (79%), Gaps = 3/311 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLKE L  PP   H++ DEE+LWRASM+ KI + PF RVPKVAFMFLTRG + LAPLWE
Sbjct  108   VGLKEFLKPPP-VVHDMDDEEMLWRASMTAKIPDYPFDRVPKVAFMFLTRGPVFLAPLWE  166

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ G +SIYVHS +PSYN + P   VF GRRIPSK VEWG  NMIEAERRLLANAL
Sbjct  167   QFFKGHEGFYSIYVHS-NPSYNGSRPESPVFKGRRIPSKEVEWGNVNMIEAERRLLANAL  225

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             +D SN+RF+LLSE+CIPLFNFSTIY+Y+MNS + ++  +D P  VGRGRYS QM P I L
Sbjct  226   VDISNQRFVLLSESCIPLFNFSTIYTYLMNSTQNYVMAFDDPSSVGRGRYSIQMLPEISL  285

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             N WRKGSQWFEMDR LALEV+SD+ YFP+FQ YC G CY+DEHYLPT ++IK  +GNSNR
Sbjct  286   NQWRKGSQWFEMDRDLALEVVSDRKYFPVFQDYCKGSCYADEHYLPTYVSIKFWEGNSNR  345

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW+KGGPHPTKF R+++TV FL  LR+   CEYNG+   +C LFARKF   ++S+
Sbjct  346   SLTWVDWSKGGPHPTKFLRSEITVKFLESLRD-QKCEYNGDSINVCFLFARKFAPGSVSK  404

Query  249   LLILAPKLMQF  217
             L  +AP +M F
Sbjct  405   LTKIAPMVMHF  415



>gb|EYU41282.1| hypothetical protein MIMGU_mgv1a010939mg [Erythranthe guttata]
Length=297

 Score =   405 bits (1041),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 237/297 (80%), Gaps = 1/297 (0%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYV  928
             H++ +EEL+WRASM PK+ E PFRR PKVAFMFL +  LP+APLWE+FFRG+ GLFSIYV
Sbjct  2     HDMKEEELIWRASMKPKVREYPFRRTPKVAFMFLAKRDLPMAPLWELFFRGHQGLFSIYV  61

Query  927   HSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEA  748
             HS  PSYN T PP+SVF+GRRIPSK V WG+ +MIEAERRLLANALLD SN+RF+LLSEA
Sbjct  62    HSQ-PSYNATVPPDSVFYGRRIPSKEVAWGEFSMIEAERRLLANALLDVSNQRFVLLSEA  120

Query  747   CIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDR  568
             CIPLFNF TIY+Y+M S  +F+E YDL GPVGRGRY S M P + L DWRKG+QWFEMDR
Sbjct  121   CIPLFNFKTIYNYLMESTTSFVESYDLLGPVGRGRYDSHMMPYVTLEDWRKGAQWFEMDR  180

Query  567   RLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHP  388
              LA+EVI+D+ Y+ +F+ YC   CYSDEHYLPT++  K    N+NRTLTWVDW++GGPHP
Sbjct  181   ELAVEVIADRIYYSVFKKYCKPACYSDEHYLPTMITKKFPTKNANRTLTWVDWSRGGPHP  240

Query  387   TKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQF  217
              KF R D++ D L ++R G  C YNG  T +C+LFARKFT++AL RLL  AP +M F
Sbjct  241   LKFIRTDISPDMLYRMRTGKQCLYNGNPTNVCYLFARKFTVNALDRLLRFAPMVMHF  297



>ref|XP_009105384.1| PREDICTED: uncharacterized protein LOC103831252 [Brassica rapa]
 emb|CDX96025.1| BnaA07g27060D [Brassica napus]
Length=416

 Score =   410 bits (1053),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 207/317 (65%), Positives = 251/317 (79%), Gaps = 7/317 (2%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL++ L  P    H++ +EELLWRASM+PKI   PFRR PKVAFMFLT+G LPLAPLWE
Sbjct  101   IGLEQFLRPPKKIMHDMEEEELLWRASMTPKIKNYPFRRTPKVAFMFLTKGHLPLAPLWE  160

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FFRG+ GLFSIYVHS  PSYN+T+P  SVFHGR+IPSK V+WG  NM+EAE+RLLANAL
Sbjct  161   RFFRGHEGLFSIYVHSY-PSYNQTDPEGSVFHGRQIPSKRVDWGYVNMVEAEQRLLANAL  219

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SNERF+LLSE+CIPLFNF+T+YSY+  S +T ++ YD  G VGRGRYS +M P I+L
Sbjct  220   LDISNERFVLLSESCIPLFNFTTVYSYLTKSIQTHVQSYDELGGVGRGRYSPEMKPRIQL  279

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIK--LGQGNS  436
               WRKGSQWFE+DR +ALE+ISD+ Y+PLF  YC   CY+DEHY+PTL+NIK  LG+ NS
Sbjct  280   RHWRKGSQWFELDRAMALEIISDKIYWPLFYRYCHHGCYTDEHYIPTLLNIKSSLGRRNS  339

Query  435   NRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNG----NTCEYNGEKTTMCHLFARKFT  268
             NRTLTWVDW+KGGPHP +F R +VT +FL KLR+G      C +NGEKT +C+LFARKF 
Sbjct  340   NRTLTWVDWSKGGPHPNRFIRYEVTEEFLVKLRSGGEENRQCYHNGEKTNICYLFARKFL  399

Query  267   LHALSRLLILAPKLMQF  217
               AL RLL LAP ++ F
Sbjct  400   PTALGRLLRLAPTVLYF  416



>gb|KCW83891.1| hypothetical protein EUGRSUZ_B00742 [Eucalyptus grandis]
Length=302

 Score =   405 bits (1040),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/302 (67%), Positives = 246/302 (81%), Gaps = 6/302 (2%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYV  928
             H++ D ELLWRASM+PKI + PF+RVPKVAF+FLTRG LPLAPLWE FFRG+ GLFSIYV
Sbjct  2     HDMDDRELLWRASMAPKIRQYPFKRVPKVAFLFLTRGPLPLAPLWERFFRGHEGLFSIYV  61

Query  927   HSSDPSYNET----EPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFIL  760
             HS  P++N T    E   SVFHGRRIPSK V+WG  NM+EAERRLLANALLD SN+RF+L
Sbjct  62    HS-HPAFNATAGGGESEGSVFHGRRIPSKEVQWGNFNMVEAERRLLANALLDISNQRFVL  120

Query  759   LSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWF  580
             LSE+CIPLFNF+TIYSY++ S  +FIE YD PGPVGRGRY+ +M P+I++  WRKGSQWF
Sbjct  121   LSESCIPLFNFTTIYSYLVGSTRSFIEAYDKPGPVGRGRYNLRMRPVIQIGQWRKGSQWF  180

Query  579   EMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKG  400
             EMDR LA+EV+SD  Y  +F+ +C G CYSDEHYLPTL++IK  + NSNR+LTWVDW+KG
Sbjct  181   EMDRGLAVEVVSDMKYISVFRRFCKGSCYSDEHYLPTLVSIKFWRRNSNRSLTWVDWSKG  240

Query  399   GPHPTKFTRNDVTVDFLNKLRNGN-TCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLM  223
             GPHPT+F R  VTV+ L +LR G+  CEYNG+ T++C LFARKF  +AL RLL  APK+M
Sbjct  241   GPHPTRFGRWQVTVELLKRLRGGSRKCEYNGKSTSVCFLFARKFLPNALDRLLRFAPKVM  300

Query  222   QF  217
             +F
Sbjct  301   EF  302



>ref|XP_004301820.1| PREDICTED: uncharacterized protein LOC101311102 [Fragaria vesca 
subsp. vesca]
Length=426

 Score =   409 bits (1052),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 200/305 (66%), Positives = 242/305 (79%), Gaps = 4/305 (1%)
 Frame = -3

Query  1119  PGAAHNLSDEELLWRASMSPK-IGEMPFRR--VPKVAFMFLTRGALPLAPLWEMFFRGNA  949
             P A H++ D ELLWRASM PK  G  PF+    PKVAFMFLTRG L LAPLWE FF+G+ 
Sbjct  123   PSAMHDMEDSELLWRASMVPKRSGAYPFKNDTKPKVAFMFLTRGDLALAPLWERFFKGHE  182

Query  948   GLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNER  769
             GL+SIY+H+ +P   E  P  SVFHGRR+PSK V WG+ NM++AERRLLANALLD +N+R
Sbjct  183   GLYSIYIHA-NPDSGEPMPENSVFHGRRVPSKNVTWGEPNMVQAERRLLANALLDLTNQR  241

Query  768   FILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGS  589
             FILLSE+CIPLFNF T+Y+YVM+S +TF+E YDLPG VGR RY  +M+P IKL  WRKGS
Sbjct  242   FILLSESCIPLFNFKTVYNYVMDSTQTFVEAYDLPGAVGRDRYRKKMSPTIKLEQWRKGS  301

Query  588   QWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDW  409
             QWFE+DR+LAL V+SD +YFPLF+ YC   CYSDEHYLPT ++I+  + NSNRTL WVDW
Sbjct  302   QWFEVDRQLALGVVSDTSYFPLFEKYCVPSCYSDEHYLPTYVSIRFWKKNSNRTLHWVDW  361

Query  408   AKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPK  229
             ++GGPHP+++ R DVT +FLNK+R G TCEYNG+ T MCH+FARKF  + L RLL  APK
Sbjct  362   SRGGPHPSRYQRTDVTYEFLNKMRFGTTCEYNGKSTNMCHMFARKFMPNTLDRLLRFAPK  421

Query  228   LMQFN  214
             LMQFN
Sbjct  422   LMQFN  426



>ref|XP_011097027.1| PREDICTED: uncharacterized protein LOC105176048 [Sesamum indicum]
Length=420

 Score =   409 bits (1050),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 203/297 (68%), Positives = 237/297 (80%), Gaps = 1/297 (0%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYV  928
             H + D+ELLWRASM PKIGE PF+R PKVAFMFL R  LPLAPLWEMFFRG+ GL+SIYV
Sbjct  125   HEMGDKELLWRASMKPKIGEYPFKRTPKVAFMFLARRELPLAPLWEMFFRGHEGLYSIYV  184

Query  927   HSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEA  748
             HS  PSYN +EP  SVFHGRR+PSK V+WG+ +M+EAERRLLANALLD+SNERF+LLSEA
Sbjct  185   HSL-PSYNGSEPEGSVFHGRRVPSKEVKWGEFSMVEAERRLLANALLDYSNERFVLLSEA  243

Query  747   CIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDR  568
             CIPLFNF+TIY Y++ S  TF+E YDL GPVGRGRY   M P IKL +WRKG+QWFE+DR
Sbjct  244   CIPLFNFTTIYDYLIKSTTTFVESYDLAGPVGRGRYDKHMRPHIKLKEWRKGAQWFEIDR  303

Query  567   RLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHP  388
              LALEVISD+ Y  LF+ YC   CYSDEHYLPT +  K    NSNRTLTWVDW+KGGPHP
Sbjct  304   ELALEVISDRLYSFLFKKYCKPACYSDEHYLPTFVTKKFPWKNSNRTLTWVDWSKGGPHP  363

Query  387   TKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQF  217
              +F R+DV+    N+LR+ + C YNG  T +C+LFARKFT+  L RLL  APK+MQF
Sbjct  364   LRFVRSDVSSALRNQLRSSSECVYNGRPTDICYLFARKFTVGTLDRLLRFAPKVMQF  420



>ref|XP_002311468.2| hypothetical protein POPTR_0008s12260g [Populus trichocarpa]
 gb|EEE88835.2| hypothetical protein POPTR_0008s12260g [Populus trichocarpa]
Length=391

 Score =   407 bits (1047),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 199/313 (64%), Positives = 248/313 (79%), Gaps = 2/313 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLKE L  P    H++ ++ELLWRASM+P+I E PF RVPKVAFMFLT+G + +APLWE
Sbjct  81    VGLKEHLKVP-DVKHDMDEKELLWRASMTPRIREYPFDRVPKVAFMFLTKGPVLMAPLWE  139

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ GL+SIYVHSS PSYNE+EP   VFHGRRIPSK V+WG  N+IEAERRLLANAL
Sbjct  140   RFFQGHEGLYSIYVHSS-PSYNESEPESPVFHGRRIPSKDVQWGNTNIIEAERRLLANAL  198

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SN+RF+LLSE+CIP+F+FST+Y+Y+MNS +  ++ Y L GPVG GRY+ +M P+IK+
Sbjct  199   LDISNQRFVLLSESCIPIFDFSTVYTYLMNSTKNHVDSYVLDGPVGNGRYNPRMRPVIKI  258

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
               WRKGSQWFEMDR LA+EV+SDQ YFP+FQ YC G CY+DEHYLPT +++K  + NSNR
Sbjct  259   EHWRKGSQWFEMDRDLAIEVVSDQEYFPVFQKYCKGHCYADEHYLPTFVSMKHSERNSNR  318

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW++GG HP KF   +VT++FL ++R+G+ C YN   T  C LFARKF   AL R
Sbjct  319   SLTWVDWSRGGAHPAKFLSREVTIEFLERMRSGSKCVYNANSTNTCFLFARKFWPPALER  378

Query  249   LLILAPKLMQFNG  211
             LL  APK+M FN 
Sbjct  379   LLRFAPKVMHFNS  391



>ref|XP_011072929.1| PREDICTED: uncharacterized protein LOC105158025 [Sesamum indicum]
Length=425

 Score =   408 bits (1049),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 202/311 (65%), Positives = 249/311 (80%), Gaps = 2/311 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL++ L  PP A H++++EELLWRASM PKI E PFRR+PK+AFMFLT+G LP+APLWE
Sbjct  116   IGLRQYL-RPPRAMHDMTEEELLWRASMVPKIQEYPFRRIPKIAFMFLTKGDLPMAPLWE  174

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ GL+SIYVHS  PS+N T P  SVF+ R+IPSK V WG+ NM+EAERRLLANAL
Sbjct  175   RFFKGHEGLYSIYVHS-QPSHNITTPKTSVFYRRQIPSKEVAWGEFNMVEAERRLLANAL  233

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDF+N+RFILLSEACIPLFNF+TIY+Y+  S  +FIE YD  GPVGRGRY+  M P + L
Sbjct  234   LDFANQRFILLSEACIPLFNFNTIYNYLTRSTTSFIESYDQWGPVGRGRYNKNMEPHVTL  293

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKG+QWFE++R LA+EV+SDQ Y+ LF+ YC   CYSDEHYLPT + +K    N NR
Sbjct  294   DQWRKGAQWFEVNRELAVEVVSDQKYYNLFKEYCKPECYSDEHYLPTFVTMKFPWMNGNR  353

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW+KGGPHPT+F R+DVTVD L ++R G TC YNG+ T +C LFARKFT + L R
Sbjct  354   TLTWVDWSKGGPHPTQFLRSDVTVDRLKRMRTGTTCLYNGKPTNICFLFARKFTANGLDR  413

Query  249   LLILAPKLMQF  217
             LL LAP++M F
Sbjct  414   LLRLAPQIMHF  424



>gb|KEH27363.1| core-2/I-branching enzyme [Medicago truncatula]
Length=387

 Score =   407 bits (1045),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 202/312 (65%), Positives = 255/312 (82%), Gaps = 3/312 (1%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL+ELL  P  A H+++++EL WRAS++P I + PF++ PKVAFMFLT+G + LAPLWE 
Sbjct  78    GLEELLKIP-KAMHDMNEDELFWRASLAPMIHKTPFKQTPKVAFMFLTKGPILLAPLWEK  136

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllanal  790
             FF+GN GL+SIYVH S PS+NET   +S VF+GRRIPSK V+WG+ +MIEAERRLLANAL
Sbjct  137   FFKGNEGLYSIYVHPS-PSFNETVYNQSSVFYGRRIPSKEVKWGENSMIEAERRLLANAL  195

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+RF+LLSE CIPLFNFSTIY+Y+MNS +TF+E  D+P  VGRGRY+ +M P+I+L
Sbjct  196   LDFSNQRFVLLSEHCIPLFNFSTIYTYLMNSKQTFVEAIDIPSDVGRGRYNRRMRPLIQL  255

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKG+QWF++DR LA+ ++SD+ YF +F+ YC   CYSDEHYLPTL++IK  + NSNR
Sbjct  256   SQWRKGAQWFQIDRYLAVCIVSDKPYFSVFKKYCHPGCYSDEHYLPTLVSIKFWKRNSNR  315

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW++GG HP KF+  DVT+DFL +LR G+TCEYNG+ T +CHLFARKF   AL  
Sbjct  316   TLTWVDWSRGGAHPAKFSSKDVTIDFLERLRFGSTCEYNGKTTNVCHLFARKFGTQALDG  375

Query  249   LLILAPKLMQFN  214
             LL  APKLMQFN
Sbjct  376   LLTFAPKLMQFN  387



>ref|XP_010045650.1| PREDICTED: uncharacterized protein LOC104434412 [Eucalyptus grandis]
Length=412

 Score =   407 bits (1047),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 205/310 (66%), Positives = 249/310 (80%), Gaps = 6/310 (2%)
 Frame = -3

Query  1131  LMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGN  952
              + PP   H++ D ELLWRASM+PKI + PF+RVPKVAF+FLTRG LPLAPLWE FFRG+
Sbjct  104   FLDPPTPMHDMDDRELLWRASMAPKIRQYPFKRVPKVAFLFLTRGPLPLAPLWERFFRGH  163

Query  951   AGLFSIYVHSSDPSYNET----EPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLD  784
              GLFSIYVHS  P++N T    E   SVFHGRRIPSK V+WG  NM+EAERRLLANALLD
Sbjct  164   EGLFSIYVHS-HPAFNATAGGGESEGSVFHGRRIPSKEVQWGNFNMVEAERRLLANALLD  222

Query  783   FSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLND  604
              SN+RF+LLSE+CIPLFNF+TIYSY++ S  +FIE YD PGPVGRGRY+ +M P+I++  
Sbjct  223   ISNQRFVLLSESCIPLFNFTTIYSYLVGSTRSFIEAYDKPGPVGRGRYNLRMRPVIQIGQ  282

Query  603   WRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTL  424
             WRKGSQWFEMDR LA+EV+SD  Y  +F+ +C G CYSDEHYLPTL++IK  + NSNR+L
Sbjct  283   WRKGSQWFEMDRGLAVEVVSDMKYISVFRRFCKGSCYSDEHYLPTLVSIKFWRRNSNRSL  342

Query  423   TWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGN-TCEYNGEKTTMCHLFARKFTLHALSRL  247
             TWVDW+KGGPHPT+F R  VTV+ L +LR G+  CEYNG+ T++C LFARKF  +AL RL
Sbjct  343   TWVDWSKGGPHPTRFGRWQVTVELLKRLRGGSRKCEYNGKSTSVCFLFARKFLPNALDRL  402

Query  246   LILAPKLMQF  217
             L  APK+M+F
Sbjct  403   LRFAPKVMEF  412



>ref|XP_004497066.1| PREDICTED: uncharacterized protein LOC101490811 [Cicer arietinum]
Length=406

 Score =   407 bits (1046),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 208/315 (66%), Positives = 244/315 (77%), Gaps = 4/315 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLK+ L  PP   H++ DEELLWRASM+ KI E PF RVPKVAFMFLTRG + LAPLWE
Sbjct  80    VGLKDFLKPPP-IVHDMDDEELLWRASMTAKINEYPFERVPKVAFMFLTRGPVFLAPLWE  138

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ G +SIYVHS +PSYN + P   VF GRRIPSK V WG  NMIEAERRLL+NAL
Sbjct  139   QFFKGHEGYYSIYVHS-NPSYNGSYPETPVFSGRRIPSKEVAWGNVNMIEAERRLLSNAL  197

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SN+RF+LLSE+CIPLFNFSTIYSY++NS E ++  +D P  VGRGRYS QM P + L
Sbjct  198   LDISNQRFVLLSESCIPLFNFSTIYSYLINSTENYVMAFDDPSGVGRGRYSIQMLPEVSL  257

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
               WRKG QWFEMDR LAL V+SD+ YFP+FQ YC G CY+DEHYLPT ++IK  +GNSNR
Sbjct  258   KQWRKGFQWFEMDRELALGVVSDRIYFPVFQQYCKGSCYADEHYLPTFVSIKFWEGNSNR  317

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEY-NGEKTTMCHLFARKFTLHALS  253
             +LTWVDW+KGGPHP  F R+DVTV+FL +LRN   C+Y NG  T  C LFARKF    LS
Sbjct  318   SLTWVDWSKGGPHPAHFLRSDVTVEFLERLRN-KKCKYNNGNSTNACFLFARKFLPSTLS  376

Query  252   RLLILAPKLMQFNGY  208
             RLL +AP++MQF  Y
Sbjct  377   RLLKIAPQVMQFEHY  391



>ref|XP_003555913.1| PREDICTED: uncharacterized protein LOC100779041 [Glycine max]
 gb|KHN11397.1| hypothetical protein glysoja_015292 [Glycine soja]
Length=421

 Score =   407 bits (1047),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 203/311 (65%), Positives = 244/311 (78%), Gaps = 3/311 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLKE L  PP   H++ DEELLWRAS++ KI + PF RVPKVAF+FLTRG + LAPLWE
Sbjct  114   VGLKEFLKPPP-VVHDMDDEELLWRASVTAKIPDYPFDRVPKVAFLFLTRGPVFLAPLWE  172

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ G +SIYVHS +PSYN + P   VF GRRIPSK VEWG  NMIEAERRLLANAL
Sbjct  173   QFFKGHEGFYSIYVHS-NPSYNGSRPESPVFKGRRIPSKEVEWGNVNMIEAERRLLANAL  231

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SN+RF+LLSE+CIPLFNFSTIY+Y+MNS + ++  +D P  VGRGRYS QM P I +
Sbjct  232   LDISNQRFVLLSESCIPLFNFSTIYTYLMNSTQNYVMAFDDPSSVGRGRYSIQMLPKISV  291

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             N WRKGSQWFEMDR LA EV+SD+ YFP+FQ YC G CY+DEHYLPT ++IK  +GNSNR
Sbjct  292   NQWRKGSQWFEMDRELAQEVVSDKKYFPVFQEYCKGSCYADEHYLPTYVSIKFWEGNSNR  351

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW+KGGPHPTKF R+++TV FL  LR+   CEYNG+   +C LFARKF    +S+
Sbjct  352   SLTWVDWSKGGPHPTKFLRSEITVKFLESLRD-QKCEYNGDSINVCFLFARKFAPSTVSK  410

Query  249   LLILAPKLMQF  217
             L  +AP +M F
Sbjct  411   LTKIAPMVMHF  421



>ref|XP_007142937.1| hypothetical protein PHAVU_007G029800g [Phaseolus vulgaris]
 gb|ESW14931.1| hypothetical protein PHAVU_007G029800g [Phaseolus vulgaris]
Length=418

 Score =   407 bits (1045),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 204/311 (66%), Positives = 243/311 (78%), Gaps = 3/311 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLK+ L  PP   H++ DEELLWRASM+ KI + PF RVPKVAFMFLTRG + LAPLWE
Sbjct  111   VGLKDFLQ-PPHVVHDMDDEELLWRASMTAKIPDYPFDRVPKVAFMFLTRGPVFLAPLWE  169

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+GN GL+SIYVHS +PSYN + P   VF GRRIPSK VEWG  NMIEAERRLLANAL
Sbjct  170   KFFQGNEGLYSIYVHS-NPSYNGSRPESPVFEGRRIPSKEVEWGNVNMIEAERRLLANAL  228

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD  N+RF+LLSE+CIPLFNFSTIY+Y++NS +  +  +D P  VGRGRYS QM P I +
Sbjct  229   LDIQNQRFVLLSESCIPLFNFSTIYTYLINSTQNNVMAFDDPSSVGRGRYSIQMLPDISI  288

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             N WRKGSQWFEMDR LALEV+SD+ YFP+FQ YC G CY+DEHYLPT ++IK  +GNSNR
Sbjct  289   NQWRKGSQWFEMDRELALEVVSDRKYFPVFQEYCKGSCYADEHYLPTYVSIKFWEGNSNR  348

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW+KGGPHP KF R+++TV FL  LRN   C+YNG+   +C LFARKF    +S+
Sbjct  349   SLTWVDWSKGGPHPAKFLRSEITVQFLESLRN-QKCKYNGDSINVCFLFARKFAPSTVSK  407

Query  249   LLILAPKLMQF  217
             L  +AP +M F
Sbjct  408   LTKIAPMVMHF  418



>ref|XP_010099264.1| hypothetical protein L484_015454 [Morus notabilis]
 gb|EXB77528.1| hypothetical protein L484_015454 [Morus notabilis]
Length=423

 Score =   407 bits (1045),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 202/315 (64%), Positives = 243/315 (77%), Gaps = 3/315 (1%)
 Frame = -3

Query  1155  RVVGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPL  976
             +++GL+E L  PP   HN++D+ELLWRASM P+I   PF RVPKVAFMFL RG + ++PL
Sbjct  110   QILGLEEYL-KPPSVMHNMTDKELLWRASMVPRIPAYPFNRVPKVAFMFLVRGHVFMSPL  168

Query  975   WEMFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllan  796
             WE FF+G+ GL+SIYVHS +PSYN + P   VFHGRRIPSK V WGK NMIEAERRLL N
Sbjct  169   WEQFFKGHEGLYSIYVHS-NPSYNGSAPESPVFHGRRIPSKEVGWGKVNMIEAERRLLTN  227

Query  795   alLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPII  616
             ALLD SNERFILLSEACIPL+NF TIY+Y++N+ +  +  YD PG VGRGRY+  M P I
Sbjct  228   ALLDVSNERFILLSEACIPLYNFKTIYNYLINATKNHVMAYDEPGVVGRGRYNYHMYPDI  287

Query  615   KLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNS  436
              L  WRKGSQWFEM+R LA+EV+SD  YFP+FQ YC G CYSDEHYLPTL++IK  +GNS
Sbjct  288   SLKQWRKGSQWFEMNRELAIEVVSDSKYFPIFQKYCRGNCYSDEHYLPTLVSIKFWEGNS  347

Query  435   NRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNT-CEYNGEKTTMCHLFARKFTLHA  259
             NR+LTWVDW+KGGPHP +F R DVT++ L  +R  NT C YN   T +C+LFARKF    
Sbjct  348   NRSLTWVDWSKGGPHPARFWRTDVTLELLRSMRRNNTGCAYNENSTNLCYLFARKFLPST  407

Query  258   LSRLLILAPKLMQFN  214
             + RLL  APK+M FN
Sbjct  408   VDRLLKFAPKIMHFN  422



>ref|XP_004516650.1| PREDICTED: uncharacterized protein LOC101496316 [Cicer arietinum]
Length=392

 Score =   405 bits (1042),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 200/311 (64%), Positives = 244/311 (78%), Gaps = 3/311 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLK  +  P    H+L+DEEL+WRAS++PKI E PF RVPKVAFMFL RG++PLAPLW+
Sbjct  85    VGLKNFI-EPSHVVHDLTDEELMWRASLTPKIDEYPFDRVPKVAFMFLVRGSVPLAPLWQ  143

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ G ++IY+HS +PSYN +E    VF GRRIPSK VEWGK NMIEAERRLLANAL
Sbjct  144   KFFKGHKGYYTIYIHS-NPSYNGSEVESPVFRGRRIPSKKVEWGKFNMIEAERRLLANAL  202

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+RF+L+SE+CIPLFNFST+YSY+MNS ++ +  YD    VGRGRY  +M+P IKL
Sbjct  203   LDFSNQRFVLISESCIPLFNFSTVYSYLMNSTQSHVMAYDEASSVGRGRYRIKMSPKIKL  262

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
               WRKGSQWFEM R LALEVISD+TYFP+F+ YC G CY+DEHYLPT ++IK  + NSNR
Sbjct  263   KQWRKGSQWFEMHRELALEVISDRTYFPIFEKYCKGSCYADEHYLPTFVSIKFWEKNSNR  322

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW+KGGPHP KF R +VT + L  LRN   CEYNG  T +C LFARKF   +L+R
Sbjct  323   SLTWVDWSKGGPHPAKFVRPEVTSELLENLRN-QRCEYNGNSTNVCFLFARKFLQSSLTR  381

Query  249   LLILAPKLMQF  217
             L+  AP++M  
Sbjct  382   LMRFAPRVMHL  392



>ref|XP_006302341.1| hypothetical protein CARUB_v10020398mg [Capsella rubella]
 gb|EOA35239.1| hypothetical protein CARUB_v10020398mg [Capsella rubella]
Length=405

 Score =   405 bits (1042),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 201/312 (64%), Positives = 246/312 (79%), Gaps = 3/312 (1%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL+  +  P    H++ DEELLWRASM+PKI   PF R PKVAFMF+T+G LPLA LW+ 
Sbjct  95    GLERFIKPPEKLMHDMEDEELLWRASMAPKIKNYPFPRTPKVAFMFMTKGHLPLARLWDR  154

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FFRG+ GLFSIYVHS  PSYN+++P +SVF GR +PSK V+WG  NM+EAE+RLLANALL
Sbjct  155   FFRGHEGLFSIYVHSY-PSYNQSDPEDSVFQGRHVPSKRVDWGYVNMVEAEQRLLANALL  213

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNERF+LLSE+CIPLFNF+T+YSY+MNS +T +E YD  G VGRGRYS  M P ++L+
Sbjct  214   DISNERFVLLSESCIPLFNFTTVYSYLMNSTQTHVESYDQLGGVGRGRYSPLMQPHVQLH  273

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIK--LGQGNSN  433
              WRKGSQWFEMDR +ALEVISD+ Y+PLF SYC   CY+DEHY+PTL+NIK  L + NSN
Sbjct  274   HWRKGSQWFEMDRAMALEVISDRIYWPLFYSYCHHGCYADEHYIPTLLNIKTNLNRRNSN  333

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             RTLTWVDW+KGGPHP +F R++VT +F+  LR+G  C YNGEKT MC+LFARKF   AL 
Sbjct  334   RTLTWVDWSKGGPHPNRFIRHEVTAEFMENLRSGGECLYNGEKTNMCYLFARKFLPTALD  393

Query  252   RLLILAPKLMQF  217
             RLL  +  ++ F
Sbjct  394   RLLRFSRIVLHF  405



>ref|XP_006391143.1| hypothetical protein EUTSA_v10019817mg [Eutrema salsugineum]
 gb|ESQ28429.1| hypothetical protein EUTSA_v10019817mg [Eutrema salsugineum]
Length=415

 Score =   405 bits (1042),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 207/316 (66%), Positives = 245/316 (78%), Gaps = 7/316 (2%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GLK  L  P    H++ DEEL WRASM+PKI   PF R PKVAFMFLT+G LPLAPLWE 
Sbjct  101   GLKRFLRPPENIMHDMEDEELFWRASMAPKITNYPFPRTPKVAFMFLTKGHLPLAPLWER  160

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FFRG+ GLFSIYVHS  PSYN+++P  SVFHGR+IPSK V+WG  NM+EAE+RLLANALL
Sbjct  161   FFRGHEGLFSIYVHSY-PSYNQSDPEGSVFHGRQIPSKRVDWGYVNMVEAEQRLLANALL  219

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNERF+LLSE+CIPLFNF+T+YSY+ NS +T +E YD PG VGRGRYS +M P ++L 
Sbjct  220   DISNERFLLLSESCIPLFNFTTVYSYLTNSTQTHVESYDQPGGVGRGRYSPEMRPRVQLR  279

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIK--LGQGNSN  433
              WRKGSQWFE++R LALE+ISD+TY+PLF  YC   CY+DEHY+PTL+NI   LG  N+N
Sbjct  280   HWRKGSQWFELNRALALEIISDKTYWPLFYRYCHHGCYADEHYIPTLLNINPSLGSRNTN  339

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGN----TCEYNGEKTTMCHLFARKFTL  265
             RTLTWVDW+KGGPHP +F R +VT +FL KLR G      C YN EKT  C+LFARKF  
Sbjct  340   RTLTWVDWSKGGPHPNRFIRYEVTKEFLEKLRGGGDENRKCFYNAEKTNNCYLFARKFLP  399

Query  264   HALSRLLILAPKLMQF  217
              AL RLL LAP ++ F
Sbjct  400   TALGRLLRLAPSVLYF  415



>emb|CBI15480.3| unnamed protein product [Vitis vinifera]
Length=295

 Score =   401 bits (1030),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 196/296 (66%), Positives = 238/296 (80%), Gaps = 1/296 (0%)
 Frame = -3

Query  1101  LSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHS  922
             + D ELLWRASM P++GE PF+RVPK+AF+FLTRG+LPLAPLWEMFFRG+  L+SIYVHS
Sbjct  1     MKDAELLWRASMVPRVGEFPFKRVPKIAFLFLTRGSLPLAPLWEMFFRGHEALYSIYVHS  60

Query  921   SDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEACI  742
              DPS+N T P  SVF+GR IPS+ V+WG  +M+EAERRLLANALLD SN RF+LLSE+CI
Sbjct  61    -DPSFNRTVPKSSVFYGRSIPSQEVQWGNFSMLEAERRLLANALLDISNHRFVLLSESCI  119

Query  741   PLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRL  562
             PLFNFSTIYSY+M S ++FIE YDLPGPVGR RY  +M PI+ +  WRKGSQWFEMDR L
Sbjct  120   PLFNFSTIYSYLMASTKSFIEAYDLPGPVGRARYDHRMKPIVTIGQWRKGSQWFEMDRGL  179

Query  561   ALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTK  382
             A+EVISD+ YF +F+  C   CY+DEHYLPTL++I+  + N+NR+LTWVDW+ GG HP  
Sbjct  180   AIEVISDRKYFAVFRECCEASCYADEHYLPTLVSIEFWRRNANRSLTWVDWSNGGAHPAG  239

Query  381   FTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             F R DVTV+FL  LR  + C+YNG  T +C LFARKF    L+RLL +APKLM+FN
Sbjct  240   FWRRDVTVEFLQSLRTESHCQYNGNNTDICFLFARKFLPGTLNRLLRVAPKLMKFN  295



>gb|KFK41255.1| hypothetical protein AALP_AA2G105500 [Arabis alpina]
Length=406

 Score =   404 bits (1039),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 207/316 (66%), Positives = 247/316 (78%), Gaps = 7/316 (2%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL   L  P    H++ D+ELLWRASM+PKI   PF R PKVAFMFLT+G LPLAPLWE 
Sbjct  92    GLDGFLKPPEKIMHDMEDDELLWRASMTPKIKNYPFLRTPKVAFMFLTKGHLPLAPLWER  151

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FF+G+ GLFSIY+HS DPSYN+T+P  SVFHGR+IPSK V+WG ANMIEAE+RLLANALL
Sbjct  152   FFQGHEGLFSIYIHS-DPSYNKTDPEGSVFHGRQIPSKRVDWGNANMIEAEQRLLANALL  210

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNERF+LLSE+CIPLFNFST+YSY+  S +T +E YD  G VGRGRYS +M P I+L 
Sbjct  211   DISNERFVLLSESCIPLFNFSTVYSYLTLSTQTHVESYDQLGGVGRGRYSPEMRPRIQLR  270

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIK--LGQGNSN  433
              WRKGSQWFE+DR +ALE+ISD  Y+PLF  YC   CYSDEHY+PTL+NIK  L   NSN
Sbjct  271   HWRKGSQWFELDRAMALEIISDTLYWPLFYRYCHHGCYSDEHYIPTLLNIKPSLAHRNSN  330

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNG----NTCEYNGEKTTMCHLFARKFTL  265
             RTLTWVDW+KGGPHP +F R++VT +FL +LR+G      C +NGEKT +C+LFARKF  
Sbjct  331   RTLTWVDWSKGGPHPNRFIRHEVTPEFLERLRSGGDENKECFHNGEKTNICYLFARKFLP  390

Query  264   HALSRLLILAPKLMQF  217
              AL RL+ LAP ++ F
Sbjct  391   TALGRLIRLAPTVLYF  406



>ref|XP_004299045.1| PREDICTED: uncharacterized protein LOC101307203 [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   404 bits (1039),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 194/313 (62%), Positives = 247/313 (79%), Gaps = 2/313 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +G  E  + PP   H++ DEELLWRASM+P+I + PF+RVPKVAFMFLTRG + LAPLWE
Sbjct  94    IGALEEFLKPPKVWHDMDDEELLWRASMAPRILQYPFKRVPKVAFMFLTRGPIHLAPLWE  153

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllana  793
              FF+G+ GL+SIY+HS D  YNE+  PES +F GRRIPS+ V+WG+ N+IEAE RL+ANA
Sbjct  154   KFFQGHQGLYSIYIHS-DMYYNESSHPESPIFRGRRIPSQRVDWGRVNLIEAESRLIANA  212

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SN+RF+LLSEACIPLFNFST+YSY++N+++TF++VYD P  VGRGRY+    P I 
Sbjct  213   LLDVSNQRFVLLSEACIPLFNFSTVYSYLINTHQTFVQVYDDPSGVGRGRYNESYYPQIT  272

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             L+ WRKGSQW E+DR +A+EV+SDQ Y+  FQ  C G C++DEHYLPT MNI+    NSN
Sbjct  273   LDQWRKGSQWVEIDRDIAIEVVSDQKYYTTFQKLCRGYCFADEHYLPTFMNIRFPTKNSN  332

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             R++TWVDW+ GGPHP ++   DVTV+ LNKLR+G+ CEYNG  T +C LFARKF L +L 
Sbjct  333   RSVTWVDWSTGGPHPVEYESTDVTVELLNKLRHGSWCEYNGRGTNVCFLFARKFPLSSLD  392

Query  252   RLLILAPKLMQFN  214
              LL +AP++MQFN
Sbjct  393   TLLKIAPQVMQFN  405



>emb|CDY59035.1| BnaCnng34190D [Brassica napus]
Length=421

 Score =   404 bits (1039),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 206/317 (65%), Positives = 248/317 (78%), Gaps = 7/317 (2%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL++ L  P    H++ +EELLWRASM+PKI   PF R PKVAFMFLT+G LPLAPLWE
Sbjct  106   IGLEQFLRPPKKIMHDMEEEELLWRASMTPKIKNYPFPRTPKVAFMFLTKGHLPLAPLWE  165

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FFRG+ GLFSIYVHS  PSYN+T+P  SVFHGR IPSK V+WG  NM+EAE+RLLANAL
Sbjct  166   RFFRGHEGLFSIYVHSY-PSYNQTDPEGSVFHGRLIPSKRVDWGYVNMVEAEQRLLANAL  224

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SNERF+LLSE+CIPLFNF+T+YSY+  S +T +E YD    VGRGRYS +M P I+L
Sbjct  225   LDISNERFVLLSESCIPLFNFTTVYSYLTKSTQTHVESYDELSGVGRGRYSPEMKPRIQL  284

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIK--LGQGNS  436
               WRKGSQWFE+DR +ALE+ISD+ Y+PLF  YC   CY+DEHY+PTL+NIK  LG+ NS
Sbjct  285   RHWRKGSQWFELDRAMALEIISDKIYWPLFYRYCHHGCYTDEHYIPTLLNIKSSLGRRNS  344

Query  435   NRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNG----NTCEYNGEKTTMCHLFARKFT  268
             NRTLTWVDW+KGGPHP +F R +VT +FL KLR+G      C +NGEKT +C+LFARKF 
Sbjct  345   NRTLTWVDWSKGGPHPNRFIRYEVTEEFLLKLRSGGEENRQCYHNGEKTNICYLFARKFL  404

Query  267   LHALSRLLILAPKLMQF  217
               AL RLL LAP ++ F
Sbjct  405   PTALGRLLRLAPTVLYF  421



>emb|CDX81507.1| BnaC02g18110D [Brassica napus]
Length=410

 Score =   404 bits (1038),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 208/317 (66%), Positives = 245/317 (77%), Gaps = 7/317 (2%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLK  L +P    H++ DEELLWRASM+PKI   PF R PKVAFMFLT+G LPLAPLWE
Sbjct  95    VGLKVFLRSPKKIMHDMEDEELLWRASMAPKIRSYPFYRTPKVAFMFLTKGYLPLAPLWE  154

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FFRG+  LF+IYVHS  PS NE+ P  SVFHGR+IPSK VEWG  NM+EAE+RLLANAL
Sbjct  155   KFFRGHEDLFNIYVHSY-PSNNESYPEGSVFHGRQIPSKRVEWGYVNMVEAEQRLLANAL  213

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SNERF+LLSE+CIPLFNF+T+YSY+  S +T +E YD  G VGRGRYS +M P ++L
Sbjct  214   LDISNERFVLLSESCIPLFNFTTVYSYLTTSTQTHVESYDQLGGVGRGRYSPEMKPGVQL  273

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIK--LGQGNS  436
               WRKGSQWFE+DR +ALE+ISD TY+PLF  YC   CY+DEHY+PTL+NIK  LG+ NS
Sbjct  274   RHWRKGSQWFELDRAMALEIISDTTYWPLFYRYCHHGCYADEHYIPTLLNIKSSLGRRNS  333

Query  435   NRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNG----NTCEYNGEKTTMCHLFARKFT  268
             NRTLTWVDW  GGPHPT+F R +VT + L KLRNG      C +NGEKT +C+LFARKF 
Sbjct  334   NRTLTWVDWRNGGPHPTRFIRYEVTEELLVKLRNGGGENRQCYHNGEKTNVCYLFARKFL  393

Query  267   LHALSRLLILAPKLMQF  217
               AL RLL LAP ++ F
Sbjct  394   PTALGRLLRLAPSVLYF  410



>ref|XP_009589451.1| PREDICTED: uncharacterized protein LOC104086812 [Nicotiana tomentosiformis]
Length=421

 Score =   404 bits (1038),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/312 (63%), Positives = 246/312 (79%), Gaps = 3/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLK+ +  PP A H+++DEEL+WRASM PK+   PF+R PK+AFMFL RG+LPLAPLWE
Sbjct  111   IGLKDYI-KPPEAMHDMNDEELIWRASMVPKVRNFPFKRTPKIAFMFLARGSLPLAPLWE  169

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllana  793
              FF+GN G +SIY+HS  PS+    P E  +FHGRR+PSK V+WG+ +M+EAERRLLANA
Sbjct  170   RFFKGNEGRYSIYIHS-QPSFKGIAPEEGPIFHGRRVPSKRVDWGEFSMVEAERRLLANA  228

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SNERF+LLSEACIPL+NF+TIY+Y+MNS +TF+E YD  GPVGRGRY+SQM P + 
Sbjct  229   LLDMSNERFVLLSEACIPLYNFTTIYTYIMNSTKTFVESYDEWGPVGRGRYNSQMTPWVT  288

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             +  WRKGSQWFE+DR +A++VI+D  YF LF+ +C   CYSDEHYLPT + ++    N N
Sbjct  289   IEQWRKGSQWFELDREIAVDVITDPKYFNLFKEFCRPACYSDEHYLPTFVTMRYWWKNGN  348

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             RTLTWVDW KGGPHPTKF R +VT + LN++R+G  CEYNGE T+MC+LFARKF    L 
Sbjct  349   RTLTWVDWTKGGPHPTKFARTEVTKELLNQMRSGIQCEYNGEPTSMCYLFARKFLPSTLD  408

Query  252   RLLILAPKLMQF  217
             RLL  APK+M F
Sbjct  409   RLLKFAPKVMMF  420



>ref|XP_009413609.1| PREDICTED: uncharacterized protein LOC103994882 [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   402 bits (1034),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 196/312 (63%), Positives = 243/312 (78%), Gaps = 3/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLKE +  P    H+++DEELLWRASM PKI + PF R PKVAF+FLT+G LPLAPLWE
Sbjct  85    IGLKEFV-EPDVILHDMTDEELLWRASMIPKIQKRPFSRPPKVAFLFLTKGHLPLAPLWE  143

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF GN G +SIYVH+S    N + P  SVFHGRR+PSK V+WG  NM+EAERRLLANAL
Sbjct  144   KFFEGNEGFYSIYVHASP--LNGSAPKGSVFHGRRVPSKAVQWGGMNMMEAERRLLANAL  201

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SN+RF+LLSEACIPLFNF TIYSY++NS + +++ YDLPGP GRGRY  +M P++KL
Sbjct  202   LDVSNQRFVLLSEACIPLFNFPTIYSYLINSTKIYVQAYDLPGPTGRGRYMKKMKPLLKL  261

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
               WRKGSQWFE+DR LA+EVISD  YFPLFQ +CT  C++DEHYL T ++++     +NR
Sbjct  262   EQWRKGSQWFEVDRSLAIEVISDDEYFPLFQRHCTSSCFADEHYLATHVSVRFPGRTANR  321

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW+KGGPHP +F R DVTV+ L ++RNG++C YNG  T +C LFARKF  ++L R
Sbjct  322   SLTWVDWSKGGPHPARFLRRDVTVELLERMRNGSSCRYNGRSTRICFLFARKFLPNSLVR  381

Query  249   LLILAPKLMQFN  214
             L+  APKLM F 
Sbjct  382   LMRFAPKLMDFK  393



>gb|ACU18543.1| unknown [Glycine max]
Length=415

 Score =   403 bits (1035),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 202/311 (65%), Positives = 243/311 (78%), Gaps = 3/311 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLK  L  PP   H++ DEE+LWRASM+ KI + PF RVPKVAFMFLTRG + LAPLWE
Sbjct  108   VGLKGFLKPPP-VVHDMDDEEMLWRASMTAKIPDYPFDRVPKVAFMFLTRGPVFLAPLWE  166

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ G +SIYVHS +PSYN + P   VF GRRIPSK VEWG  N IEAERRLLANAL
Sbjct  167   QFFKGHEGFYSIYVHS-NPSYNGSRPESPVFKGRRIPSKEVEWGNVNTIEAERRLLANAL  225

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             +D SN+RF+LLSE+CIPLFNFSTIY+Y+MNS + ++  +D P  VGRGRYS QM P I L
Sbjct  226   VDISNQRFVLLSESCIPLFNFSTIYTYLMNSTQNYVMAFDDPSSVGRGRYSIQMLPEISL  285

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             N WRKGSQWFEMDR LALEV+SD+ YFP+FQ  C G CY+DEHYLPT ++IK  +GNSNR
Sbjct  286   NQWRKGSQWFEMDRDLALEVVSDRKYFPVFQDCCKGSCYADEHYLPTYVSIKFWEGNSNR  345

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW+KGGPHPTKF R+++TV FL  LR+   CEYNG+   +C LFARKF   ++S+
Sbjct  346   SLTWVDWSKGGPHPTKFLRSEITVKFLESLRD-QKCEYNGDSINVCFLFARKFAPGSVSK  404

Query  249   LLILAPKLMQF  217
             L  +AP +M F
Sbjct  405   LTKIAPMVMHF  415



>ref|XP_003535134.1| PREDICTED: uncharacterized protein LOC100811590 [Glycine max]
Length=437

 Score =   404 bits (1037),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 246/312 (79%), Gaps = 4/312 (1%)
 Frame = -3

Query  1152  VVGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLW  973
             V  +KE +  P    H++SDEELLWRASM+PKI E PF RV KVAFMFL RG +PLA  W
Sbjct  127   VHNMKEFI-HPSNVVHDMSDEELLWRASMTPKIREYPFDRVAKVAFMFLVRGPVPLAIFW  185

Query  972   EMFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllana  793
             E FF+G+ G +SIYVHS +PSYN ++P  SVFHGRRIPSK VEWGK NMIEAERRLLANA
Sbjct  186   ERFFKGHEGYYSIYVHS-NPSYNGSDPESSVFHGRRIPSKIVEWGKFNMIEAERRLLANA  244

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLDFSN+RFIL+SE+CIPLFNFSTIYSY+MNS ++++  YD    VGRGRY+ +M+P++ 
Sbjct  245   LLDFSNQRFILISESCIPLFNFSTIYSYLMNSTQSYVMAYDEDSLVGRGRYNPRMSPMVT  304

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             L  WRKGSQWFEMDR LALEV+SD+TYFP+FQ +CT PCY+DEHYLPT +NI   + NSN
Sbjct  305   LKQWRKGSQWFEMDRELALEVVSDKTYFPIFQEHCTRPCYADEHYLPTFVNIMFPEKNSN  364

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEK-TTMCHLFARKFTLHAL  256
             R+LTWVDW+KGG HPTK+ R +VTV FL  LRN   CEYNG+  T  C LFARKF   +L
Sbjct  365   RSLTWVDWSKGGLHPTKYVRPEVTVAFLENLRN-QKCEYNGQAYTNACFLFARKFLPTSL  423

Query  255   SRLLILAPKLMQ  220
             +RL+  +P +M 
Sbjct  424   TRLMRFSPSVMH  435



>ref|XP_004299046.1| PREDICTED: uncharacterized protein LOC101307491 [Fragaria vesca 
subsp. vesca]
Length=402

 Score =   402 bits (1033),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 202/313 (65%), Positives = 245/313 (78%), Gaps = 3/313 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL++ L  PP   H++ D+ELLWRAS++P+I E PF RVPKVAF+FLT+G + LAPLWE
Sbjct  91    IGLEKFL-KPPMILHDMDDDELLWRASLAPRISEYPFHRVPKVAFLFLTKGPVYLAPLWE  149

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ GL+SIYVHS +PSYN + P   VF GRRIPS+ VEWG  NMIEAERRLLANAL
Sbjct  150   TFFKGHRGLYSIYVHS-NPSYNGSHPESPVFQGRRIPSQEVEWGNVNMIEAERRLLANAL  208

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SNERF+LLSE+CIPL NF+TIY +++NSN++F+EVYD P  VGRGRY+S M P I L
Sbjct  209   LDISNERFVLLSESCIPLHNFNTIYHHLVNSNKSFVEVYDDPSSVGRGRYNSHMYPRITL  268

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKGSQWFEM+R LA+EV++D+ YFPLF+ YC G CY+DEHYLPT + +K    NSN+
Sbjct  269   SQWRKGSQWFEMNRDLAIEVVADKKYFPLFKKYCRGSCYADEHYLPTFVQMKFAAKNSNK  328

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTC-EYNGEKTTMCHLFARKFTLHALS  253
             TLTW D++KGGPHP  FTR DVTVD LN LRNG  C +Y     T  HLFARKFT   L 
Sbjct  329   TLTWYDFSKGGPHPATFTRTDVTVDMLNSLRNGTKCLDYLMTGNTCHHLFARKFTPGTLE  388

Query  252   RLLILAPKLMQFN  214
             RL+  APKLMQFN
Sbjct  389   RLMRFAPKLMQFN  401



>ref|XP_010916432.1| PREDICTED: uncharacterized protein LOC105041249 [Elaeis guineensis]
Length=399

 Score =   402 bits (1032),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 193/312 (62%), Positives = 251/312 (80%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLK  +  P    H+++DEELLWRASM P+I   P+RRVPKVAF+FLTRG L  +PLWE
Sbjct  89    VGLKGYV-EPIKVMHDMTDEELLWRASMVPRIKSHPYRRVPKVAFLFLTRGPLAFSPLWE  147

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
             MFF+G+ G +SIYVH+ DPS+NE+ P  SVFHGRR+PSK V+WG+ +M+EAERRLLANAL
Sbjct  148   MFFKGHEGFYSIYVHA-DPSFNESAPEGSVFHGRRVPSKVVKWGQLSMMEAERRLLANAL  206

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD+SN+RFILLSE+CIPLFNFSTIYSY++NS +T++  YD PGP GRGRY+ +M P +KL
Sbjct  207   LDYSNQRFILLSESCIPLFNFSTIYSYLINSTQTYVSSYDDPGPNGRGRYNIRMKPRVKL  266

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
              +WRKGSQWFE+DR LA+E+ISD+ YFP+F+ YC   CY DEHYL T ++++    N+NR
Sbjct  267   QEWRKGSQWFEVDRALAIEIISDEKYFPVFKKYCRPSCYVDEHYLSTFVSMRFWWRNANR  326

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW+KGGPHP +F R DVT + L ++RNG+TC YNG  T++C LFARKF  ++L+R
Sbjct  327   SLTWVDWSKGGPHPARFGRLDVTTELLERMRNGSTCNYNGRTTSVCFLFARKFLPNSLTR  386

Query  249   LLILAPKLMQFN  214
             L+  AP+++ F 
Sbjct  387   LMRFAPRVLGFQ  398



>ref|XP_003610779.1| hypothetical protein MTR_5g006920 [Medicago truncatula]
 gb|AES93737.1| core-2/I-branching enzyme [Medicago truncatula]
Length=422

 Score =   402 bits (1033),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 201/312 (64%), Positives = 252/312 (81%), Gaps = 3/312 (1%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL+ELL  P  A H+++++EL WRAS++P I + PF++ PKVAFMFLT+G + LAPLWE 
Sbjct  113   GLEELLKIP-KAMHDMNEDELFWRASLAPMIHKTPFKQTPKVAFMFLTKGPVLLAPLWEK  171

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllanal  790
             FF+GN GL+SIYVH S PS+NET   +S VFHGRRIPSK V+WG+ +MIEAERRLLANAL
Sbjct  172   FFKGNEGLYSIYVHPS-PSFNETVYNQSLVFHGRRIPSKKVKWGENSMIEAERRLLANAL  230

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+RF+LLSE CIPLFNF TIY+Y+M S +TF+E  D+PG VGR RY+ +M P+I+L
Sbjct  231   LDFSNQRFVLLSEHCIPLFNFFTIYTYLMKSKQTFVEANDIPGRVGRVRYNRRMCPLIQL  290

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             + WRKG+QWF++DR LA+ ++SD+ YF +F+ YC   C SDEHYLPTL++IK  + NSNR
Sbjct  291   SQWRKGAQWFQIDRYLAVRIVSDKPYFSMFKKYCHPRCISDEHYLPTLVSIKFWKRNSNR  350

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             TLTWVDW+KGG HP KF+  DVT+DFL +LR G+TCEYNG+ T +CHLFARKF   AL  
Sbjct  351   TLTWVDWSKGGAHPAKFSSKDVTIDFLERLRFGSTCEYNGKTTNVCHLFARKFGTQALDG  410

Query  249   LLILAPKLMQFN  214
             LL  APKLMQFN
Sbjct  411   LLTFAPKLMQFN  422



>ref|XP_009127627.1| PREDICTED: uncharacterized protein LOC103852476 [Brassica rapa]
 emb|CDY44904.1| BnaA02g13780D [Brassica napus]
Length=410

 Score =   401 bits (1031),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 206/317 (65%), Positives = 245/317 (77%), Gaps = 7/317 (2%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLK  L +P    H++ DEELLWRASM+PKI   PF R PKVAFMFLT+G LPLAPLWE
Sbjct  95    VGLKGFLRSPKKIMHDMEDEELLWRASMAPKIRSYPFYRTPKVAFMFLTKGHLPLAPLWE  154

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+  LF+IYVHS  PS NE+ P  SVFHGR+IPSK V+WG  NM+EAE+RLLANAL
Sbjct  155   KFFKGHEELFNIYVHSY-PSNNESYPEGSVFHGRQIPSKRVDWGYVNMVEAEQRLLANAL  213

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SNERF+LLSE+CIPLFNF+T+YSY+  S +T +E YD  G VGRGRYS +M P ++L
Sbjct  214   LDISNERFVLLSESCIPLFNFTTVYSYLTTSTQTHVESYDQLGGVGRGRYSPEMKPRVQL  273

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIK--LGQGNS  436
               WRKGSQWFE+DR +ALE+ISD TY+PLF  YC   CY+DEHY+PTL+NIK  LG  NS
Sbjct  274   RHWRKGSQWFELDRAMALEIISDTTYWPLFYRYCHHGCYADEHYIPTLLNIKSSLGGRNS  333

Query  435   NRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGN----TCEYNGEKTTMCHLFARKFT  268
             NRTLTWVDW  GGPHPT+F R +VT + L KLRNG+     C +NGEKT +C+LFARKF 
Sbjct  334   NRTLTWVDWTNGGPHPTRFIRYEVTEELLVKLRNGDDKNRQCYHNGEKTNVCYLFARKFL  393

Query  267   LHALSRLLILAPKLMQF  217
               AL RLL LAP ++ F
Sbjct  394   PTALGRLLRLAPSVLYF  410



>ref|XP_002887179.1| hypothetical protein ARALYDRAFT_475958 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63438.1| hypothetical protein ARALYDRAFT_475958 [Arabidopsis lyrata subsp. 
lyrata]
Length=405

 Score =   401 bits (1030),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 246/312 (79%), Gaps = 3/312 (1%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL+  +  P    H++ DEELLWRASM+PKI   PF R PKVAFMF+T+G LPLA LWE 
Sbjct  95    GLERFIKPPEKLMHDMEDEELLWRASMAPKIKNYPFPRTPKVAFMFMTKGHLPLARLWER  154

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FFRG+  LF+IYVHS  PSYN+++P +SVFHGR IPSK V+WG  NM+EAE+RLLANALL
Sbjct  155   FFRGHEHLFTIYVHSY-PSYNQSDPEDSVFHGRHIPSKRVDWGYVNMVEAEQRLLANALL  213

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNERF+LLSE+CIPLFNF+T+YSY++NS +T +E YD  G VGRGRYS  M P ++L+
Sbjct  214   DISNERFVLLSESCIPLFNFTTVYSYLINSTQTHVESYDQLGGVGRGRYSPLMQPHVQLH  273

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIK--LGQGNSN  433
              WRKGSQWFE+DR +ALE+ISD+ Y+PLF SYC   CY+DEHY+PTL+NIK  L   NSN
Sbjct  274   HWRKGSQWFEVDRDMALEIISDRIYWPLFYSYCHHGCYADEHYIPTLLNIKSSLNHRNSN  333

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             RTLTWVDW+KGGPHP +F R++VT +F+  LR+G  C YNGE+T +C+LFARKF   AL 
Sbjct  334   RTLTWVDWSKGGPHPNRFIRHEVTAEFMENLRSGGECLYNGEETNICYLFARKFLPTALD  393

Query  252   RLLILAPKLMQF  217
             RLL L+  ++ F
Sbjct  394   RLLRLSRTVLYF  405



>ref|XP_010470788.1| PREDICTED: uncharacterized protein LOC104750657 isoform X2 [Camelina 
sativa]
Length=416

 Score =   401 bits (1031),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 199/312 (64%), Positives = 245/312 (79%), Gaps = 3/312 (1%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL+  +  P    H++ DEELLWRASM PKI   PF R PKVAFMF+T+G LPLA LWE 
Sbjct  106   GLEHFIKPPEKLMHDMEDEELLWRASMEPKIKSYPFPRTPKVAFMFMTKGHLPLARLWER  165

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FFRG+ G FSIYVHS  PSYN+++P  SVFHGR IPSK V+WG  NM+EAE+RLLANALL
Sbjct  166   FFRGHEGHFSIYVHSY-PSYNQSDPENSVFHGRHIPSKRVDWGYVNMVEAEQRLLANALL  224

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNERF+LLSE+CIPLFNF+T+YSY++NS +T +E YD  G VGRGRYS  M P ++L+
Sbjct  225   DLSNERFVLLSESCIPLFNFTTVYSYLINSTQTHVESYDQLGGVGRGRYSPLMQPHVQLH  284

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIK--LGQGNSN  433
              WRKGSQWFEMDR +ALE+ISD+ Y+PLF S+C   CY+DEHY+PTL+NIK  L + NSN
Sbjct  285   HWRKGSQWFEMDRAMALEIISDRIYWPLFYSFCHHGCYADEHYIPTLLNIKSSLKRRNSN  344

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             RTLTWVDW+KGGPHP +F R++VT +F+  LR+G  C YNGE+T +C+LFARKF   AL 
Sbjct  345   RTLTWVDWSKGGPHPNRFIRHEVTAEFMENLRSGGQCLYNGEETNVCYLFARKFLPTALD  404

Query  252   RLLILAPKLMQF  217
             RLL L+  ++ F
Sbjct  405   RLLRLSRTVLYF  416



>ref|XP_010415458.1| PREDICTED: uncharacterized protein LOC104701464 [Camelina sativa]
Length=412

 Score =   401 bits (1031),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 199/312 (64%), Positives = 245/312 (79%), Gaps = 3/312 (1%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL+  +  P    H++ DEELLWRASM+PKI   PF R+PKVAFMF+T+G LPLA LWE 
Sbjct  102   GLENFIKPPEKLMHDMEDEELLWRASMAPKIKSYPFPRIPKVAFMFMTKGHLPLARLWER  161

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FFRG+ GLFSIYVHS  PSYN+++P  SVFHGR IPSK V+WG  NM+EAE+RLLANALL
Sbjct  162   FFRGHEGLFSIYVHSY-PSYNQSDPENSVFHGRHIPSKRVDWGYVNMVEAEQRLLANALL  220

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNERF+LLSE+CIPLFNF+T+YSY++NS  T +E YD  G VGRGRYS  M P ++L+
Sbjct  221   DISNERFVLLSESCIPLFNFTTVYSYLINSTHTHVESYDQLGGVGRGRYSPLMQPHVQLH  280

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIK--LGQGNSN  433
              WRKGSQWFEMDR +ALE+ISD+ Y+PLF SYC   CY+DEHY+PTL+NIK  L + NS 
Sbjct  281   HWRKGSQWFEMDRAMALEIISDRIYWPLFYSYCHHGCYADEHYIPTLLNIKSGLNRRNSK  340

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             RTLTWVDW+KGGPHP +F R++VT +F+  LR+G  C YNG+ T +C+LFARKF   AL 
Sbjct  341   RTLTWVDWSKGGPHPNRFIRHEVTAEFMETLRSGGQCLYNGKVTNICYLFARKFLPTALD  400

Query  252   RLLILAPKLMQF  217
             RLL L+  ++ F
Sbjct  401   RLLRLSRTVLYF  412



>emb|CBI26988.3| unnamed protein product [Vitis vinifera]
Length=311

 Score =   397 bits (1021),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 233/291 (80%), Gaps = 1/291 (0%)
 Frame = -3

Query  1101  LSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHS  922
             + DEEL WRASM+P+I E PF+RVPKVAFMFLT+G LPLAPLWE+FF+G+ GL+SIYVHS
Sbjct  1     MDDEELPWRASMAPQIREFPFKRVPKVAFMFLTKGPLPLAPLWELFFKGHEGLYSIYVHS  60

Query  921   SDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEACI  742
               PS+NETEP  SVFH RRIPSK V+WGK NMIEAERRLLANALLDFSN  F+LLSE+CI
Sbjct  61    -HPSFNETEPENSVFHDRRIPSKEVQWGKFNMIEAERRLLANALLDFSNYHFVLLSESCI  119

Query  741   PLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRL  562
             PLFNFSTIYSY+MNS   +++ YD PGPVGRGRY  QM P I +  WRKGSQWF +DR L
Sbjct  120   PLFNFSTIYSYLMNSTRNYVQTYDFPGPVGRGRYKEQMYPTITIEQWRKGSQWFAVDRNL  179

Query  561   ALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTK  382
             A E+ISDQTYFP+FQ +C   CY+DEHYLPT + IK  + ++NR+LTWVDW++GG HP +
Sbjct  180   ATEIISDQTYFPIFQKHCKSSCYADEHYLPTFVGIKFWERSANRSLTWVDWSRGGAHPAR  239

Query  381   FTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPK  229
             F R DVT++ L +LR+   C+YNG+ T +C LFARK    AL RLL  APK
Sbjct  240   FMRWDVTIESLKRLRSEGRCDYNGKSTNICFLFARKVMPSALERLLRFAPK  290



>ref|XP_009768969.1| PREDICTED: uncharacterized protein LOC104219898 [Nicotiana sylvestris]
Length=421

 Score =   401 bits (1031),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/312 (63%), Positives = 246/312 (79%), Gaps = 3/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL + +  PP A H+++DEEL+WRASM PK+   PF+R PK+AFMFL RG+LPLAPLWE
Sbjct  111   IGLTDYI-KPPEAMHDMNDEELIWRASMVPKVRNFPFKRTPKIAFMFLARGSLPLAPLWE  169

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllana  793
              FF+GN G +SIY+HS  PS+N   P E  +FHGRR+PSK V+WG+ +M+EAERRLLANA
Sbjct  170   RFFKGNEGRYSIYIHS-QPSFNGIAPEEGPIFHGRRVPSKRVDWGEFSMVEAERRLLANA  228

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SNERF+LLSEACIPL+NF+ IY+Y+MNS +TF+E YD  GPVGRGRY+SQM P + 
Sbjct  229   LLDMSNERFVLLSEACIPLYNFTAIYTYIMNSTKTFVESYDEWGPVGRGRYNSQMTPWVT  288

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             +  WRKGSQWFE+DR +A++VI++  YF LF+ +C   CYSDEHYLPT + ++    N N
Sbjct  289   IEQWRKGSQWFELDREIAVDVITEPKYFNLFKEFCRPACYSDEHYLPTFVTMRYWWKNGN  348

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             RTLTWVDW KGGPHPTKF R +VT + LN++R+G  CEYNGE T+MC+LFARKF   +L 
Sbjct  349   RTLTWVDWTKGGPHPTKFARTEVTKELLNQMRSGIQCEYNGEPTSMCYLFARKFLPSSLD  408

Query  252   RLLILAPKLMQF  217
             RLL  APK+M F
Sbjct  409   RLLKFAPKVMMF  420



>ref|XP_010470787.1| PREDICTED: uncharacterized protein LOC104750657 isoform X1 [Camelina 
sativa]
Length=465

 Score =   402 bits (1034),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 199/312 (64%), Positives = 245/312 (79%), Gaps = 3/312 (1%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL+  +  P    H++ DEELLWRASM PKI   PF R PKVAFMF+T+G LPLA LWE 
Sbjct  155   GLEHFIKPPEKLMHDMEDEELLWRASMEPKIKSYPFPRTPKVAFMFMTKGHLPLARLWER  214

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FFRG+ G FSIYVHS  PSYN+++P  SVFHGR IPSK V+WG  NM+EAE+RLLANALL
Sbjct  215   FFRGHEGHFSIYVHSY-PSYNQSDPENSVFHGRHIPSKRVDWGYVNMVEAEQRLLANALL  273

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNERF+LLSE+CIPLFNF+T+YSY++NS +T +E YD  G VGRGRYS  M P ++L+
Sbjct  274   DLSNERFVLLSESCIPLFNFTTVYSYLINSTQTHVESYDQLGGVGRGRYSPLMQPHVQLH  333

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIK--LGQGNSN  433
              WRKGSQWFEMDR +ALE+ISD+ Y+PLF S+C   CY+DEHY+PTL+NIK  L + NSN
Sbjct  334   HWRKGSQWFEMDRAMALEIISDRIYWPLFYSFCHHGCYADEHYIPTLLNIKSSLKRRNSN  393

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             RTLTWVDW+KGGPHP +F R++VT +F+  LR+G  C YNGE+T +C+LFARKF   AL 
Sbjct  394   RTLTWVDWSKGGPHPNRFIRHEVTAEFMENLRSGGQCLYNGEETNVCYLFARKFLPTALD  453

Query  252   RLLILAPKLMQF  217
             RLL L+  ++ F
Sbjct  454   RLLRLSRTVLYF  465



>ref|NP_177006.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AAF26043.1|AC015986_6 hypothetical protein; 24280-21634 [Arabidopsis thaliana]
 gb|AAU44423.1| hypothetical protein AT1G68390 [Arabidopsis thaliana]
 gb|AAX23796.1| hypothetical protein At1g68390 [Arabidopsis thaliana]
 gb|AEE34788.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
Length=408

 Score =   400 bits (1027),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 245/312 (79%), Gaps = 3/312 (1%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GLK  +  P    H++ DEELLWRASM+PKI   PF R PKVAFMF+T+G LPLA LWE 
Sbjct  98    GLKSFIEPPEKLMHDMEDEELLWRASMAPKIKNYPFPRTPKVAFMFMTKGHLPLARLWER  157

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FFRG+ GLF+IYVHS  PSYN+++P +SVF GR IPSK V+WG  NM+EAE+RLLANALL
Sbjct  158   FFRGHEGLFTIYVHSY-PSYNQSDPEDSVFRGRHIPSKRVDWGYVNMVEAEQRLLANALL  216

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNERF+LLSE+CIPLFNF+T+YSY++NS +T +E YD  G VGRGRYS  M P ++L 
Sbjct  217   DISNERFVLLSESCIPLFNFTTVYSYLINSTQTHVESYDQLGGVGRGRYSPLMQPHVQLR  276

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIK--LGQGNSN  433
              WRKGSQW E+DR +ALE+ISD+ Y+PLF SYC   CY+DEHY+PTL+NIK  L + NSN
Sbjct  277   HWRKGSQWIEVDRAMALEIISDRIYWPLFYSYCHHGCYADEHYIPTLLNIKSSLKRRNSN  336

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             RTLTWVDW+KGGPHP +F R++VT +F+  LR+G  C YNGE+T +C+LFARKF   AL 
Sbjct  337   RTLTWVDWSKGGPHPNRFIRHEVTAEFMENLRSGGECLYNGEETNICYLFARKFLPTALD  396

Query  252   RLLILAPKLMQF  217
             RLL L+  ++ F
Sbjct  397   RLLRLSRTVLHF  408



>gb|AHL38887.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=408

 Score =   399 bits (1025),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 244/312 (78%), Gaps = 3/312 (1%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GLK  +  P    H++ DEELLWRASM+PKI   PF R PKVAFMF+T+G LPLA LWE 
Sbjct  98    GLKSFIEPPEKLMHDMEDEELLWRASMAPKIKNYPFPRTPKVAFMFMTKGHLPLARLWER  157

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FFRG+ GLF+IYVHS  PSYN+++P +SVF GR IPSK V+WG  NM+EAE+RLLANALL
Sbjct  158   FFRGHEGLFTIYVHSY-PSYNQSDPEDSVFRGRHIPSKRVDWGYVNMVEAEQRLLANALL  216

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNERF+LLSE+CIPLFNF+T+YSY++NS +T +E YD  G VGRGRYS  M P ++L 
Sbjct  217   DISNERFVLLSESCIPLFNFTTVYSYLINSTQTHVESYDQLGGVGRGRYSPLMQPHVQLR  276

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIK--LGQGNSN  433
              WRKGSQW E DR +ALE+ISD+ Y+PLF SYC   CY+DEHY+PTL+NIK  L + NSN
Sbjct  277   HWRKGSQWIEADRAMALEIISDRIYWPLFYSYCHHGCYADEHYIPTLLNIKSSLKRRNSN  336

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             RTLTWVDW+KGGPHP +F R++VT +F+  LR+G  C YNGE+T +C+LFARKF   AL 
Sbjct  337   RTLTWVDWSKGGPHPNRFIRHEVTAEFMENLRSGGECLYNGEETNICYLFARKFLPTALD  396

Query  252   RLLILAPKLMQF  217
             RLL L+  ++ F
Sbjct  397   RLLRLSRTVLHF  408



>ref|XP_008812373.1| PREDICTED: uncharacterized protein LOC103723273 [Phoenix dactylifera]
Length=406

 Score =   399 bits (1024),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/305 (63%), Positives = 247/305 (81%), Gaps = 1/305 (0%)
 Frame = -3

Query  1128  MAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNA  949
             + P  A H+++DEELLWRASM P+I   PF RVPKVAF+FLTRG L  +PLWE FF+G+ 
Sbjct  102   VEPIEAMHDMTDEELLWRASMVPRIKNHPFHRVPKVAFLFLTRGPLAFSPLWEKFFKGHE  161

Query  948   GLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNER  769
             GL++IYVH+ DPS+NE+ P  SVFHGRR+PSK V+WG+ +M+EAERRLLANALLDFSN+R
Sbjct  162   GLYTIYVHA-DPSFNESAPEGSVFHGRRVPSKVVKWGQLSMMEAERRLLANALLDFSNQR  220

Query  768   FILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGS  589
             FILLSE+CIPLFNFSTIYSY++NS +T++  +D  GP GRGRY+ +M P +KL +WRKGS
Sbjct  221   FILLSESCIPLFNFSTIYSYLINSTKTYVSSFDDRGPNGRGRYNIRMKPQVKLQEWRKGS  280

Query  588   QWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDW  409
             QW E+DR LA+E+ISD+ YFP+F+ YC   CY DEHYLPT ++++    NSNR+LTWVDW
Sbjct  281   QWLEVDRDLAIEIISDEKYFPVFKKYCKRSCYVDEHYLPTFVSMRFWWSNSNRSLTWVDW  340

Query  408   AKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPK  229
             +KGGPHP +F R DVT++ L ++RNG+TC+YNG  T +C LFARKF  ++L+RL+  APK
Sbjct  341   SKGGPHPARFGRLDVTIELLERMRNGSTCKYNGRTTNVCFLFARKFLPNSLTRLMRFAPK  400

Query  228   LMQFN  214
             +M F 
Sbjct  401   VMGFQ  405



>ref|XP_007036567.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein, putative [Theobroma cacao]
 gb|EOY21068.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein, putative [Theobroma cacao]
Length=429

 Score =   399 bits (1025),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/309 (62%), Positives = 243/309 (79%), Gaps = 2/309 (1%)
 Frame = -3

Query  1143  LKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMF  964
             ++E    P    H++ D+EL WRASM+PKI E P  RVPK+AF+FLTRG + LAP+WE F
Sbjct  123   IEEFFQPPEITMHDMKDKELFWRASMAPKIQEYPIERVPKLAFLFLTRGKVLLAPIWEKF  182

Query  963   FRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLD  784
             F+G+ GL+SIYVHSS PS+NET P  SVF+GR+IPSK V WG+ NM+ AERRLLANALLD
Sbjct  183   FQGHQGLYSIYVHSS-PSFNETVPQGSVFYGRQIPSKNVSWGEMNMVAAERRLLANALLD  241

Query  783   FSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLND  604
              SNERF+L+SE+CIPLFNF+TIY Y+++S ++ +E +D+PGPVGRGRYSS+M P++ +  
Sbjct  242   ISNERFVLVSESCIPLFNFTTIYKYLIHSEKSHVESFDVPGPVGRGRYSSEMEPVVTIEQ  301

Query  603   WRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTL  424
             WRKGSQWFEMDR LA+EVISDQTYFP+F  +C   CY DEHYLPT + I   + N NRTL
Sbjct  302   WRKGSQWFEMDRFLAIEVISDQTYFPVFNLFCKDACYGDEHYLPTFVGINFLERNLNRTL  361

Query  423   TWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLL  244
             T+VDW+KGGPHP  F  +DVT +FL KLRN ++C YNGEK  +C+LFARKF  + L RLL
Sbjct  362   TYVDWSKGGPHPYTFESSDVTKEFLEKLRN-SSCYYNGEKADICYLFARKFAANTLDRLL  420

Query  243   ILAPKLMQF  217
               AP++M F
Sbjct  421   SFAPEVMYF  429



>ref|XP_006341708.1| PREDICTED: uncharacterized protein LOC102599552 [Solanum tuberosum]
Length=414

 Score =   398 bits (1023),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 196/314 (62%), Positives = 244/314 (78%), Gaps = 4/314 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAA--HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPL  976
             +GLK+ +  P  +   H++ DEEL+ RA M P++ ++PF+R PK+AFMFL RG+LPLAPL
Sbjct  101   IGLKDFMKIPKLSTPKHDMKDEELISRAMMVPRVSDLPFKRKPKIAFMFLARGSLPLAPL  160

Query  975   WEMFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrlla  799
             WE FF+G+ GL+SIY+HS  PS+N T P E  +FHGRR+ SK VEWGK NM+EAERRLLA
Sbjct  161   WERFFQGHEGLYSIYIHS-QPSFNGTAPQEGPIFHGRRVASKKVEWGKFNMVEAERRLLA  219

Query  798   nalLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPI  619
             NALLD SNERF+LLSE+CIPL+NF+TIY+Y++NS  TF+E YDL  PVGRGRYS +M P+
Sbjct  220   NALLDLSNERFVLLSESCIPLYNFTTIYNYIINSANTFMESYDLISPVGRGRYSKKMKPL  279

Query  618   IKLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGN  439
             + L  WRKGSQWFE+DR +A+++ISDQ Y  LF+ +C   CYSDEHYLPT + +K    N
Sbjct  280   VTLAQWRKGSQWFEVDREIAMDIISDQKYSHLFKRFCRPACYSDEHYLPTFVTMKYWWKN  339

Query  438   SNRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHA  259
              NRTLTWVDWAKGGPHPTKF R +VT D LN +RNG  CEYNG  + MC+LFARKF    
Sbjct  340   ENRTLTWVDWAKGGPHPTKFIRPEVTEDLLNGMRNGTKCEYNGRPSNMCYLFARKFLPST  399

Query  258   LSRLLILAPKLMQF  217
             L RLL  APK+M+F
Sbjct  400   LDRLLRFAPKIMKF  413



>ref|XP_010926004.1| PREDICTED: uncharacterized protein LOC105048408 [Elaeis guineensis]
Length=407

 Score =   398 bits (1022),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 196/309 (63%), Positives = 246/309 (80%), Gaps = 2/309 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLK  +  P  A H+++DEELLWRASM P+I   PF RVPKVAF+FLTR AL  APLWE
Sbjct  97    VGLKGYV-EPVEAMHDMTDEELLWRASMVPRIKGYPFDRVPKVAFLFLTRKALHFAPLWE  155

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ GL+SIYVH+ DPS+NE+ P  SVFHGRR+PSK V+WG+ +M+EAERRLLANAL
Sbjct  156   KFFQGHEGLYSIYVHA-DPSFNESAPEGSVFHGRRVPSKPVKWGQLSMMEAERRLLANAL  214

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+RF+LLSE+CIPLFNF TIYSY++NS +T++  YD PGP GRGRY  +M P ++L
Sbjct  215   LDFSNQRFVLLSESCIPLFNFPTIYSYLINSTKTYVSSYDDPGPNGRGRYRIKMRPYLEL  274

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
               WRKGSQWFE+DR LA+E+ISD+ YFP+F+ YC   CY DEHYL T ++I     N+NR
Sbjct  275   QQWRKGSQWFEVDRNLAIEIISDEKYFPVFKKYCKPSCYVDEHYLSTFVSISFWGRNANR  334

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW+KGGPHP +F R DVT++ L +LRNG+TC+YNG  T +C LFARKF  ++L+R
Sbjct  335   SLTWVDWSKGGPHPARFGRLDVTIELLERLRNGSTCDYNGRTTNICFLFARKFLPNSLTR  394

Query  249   LLILAPKLM  223
              L  APK+M
Sbjct  395   FLRFAPKVM  403



>ref|XP_008806040.1| PREDICTED: uncharacterized protein LOC103718829 [Phoenix dactylifera]
Length=397

 Score =   397 bits (1020),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 194/309 (63%), Positives = 248/309 (80%), Gaps = 2/309 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLK  +  P  A H++++EELLWRASM P+I + PF RVPKVAF+FL RG+L  APLWE
Sbjct  87    VGLKGYV-EPAKAMHDMTEEELLWRASMVPRIKDYPFDRVPKVAFLFLARGSLAFAPLWE  145

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+G+ GL+SIYVH+ DPS+NE+ P  SVFHGRR+PSK V WG+ +M+EAERRLLANAL
Sbjct  146   KFFKGHEGLYSIYVHA-DPSFNESAPEGSVFHGRRVPSKLVRWGQLSMMEAERRLLANAL  204

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LDFSN+RFILLSE+CIPLFNFSTIYSY++NS +T++  YD PGP GRGRY+ +M P +KL
Sbjct  205   LDFSNQRFILLSESCIPLFNFSTIYSYLINSTKTYVSSYDDPGPNGRGRYNIRMKPHVKL  264

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
               WRKGSQWFE+DR LA+E+ISD  YFP+F+ YC   CY DEHYL T ++++    N+NR
Sbjct  265   QQWRKGSQWFEVDRNLAIEIISDDKYFPVFKRYCKPSCYVDEHYLSTFVSMRFWWRNANR  324

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTWVDW+K GPHP +F R DVT++ L  +RNG+TC+YNG  T++C LFARKF  ++L+R
Sbjct  325   SLTWVDWSKRGPHPARFGRLDVTIELLKGMRNGSTCDYNGRTTSICFLFARKFLPNSLTR  384

Query  249   LLILAPKLM  223
             L+  APK+M
Sbjct  385   LMRFAPKVM  393



>ref|XP_002535241.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27143.1| conserved hypothetical protein [Ricinus communis]
Length=286

 Score =   393 bits (1009),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 195/286 (68%), Positives = 234/286 (82%), Gaps = 2/286 (1%)
 Frame = -3

Query  1068  MSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHSSDPSYNETEPP  889
             M+P+I + PF RVPKVAFMFLTRG + +APLWE FF+G+ GL+SIYVHS +PSYNE+EP 
Sbjct  1     MAPRIPQYPFERVPKVAFMFLTRGPVLMAPLWEKFFKGHEGLYSIYVHS-NPSYNESEPE  59

Query  888   ESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEACIPLFNFSTIYSY  709
               VF+ RRIPSK V+WG  NMIEAERRLLANALLD SN+RF+LLSE+CIPLFNFST+YSY
Sbjct  60    SPVFNSRRIPSKEVKWGNVNMIEAERRLLANALLDISNQRFVLLSESCIPLFNFSTVYSY  119

Query  708   VMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRLALEVISDQTYF  529
             +MNSN+ F+E YDL  PVGRGRY+S M+P I ++ WRKGSQWFEMDR LA+EV+SDQ YF
Sbjct  120   LMNSNKNFVEAYDLDNPVGRGRYNSHMSPEITIDQWRKGSQWFEMDRELAVEVVSDQKYF  179

Query  528   PLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTKFTRNDVTVDFL  349
             P+FQ YC G CY+DEHYLPT ++IK  + NSNRTLTWVDW++GGPHPT+F R +VTV+FL
Sbjct  180   PIFQKYCRGNCYADEHYLPTFVSIKHWERNSNRTLTWVDWSRGGPHPTRFIRTEVTVEFL  239

Query  348   NKLRNGNTCEYNG-EKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
               +R+ + C YNG   TT C LFARKF   AL RLL  APK+M FN
Sbjct  240   ENMRSSSKCLYNGNSSTTTCFLFARKFLPTALDRLLRFAPKVMHFN  285



>ref|XP_004252429.1| PREDICTED: uncharacterized protein LOC101255566 [Solanum lycopersicum]
Length=324

 Score =   393 bits (1009),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 195/312 (63%), Positives = 241/312 (77%), Gaps = 3/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL + +  PP A H++ D+EL+WRASM PK    PF R PKVAFMFL RG+LPLAPLWE
Sbjct  15    IGLTDYI-KPPEAMHDMLDDELIWRASMIPKAKIFPFNRTPKVAFMFLARGSLPLAPLWE  73

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllana  793
              FFRG+ G +SIY+HS  PS+    P E  +FHGRR+PSK V+WG+ +M++AERRLLANA
Sbjct  74    RFFRGHEGHYSIYIHSQ-PSFKGDAPEEGPIFHGRRVPSKRVDWGEFSMVDAERRLLANA  132

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SNERF+LLSEACIPL+NF+TIY+Y+MNS +TF+E YD  GPVGRGRY+SQM P + 
Sbjct  133   LLDMSNERFVLLSEACIPLYNFTTIYTYIMNSTKTFVESYDEWGPVGRGRYNSQMTPWVT  192

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             +  WRKGSQWFE+DR +AL++I+DQ YF LF+ +C   CYSDEHYLPT + ++    N N
Sbjct  193   IEQWRKGSQWFELDREIALDMITDQKYFNLFKDFCRPACYSDEHYLPTFVTMRYWWKNGN  252

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             RTLTWVDW KGGPHPTKF R +VT + L+++R G  C YNGE T MC+LFARKF   AL 
Sbjct  253   RTLTWVDWTKGGPHPTKFARTEVTKELLHQMRTGIQCMYNGEPTNMCYLFARKFLPSALD  312

Query  252   RLLILAPKLMQF  217
             RLL  APK+M F
Sbjct  313   RLLKFAPKVMMF  324



>ref|XP_010513660.1| PREDICTED: uncharacterized protein LOC104789704 [Camelina sativa]
Length=407

 Score =   396 bits (1017),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 197/312 (63%), Positives = 243/312 (78%), Gaps = 3/312 (1%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL+  +  P    H++ DEELLWRASM+PKI   PF R PKVAFMF+T+G LPLA LWE 
Sbjct  97    GLEHFIKPPEKLMHDMEDEELLWRASMAPKIKNYPFPRTPKVAFMFMTKGHLPLARLWER  156

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FFRG+  LFSIYVHS  PSY +++P  SVFHGR IPSK V+WG  NM+EAE+RLLANALL
Sbjct  157   FFRGHEDLFSIYVHSY-PSYYQSDPENSVFHGRHIPSKRVDWGYVNMVEAEQRLLANALL  215

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNERF+LLSE+CIPLFNF+T+YSY++NS +T +E YD  G VGRGRYS  M P ++L+
Sbjct  216   DLSNERFVLLSESCIPLFNFTTVYSYLINSTQTHVESYDQLGGVGRGRYSPLMQPHVQLH  275

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIK--LGQGNSN  433
              WRKGSQWFEMDR +ALE+ISD+ Y+PLF SYC   CY+DEHY+PTL+NIK  L + NS 
Sbjct  276   HWRKGSQWFEMDRAMALEIISDRIYWPLFYSYCHHGCYADEHYIPTLLNIKSGLNRRNSK  335

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             RTLTWVDW+KGGPHP +F R++VT +F+  LR+G  C YNG+ T +C+LFARKF   AL 
Sbjct  336   RTLTWVDWSKGGPHPNRFIRHEVTAEFMETLRSGGQCLYNGKVTNICYLFARKFLPTALD  395

Query  252   RLLILAPKLMQF  217
             RLL L+  ++ F
Sbjct  396   RLLRLSRTVLYF  407



>ref|XP_009403975.1| PREDICTED: uncharacterized protein LOC103987406 [Musa acuminata 
subsp. malaccensis]
Length=398

 Score =   394 bits (1012),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 188/306 (61%), Positives = 239/306 (78%), Gaps = 1/306 (0%)
 Frame = -3

Query  1128  MAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNA  949
             + P    H++ DEELLWRASM P+I ++PF+   KVAF+FLTRG LPLAPLWE FF+GN 
Sbjct  93    VKPRNFMHDMEDEELLWRASMVPRIRKLPFKHAQKVAFLFLTRGNLPLAPLWEEFFKGNE  152

Query  948   GLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNER  769
             G +SIYVH+ DPS++ + P  SVF+GRRIPS+ V WG  +M++AERRLLANALLDFSN R
Sbjct  153   GSYSIYVHT-DPSFDWSVPKSSVFYGRRIPSQVVRWGTISMLDAERRLLANALLDFSNRR  211

Query  768   FILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGS  589
             F+LLSE+CIPLFNF T+YSY++NS E F+EVYD PGP GRGRY S + P I+   WRKGS
Sbjct  212   FVLLSESCIPLFNFPTVYSYLINSTEVFVEVYDDPGPNGRGRYKSTLKPGIEFKQWRKGS  271

Query  588   QWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDW  409
             QWF +DR LA+E++SD+ YFPLFQ YC   C +DEHYLPTLMN++   G +NR+LTW DW
Sbjct  272   QWFAVDRGLAMEIVSDEKYFPLFQRYCRPSCLADEHYLPTLMNVRSFWGTANRSLTWADW  331

Query  408   AKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPK  229
             +KGGPHP +  RN++T + L ++RNG+ C YNG  T +C+LF RKF  ++L+RL+ LAPK
Sbjct  332   SKGGPHPARIGRNEITAELLQRMRNGSACSYNGRTTRICYLFGRKFLPNSLNRLVRLAPK  391

Query  228   LMQFNG  211
             LM F G
Sbjct  392   LMDFGG  397



>ref|XP_008453432.1| PREDICTED: uncharacterized protein LOC103494140 [Cucumis melo]
Length=299

 Score =   388 bits (997),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 197/299 (66%), Positives = 243/299 (81%), Gaps = 4/299 (1%)
 Frame = -3

Query  1101  LSDEELLWRASMSPK-IGEMPFRRVP--KVAFMFLTRGALPLAPLWEMFFRGNAGLFSIY  931
             +++EELLWRAS+ P+ I ++P       K+AF+FLT+  + LAPLWE+FF+G AGL+SIY
Sbjct  1     MTEEELLWRASLVPRRIPKLPSTETSRRKIAFLFLTKDGVSLAPLWELFFKGYAGLYSIY  60

Query  930   VHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSE  751
             VH S PS N T    SVF+GR IPSKGV+WG+ +M+EAERRLLANALLDFSN+RFILLSE
Sbjct  61    VHRS-PSSNSTVDSSSVFYGRSIPSKGVKWGEPSMMEAERRLLANALLDFSNQRFILLSE  119

Query  750   ACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMD  571
             +CIPLFNFSTIY+Y+M+S  TFIE YDLPGPVGRGRYS +M PII L+ WRKGSQWFEMD
Sbjct  120   SCIPLFNFSTIYNYLMDSKSTFIEAYDLPGPVGRGRYSPKMRPIINLHQWRKGSQWFEMD  179

Query  570   RRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPH  391
             R +A +V+SDQ YFP+FQ +C   CY DEHYLPT + I+  + NSNRTLTWVDW++GG H
Sbjct  180   RTIASQVVSDQKYFPVFQKFCKPSCYMDEHYLPTFVGIRFSKSNSNRTLTWVDWSRGGAH  239

Query  390   PTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             PT+F R DVTV+ L +LR+G+ CEYNG KT +CHLFARKF  ++L+RLL+ APKLM FN
Sbjct  240   PTRFIRTDVTVELLQRLRSGSHCEYNGVKTNLCHLFARKFMANSLNRLLMFAPKLMHFN  298



>ref|XP_004160451.1| PREDICTED: uncharacterized protein LOC101227205 [Cucumis sativus]
 gb|KGN63836.1| hypothetical protein Csa_1G024220 [Cucumis sativus]
Length=397

 Score =   391 bits (1005),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 203/318 (64%), Positives = 249/318 (78%), Gaps = 7/318 (2%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPK-IGEMPFRRVP----KVAFMFLTRGALPL  985
             VGLKE L  PP   H++++EELLWRAS+ P+ I ++P         K+AF+FLT+  + L
Sbjct  80    VGLKEFLNPPP-VLHDMTEEELLWRASLVPRRIPKLPSTETTTSTRKIAFLFLTKDGVSL  138

Query  984   APLWEMFFRGNAGLFSIYVHSS-DPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerr  808
             APLWE+FF+G AGL+SIYVH +   S   T    SVF+GR IPSKGV+WG+ +M+EAERR
Sbjct  139   APLWELFFKGYAGLYSIYVHRTPSSSSTSTVDSSSVFYGRSIPSKGVKWGEPSMMEAERR  198

Query  807   llanalLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQM  628
             LLANALLDFSNERFILLSE+CIPLFNFST+Y+Y+M S  TFIE YDLPGPVGRGRY+ +M
Sbjct  199   LLANALLDFSNERFILLSESCIPLFNFSTVYNYLMGSKSTFIEAYDLPGPVGRGRYNPKM  258

Query  627   NPIIKLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLG  448
              PIIKL+ WRKGSQWFEMDR +A +VISDQ YF +FQ +C   CY DEHYLPT + I+  
Sbjct  259   RPIIKLHQWRKGSQWFEMDRTIASQVISDQKYFSVFQKFCKPSCYMDEHYLPTFVGIRFP  318

Query  447   QGNSNRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFT  268
             + NSNRTLTWVDW++GG HPT+F R DVT++ L +LRNG  CEYNG KT +CHLFARKF 
Sbjct  319   KTNSNRTLTWVDWSRGGAHPTRFVRTDVTLELLKRLRNGGHCEYNGVKTNLCHLFARKFM  378

Query  267   LHALSRLLILAPKLMQFN  214
              ++L+RLL+ APKLM FN
Sbjct  379   ANSLNRLLMFAPKLMHFN  396



>ref|XP_006353820.1| PREDICTED: uncharacterized protein LOC102581987 [Solanum tuberosum]
Length=325

 Score =   387 bits (995),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/312 (61%), Positives = 240/312 (77%), Gaps = 3/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL + +  PP A H++ D+EL+WRASM PK    PF R PKVAFMFL RG+LPLAPLWE
Sbjct  15    IGLTDYI-KPPEAMHDMMDDELIWRASMVPKAKIFPFNRTPKVAFMFLARGSLPLAPLWE  73

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllana  793
              FF+G+ G +SIY+HS  PS+    P E  +FH RR+PSK V+WG+ +M++AERRLLANA
Sbjct  74    RFFKGHEGRYSIYIHSQ-PSFKGDAPEEGPIFHARRVPSKRVDWGEFSMVDAERRLLANA  132

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SNERF+LLSEACIPL+NF+TIY+Y+MNS +TF+E YD  GPVGRGRY+SQM P + 
Sbjct  133   LLDMSNERFVLLSEACIPLYNFTTIYTYIMNSTKTFVESYDEWGPVGRGRYNSQMTPWVT  192

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             +  WRKGSQWFE+DR +AL++I+D  +F LF+ +C   CYSDEHYLPT + ++    N N
Sbjct  193   IEQWRKGSQWFELDREIALDMITDTKFFNLFKDFCRPACYSDEHYLPTFVTMRYWWKNGN  252

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             RTLTWVDW KGGPHPTKF R +VT + L+++R G  C YNGE T+MC+LFARKF   AL 
Sbjct  253   RTLTWVDWTKGGPHPTKFARTEVTRELLHQMRTGIQCMYNGEPTSMCYLFARKFLPSALD  312

Query  252   RLLILAPKLMQF  217
             RLL  APK+M F
Sbjct  313   RLLKFAPKVMMF  324



>gb|EPS62381.1| hypothetical protein M569_12413, partial [Genlisea aurea]
Length=371

 Score =   389 bits (999),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 196/314 (62%), Positives = 241/314 (77%), Gaps = 4/314 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLKE L  PP   H++++EEL+WRASM   IG  PF R PKVAFMFL +  LPLAPLWE
Sbjct  59    VGLKEYLR-PPEVFHDMTEEELMWRASMRAGIGTYPFDRRPKVAFMFLAKKGLPLAPLWE  117

Query  969   MFFRGNAGLFSIYVHSSDPSYNETE---PPESVFHGRRIPSKGVEWGKANMIeaerrlla  799
             +FFRGN G FSIYVHS  PS +  E   PPESVFHGR IPSK VEWG+ +M+EAERRLLA
Sbjct  118   LFFRGNEGSFSIYVHSPPPSSSLPEWHAPPESVFHGRTIPSKAVEWGRYSMVEAERRLLA  177

Query  798   nalLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPI  619
             NALLD SN+RF+LLSE+CIP++NF+T+Y Y++ S E+F+E YD  GPVGRGRY+ +M P 
Sbjct  178   NALLDLSNQRFVLLSESCIPIYNFTTVYEYLVGSAESFVESYDEDGPVGRGRYNRRMRPH  237

Query  618   IKLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGN  439
             + +  WRKG+QWFEMDR LA+EV++D+ Y  LF+ +C   CYSDEHYLPT +  K  + N
Sbjct  238   VTVEQWRKGAQWFEMDRGLAVEVVADRLYCNLFRRFCRPSCYSDEHYLPTFVTAKFARNN  297

Query  438   SNRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHA  259
             SNRTLTWVDW++GGPHP +F R+DV+ + + +LR G+ C YNG  T +CHLFARKFTL A
Sbjct  298   SNRTLTWVDWSRGGPHPLRFLRSDVSPELVKRLRTGSRCVYNGRSTNVCHLFARKFTLGA  357

Query  258   LSRLLILAPKLMQF  217
             L RLL  AP LM F
Sbjct  358   LDRLLRFAPSLMYF  371



>gb|AFK35806.1| unknown [Lotus japonicus]
Length=401

 Score =   388 bits (997),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 197/313 (63%), Positives = 240/313 (77%), Gaps = 6/313 (2%)
 Frame = -3

Query  1152  VVGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLW  973
             + GLKE L  P    H++SDEELLWRASM+PKI + PFRRVPKVAF+FL R  +PLAPLW
Sbjct  92    IAGLKEFLQ-PSHVIHDMSDEELLWRASMTPKIHDYPFRRVPKVAFLFLVRSNVPLAPLW  150

Query  972   EMFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllana  793
             E+FFRG+ G FSIYVHS  PSYN ++    +F GRRIPSK VEWG+ NM+EAERRLLANA
Sbjct  151   EVFFRGHEGYFSIYVHS-HPSYNGSDK-SPLFRGRRIPSKIVEWGRVNMMEAERRLLANA  208

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLDFSN+RF+L+SE+CIPLFNFSTIY Y+MNS + ++   D P   GRGRY  QM+P I 
Sbjct  209   LLDFSNQRFVLISESCIPLFNFSTIYFYLMNSTQNYVMAVDEPSAAGRGRYKIQMSPEIT  268

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCT--GPCYSDEHYLPTLMNIKLGQGN  439
             L  W KGSQWFEMDR LALEV+SD+ YFP+FQ YC     C +DEHYL T ++IK  + N
Sbjct  269   LRQWGKGSQWFEMDRELALEVVSDRKYFPVFQKYCNSGSSCCADEHYLQTFVSIKFWKRN  328

Query  438   SNRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHA  259
             +NR+LTWVDW+KGGPHP KF R +VTV+FL  LRN  TC+YNG    +C+LFARKF   +
Sbjct  329   ANRSLTWVDWSKGGPHPAKFVRPEVTVEFLESLRN-QTCKYNGNSKNVCYLFARKFLHTS  387

Query  258   LSRLLILAPKLMQ  220
             L+RL+  AP++M 
Sbjct  388   LTRLMRFAPQVMH  400



>ref|XP_010916430.1| PREDICTED: uncharacterized protein LOC105041248 [Elaeis guineensis]
 ref|XP_010916431.1| PREDICTED: uncharacterized protein LOC105041248 [Elaeis guineensis]
Length=402

 Score =   388 bits (997),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 192/311 (62%), Positives = 239/311 (77%), Gaps = 2/311 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGLK   M P    H++SDEELLWRASM PK+   P++R+PKVAF+FLT+GALP APLWE
Sbjct  93    VGLKGF-MEPGKVMHDMSDEELLWRASMVPKMEAFPYKRIPKVAFLFLTKGALPFAPLWE  151

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+GN GL+SIYVH   PSY E+ P +SVFHGRR+PSK V WG+ NM+EAERRLLANAL
Sbjct  152   KFFKGNEGLYSIYVHP-HPSYKESVPEDSVFHGRRVPSKVVRWGQPNMVEAERRLLANAL  210

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SN+RF+LLSE+CIP+FNFSTIYS+++NS +TFI  YD  GP GRGRY   M+P +KL
Sbjct  211   LDHSNQRFVLLSESCIPVFNFSTIYSHLINSTKTFIHSYDDLGPGGRGRYKIAMSPQLKL  270

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
               WRKGSQW E+DR LA+E+ISD+TYFPLF  YC   C +DEHYLPT +++K G  N+NR
Sbjct  271   EQWRKGSQWVEVDRNLAIEIISDETYFPLFLKYCRSSCLTDEHYLPTFVSMKFGWKNANR  330

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             +LTW +W+    HPT +  + VT+  L ++RNG TC YN   T +C LFARKF+ ++L R
Sbjct  331   SLTWTEWSPHQSHPTLYQGSHVTIQLLERMRNGTTCSYNDRTTRVCFLFARKFSPNSLDR  390

Query  249   LLILAPKLMQF  217
             LL LAPK+M F
Sbjct  391   LLTLAPKIMGF  401



>ref|XP_004236422.2| PREDICTED: uncharacterized protein LOC101267221 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010318627.1| PREDICTED: uncharacterized protein LOC101267221 isoform X1 [Solanum 
lycopersicum]
Length=426

 Score =   389 bits (998),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 191/314 (61%), Positives = 239/314 (76%), Gaps = 4/314 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAA--HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPL  976
             + LK+ +  P  +   H + DE+L+WRA M P + ++PF R PK+AFMFL RG+LPLAPL
Sbjct  113   IRLKDFMETPKFSTPKHVMKDEDLIWRAMMVPSVSDLPFNRKPKIAFMFLARGSLPLAPL  172

Query  975   WEMFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrlla  799
             WE FF+G+ GL+SIY+HS  PS+N + P E  +FH RR+ SK VEWGK NM+EAERRLLA
Sbjct  173   WERFFQGHEGLYSIYIHSQ-PSFNGSAPQEGPIFHDRRVASKKVEWGKFNMVEAERRLLA  231

Query  798   nalLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPI  619
             NALLD SNERF+LLSE+CIPL++F+TIY Y++NS  TF+E YDL  PVGRGRY+ +M P+
Sbjct  232   NALLDISNERFVLLSESCIPLYDFTTIYDYIINSANTFMESYDLISPVGRGRYNKKMKPL  291

Query  618   IKLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGN  439
             + L  WRKGSQWFE+DR +A+++ISDQ Y  LF+ +C   CYSDEHYLPT + +K    N
Sbjct  292   VTLAQWRKGSQWFEVDREIAIDIISDQKYSNLFKRFCRPACYSDEHYLPTFVTMKYWWKN  351

Query  438   SNRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHA  259
              NRTLTWVDWAKGGPHPTKF R DVT D L  +RNG  CEYNG+ + MC+LFARKF    
Sbjct  352   ENRTLTWVDWAKGGPHPTKFIRPDVTEDLLYGMRNGTKCEYNGQPSNMCYLFARKFLPST  411

Query  258   LSRLLILAPKLMQF  217
             L RLL  APK+M+F
Sbjct  412   LDRLLRFAPKIMKF  425



>ref|XP_008812383.1| PREDICTED: uncharacterized protein LOC103723284 [Phoenix dactylifera]
Length=384

 Score =   386 bits (992),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 188/312 (60%), Positives = 241/312 (77%), Gaps = 1/312 (0%)
 Frame = -3

Query  1152  VVGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLW  973
             +VG K  +       H++SDEELLWRASM PKI   P+ R+PKVAF+FL +GALPLAP+W
Sbjct  73    IVGRKGYIEPSKVIMHDMSDEELLWRASMVPKIEAFPYNRIPKVAFLFLIKGALPLAPVW  132

Query  972   EMFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllana  793
             E FF+GN GL+SIYVH   PSY ++ P +SVFHGRR+PSK V+WG+ +M+EAERRLLANA
Sbjct  133   EKFFKGNEGLYSIYVHP-HPSYKDSAPEDSVFHGRRVPSKVVQWGQPSMVEAERRLLANA  191

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD+SN+RF+LLSE+CIP+FNFSTIYSY++NS ET+I  YD  GP GRGRY   M+P +K
Sbjct  192   LLDYSNQRFVLLSESCIPIFNFSTIYSYLINSTETYIHSYDDLGPGGRGRYKIAMSPQLK  251

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             L  WRKGSQW E+DR LA+E+ISD+TYFPLF  +C   C +DEHYLPT +++K G  N+N
Sbjct  252   LEQWRKGSQWVEVDRNLAVEIISDETYFPLFLKHCRTSCITDEHYLPTFVSVKFGWKNAN  311

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALS  253
             R+LTW +WA    HP  +  +DVT+  L ++RNG TC YNG  T +C LFARKF+ ++L 
Sbjct  312   RSLTWTEWAPRQSHPALYQGSDVTIQLLERMRNGTTCNYNGGTTRVCFLFARKFSPNSLD  371

Query  252   RLLILAPKLMQF  217
             +LL+LAPK+M F
Sbjct  372   QLLMLAPKIMGF  383



>ref|XP_008467193.1| PREDICTED: uncharacterized protein LOC103504601 [Cucumis melo]
Length=379

 Score =   386 bits (991),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 196/314 (62%), Positives = 243/314 (77%), Gaps = 5/314 (2%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGL+E L  PP   H++ DEELLWRASM+  I + PF+RVPK+AFMFLT+G + LAPLWE
Sbjct  66    VGLEEFL-KPPEVMHDMDDEELLWRASMTAGIKKFPFQRVPKIAFMFLTKGPVYLAPLWE  124

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+GN  L+S+YVHS DPSYN + P   VFHGRRIPSK V WGK NMIEAERRL++NAL
Sbjct  125   EFFKGNERLYSVYVHS-DPSYNHSSPESPVFHGRRIPSKKVGWGKVNMIEAERRLISNAL  183

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSN-ETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LD SNERF+LLSE+CIPLFNFST+YS+++NS  ++FI  YD PG VGRGRY ++M P I 
Sbjct  184   LDISNERFVLLSESCIPLFNFSTVYSFLINSTMKSFIMSYDEPGNVGRGRYRNKMFPPIS  243

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             L  WRKGSQWFEMDR  A+ V+SD+ YFP+FQ+YC G CYSDEHYLPTL+N+     N+N
Sbjct  244   LKQWRKGSQWFEMDRDTAVAVVSDKKYFPVFQNYCKGQCYSDEHYLPTLVNVLGWDRNAN  303

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRN--GNTCEYNGEKTTMCHLFARKFTLHA  259
             R+LTWVDW+KGGPHP +F+R+D+ V+ + +LRN  G   +   E T +C LFARKF  + 
Sbjct  304   RSLTWVDWSKGGPHPARFSRSDIHVELIQRLRNQTGECRKSKMEGTGVCFLFARKFAPNT  363

Query  258   LSRLLILAPKLMQF  217
             L RL+ +APK M F
Sbjct  364   LERLMKIAPKAMYF  377



>gb|KDP20145.1| hypothetical protein JCGZ_05914 [Jatropha curcas]
Length=404

 Score =   386 bits (991),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 186/297 (63%), Positives = 240/297 (81%), Gaps = 1/297 (0%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYV  928
             HN++D+ELLWRASM  ++ E PF+  PKVAF+FLT+G+LPLAPLWE+FF+G+ GL+SIYV
Sbjct  109   HNMADKELLWRASMVARVSEFPFKLTPKVAFLFLTKGSLPLAPLWELFFKGHEGLYSIYV  168

Query  927   HSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEA  748
             H S PS+N T P +SVF+GRRIPSK   WG+  ++EAERRLLA+ALLDFSN+ FILLSE+
Sbjct  169   HYS-PSFNGTVPVDSVFYGRRIPSKETRWGEFTIVEAERRLLASALLDFSNQYFILLSES  227

Query  747   CIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDR  568
             CIPLFNFSTIY+Y+M S ++F++ +DL GP GR RY+ +M+P I L+ WRKGSQWF+M R
Sbjct  228   CIPLFNFSTIYNYLMGSEKSFVQSFDLRGPDGRYRYNPRMSPTIMLDQWRKGSQWFQMKR  287

Query  567   RLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHP  388
              +A+EV+SD+ YFP+FQ +C G CY+DEHYLPT + IK  +  SNRTLTW+DW K GPHP
Sbjct  288   NIAIEVVSDRKYFPVFQRFCKGYCYADEHYLPTFVGIKFLKKTSNRTLTWIDWPKRGPHP  347

Query  387   TKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQF  217
             + + R DVTV+FL  LRN   C+YNG++ ++C LFARKF  +AL RLL  APKLM+F
Sbjct  348   SHYGRMDVTVNFLESLRNKGPCDYNGKENSICFLFARKFVPNALPRLLRFAPKLMKF  404



>ref|XP_002276791.2| PREDICTED: uncharacterized protein LOC100257764 [Vitis vinifera]
Length=411

 Score =   384 bits (986),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 180/284 (63%), Positives = 229/284 (81%), Gaps = 1/284 (0%)
 Frame = -3

Query  1119  PGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLF  940
             P   H++ D+EL WRASM P+I + P+  VPKVAFMFLT+G +PL PLW++FF+G+ G +
Sbjct  112   PTLMHSMDDDELFWRASMVPRIQQFPYENVPKVAFMFLTKGPIPLGPLWDLFFKGHEGFY  171

Query  939   SIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFIL  760
             SIYVH   PSYN++ P +SVFHGRRIPSK V+WG+A MI+AERRLLANALLDFSNERF+L
Sbjct  172   SIYVHPH-PSYNDSVPEDSVFHGRRIPSKAVKWGRATMIDAERRLLANALLDFSNERFVL  230

Query  759   LSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWF  580
             LSE CIPLFNF+TIYSY++NSN++FI  YD P  VGRGRY+ QM+P I +++WRKGSQWF
Sbjct  231   LSETCIPLFNFTTIYSYIINSNQSFIASYDDPRKVGRGRYNPQMSPTINISEWRKGSQWF  290

Query  579   EMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKG  400
             E+ R LA+E++SD+ Y+P+F+ +C  PCY DEHY+PTL+NI   + NSNRT+TWVDW+K 
Sbjct  291   EVHRELAIEIVSDKKYYPVFREHCHVPCYMDEHYIPTLINILAPEKNSNRTITWVDWSKS  350

Query  399   GPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFT  268
             GPHP +F R DVT++FLN+ R G  C Y G  T+MC LFARKF 
Sbjct  351   GPHPGRFIRQDVTLEFLNQTRFGTNCTYGGNTTSMCFLFARKFV  394



>ref|XP_004137544.1| PREDICTED: uncharacterized protein LOC101209845 [Cucumis sativus]
Length=303

 Score =   378 bits (970),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 194/302 (64%), Positives = 239/302 (79%), Gaps = 6/302 (2%)
 Frame = -3

Query  1101  LSDEELLWRASMSPK-IGEMPFRRVP----KVAFMFLTRGALPLAPLWEMFFRGNAGLFS  937
             +++EELLWRAS+ P+ I ++P         K+AF+FLT+  + LAPLWE+FF+G AGL+S
Sbjct  1     MTEEELLWRASLVPRRIPKLPSTETTTSTRKIAFLFLTKDGVSLAPLWELFFKGYAGLYS  60

Query  936   IYVHSS-DPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFIL  760
             IYVH +   S   T    SVF+GR IPSKGV+WG+ +M+EAERRLLANALLDFSNERFIL
Sbjct  61    IYVHRTPSSSSTSTVDSSSVFYGRSIPSKGVKWGEPSMMEAERRLLANALLDFSNERFIL  120

Query  759   LSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWF  580
             LSE+CIPLFNFST+Y+Y+M S  TFIE YDLPGPVGRGRY+ +M PIIKL+ WRKGSQWF
Sbjct  121   LSESCIPLFNFSTVYNYLMGSKSTFIEAYDLPGPVGRGRYNPKMRPIIKLHQWRKGSQWF  180

Query  579   EMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKG  400
             EMDR +A +VISDQ YF +FQ +C   CY DEHYLPT + I+  + NSNRTLTWVDW++G
Sbjct  181   EMDRTIASQVISDQKYFSVFQKFCKPSCYMDEHYLPTFVGIRFPKTNSNRTLTWVDWSRG  240

Query  399   GPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQ  220
             G HPT+F R DVT++ L +LRNG  CEYNG KT +CHLFARKF  ++L+RLL+ APKLM 
Sbjct  241   GAHPTRFVRTDVTLELLKRLRNGGHCEYNGVKTNLCHLFARKFMANSLNRLLMFAPKLMH  300

Query  219   FN  214
             FN
Sbjct  301   FN  302



>emb|CBI15479.3| unnamed protein product [Vitis vinifera]
Length=294

 Score =   377 bits (969),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 178/278 (64%), Positives = 226/278 (81%), Gaps = 1/278 (0%)
 Frame = -3

Query  1101  LSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHS  922
             + D+EL WRASM P+I + P+  VPKVAFMFLT+G +PL PLW++FF+G+ G +SIYVH 
Sbjct  1     MDDDELFWRASMVPRIQQFPYENVPKVAFMFLTKGPIPLGPLWDLFFKGHEGFYSIYVHP  60

Query  921   SDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEACI  742
               PSYN++ P +SVFHGRRIPSK V+WG+A MI+AERRLLANALLDFSNERF+LLSE CI
Sbjct  61    H-PSYNDSVPEDSVFHGRRIPSKAVKWGRATMIDAERRLLANALLDFSNERFVLLSETCI  119

Query  741   PLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRL  562
             PLFNF+TIYSY++NSN++FI  YD P  VGRGRY+ QM+P I +++WRKGSQWFE+ R L
Sbjct  120   PLFNFTTIYSYIINSNQSFIASYDDPRKVGRGRYNPQMSPTINISEWRKGSQWFEVHREL  179

Query  561   ALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTK  382
             A+E++SD+ Y+P+F+ +C  PCY DEHY+PTL+NI   + NSNRT+TWVDW+K GPHP +
Sbjct  180   AIEIVSDKKYYPVFREHCHVPCYMDEHYIPTLINILAPEKNSNRTITWVDWSKSGPHPGR  239

Query  381   FTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFT  268
             F R DVT++FLN+ R G  C Y G  T+MC LFARKF 
Sbjct  240   FIRQDVTLEFLNQTRFGTNCTYGGNTTSMCFLFARKFV  277



>ref|XP_007224741.1| hypothetical protein PRUPE_ppa024535mg [Prunus persica]
 gb|EMJ25940.1| hypothetical protein PRUPE_ppa024535mg [Prunus persica]
Length=410

 Score =   382 bits (980),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 199/316 (63%), Positives = 241/316 (76%), Gaps = 7/316 (2%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLKE L  PP   H+++D ELLWRASMSP+I E PF  VPK+AFMFL RG + LAPLWE
Sbjct  94    IGLKEYL-KPPKVFHDMNDTELLWRASMSPRIPEYPFHLVPKIAFMFLARGPVLLAPLWE  152

Query  969   MFFRGNAGLFSIYVHSSDPSYNETE-PPESVFHGRRIPSK-GVEWGKANMIeaerrllan  796
              FF G+ G +SIYVHS +PS+N++     SVFHGRRIPS   V+WG  ++IEAER LLAN
Sbjct  153   KFFEGHQGFYSIYVHS-EPSHNQSSYAGSSVFHGRRIPSDLKVKWGTVSLIEAERLLLAN  211

Query  795   alLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPII  616
             ALLD SN+RF+LLSEACIPL+NFST+YSY++NS ETF+EVYD P  VGRGRY     P I
Sbjct  212   ALLDISNQRFVLLSEACIPLYNFSTVYSYLINSKETFVEVYDDPSAVGRGRYYFVQYPGI  271

Query  615   KLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNS  436
              +  WRKGSQWFE+DR LA+EV+SD+ YFP+++  C G C++DEHYLPT +NIK G  N+
Sbjct  272   SVEQWRKGSQWFEIDRDLAIEVVSDRKYFPVYRR-CRGECFADEHYLPTFVNIKFGAKNA  330

Query  435   NRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRN--GNTCEYNGEKTTMCHLFARKFTLH  262
             NRTLTWVDWAKGGPHPT++   +VTV+ LN LR   G  CEYNG  T +C LFARKF   
Sbjct  331   NRTLTWVDWAKGGPHPTEYMSLNVTVELLNGLRTGYGRRCEYNGRSTHVCFLFARKFPPS  390

Query  261   ALSRLLILAPKLMQFN  214
             AL  LL +APK+M FN
Sbjct  391   ALDSLLRIAPKIMHFN  406



>ref|XP_004147140.1| PREDICTED: uncharacterized protein LOC101202787 [Cucumis sativus]
 gb|KGN51542.1| hypothetical protein Csa_5G576840 [Cucumis sativus]
Length=379

 Score =   380 bits (976),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 241/314 (77%), Gaps = 5/314 (2%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGL+E L  PP   H++ DEELLWRASM  +I + PF+RVPK+AFMFLT+G + LAPLWE
Sbjct  66    VGLEEFL-KPPEVMHDMDDEELLWRASMMARIKKFPFQRVPKIAFMFLTKGPVYLAPLWE  124

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FF+GN GL+S+YVHS DPSYN + P    FHGRRIPSK V WGK NMIEAERRL++NAL
Sbjct  125   EFFKGNEGLYSVYVHS-DPSYNHSSPEPPAFHGRRIPSKKVGWGKVNMIEAERRLISNAL  183

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSN-ETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LD SNERF+LLSE+CIPLFNFST+YS+++NS  ++FI  YD P  VGRGRY ++M P I 
Sbjct  184   LDISNERFVLLSESCIPLFNFSTVYSFLINSTMKSFIMSYDEPSNVGRGRYRNKMFPPIS  243

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             L  WRKGSQWFE+DR  A+ V+SD+ YFP+FQ+YC G CYSDEHYLPTL+N+     N N
Sbjct  244   LKQWRKGSQWFEIDRDTAVAVVSDKKYFPVFQNYCKGQCYSDEHYLPTLVNVLGWDRNGN  303

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRN--GNTCEYNGEKTTMCHLFARKFTLHA  259
             R+LTWVDW+KGGPHP +++R+D+ V+ + +LRN  G   +   E   +C LFARKF  +A
Sbjct  304   RSLTWVDWSKGGPHPARYSRSDIHVELIQRLRNQTGECRKSKMEGKGVCFLFARKFAPNA  363

Query  258   LSRLLILAPKLMQF  217
             L RL+ +APK M F
Sbjct  364   LERLVNIAPKAMYF  377



>gb|EYU40777.1| hypothetical protein MIMGU_mgv1a007709mg [Erythranthe guttata]
Length=398

 Score =   378 bits (971),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 186/308 (60%), Positives = 237/308 (77%), Gaps = 1/308 (0%)
 Frame = -3

Query  1137  ELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFR  958
             E  ++P    H +SD EL+WRAS+ P+I + PF R PKVAFMFLTRG LPLAPLWEMFF+
Sbjct  91    EEWISPKDVWHTMSDRELMWRASLVPRILDFPFNRTPKVAFMFLTRGKLPLAPLWEMFFK  150

Query  957   GNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFS  778
             GN GLFSIY+H+  P +    P  SVF+ RRIPSK V+WG+ +MI+AERRLLANALLDF+
Sbjct  151   GNEGLFSIYLHTL-PEFTYEPPESSVFYKRRIPSKLVQWGRPSMIDAERRLLANALLDFT  209

Query  777   NERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWR  598
             N+RF+LLSE CIPLFNFSTIY+Y++NSN++F+  +D P P+GRGRY+ +M P I L+DWR
Sbjct  210   NQRFVLLSETCIPLFNFSTIYNYLINSNQSFLSTFDDPRPIGRGRYNKRMGPAISLSDWR  269

Query  597   KGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTW  418
             KGSQWFE +R LA+ +ISD  Y+P+F+++C  PCY DEHYLPTL+N       SNRT+TW
Sbjct  270   KGSQWFEANRELAIAIISDVEYYPIFRNHCLPPCYMDEHYLPTLVNKVCPNLTSNRTVTW  329

Query  417   VDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLIL  238
              DW++GG HP  F RNDVT +FL+++R+G  C YNGE  ++C LFARKF    L  LL +
Sbjct  330   TDWSEGGSHPRMFMRNDVTEEFLDRVRSGFNCTYNGEMRSICSLFARKFHPTTLQPLLRI  389

Query  237   APKLMQFN  214
             APKL+ FN
Sbjct  390   APKLLGFN  397



>ref|XP_009356310.1| PREDICTED: uncharacterized protein LOC103947180 [Pyrus x bretschneideri]
Length=412

 Score =   379 bits (972),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/315 (62%), Positives = 239/315 (76%), Gaps = 6/315 (2%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLK+ L  PP A H++++ ELLWRASM+P+I E PFR VPKVAFMFLTRG + LAPLWE
Sbjct  100   IGLKDYL-KPPKAFHDMNNAELLWRASMTPRIPEHPFRLVPKVAFMFLTRGPVVLAPLWE  158

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllana  793
              FF G+ GL+SIYVHSS PSYN +   E+ VF GRRIPS+ VEWG  ++IEAER +LANA
Sbjct  159   KFFAGHHGLYSIYVHSS-PSYNHSSYTETPVFRGRRIPSQEVEWGTVSLIEAERLVLANA  217

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SN+RF+LLSEACIPL+NFST+YSY++NS +TF+EVYD P   GRGRY     P I 
Sbjct  218   LLDISNQRFVLLSEACIPLYNFSTVYSYLINSTQTFVEVYDNPNGDGRGRYGLSDYPGIT  277

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             ++ WRKGSQWF+ DR LALE +SDQ YFP+F   C G C+SDEHYLPT +++K G  N+N
Sbjct  278   IDQWRKGSQWFQADRDLALEFVSDQKYFPVFMK-CKGYCFSDEHYLPTFVSMKFGAKNAN  336

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRN--GNTCEYNGEKTTMCHLFARKFTLHA  259
             RTLTWVDW KGGPHPT++   +VT + L+ LRN  G  CEY G  T +C LFARKF   A
Sbjct  337   RTLTWVDWEKGGPHPTEYASENVTAELLSSLRNGFGRKCEYGGRSTDVCFLFARKFPPTA  396

Query  258   LSRLLILAPKLMQFN  214
             L  LL  AP++M FN
Sbjct  397   LDYLLKFAPEIMHFN  411



>ref|XP_011076478.1| PREDICTED: uncharacterized protein LOC105160693 [Sesamum indicum]
Length=395

 Score =   377 bits (968),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 189/311 (61%), Positives = 240/311 (77%), Gaps = 2/311 (1%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GLKE + +P    H+++DEEL+WRASM P I + PF R PKVAFMFLTRG LPLAPLW+M
Sbjct  86    GLKEWI-SPKDRWHSMTDEELMWRASMVPGIVQYPFNRTPKVAFMFLTRGRLPLAPLWDM  144

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FFRG+ GLFSIY+H+  P +       SVF+ RRIPSK V+WG++ MI+AERRLLANALL
Sbjct  145   FFRGHEGLFSIYLHTL-PEFTYEPSKSSVFYKRRIPSKLVQWGRSTMIDAERRLLANALL  203

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             DFSNERF+LLSE CIPLFNFS IY+Y++NSN++F+  +D P P+GRGRY+ +M P I L+
Sbjct  204   DFSNERFVLLSETCIPLFNFSIIYNYLINSNQSFLSTFDDPRPIGRGRYNKRMWPTITLS  263

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
             DWRKGSQWFE +R LAL ++SD  Y+PLF+++C  PCY DEHYLPT++        SNRT
Sbjct  264   DWRKGSQWFEANRELALAIVSDIKYYPLFRNHCMPPCYMDEHYLPTVVTKFWPNLTSNRT  323

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TW DW++GG HP  F RNDVT  FL+++RNG  C YNGE++T+C LFARKF  + L  L
Sbjct  324   ITWTDWSRGGSHPAMFMRNDVTGGFLDRMRNGFNCTYNGERSTICFLFARKFHPNTLQPL  383

Query  246   LILAPKLMQFN  214
             L +APKL+ F+
Sbjct  384   LRVAPKLLGFD  394



>ref|XP_010537457.1| PREDICTED: uncharacterized protein LOC104812147 [Tarenaya hassleriana]
Length=398

 Score =   377 bits (968),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 185/313 (59%), Positives = 242/313 (77%), Gaps = 3/313 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGL++ +  P    H ++DEELLWRASM P+  E PF + PK+AF+FLTRG LP AP WE
Sbjct  87    VGLRDFV-EPKNVMHGMTDEELLWRASMKPERKETPFSQTPKIAFLFLTRGRLPFAPFWE  145

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPE-SVFHGRRIPSKGVEWGKANMIeaerrllana  793
              FF+G+ G +SIYVH+SDP + + + PE S F+ RRIPSK VEWGK +++EAERRLLANA
Sbjct  146   KFFKGHEGFYSIYVHTSDPRHVDHDTPETSPFYRRRIPSKEVEWGKFSLMEAERRLLANA  205

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SN RF+LLSEA +P+F+FST+YS+++NS+ +F++++D  GP G+GRYS +M P++ 
Sbjct  206   LLDSSNRRFVLLSEAGVPIFDFSTVYSHLINSHHSFVDLFDDHGPTGQGRYSRRMAPLVT  265

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             L +WRKGSQWFEMDR LAL V+SD TYFPLF+ +C G CY+DEHYLPT ++IK    N+N
Sbjct  266   LREWRKGSQWFEMDRELALAVVSDTTYFPLFKKHCHGGCYADEHYLPTFVHIKFPGKNAN  325

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNG-NTCEYNGEKTTMCHLFARKFTLHAL  256
             R+LTW DW++GGPHP  +TR  VTVDFL  LR    TC YNGE T +C+LFARKF   +L
Sbjct  326   RSLTWTDWSRGGPHPRTYTRPLVTVDFLRGLRKSEKTCAYNGETTEICYLFARKFDERSL  385

Query  255   SRLLILAPKLMQF  217
             +R ++ APK+M F
Sbjct  386   NRFILFAPKIMGF  398



>ref|XP_010678016.1| PREDICTED: uncharacterized protein LOC104893585 [Beta vulgaris 
subsp. vulgaris]
Length=389

 Score =   375 bits (964),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 192/301 (64%), Positives = 229/301 (76%), Gaps = 4/301 (1%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRR---VPKVAFMFLTRGALPLAPLWEMFFRGNAGLFS  937
             H + DEELLWRASM PKIG   +       K+AF+FL RG+LPLAPLWEMFF+G+   ++
Sbjct  90    HEMEDEELLWRASMVPKIGGENYSSKFVTNKIAFLFLVRGSLPLAPLWEMFFKGHGDYYT  149

Query  936   IYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILL  757
             IYVHS  PSYNE+ P  SVFHGRRIPSK VEWGK NM+EAERRLLANALLD SN+RFILL
Sbjct  150   IYVHSL-PSYNESYPTNSVFHGRRIPSKEVEWGKFNMVEAERRLLANALLDVSNQRFILL  208

Query  756   SEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFE  577
             SE+CIPLFNFSTIYSY++NS ++++E YD     GRGRYS  M P ++L+ WRKGSQWFE
Sbjct  209   SESCIPLFNFSTIYSYLINSKKSYVEAYDSDSSTGRGRYSYHMMPQVRLSQWRKGSQWFE  268

Query  576   MDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGG  397
             MDR +A++VISD+ YF LFQ +CT  CY DEHYLPT ++I+    NSNR+LTWVDW+K G
Sbjct  269   MDRAVAVKVISDEEYFTLFQKFCTRGCYGDEHYLPTFLSIEFWWRNSNRSLTWVDWSKTG  328

Query  396   PHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQF  217
             PHP  F R  VT   L  LR+  TCEYNG KT +C LFARKF    L+RLL  AP +M+F
Sbjct  329   PHPGVFQRPQVTPQLLQSLRSNGTCEYNGGKTHICFLFARKFMPGTLTRLLRFAPPIMKF  388

Query  216   N  214
             N
Sbjct  389   N  389



>ref|XP_009356309.1| PREDICTED: uncharacterized protein LOC103947179 [Pyrus x bretschneideri]
Length=405

 Score =   375 bits (962),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 195/315 (62%), Positives = 237/315 (75%), Gaps = 6/315 (2%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
              GLK+ L  PP A H++++ ELLWRAS++P+I E PF  VPKVAFMFLT+G + LAPLWE
Sbjct  93    TGLKDYL-KPPKAFHDMNNAELLWRASITPRIPEYPFHFVPKVAFMFLTKGPVVLAPLWE  151

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllana  793
              FF G+ GL+SIYVHSS PSYN +   E+ VF GRRIPS+ VEWGK ++I AER LLANA
Sbjct  152   KFFAGHQGLYSIYVHSS-PSYNHSSYTETPVFGGRRIPSQEVEWGKVSLIAAERLLLANA  210

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SN+RF+LLSE+CIPL+NFST+YSY+MNS +TF+EV+D P  VGRGRY     P I 
Sbjct  211   LLDVSNQRFVLLSESCIPLYNFSTVYSYLMNSTQTFVEVFDDPSGVGRGRYELSDYPGIT  270

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             ++ WRKGSQWF+ DR LALE +SD+TYFP+F   C G C++DEHYLPT + IK G  N+N
Sbjct  271   IDQWRKGSQWFQADRDLALEFVSDRTYFPVFMK-CKGYCFADEHYLPTFVYIKFGAKNAN  329

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRN--GNTCEYNGEKTTMCHLFARKFTLHA  259
             RTLTWVDW KGGPHPT++   +VT   L+ LRN  G  CEYNG  T +C LFARKF   A
Sbjct  330   RTLTWVDWEKGGPHPTEYASENVTAVLLSGLRNGFGRKCEYNGRSTDVCFLFARKFPPTA  389

Query  258   LSRLLILAPKLMQFN  214
             L  LL  AP +M FN
Sbjct  390   LDNLLKFAPAIMHFN  404



>ref|XP_011007501.1| PREDICTED: uncharacterized protein LOC105113152 isoform X2 [Populus 
euphratica]
Length=411

 Score =   375 bits (962),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/304 (61%), Positives = 234/304 (77%), Gaps = 1/304 (0%)
 Frame = -3

Query  1128  MAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNA  949
             + P    H+++D+ELLWRASM P I E P+ R PKVAFMFLTRG+LPLAPLW+MFF+G+A
Sbjct  107   VTPKELCHSMNDKELLWRASMVPHIDEYPYNRTPKVAFMFLTRGSLPLAPLWDMFFKGHA  166

Query  948   GLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNER  769
             GL+SIY+H S P +    P  SVF+ R+IPSK  EWG+A MI+AERRLLANALLDFSNER
Sbjct  167   GLYSIYLHKS-PEFTNQHPESSVFYQRQIPSKPAEWGRATMIDAERRLLANALLDFSNER  225

Query  768   FILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGS  589
             F+LLSE CIP+FNFSTIY+Y+MNSN++F+  +D P  +GRGRY+ +M P + L+DWRKGS
Sbjct  226   FVLLSETCIPVFNFSTIYNYLMNSNQSFLGSFDDPRHMGRGRYNKRMRPTVTLSDWRKGS  285

Query  588   QWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDW  409
             QWFE  R++A+E+ISD  Y+P+F+ +C  PCY DEHY PTL+     + NSNR++TWVDW
Sbjct  286   QWFEAHRKVAIEMISDVKYYPVFRDHCRPPCYMDEHYFPTLVTKISPELNSNRSITWVDW  345

Query  408   AKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPK  229
             + GG HPT+F R DV+  FLN++RNG  C YNG  TT+C LFARKF    L  LL +AP 
Sbjct  346   SGGGSHPTRFVRKDVSEAFLNQIRNGFNCTYNGGITTVCFLFARKFHPSTLDPLLRIAPG  405

Query  228   LMQF  217
             L+ F
Sbjct  406   LLGF  409



>ref|XP_002315929.2| hypothetical protein POPTR_0010s13160g [Populus trichocarpa]
 gb|EEF02100.2| hypothetical protein POPTR_0010s13160g [Populus trichocarpa]
Length=411

 Score =   374 bits (961),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 183/304 (60%), Positives = 233/304 (77%), Gaps = 1/304 (0%)
 Frame = -3

Query  1128  MAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNA  949
             + P    H+++D+ELLWRASM P I E P+ R PKVAFMFLTRG+LPLAPLWEMFF+G+ 
Sbjct  107   VTPKELCHSMNDKELLWRASMVPHIDEYPYNRTPKVAFMFLTRGSLPLAPLWEMFFKGHE  166

Query  948   GLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNER  769
             GL+SIY+H S P +    P  SVF+ R+IPSK  EWG+A MI+AERRLLANALLDFSNER
Sbjct  167   GLYSIYLHKS-PEFTNQHPESSVFYQRQIPSKPAEWGRATMIDAERRLLANALLDFSNER  225

Query  768   FILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGS  589
             F+LLSE CIP+FNFSTIY+Y+MNSN++F+  +D P  +GRGRY+ +M P + L+DWRKGS
Sbjct  226   FVLLSETCIPVFNFSTIYNYLMNSNQSFLGSFDDPRHMGRGRYNKRMRPTVTLSDWRKGS  285

Query  588   QWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDW  409
             QWFE  R++A+E+ISD  Y+P+F+ +C  PCY DEHY PTL+     + NSNR++TWVDW
Sbjct  286   QWFEAHRKVAIEMISDVKYYPVFRDHCRPPCYMDEHYFPTLVTKISPELNSNRSITWVDW  345

Query  408   AKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPK  229
             + GG HP +F R DV+  FLN++RNG  C YNG  TT+C LFARKF    L  LL +AP+
Sbjct  346   SGGGSHPARFVRKDVSEAFLNQIRNGFNCTYNGGITTVCFLFARKFHPSTLDSLLRIAPE  405

Query  228   LMQF  217
             L+ F
Sbjct  406   LLGF  409



>emb|CDP00652.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   370 bits (950),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 180/296 (61%), Positives = 229/296 (77%), Gaps = 1/296 (0%)
 Frame = -3

Query  1101  LSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHS  922
             +SDEELLWRAS+ P I E PF R PK+AFMFLTRG+LPLAPLWE+FF+G+ G FSIY+H+
Sbjct  1     MSDEELLWRASLVPHITEYPFNRTPKIAFMFLTRGSLPLAPLWEVFFKGHQGFFSIYLHT  60

Query  921   SDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEACI  742
             S P +    P  SVF+ RRIPSK V+WG+  MI+AE+RLLANALLD SNERFILLSEACI
Sbjct  61    S-PEFTNEPPESSVFYKRRIPSKHVQWGRVTMIDAEKRLLANALLDHSNERFILLSEACI  119

Query  741   PLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRL  562
             P+FNF+TIY+Y++N+N++F+  +D P P+GRGRY+ +M P+I L+DWRKGSQWFE +R+L
Sbjct  120   PIFNFTTIYNYLINANQSFLSTFDDPRPIGRGRYNKRMWPMITLSDWRKGSQWFEANRKL  179

Query  561   ALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTK  382
             A+E++SD   +P+F+  C  PCY DEHYLPTL+     +  SNRT+TW DW+ GG HP  
Sbjct  180   AIEIVSDVKLYPIFRDLCMPPCYMDEHYLPTLVTKVCPELTSNRTITWTDWSTGGSHPRT  239

Query  381   FTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             F RND+T  FLN+ R G  C YNGE +++CHLFARKF    L  LL +APKL+ F 
Sbjct  240   FMRNDITEPFLNQARFGVNCSYNGEISSVCHLFARKFHPSTLQPLLRIAPKLLGFT  295



>ref|XP_004161853.1| PREDICTED: uncharacterized LOC101207079 [Cucumis sativus]
 gb|KGN64131.1| hypothetical protein Csa_1G042430 [Cucumis sativus]
Length=404

 Score =   374 bits (960),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 184/304 (61%), Positives = 236/304 (78%), Gaps = 5/304 (2%)
 Frame = -3

Query  1119  PGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLF  940
             P   H +SD+E+ WRASM P I E P+ RVPK+AFMFL +G+LPLAPLWEMFF+G+  LF
Sbjct  99    PPLMHRMSDDEVFWRASMVPMIKEFPYERVPKIAFMFLIKGSLPLAPLWEMFFKGHEHLF  158

Query  939   SIYVHSSDPSYNETE--PPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERF  766
             SIYVH+  P YN +   PP SVF+GRRIPS+ V+WG+ +MI+AERRLLANALLDFSNERF
Sbjct  159   SIYVHT-HPLYNVSSSLPPNSVFYGRRIPSQAVQWGRPSMIDAERRLLANALLDFSNERF  217

Query  765   ILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQ  586
             ILLSE CIPL+NF+TIY+Y++NS  TF+  YD P  +GRGRY+ +M P+I + DWRKGSQ
Sbjct  218   ILLSETCIPLYNFTTIYNYLINSQYTFVSSYDDPRKIGRGRYNPRMFPVISIADWRKGSQ  277

Query  585   WFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWA  406
             W E+DRR+A+E+ISD TY+P+F+ +C  PCY DEHY+PTL+NI L   NSNRT+TWVDW+
Sbjct  278   WIEVDRRVAIEIISDSTYYPVFREHCGPPCYMDEHYIPTLVNIVLPDRNSNRTVTWVDWS  337

Query  405   KGGPHPTKFTRNDVTVDFLNKLRNGNTCEYN--GEKTTMCHLFARKFTLHALSRLLILAP  232
             K GPHP +F R +++V+ LN++R G  C YN   E  ++C LFARKF   +L  LL + P
Sbjct  338   KNGPHPGRFGRREISVELLNRVRFGFNCSYNDGNETVSLCFLFARKFMPDSLQPLLKIWP  397

Query  231   KLMQ  220
              L+Q
Sbjct  398   SLLQ  401



>ref|XP_004167307.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101223507, 
partial [Cucumis sativus]
Length=333

 Score =   371 bits (952),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 239/315 (76%), Gaps = 6/315 (2%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             VGL+E L  PP   H++ DEELLWRASM  +I + PF+RVPK+AFMFLT+G + LAPLWE
Sbjct  19    VGLEEFL-KPPEVMHDMDDEELLWRASMMARIKKFPFQRVPKIAFMFLTKGPVYLAPLWE  77

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEW-GKANMIeaerrllana  793
              FF+GN GL+S+YVHS DPSYN + P    FHGRRIPSK   W GK NMIEAERRL++NA
Sbjct  78    EFFKGNEGLYSVYVHS-DPSYNHSSPEPPAFHGRRIPSKVKSWMGKVNMIEAERRLISNA  136

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSN-ETFIEVYDLPGPVGRGRYSSQMNPII  616
             LLD SNERF+LLSE+CIPLFNFST+YS+++NS  ++FI  YD P  VGRGRY ++M P I
Sbjct  137   LLDISNERFVLLSESCIPLFNFSTVYSFLINSTMKSFIMSYDEPSNVGRGRYRNKMFPPI  196

Query  615   KLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNS  436
              L  WRKGSQWFE+D   A+ V+SD+ YFP+FQ+YC G CYSDEHYLPTL+N+     N 
Sbjct  197   SLKQWRKGSQWFEIDETXAVAVVSDKKYFPVFQNYCKGQCYSDEHYLPTLVNVLGWDRNG  256

Query  435   NRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRN--GNTCEYNGEKTTMCHLFARKFTLH  262
             NR+LTWVDW+KGGPHP +++R+D+ V+ + +LRN  G   +   E   +C LFARKF  +
Sbjct  257   NRSLTWVDWSKGGPHPARYSRSDIHVELIQRLRNQTGECRKSKMEGKGVCFLFARKFAPN  316

Query  261   ALSRLLILAPKLMQF  217
             AL RL+ +APK M F
Sbjct  317   ALERLVNIAPKAMYF  331



>ref|XP_009358798.1| PREDICTED: uncharacterized protein LOC103949407 [Pyrus x bretschneideri]
Length=350

 Score =   371 bits (953),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 195/315 (62%), Positives = 238/315 (76%), Gaps = 6/315 (2%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
              GLK+ L  PP A H++++ ELLWRASM+P+I E PF  VPKVAFMFLTRG + LAPLWE
Sbjct  38    TGLKDYL-KPPKAFHDMNNSELLWRASMTPRIPEYPFHLVPKVAFMFLTRGPVVLAPLWE  96

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllana  793
              FF G+ GL+SIYVHSS PSYN +   E+ VF  RRIPS+ VEWGK ++IEAERRLLANA
Sbjct  97    KFFAGHQGLYSIYVHSS-PSYNHSSYTETPVFRSRRIPSQEVEWGKVSLIEAERRLLANA  155

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SN+RF+LLSEACIPL+NFST+YSY+MNS +TF+EVYD P  VGRGRY     P I 
Sbjct  156   LLDISNQRFVLLSEACIPLYNFSTVYSYLMNSTQTFVEVYDDPSGVGRGRYELSDYPGIT  215

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             ++ WRKGSQWF+ DR LALE +SD+ YFP+F   C   C++DEHYLPT +++K G  N+N
Sbjct  216   IDQWRKGSQWFQADRDLALEFVSDRKYFPVFMK-CKDYCFADEHYLPTFVHMKFGAKNAN  274

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRN--GNTCEYNGEKTTMCHLFARKFTLHA  259
             RTLTWVDW KGGPHPT++   +VT + L+ LRN  G  CEYNG  T +C LFARKF   A
Sbjct  275   RTLTWVDWEKGGPHPTEYKSENVTAELLSGLRNGFGRKCEYNGRSTDVCFLFARKFPPTA  334

Query  258   LSRLLILAPKLMQFN  214
             L  LL  A +++ FN
Sbjct  335   LDNLLKFAGEIIHFN  349



>ref|XP_008244554.1| PREDICTED: uncharacterized protein LOC103342693 [Prunus mume]
Length=341

 Score =   371 bits (952),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/299 (60%), Positives = 235/299 (79%), Gaps = 1/299 (0%)
 Frame = -3

Query  1110  AHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIY  931
              HN+SDEEL WRASM P+I ++P++ VPKVAFMFLT+G LPL PLWE FF G+ GL+S+Y
Sbjct  43    VHNMSDEELFWRASMVPRIQKLPYKYVPKVAFMFLTKGPLPLGPLWEKFFEGHEGLYSVY  102

Query  930   VHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSE  751
             VH+  P +NE+ P +SVFHG+RI S+ V WG + M++AERRLLANALLDFSN+RF+LLSE
Sbjct  103   VHAH-PDFNESVPEDSVFHGKRIHSQPVYWGTSTMLDAERRLLANALLDFSNQRFVLLSE  161

Query  750   ACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMD  571
             +CIPLFNF+T Y Y++NSN +F+  +D P   GRGRY+ QM PII + +WRKGSQWFE+ 
Sbjct  162   SCIPLFNFTTTYDYLINSNLSFLSSFDDPRKPGRGRYNPQMYPIINITNWRKGSQWFEVH  221

Query  570   RRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPH  391
             R LA+ ++SD  Y+P+FQ YC  PCY DEHY+PTL+N+   + NS R++TWVDW++GGPH
Sbjct  222   RELAIHIVSDCKYYPIFQEYCHPPCYIDEHYIPTLVNLLYSELNSKRSITWVDWSRGGPH  281

Query  390   PTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             P KF  +D+T +FLN++R G+ CEYNG  T++C LFARKF  + L  LL +AP L+ F+
Sbjct  282   PGKFGGSDITDEFLNRIRFGSECEYNGNTTSICFLFARKFMPNTLEPLLRVAPLLLGFD  340



>ref|XP_009615448.1| PREDICTED: uncharacterized protein LOC104108166 [Nicotiana tomentosiformis]
Length=401

 Score =   372 bits (955),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 184/311 (59%), Positives = 241/311 (77%), Gaps = 2/311 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             + LK+ L +P    H ++D+EL+WRASM  ++ + PF R PKVAF+FLTRG LPLAPLWE
Sbjct  92    MDLKDFL-SPKDLWHAMNDDELMWRASMVSQVKQYPFNRTPKVAFLFLTRGRLPLAPLWE  150

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
             MFF+ N GLFSIY+H+S P +N   PP SVF+ RRIPS+ V+WG+A+MI+AERRLLANAL
Sbjct  151   MFFKRNEGLFSIYLHTS-PEFNFEPPPSSVFYKRRIPSQTVQWGRASMIDAERRLLANAL  209

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SNERFILLSE CIPLFNF+TIY+++  SN++F+ ++D P  +GRGRY+ +M+PII +
Sbjct  210   LDISNERFILLSETCIPLFNFTTIYNFLTKSNQSFLGLFDDPRKIGRGRYNKRMHPIITI  269

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
             +DWRKGSQWFE+ R+LAL++ISD TY+P+F++YCT PCY DEHYLPTL+N    +  SN 
Sbjct  270   SDWRKGSQWFEVHRKLALKIISDVTYYPVFKNYCTPPCYMDEHYLPTLVNKVCPKLTSNW  329

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             ++TW DW+ GG HPT F R DVT +FL+ +R G  C YNGE +++C LF RKF    L  
Sbjct  330   SVTWADWSAGGSHPTTFLRKDVTEEFLDSVRYGFNCSYNGELSSICFLFGRKFHPSTLQP  389

Query  249   LLILAPKLMQF  217
             LL + PKL+ F
Sbjct  390   LLRIGPKLLGF  400



>ref|XP_008243418.1| PREDICTED: uncharacterized protein LOC103341652 [Prunus mume]
Length=410

 Score =   372 bits (955),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 195/316 (62%), Positives = 238/316 (75%), Gaps = 7/316 (2%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GL E L  P    H+++D ELLWRASMSP+I E PF  +PK+AFMFL RG + LAPLWE
Sbjct  94    IGLTEYL-KPLKVFHDMNDTELLWRASMSPRIPEYPFHLIPKIAFMFLARGPVLLAPLWE  152

Query  969   MFFRGNAGLFSIYVHSSDPSYNE-TEPPESVFHGRRIPSK-GVEWGKANMIeaerrllan  796
              FF G+ G +SIYVHS +PS+N+ +    SVFHGRRIPS   V+WG  ++IEAER LLAN
Sbjct  153   KFFEGHQGFYSIYVHS-EPSHNQPSYAGSSVFHGRRIPSDLKVKWGTVSLIEAERLLLAN  211

Query  795   alLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPII  616
             ALLD SN+RF+LLSEACIPL+NFST+YSY++NS ETF+EVYD P  VGRGRY     P I
Sbjct  212   ALLDISNQRFVLLSEACIPLYNFSTVYSYLINSKETFVEVYDDPSAVGRGRYYFVQYPGI  271

Query  615   KLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNS  436
              ++ WRKGSQWFE+DR LA+EV+SD+ YFP++   C G C++DEHYLPT +NIK G  N+
Sbjct  272   SVDQWRKGSQWFEIDRDLAIEVVSDRKYFPVYFR-CRGECFADEHYLPTFVNIKFGAKNA  330

Query  435   NRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRN--GNTCEYNGEKTTMCHLFARKFTLH  262
             NRTLTWVDWAK GPHPT++  + VTV+ LN LR   G  CEYNG  T +C LFARKF   
Sbjct  331   NRTLTWVDWAKSGPHPTEYMSSTVTVELLNGLRTGYGRRCEYNGRSTHVCFLFARKFPPS  390

Query  261   ALSRLLILAPKLMQFN  214
             AL  LL +APK+M FN
Sbjct  391   ALDSLLRIAPKIMHFN  406



>ref|XP_008340286.1| PREDICTED: uncharacterized protein LOC103403235 [Malus domestica]
Length=412

 Score =   372 bits (955),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 195/315 (62%), Positives = 237/315 (75%), Gaps = 6/315 (2%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +GLK+ L  PP A H++++ ELLWRASM+P+I E PF  VPKVAFMFLTRG + LAPLWE
Sbjct  100   IGLKDYL-KPPKAFHDMNNSELLWRASMTPRIPEYPFHLVPKVAFMFLTRGPVVLAPLWE  158

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllana  793
              FF G+ G +SIYVHSS PSYN +   E+ VF GRRIPS+ VEWGK ++IEAERRLLANA
Sbjct  159   KFFAGHQGFYSIYVHSS-PSYNHSSYTETPVFRGRRIPSQEVEWGKVSLIEAERRLLANA  217

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SN+RF+LLSEACIPL+NFST+YSY+MNS +TF+EVYD P  VGRGRY     P I 
Sbjct  218   LLDISNQRFVLLSEACIPLYNFSTVYSYLMNSTQTFVEVYDDPSGVGRGRYELSDYPGIT  277

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             ++ WRKGSQWF+ DR LALE +SD+ YFP+F   C   C++DEHYLPT + +K G  N+N
Sbjct  278   IDQWRKGSQWFQADRDLALEFVSDRKYFPVFMK-CKDYCFADEHYLPTFVYMKFGAKNAN  336

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRN--GNTCEYNGEKTTMCHLFARKFTLHA  259
             RTLTWVDW KGGPHPT++   +VT + L+ LRN  G  CEYNG  T +C LFARKF   A
Sbjct  337   RTLTWVDWEKGGPHPTEYKSENVTAELLSDLRNGFGRKCEYNGRSTDVCFLFARKFPPTA  396

Query  258   LSRLLILAPKLMQFN  214
             L  LL  A + + FN
Sbjct  397   LDNLLKFARESIHFN  411



>ref|XP_007036566.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY21067.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=463

 Score =   374 bits (959),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 184/306 (60%), Positives = 234/306 (76%), Gaps = 1/306 (0%)
 Frame = -3

Query  1119  PGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLF  940
             P   HN+SDEEL WRAS  P++ E PF  VPK+AFMFLT+GALPLAPLWEMFF+G+ GL+
Sbjct  159   PPLMHNMSDEELFWRASFVPRVKEFPFENVPKIAFMFLTKGALPLAPLWEMFFKGHEGLY  218

Query  939   SIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFIL  760
             +IYVH   P Y ++ P +SVF+GRRIPSK VEWGK  MI+AERRLLANALLDF+N+RF+L
Sbjct  219   NIYVHP-HPLYKDSVPEDSVFYGRRIPSKPVEWGKKTMIDAERRLLANALLDFTNDRFVL  277

Query  759   LSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWF  580
             LSE CIPLFNF+TIY+Y++NSN+++I  YD P  VGRGRY+ +M P I +  WRKGSQWF
Sbjct  278   LSETCIPLFNFTTIYNYLLNSNQSYIGSYDDPRKVGRGRYNPKMFPAISIAQWRKGSQWF  337

Query  579   EMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKG  400
             E+ R LA+E++SD+ Y+  F+ YC+ PCY DEHY+PTL+ I   + NSNR++TWVDW+K 
Sbjct  338   EVTRSLAIEIVSDKKYYESFRKYCSPPCYMDEHYIPTLVYIAWPEQNSNRSVTWVDWSKA  397

Query  399   GPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQ  220
             GPHP KF +  ++ DFLNK+R    C YNG  T+MC LFARKF  + L  LL +A  L+ 
Sbjct  398   GPHPGKFGKGAISEDFLNKVRFAGNCCYNGNITSMCFLFARKFLPNTLQPLLDIATMLLS  457

Query  219   FNGY*T  202
              N + T
Sbjct  458   SNQFLT  463



>gb|KDP29448.1| hypothetical protein JCGZ_18369 [Jatropha curcas]
Length=258

 Score =   366 bits (939),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 178/258 (69%), Positives = 216/258 (84%), Gaps = 1/258 (0%)
 Frame = -3

Query  987  LAPLWEMFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerr  808
            +APLWE FF+G+ GL++IYVHS +PSYNE+ P   VFHGRRIPSK V+WG  NMIEAERR
Sbjct  1    MAPLWEKFFKGHEGLYTIYVHS-NPSYNESFPESPVFHGRRIPSKDVKWGNVNMIEAERR  59

Query  807  llanalLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQM  628
            LLANALLD SN+RF+LLSEACIPLFNFSTIYSY++NS + F+E YDL GPVGRGRY+ QM
Sbjct  60   LLANALLDISNQRFVLLSEACIPLFNFSTIYSYLINSTKNFVEAYDLEGPVGRGRYNHQM  119

Query  627  NPIIKLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLG  448
            +P I ++ WRKGSQWFEMDR+LA+EV+SDQ YFP+FQ YC G CY+DEHYLPT +++K  
Sbjct  120  SPQITIDQWRKGSQWFEMDRQLAIEVVSDQKYFPIFQKYCKGNCYADEHYLPTFVSMKHW  179

Query  447  QGNSNRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFT  268
            Q NSNR+LTWVDW++GGPHPT+F R +VTV+FL KLR+G+ C YNG+ +++C LFARKF 
Sbjct  180  QRNSNRSLTWVDWSRGGPHPTRFIRTEVTVEFLEKLRSGSKCLYNGKSSSICFLFARKFL  239

Query  267  LHALSRLLILAPKLMQFN  214
              AL RLL  APK M FN
Sbjct  240  PTALDRLLRFAPKAMHFN  257



>gb|EPS59287.1| hypothetical protein M569_15522 [Genlisea aurea]
Length=387

 Score =   370 bits (950),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 184/293 (63%), Positives = 234/293 (80%), Gaps = 4/293 (1%)
 Frame = -3

Query  1089  ELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHSSDPS  910
             E+  RAS    + +  FR VPKVAFMFLT+G + LAPLWE FF+G  GL+S+YVH  DP 
Sbjct  97    EIFRRASRI--LPDSDFREVPKVAFMFLTKGPVILAPLWEEFFKGYRGLYSVYVHC-DPG  153

Query  909   YNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEACIPLFN  730
             YN +EP  SVF GRRI S+ V+WGK NM+EAERRLLANALLD SN+RF+LLSE+CIPL+N
Sbjct  154   YNGSEPEGSVFRGRRIHSQRVDWGKVNMVEAERRLLANALLDSSNQRFVLLSESCIPLYN  213

Query  729   FSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRLALEV  550
             FST+YSY++NS++TF+E+YDLPG VGRGRY+ +M+P I+++ WRKGSQWF  DRRLA+E+
Sbjct  214   FSTVYSYLLNSSQTFVELYDLPGAVGRGRYNPKMSPTIRIHQWRKGSQWFAADRRLAIEI  273

Query  549   ISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIK-LGQGNSNRTLTWVDWAKGGPHPTKFTR  373
             ISD+TY+P+F+ YC G CY+DEHYLPT + ++  G+ N+NRTLTWVDW++GGPHP KF R
Sbjct  274   ISDRTYWPVFRRYCNGSCYADEHYLPTFVLMREFGRRNANRTLTWVDWSRGGPHPAKFIR  333

Query  372   NDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
              DVT +FL +LR    CEYNG K  +C LFARKFT   L+RLL  AP++M F+
Sbjct  334   TDVTPEFLQRLRAAGECEYNGRKGGVCFLFARKFTESTLTRLLRFAPRVMMFD  386



>ref|XP_002279551.2| PREDICTED: uncharacterized protein LOC100250702 [Vitis vinifera]
Length=427

 Score =   371 bits (953),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 182/306 (59%), Positives = 234/306 (76%), Gaps = 1/306 (0%)
 Frame = -3

Query  1131  LMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGN  952
             L+AP    H+++D+EL+WRASM P   + P+ R PKVAFMFL+RG LPLA LWE FF+G+
Sbjct  122   LIAPKELWHSMNDKELMWRASMVPHFVDYPYDRTPKVAFMFLSRGRLPLASLWEKFFKGH  181

Query  951   AGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNE  772
             AGL+SIY+H+S P +N   P  SVF+ RRIPSK V+WGKA M++AERRLLANALLDFSNE
Sbjct  182   AGLYSIYLHTS-PEFNTEMPESSVFYKRRIPSKSVDWGKATMVDAERRLLANALLDFSNE  240

Query  771   RFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKG  592
             RF+LLSE CIPLFNF+TIY Y++NSN +F+  +D P  +GRGRY+ +M P + L DWRKG
Sbjct  241   RFVLLSETCIPLFNFTTIYKYLINSNHSFVSSFDDPRHIGRGRYNKRMFPTVTLPDWRKG  300

Query  591   SQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVD  412
             SQWFE+ R+LA+E++SD TY+P+FQ +C  PCY DEHYL TL+N      NSNR++TWVD
Sbjct  301   SQWFEVHRKLAIEIVSDVTYYPIFQEHCRPPCYMDEHYLATLVNKLRPDLNSNRSITWVD  360

Query  411   WAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAP  232
             W++GG HPTKF R DV+  FLN+ R+G  C YN   +++C LFARKF    L  LL +AP
Sbjct  361   WSRGGSHPTKFVRKDVSEAFLNQARHGFNCSYNSGLSSICFLFARKFHPSTLEPLLRIAP  420

Query  231   KLMQFN  214
              L+ F+
Sbjct  421   SLLGFD  426



>ref|XP_009767015.1| PREDICTED: uncharacterized protein LOC104218269 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009767016.1| PREDICTED: uncharacterized protein LOC104218269 isoform X2 [Nicotiana 
sylvestris]
Length=310

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 182/304 (60%), Positives = 235/304 (77%), Gaps = 1/304 (0%)
 Frame = -3

Query  1128  MAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNA  949
             ++P    H ++DEEL+WRASM  +I + PF R PKVAF+FLTRG LPLAPLWEMFF+G+ 
Sbjct  7     LSPKDLWHAMNDEELMWRASMVSQIMDYPFNRTPKVAFLFLTRGRLPLAPLWEMFFKGHE  66

Query  948   GLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNER  769
              LFSIY+H+S P +N   PP SVF+ RRIPS+ V+WG+A+MI+AERRLLANALLD SNER
Sbjct  67    ELFSIYLHTS-PEFNFEPPPTSVFYKRRIPSQEVQWGRASMIDAERRLLANALLDISNER  125

Query  768   FILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGS  589
             FILLSE CIPLFNF+TIY+++  SN++F+ ++D P  +GRGRY+ +M PII ++DWRKGS
Sbjct  126   FILLSETCIPLFNFTTIYTFLTKSNQSFLGLFDDPRKIGRGRYNKRMYPIITISDWRKGS  185

Query  588   QWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDW  409
             QWFE+ R LAL++ISD TY+P+F++YCT PCY DEHYLPTL+N    +  SN ++TW DW
Sbjct  186   QWFEVHRELALKIISDVTYYPVFKNYCTPPCYMDEHYLPTLVNKVCPKLTSNWSVTWADW  245

Query  408   AKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPK  229
             + GG HPT F R DVT +FL+ +R G+ C YNGE +++C LF RKF    L  LL + PK
Sbjct  246   SAGGSHPTTFLRKDVTEEFLDSVRYGSNCSYNGELSSICFLFGRKFHPSTLQPLLRIGPK  305

Query  228   LMQF  217
             L  F
Sbjct  306   LFGF  309



>ref|XP_002524909.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37533.1| conserved hypothetical protein [Ricinus communis]
Length=405

 Score =   369 bits (948),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/304 (59%), Positives = 243/304 (80%), Gaps = 8/304 (3%)
 Frame = -3

Query  1119  PGAAHNLSDE-ELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGL  943
             P  AHN+ D  ELL RA+M      +P   VPKVAFMFLT+G LPLA LWE FF+G+ GL
Sbjct  101   PPLAHNMEDNVELLHRAAM------VPHDHVPKVAFMFLTKGPLPLAALWEKFFKGHEGL  154

Query  942   FSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFI  763
             ++IYVHS  PS+N+T P +SVFHGRR+PSK VEWGK +MI+AERRLLANALLDFSNERF+
Sbjct  155   YTIYVHS-HPSFNDTVPQDSVFHGRRVPSKPVEWGKPSMIDAERRLLANALLDFSNERFV  213

Query  762   LLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQW  583
             LLSE+CIPLFNF+TIY+Y++N+N++FI+ +D P  +GRGRY+ +M+P I ++DWRKGSQW
Sbjct  214   LLSESCIPLFNFTTIYNYLLNTNQSFIDSFDDPRKIGRGRYNPKMSPTINISDWRKGSQW  273

Query  582   FEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAK  403
             FE++R+LA++++SD  Y+P+F  +C+ PCY DEHY+PTL+N+   + N+NR +TWVDW+K
Sbjct  274   FEVNRKLAIKIVSDTKYYPIFSEHCSPPCYMDEHYIPTLVNVICPEENANRGITWVDWSK  333

Query  402   GGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLM  223
              GPHP KF + DV+V+FL+++R G+ C YNG  +++C LFARKF  + L  LL +AP+L+
Sbjct  334   SGPHPGKFVKQDVSVEFLDQIRFGHNCSYNGIASSICFLFARKFLPNTLQPLLHIAPELL  393

Query  222   QFNG  211
              F+ 
Sbjct  394   YFSN  397



>ref|XP_008240317.1| PREDICTED: uncharacterized protein LOC103338839 [Prunus mume]
Length=380

 Score =   368 bits (945),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 183/293 (62%), Positives = 231/293 (79%), Gaps = 3/293 (1%)
 Frame = -3

Query  1095  DEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHSSD  916
             D+ELLWRAS+ P+I + PF  VP+VAFMFLT+G +PLAPLWEMFF+G+ GL++IYVH+  
Sbjct  85    DDELLWRASLVPRIRKFPFNHVPRVAFMFLTKGPIPLAPLWEMFFKGHEGLYTIYVHTH-  143

Query  915   PSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEACIPL  736
             PSY ++ P  SVF+GRRIPSK V WGK+ MI+ ERRLLA+ALLDFSNERF+LLSE+CIPL
Sbjct  144   PSYVDSWPQNSVFYGRRIPSKEVGWGKSTMIDGERRLLASALLDFSNERFVLLSESCIPL  203

Query  735   FNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRLAL  556
             FNF+TIYSY+MNS+E+ I  YD P  VGRGRY+ +M P I ++DWRKGSQWFE  R+LA+
Sbjct  204   FNFTTIYSYLMNSSESNIGSYDDPRKVGRGRYNPKMWPAINISDWRKGSQWFEASRKLAI  263

Query  555   EVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTKFT  376
             E+ISD  Y+P+F+ +C  PCY DEHY+PTL+NI   + NSNR++TWVDW+K GPHP +F 
Sbjct  264   EIISDTKYYPIFKEHCNPPCYMDEHYIPTLVNILGVEDNSNRSITWVDWSKSGPHPGRFR  323

Query  375   RNDVTVDFLNKLRNGNTCEYNG--EKTTMCHLFARKFTLHALSRLLILAPKLM  223
             RNDV+ +FLN++R G  C  NG    T MC LFARKF    L  LL +AP L+
Sbjct  324   RNDVSYEFLNQIRFGTNCTCNGINATTCMCFLFARKFMGDTLRPLLQIAPILL  376



>ref|XP_009767014.1| PREDICTED: uncharacterized protein LOC104218269 isoform X1 [Nicotiana 
sylvestris]
Length=406

 Score =   369 bits (947),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 182/304 (60%), Positives = 235/304 (77%), Gaps = 1/304 (0%)
 Frame = -3

Query  1128  MAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNA  949
             ++P    H ++DEEL+WRASM  +I + PF R PKVAF+FLTRG LPLAPLWEMFF+G+ 
Sbjct  103   LSPKDLWHAMNDEELMWRASMVSQIMDYPFNRTPKVAFLFLTRGRLPLAPLWEMFFKGHE  162

Query  948   GLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNER  769
              LFSIY+H+S P +N   PP SVF+ RRIPS+ V+WG+A+MI+AERRLLANALLD SNER
Sbjct  163   ELFSIYLHTS-PEFNFEPPPTSVFYKRRIPSQEVQWGRASMIDAERRLLANALLDISNER  221

Query  768   FILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGS  589
             FILLSE CIPLFNF+TIY+++  SN++F+ ++D P  +GRGRY+ +M PII ++DWRKGS
Sbjct  222   FILLSETCIPLFNFTTIYTFLTKSNQSFLGLFDDPRKIGRGRYNKRMYPIITISDWRKGS  281

Query  588   QWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDW  409
             QWFE+ R LAL++ISD TY+P+F++YCT PCY DEHYLPTL+N    +  SN ++TW DW
Sbjct  282   QWFEVHRELALKIISDVTYYPVFKNYCTPPCYMDEHYLPTLVNKVCPKLTSNWSVTWADW  341

Query  408   AKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPK  229
             + GG HPT F R DVT +FL+ +R G+ C YNGE +++C LF RKF    L  LL + PK
Sbjct  342   SAGGSHPTTFLRKDVTEEFLDSVRYGSNCSYNGELSSICFLFGRKFHPSTLQPLLRIGPK  401

Query  228   LMQF  217
             L  F
Sbjct  402   LFGF  405



>ref|XP_011007493.1| PREDICTED: uncharacterized protein LOC105113152 isoform X1 [Populus 
euphratica]
Length=415

 Score =   369 bits (947),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 184/308 (60%), Positives = 234/308 (76%), Gaps = 5/308 (2%)
 Frame = -3

Query  1128  MAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNA  949
             + P    H+++D+ELLWRASM P I E P+ R PKVAFMFLTRG+LPLAPLW+MFF+G+A
Sbjct  107   VTPKELCHSMNDKELLWRASMVPHIDEYPYNRTPKVAFMFLTRGSLPLAPLWDMFFKGHA  166

Query  948   GLFSIYVHSSDPSYNETEPPESVFHGRRIPSKG----VEWGKANMIeaerrllanalLDF  781
             GL+SIY+H S P +    P  SVF+ R+IPSK      EWG+A MI+AERRLLANALLDF
Sbjct  167   GLYSIYLHKS-PEFTNQHPESSVFYQRQIPSKCFLQPAEWGRATMIDAERRLLANALLDF  225

Query  780   SNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDW  601
             SNERF+LLSE CIP+FNFSTIY+Y+MNSN++F+  +D P  +GRGRY+ +M P + L+DW
Sbjct  226   SNERFVLLSETCIPVFNFSTIYNYLMNSNQSFLGSFDDPRHMGRGRYNKRMRPTVTLSDW  285

Query  600   RKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLT  421
             RKGSQWFE  R++A+E+ISD  Y+P+F+ +C  PCY DEHY PTL+     + NSNR++T
Sbjct  286   RKGSQWFEAHRKVAIEMISDVKYYPVFRDHCRPPCYMDEHYFPTLVTKISPELNSNRSIT  345

Query  420   WVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLI  241
             WVDW+ GG HPT+F R DV+  FLN++RNG  C YNG  TT+C LFARKF    L  LL 
Sbjct  346   WVDWSGGGSHPTRFVRKDVSEAFLNQIRNGFNCTYNGGITTVCFLFARKFHPSTLDPLLR  405

Query  240   LAPKLMQF  217
             +AP L+ F
Sbjct  406   IAPGLLGF  413



>gb|KDP29447.1| hypothetical protein JCGZ_18368 [Jatropha curcas]
Length=353

 Score =   367 bits (941),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 180/306 (59%), Positives = 230/306 (75%), Gaps = 1/306 (0%)
 Frame = -3

Query  1128  MAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNA  949
             +AP    H++ D+ELLWRASM P+I E P+ R  KVAFMFLT+G+LPLAPLWE FF+G  
Sbjct  49    IAPMEIWHSMKDKELLWRASMVPRIDEYPYNRTSKVAFMFLTKGSLPLAPLWERFFKGQE  108

Query  948   GLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNER  769
             GL+SIYVH+S P +       SVFH RRIPS+ VEWGKA M++AERRLLANALLDFSNER
Sbjct  109   GLYSIYVHTS-PEFTFEPSQSSVFHNRRIPSQQVEWGKATMVDAERRLLANALLDFSNER  167

Query  768   FILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGS  589
             F+LLSE CIP+FNF+TIY+Y++NSN++F+  YD P   GRGRY+ ++ P + L+DWRKGS
Sbjct  168   FVLLSETCIPIFNFTTIYNYLINSNQSFLASYDDPSRAGRGRYNKRLWPTVTLSDWRKGS  227

Query  588   QWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDW  409
             QWFE+ R+L  +++SD  Y+P+F+ YC  PCY DEHY PTL+     + NSNR++TWVDW
Sbjct  228   QWFEIHRKLTGKIVSDVKYYPIFRDYCKPPCYMDEHYFPTLVTKICPELNSNRSITWVDW  287

Query  408   AKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPK  229
             + GGPHP  + + DV+  FLN +RNG  C YNG  TT+C LFARKF   AL  LL +AP 
Sbjct  288   SLGGPHPRNYVKKDVSEAFLNWIRNGFNCSYNGAMTTVCFLFARKFHSSALQPLLRIAPA  347

Query  228   LMQFNG  211
             L+ F+ 
Sbjct  348   LLGFSS  353



>ref|XP_008459135.1| PREDICTED: uncharacterized protein LOC103498310 [Cucumis melo]
Length=405

 Score =   369 bits (946),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 181/305 (59%), Positives = 236/305 (77%), Gaps = 6/305 (2%)
 Frame = -3

Query  1119  PGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLF  940
             P   H +SD+E+ WRASM P I E P+ RVPK+AFMFL +G+LPLAPLWEMFF+G+  LF
Sbjct  99    PPLMHRMSDDEVFWRASMVPMIKEFPYERVPKIAFMFLIKGSLPLAPLWEMFFKGHEHLF  158

Query  939   SIYVHSSDPSYNETE--PPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERF  766
             SIYVH+  P YN +   PP SVF+GRRIPS+ V+WG+ +MI+AERRLLANALLDFSNERF
Sbjct  159   SIYVHT-HPLYNVSSSLPPNSVFYGRRIPSQAVQWGRPSMIDAERRLLANALLDFSNERF  217

Query  765   ILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQ  586
             ILLSE CIPL+NF+TIY+Y++NS  TF+  YD P  +GRGRY+ +M PI+ + DWRKGSQ
Sbjct  218   ILLSETCIPLYNFTTIYNYLINSQYTFVSSYDDPRKIGRGRYNPRMFPIVSIADWRKGSQ  277

Query  585   WFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWA  406
             WFE+DR +A+E+ISD TY+P+F+ +C  PCY DEHY+PTL+NI L + NSN+T+TWVDW+
Sbjct  278   WFEVDRTVAIEIISDTTYYPIFREHCGPPCYMDEHYIPTLVNIVLPERNSNQTVTWVDWS  337

Query  405   KGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEK---TTMCHLFARKFTLHALSRLLILA  235
             K GPHP +F R +++++ LN++R    C YN  K    ++C LFARKF   +L  LL + 
Sbjct  338   KNGPHPGRFGRREISLELLNRVRFSFNCSYNDGKNDTVSLCFLFARKFMPDSLQPLLKIW  397

Query  234   PKLMQ  220
             P L+Q
Sbjct  398   PSLLQ  402



>ref|XP_002280674.1| PREDICTED: uncharacterized protein LOC100244641 [Vitis vinifera]
Length=414

 Score =   369 bits (947),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 184/298 (62%), Positives = 233/298 (78%), Gaps = 1/298 (0%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYV  928
             HN+SDEEL WRASM PK+ E+P++ V KVAFMFLT+G  PL PLWE FF G+ GL+SIYV
Sbjct  117   HNMSDEELFWRASMVPKVQELPYKLVRKVAFMFLTKGPHPLVPLWEKFFEGHGGLYSIYV  176

Query  927   HSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEA  748
             H   PS++E+ P  SVFHGRRIPSK V WG A+MI+AERRLLANALLDFSN+RF+LLSE+
Sbjct  177   HP-HPSFDESVPETSVFHGRRIPSKPVYWGTASMIDAERRLLANALLDFSNQRFVLLSES  235

Query  747   CIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDR  568
             CIPLFNF+T Y+Y+M SN +F+  +D P   GRGRY+ QM P I ++DWRKGSQWFE+ R
Sbjct  236   CIPLFNFTTTYNYLMASNLSFLGSFDDPRKPGRGRYNPQMWPAINISDWRKGSQWFEVHR  295

Query  567   RLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHP  388
              LA+++ISD+ Y+ +F  YC  PCY DEHY+PTL+N+   + NSNR++TWVDW++GGPHP
Sbjct  296   ELAVQIISDRKYYTIFGEYCHPPCYMDEHYIPTLVNMLYVKMNSNRSITWVDWSRGGPHP  355

Query  387   TKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             +KF   D+T +FLNK+R G+ C YNG  T +C LFARKF   AL  LL +AP L+ F+
Sbjct  356   SKFGWGDITDEFLNKIRYGSDCIYNGNTTNICFLFARKFLPTALEPLLRIAPLLLGFD  413



>ref|XP_007208880.1| hypothetical protein PRUPE_ppa026447mg [Prunus persica]
 gb|EMJ10079.1| hypothetical protein PRUPE_ppa026447mg [Prunus persica]
Length=436

 Score =   369 bits (948),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 183/293 (62%), Positives = 232/293 (79%), Gaps = 3/293 (1%)
 Frame = -3

Query  1095  DEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHSSD  916
             D+ELLWRAS+ P+I + PF  VP+VAFMFLT+G +PLAPLWEMFF+G+ GL++IYVH+  
Sbjct  141   DDELLWRASLVPRIRKFPFNHVPRVAFMFLTKGNIPLAPLWEMFFKGHEGLYTIYVHT-H  199

Query  915   PSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEACIPL  736
             PSY ++ P  SVF+GRRIPSK VEWGK  MI+ ERRLLA+ALLDFSNERF+LLSE+CIPL
Sbjct  200   PSYVDSWPQNSVFYGRRIPSKEVEWGKPTMIDGERRLLASALLDFSNERFVLLSESCIPL  259

Query  735   FNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRLAL  556
             FNF+TIYSY++NS+E+ I  YD P  VGRGRY+ +M P I ++DWRKGSQWFE  R+LA+
Sbjct  260   FNFTTIYSYLVNSSESNIGSYDDPRKVGRGRYNPKMWPAINISDWRKGSQWFEASRKLAI  319

Query  555   EVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTKFT  376
             E+ISD  Y+P+F+ +C  PCY DEHY+PTL+NI   + NSNR++TWVDW++GGPHP +F 
Sbjct  320   EIISDTKYYPIFKEHCNPPCYMDEHYIPTLVNILGVEDNSNRSITWVDWSRGGPHPRRFG  379

Query  375   RNDVTVDFLNKLRNGNTCEYNG--EKTTMCHLFARKFTLHALSRLLILAPKLM  223
             RNDV+ +FLN++R G  C  NG    T MC LFARKF    L  LL +AP L+
Sbjct  380   RNDVSYEFLNQIRFGTNCTCNGINATTCMCFLFARKFMGDTLRPLLQIAPILL  432



>ref|XP_004300973.1| PREDICTED: uncharacterized protein LOC101293399 [Fragaria vesca 
subsp. vesca]
Length=409

 Score =   368 bits (945),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/306 (60%), Positives = 232/306 (76%), Gaps = 3/306 (1%)
 Frame = -3

Query  1128  MAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNA  949
             +AP    H++SD+ELLWRASM+P++ E P+ R PKVAFMFLT+G LPLAPLWE FFRG+ 
Sbjct  98    IAPKELWHSMSDQELLWRASMAPQVTEYPYNRTPKVAFMFLTKGKLPLAPLWERFFRGHE  157

Query  948   GLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNER  769
             G +S+Y+H++ P +    P  SVF+ R IPSK VEWGK  M+EAERRLLANALLDFSNER
Sbjct  158   GFYSVYLHAA-PDFKNEPPESSVFYKRMIPSKAVEWGKVTMVEAERRLLANALLDFSNER  216

Query  768   FILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGS  589
             F+LLSE+CIPLFNF+T+Y Y+ NS  +FI  +D P   GRGRY+ +M P + L+DWRKGS
Sbjct  217   FVLLSESCIPLFNFTTVYDYLTNSKYSFISSFDDPRGTGRGRYNRRMWPTVTLSDWRKGS  276

Query  588   QWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQG-NSNRTLTWVD  412
             QWFE+ R LAL+++SD TYFP+F+  C  PCY+DEHYL TL+  K+G G NSNR++TW D
Sbjct  277   QWFEVHRNLALKIVSDVTYFPIFRDLCQPPCYNDEHYLATLVT-KVGPGVNSNRSITWAD  335

Query  411   WAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAP  232
             W+ GGPHP  + R DV   FLN+LR+G  C YNG  + +CHLFARKF   AL  LL +AP
Sbjct  336   WSIGGPHPATYERRDVNEMFLNQLRHGFNCTYNGGISNICHLFARKFHPSALEPLLKIAP  395

Query  231   KLMQFN  214
              L +FN
Sbjct  396   ALFKFN  401



>ref|XP_010046585.1| PREDICTED: uncharacterized protein LOC104435558 [Eucalyptus grandis]
Length=403

 Score =   367 bits (941),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 235/304 (77%), Gaps = 0/304 (0%)
 Frame = -3

Query  1128  MAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNA  949
             + P  + H++SDEEL WRASM P I E P  R PKVAFMFL+RG+LPLAPLWE FF+G+ 
Sbjct  98    VGPETSWHSMSDEELAWRASMVPHILEYPCNRTPKVAFMFLSRGSLPLAPLWEKFFKGHK  157

Query  948   GLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNER  769
              L+SIY+H S    N+  P  SVF+ RRIPSK  +WG+A+MI+AERRLLANALLDFSNER
Sbjct  158   DLYSIYLHMSVDLGNDEMPETSVFYKRRIPSKPAQWGRASMIDAERRLLANALLDFSNER  217

Query  768   FILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGS  589
             F+LLSE CIPLFNF+T+YSY++NSN++F+  +D P P+GRGRY+ +M P + L++WRKGS
Sbjct  218   FVLLSETCIPLFNFTTVYSYLINSNQSFLGSFDDPRPMGRGRYNKRMWPTVSLSEWRKGS  277

Query  588   QWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDW  409
             QWFE+ RR+A+E++SD  Y+P+F+++C  PCY DEHYLPTL+       NSNR++TWVDW
Sbjct  278   QWFEVQRRVAVEIVSDVIYYPVFRNHCMPPCYMDEHYLPTLVTKVCPGANSNRSITWVDW  337

Query  408   AKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPK  229
             + GG HP +FTR DV+  FLN++R+G  C YNG  T++C LFARKF  + L  LL +AP 
Sbjct  338   SGGGSHPKQFTRTDVSQVFLNRIRHGFNCTYNGITTSICFLFARKFHPNTLQPLLKIAPP  397

Query  228   LMQF  217
             L+ F
Sbjct  398   LLGF  401



>emb|CBI26990.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   362 bits (930),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 228/296 (77%), Gaps = 1/296 (0%)
 Frame = -3

Query  1101  LSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHS  922
             ++D+EL+WRASM P   + P+ R PKVAFMFL+RG LPLA LWE FF+G+AGL+SIY+H+
Sbjct  1     MNDKELMWRASMVPHFVDYPYDRTPKVAFMFLSRGRLPLASLWEKFFKGHAGLYSIYLHT  60

Query  921   SDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEACI  742
             S P +N   P  SVF+ RRIPSK V+WGKA M++AERRLLANALLDFSNERF+LLSE CI
Sbjct  61    S-PEFNTEMPESSVFYKRRIPSKSVDWGKATMVDAERRLLANALLDFSNERFVLLSETCI  119

Query  741   PLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRL  562
             PLFNF+TIY Y++NSN +F+  +D P  +GRGRY+ +M P + L DWRKGSQWFE+ R+L
Sbjct  120   PLFNFTTIYKYLINSNHSFVSSFDDPRHIGRGRYNKRMFPTVTLPDWRKGSQWFEVHRKL  179

Query  561   ALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTK  382
             A+E++SD TY+P+FQ +C  PCY DEHYL TL+N      NSNR++TWVDW++GG HPTK
Sbjct  180   AIEIVSDVTYYPIFQEHCRPPCYMDEHYLATLVNKLRPDLNSNRSITWVDWSRGGSHPTK  239

Query  381   FTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             F R DV+  FLN+ R+G  C YN   +++C LFARKF    L  LL +AP L+ F+
Sbjct  240   FVRKDVSEAFLNQARHGFNCSYNSGLSSICFLFARKFHPSTLEPLLRIAPSLLGFD  295



>ref|XP_007033224.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY04150.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=421

 Score =   367 bits (941),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 182/299 (61%), Positives = 233/299 (78%), Gaps = 2/299 (1%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPF-RRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIY  931
             HN++++ELLWRASM+P+I E    +  PKVAFMFLT G LPLAPLWE FF+GN GL+SIY
Sbjct  123   HNMTEKELLWRASMAPRIEESSHDQHAPKVAFMFLTAGPLPLAPLWEKFFKGNEGLYSIY  182

Query  930   VHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSE  751
             VHS  P Y ET P  SVF+GRRIPSK V WG A MI+AERRLLANALLD SN+RF+LLS+
Sbjct  183   VHS-HPDYTETVPETSVFYGRRIPSKPVYWGTATMIDAERRLLANALLDISNQRFVLLSD  241

Query  750   ACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMD  571
             +CIPLFNF+ IY Y++NSN +F+ V+D P   GRGRY+ QM P I + DWRKGSQWFE+ 
Sbjct  242   SCIPLFNFNKIYDYLINSNLSFLSVFDDPRKAGRGRYNPQMWPAINITDWRKGSQWFEVH  301

Query  570   RRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPH  391
             R +AL ++SD+ Y+ +FQ YC  PCY+DEHY+PTL+N+  G+ NSNR+ TWVDW++GGPH
Sbjct  302   RDIALHIVSDKKYYSIFQQYCQPPCYNDEHYIPTLVNMFYGELNSNRSTTWVDWSRGGPH  361

Query  390   PTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             P KF   D++ +FLN++R+G+ C YNG  T+MC LFARKF+   L  LL +AP ++ F+
Sbjct  362   PRKFGWPDISDEFLNQIRHGSECIYNGNTTSMCFLFARKFSPGTLEPLLRIAPLVLDFD  420



>ref|XP_006448428.1| hypothetical protein CICLE_v10017943mg [Citrus clementina]
 gb|ESR61668.1| hypothetical protein CICLE_v10017943mg [Citrus clementina]
Length=411

 Score =   366 bits (940),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 235/307 (77%), Gaps = 2/307 (1%)
 Frame = -3

Query  1128  MAPP--GAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRG  955
             ++PP  G  H+++D+EL+WRASM PK+ E  + R PKVAFMFLTRG LPLAPLWE FF+G
Sbjct  104   ISPPNKGVWHSMNDDELMWRASMVPKVEEYAYNRKPKVAFMFLTRGILPLAPLWEKFFKG  163

Query  954   NAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSN  775
               GL+SIY+HSS P + +     SVF+ RRIPSK  EWGKA+MI+AERRLLANALLDFSN
Sbjct  164   YEGLYSIYLHSSKPGFTQESLNSSVFYNRRIPSKPAEWGKASMIDAERRLLANALLDFSN  223

Query  774   ERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRK  595
             ERF+LLSE CIPLFNF+T+Y+Y++NS  +     D P P+GRGRYS +M P + L+DWRK
Sbjct  224   ERFVLLSETCIPLFNFTTVYNYLINSRHSNQGSIDDPRPMGRGRYSKRMLPTVSLSDWRK  283

Query  594   GSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWV  415
             GSQWFE+ R++A+E+I+D TY+P+F+ +C  PCY DEHY  TL++    + NSNR++TWV
Sbjct  284   GSQWFEVHRKVAVEMIADVTYYPVFRDHCRPPCYMDEHYFATLVSKICPELNSNRSITWV  343

Query  414   DWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILA  235
             DW++GG HP  F R DV+  FLN++R+G  C YNG +TTMC LFARKF  + L  LL +A
Sbjct  344   DWSRGGSHPATFVRKDVSEKFLNRIRHGFNCSYNGFRTTMCFLFARKFHPNTLEPLLRIA  403

Query  234   PKLMQFN  214
             P L+ F+
Sbjct  404   PALLGFD  410



>emb|CBI33634.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   362 bits (929),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 182/296 (61%), Positives = 231/296 (78%), Gaps = 1/296 (0%)
 Frame = -3

Query  1101  LSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHS  922
             +SDEEL WRASM PK+ E+P++ V KVAFMFLT+G  PL PLWE FF G+ GL+SIYVH 
Sbjct  1     MSDEELFWRASMVPKVQELPYKLVRKVAFMFLTKGPHPLVPLWEKFFEGHGGLYSIYVHP  60

Query  921   SDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEACI  742
               PS++E+ P  SVFHGRRIPSK V WG A+MI+AERRLLANALLDFSN+RF+LLSE+CI
Sbjct  61    H-PSFDESVPETSVFHGRRIPSKPVYWGTASMIDAERRLLANALLDFSNQRFVLLSESCI  119

Query  741   PLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRL  562
             PLFNF+T Y+Y+M SN +F+  +D P   GRGRY+ QM P I ++DWRKGSQWFE+ R L
Sbjct  120   PLFNFTTTYNYLMASNLSFLGSFDDPRKPGRGRYNPQMWPAINISDWRKGSQWFEVHREL  179

Query  561   ALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTK  382
             A+++ISD+ Y+ +F  YC  PCY DEHY+PTL+N+   + NSNR++TWVDW++GGPHP+K
Sbjct  180   AVQIISDRKYYTIFGEYCHPPCYMDEHYIPTLVNMLYVKMNSNRSITWVDWSRGGPHPSK  239

Query  381   FTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             F   D+T +FLNK+R G+ C YNG  T +C LFARKF   AL  LL +AP L+ F+
Sbjct  240   FGWGDITDEFLNKIRYGSDCIYNGNTTNICFLFARKFLPTALEPLLRIAPLLLGFD  295



>ref|XP_006469090.1| PREDICTED: uncharacterized protein LOC102627718 [Citrus sinensis]
Length=374

 Score =   364 bits (935),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 234/307 (76%), Gaps = 2/307 (1%)
 Frame = -3

Query  1128  MAPP--GAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRG  955
             ++PP  G  H+++D+EL+WRASM PKI E P+ R PKVAFMFL RG LPLAPLWE FF+G
Sbjct  67    ISPPNKGVWHSMNDDELMWRASMVPKIEEYPYNRKPKVAFMFLIRGILPLAPLWEKFFKG  126

Query  954   NAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSN  775
               GL+SIY+HSS P + +     SVF+ RRIPSK  EWGKA+MI+AERRLLANALLDFSN
Sbjct  127   YEGLYSIYLHSSKPGFTQESLNSSVFYNRRIPSKPAEWGKASMIDAERRLLANALLDFSN  186

Query  774   ERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRK  595
             ERF+LLSE CIPLFNF+T+Y+Y++NS  +     D P P+GRGRY+ +M P + L+DWRK
Sbjct  187   ERFVLLSETCIPLFNFTTVYNYLINSRHSNQGSIDDPRPMGRGRYNKRMLPSVSLSDWRK  246

Query  594   GSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWV  415
             GSQWFE+ R++A+E+ISD TY+P+ + +C  PCY DEHY  TL++    + NSNR++TWV
Sbjct  247   GSQWFEVHRKVAVEIISDVTYYPVLRDHCRPPCYMDEHYFATLVSKICPELNSNRSITWV  306

Query  414   DWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILA  235
             DW++GG HP  F R DV+  FLN++R+G  C YNG +TTMC LFARKF  + L  LL +A
Sbjct  307   DWSRGGSHPATFVRKDVSEKFLNRIRHGFNCSYNGFRTTMCFLFARKFHPNTLEPLLRIA  366

Query  234   PKLMQFN  214
             P L+ F+
Sbjct  367   PALLGFD  373



>gb|KDO76927.1| hypothetical protein CISIN_1g046575mg [Citrus sinensis]
Length=411

 Score =   365 bits (938),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 234/307 (76%), Gaps = 2/307 (1%)
 Frame = -3

Query  1128  MAPP--GAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRG  955
             ++PP  G  H+++D+EL+WRASM PKI E P+ R PKVAFMFL RG LPLAPLWE FF+G
Sbjct  104   ISPPNKGVWHSMNDDELMWRASMVPKIEEYPYNRKPKVAFMFLIRGILPLAPLWEKFFKG  163

Query  954   NAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSN  775
               GL+SIY+HSS P + +     SVF+ RRIPSK  EWGKA+MI+AERRLLANALLDFSN
Sbjct  164   YEGLYSIYLHSSKPGFTQESLNSSVFYNRRIPSKPAEWGKASMIDAERRLLANALLDFSN  223

Query  774   ERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRK  595
             ERF+LLSE CIPLFNF+T+Y+Y++NS  +     D P P+GRGRY+ +M P + L+DWRK
Sbjct  224   ERFVLLSETCIPLFNFTTVYNYLINSRHSNQGSIDDPRPMGRGRYNKRMLPSVSLSDWRK  283

Query  594   GSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWV  415
             GSQWFE+ R++A+E+ISD TY+P+ + +C  PCY DEHY  TL++    + NSNR++TWV
Sbjct  284   GSQWFEVHRKVAVEIISDVTYYPVLRDHCRPPCYMDEHYFATLVSKICPELNSNRSITWV  343

Query  414   DWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILA  235
             DW++GG HP  F R DV+  FLN++R+G  C YNG +TTMC LFARKF  + L  LL +A
Sbjct  344   DWSRGGSHPATFVRKDVSEKFLNRIRHGFNCSYNGFRTTMCFLFARKFHPNTLEPLLRIA  403

Query  234   PKLMQFN  214
             P L+ F+
Sbjct  404   PALLGFD  410



>ref|XP_010694626.1| PREDICTED: uncharacterized protein LOC104907403 [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score =   363 bits (931),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 187/307 (61%), Positives = 232/307 (76%), Gaps = 5/307 (2%)
 Frame = -3

Query  1125  APPGAAHNLSDEELLWRASMSPKI--GEMPFRRVP--KVAFMFLTRGALPLAPLWEMFFR  958
             +P   AH + DEELLWRASM  KI   E+  ++VP  K+AFMFL RG LPLAPLW+ FF 
Sbjct  51    SPLPLAHGMDDEELLWRASMVHKIRDKELMKKKVPQPKIAFMFLVRGPLPLAPLWDKFFL  110

Query  957   GNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFS  778
             G+ GL+SIYVH+ +P YN++ P +S F+GRRIPSK V+WGK NM+EAERRLLANALLD S
Sbjct  111   GHEGLYSIYVHA-NPLYNQSYPKQSAFYGRRIPSKEVKWGKFNMVEAERRLLANALLDHS  169

Query  777   NERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWR  598
             NERFILLSE+CIPLFNFST+YSY++NS ++ I+VYDL G  GRGRY   M+P+++L  WR
Sbjct  170   NERFILLSESCIPLFNFSTVYSYLINSTKSHIQVYDLKGATGRGRYDYHMSPLVRLWQWR  229

Query  597   KGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTW  418
             KGSQWFEM R LA+EVISD+ YF +F  +C   CY DEHYLPT ++I   + N+NRT+TW
Sbjct  230   KGSQWFEMSRELAIEVISDKKYFTIFSKFCKNSCYGDEHYLPTYVSINFWKKNTNRTVTW  289

Query  417   VDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLIL  238
             VDW+  GPHP KF R  VT   L KLR+  TCEYNG+KT +C LFARKF    L RL+  
Sbjct  290   VDWSILGPHPGKFERPHVTPTLLQKLRSNYTCEYNGKKTNICFLFARKFMPGTLIRLMKF  349

Query  237   APKLMQF  217
             + K ++F
Sbjct  350   SRKFLKF  356



>ref|XP_007226202.1| hypothetical protein PRUPE_ppa016185mg [Prunus persica]
 gb|EMJ27401.1| hypothetical protein PRUPE_ppa016185mg [Prunus persica]
Length=404

 Score =   364 bits (935),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 179/305 (59%), Positives = 232/305 (76%), Gaps = 3/305 (1%)
 Frame = -3

Query  1125  APPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAG  946
             AP    H++S+EEL W+ SM P+I + P+ R PKVAFM+LT+G LP APLWE FF+G+ G
Sbjct  101   APKELWHSMSEEELFWQESMVPRIVKYPYNRTPKVAFMYLTKGRLPFAPLWESFFKGHDG  160

Query  945   LFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERF  766
              +S+Y+H++ P +    P  SVF+ R+IPS+ VEWGK  M++AERRLLANALLDFSNERF
Sbjct  161   FYSVYLHAA-PDFKNEPPESSVFYKRKIPSQAVEWGKPTMVDAERRLLANALLDFSNERF  219

Query  765   ILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQ  586
             +LLSE+CIPLFNF+ +YS+++NSN +F+  +D P  VGRGRY  QM P + L+DWRKGSQ
Sbjct  220   VLLSESCIPLFNFTKVYSHLVNSNHSFVSSFDDPRNVGRGRYKKQMWPTVTLSDWRKGSQ  279

Query  585   WFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQG-NSNRTLTWVDW  409
             WFE  R+L +E++SD TY+P+F+ +C  PCY+DEHYL TL+  K+G G NSNRT+TWVDW
Sbjct  280   WFEAHRKLTIEIVSDPTYYPVFKDFCLPPCYTDEHYLATLVT-KVGPGINSNRTITWVDW  338

Query  408   AKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPK  229
             + GGPHPT F R DVT +FL +LRNG  C YNG  +++CHLFARKF    L  LL +AP 
Sbjct  339   STGGPHPTTFVRKDVTENFLIRLRNGFNCTYNGGMSSICHLFARKFHPSTLEPLLKIAPA  398

Query  228   LMQFN  214
             L  FN
Sbjct  399   LFGFN  403



>gb|KCW86302.1| hypothetical protein EUGRSUZ_B02994 [Eucalyptus grandis]
Length=297

 Score =   360 bits (924),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 178/295 (60%), Positives = 230/295 (78%), Gaps = 0/295 (0%)
 Frame = -3

Query  1101  LSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHS  922
             +SDEEL WRASM P I E P  R PKVAFMFL+RG+LPLAPLWE FF+G+  L+SIY+H 
Sbjct  1     MSDEELAWRASMVPHILEYPCNRTPKVAFMFLSRGSLPLAPLWEKFFKGHKDLYSIYLHM  60

Query  921   SDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEACI  742
             S    N+  P  SVF+ RRIPSK  +WG+A+MI+AERRLLANALLDFSNERF+LLSE CI
Sbjct  61    SVDLGNDEMPETSVFYKRRIPSKPAQWGRASMIDAERRLLANALLDFSNERFVLLSETCI  120

Query  741   PLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRL  562
             PLFNF+T+YSY++NSN++F+  +D P P+GRGRY+ +M P + L++WRKGSQWFE+ RR+
Sbjct  121   PLFNFTTVYSYLINSNQSFLGSFDDPRPMGRGRYNKRMWPTVSLSEWRKGSQWFEVQRRV  180

Query  561   ALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTK  382
             A+E++SD  Y+P+F+++C  PCY DEHYLPTL+       NSNR++TWVDW+ GG HP +
Sbjct  181   AVEIVSDVIYYPVFRNHCMPPCYMDEHYLPTLVTKVCPGANSNRSITWVDWSGGGSHPKQ  240

Query  381   FTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQF  217
             FTR DV+  FLN++R+G  C YNG  T++C LFARKF  + L  LL +AP L+ F
Sbjct  241   FTRTDVSQVFLNRIRHGFNCTYNGITTSICFLFARKFHPNTLQPLLKIAPPLLGF  295



>ref|XP_007044267.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY00099.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=404

 Score =   363 bits (931),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 231/299 (77%), Gaps = 1/299 (0%)
 Frame = -3

Query  1113  AAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSI  934
             A H+++DEEL+WRAS  P + E P  R PKVAFMFL+RG LPLAPLWE FF G+ GL+SI
Sbjct  104   AWHSMTDEELMWRASTVPNVVEYPHNRTPKVAFMFLSRGTLPLAPLWEKFFMGHKGLYSI  163

Query  933   YVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLS  754
             Y H+S P + +     SVF+ RRIPSK V+WG+A M++AERRLLANALLD +NERF+LLS
Sbjct  164   YFHTS-PDFIDKPLVTSVFYERRIPSKPVQWGRATMVDAERRLLANALLDLTNERFVLLS  222

Query  753   EACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEM  574
             EACIPLFNF+T+Y+Y++NS+ +F+  +D P   GRGRY+ QM P + L DWRKGSQWFE+
Sbjct  223   EACIPLFNFTTVYNYLINSSRSFLGSFDDPTHTGRGRYNKQMWPTVSLADWRKGSQWFEV  282

Query  573   DRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGP  394
             +R LA E++SD  Y+P+F+ +C  PCY DEHYLPTL+N+   + NSNR++TWVDW++GGP
Sbjct  283   NRMLAAEIVSDDKYYPVFRDHCRPPCYMDEHYLPTLVNLICPELNSNRSITWVDWSRGGP  342

Query  393   HPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQF  217
             HPTK+ R DV+V  LN++R G  C YNGE++++C LFARKF    L  LL +AP L+ F
Sbjct  343   HPTKYLRKDVSVALLNQVRQGFNCTYNGERSSICFLFARKFHPSTLEPLLRIAPALLGF  401



>ref|XP_008351009.1| PREDICTED: uncharacterized protein LOC103414400, partial [Malus 
domestica]
Length=321

 Score =   359 bits (922),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 232/315 (74%), Gaps = 6/315 (2%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
              GLK+ L  PP A H++++ ELLWRAS++P+I E PF  VPKVAFMFLT+G + LAPLWE
Sbjct  9     TGLKDYL-KPPNAFHDMNNAELLWRASITPQIPEYPFHFVPKVAFMFLTKGPVVLAPLWE  67

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllana  793
              FF G+ GL+SIYVHSS PSYN +   E+ VF GRRIPS+ V WGK ++I AER LLANA
Sbjct  68    KFFAGHQGLYSIYVHSS-PSYNHSLYTETPVFGGRRIPSQXVXWGKVSLIAAERLLLANA  126

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SN+RF+LLSE+CIPL NF T+YSY+MNS +TF+EV+D P  VGRGRY       I 
Sbjct  127   LLDXSNQRFVLLSESCIPLXNFXTVYSYLMNSTQTFVEVFDDPSGVGRGRYELSDYXGIT  186

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             ++ WRKGS WF+ DR LALE +SD+ YFP+F   C G C++DEHYLPT + IK G  N+N
Sbjct  187   IDQWRKGSXWFQADRDLALEFVSDRIYFPVFMK-CKGYCFADEHYLPTFVYIKFGAKNAN  245

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRN--GNTCEYNGEKTTMCHLFARKFTLHA  259
             RTLTWVDW KGGPHPT++   +VT   L+ LRN  G  CEYNG  T +C LFARKF   A
Sbjct  246   RTLTWVDWEKGGPHPTEYASENVTAVLLSGLRNGFGRKCEYNGRXTDVCFLFARKFPPTA  305

Query  258   LSRLLILAPKLMQFN  214
             L  LL  AP++M FN
Sbjct  306   LDNLLKFAPEIMHFN  320



>ref|XP_003603189.1| hypothetical protein MTR_3g104840 [Medicago truncatula]
 gb|AES73440.1| core-2/I-branching enzyme [Medicago truncatula]
Length=394

 Score =   362 bits (928),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 185/303 (61%), Positives = 233/303 (77%), Gaps = 20/303 (7%)
 Frame = -3

Query  1119  PGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLF  940
             P   H+++D+EL  R S+   I E PF + PK+AFMFLT+G + LAP WE FF+GN G++
Sbjct  111   PMVTHDMNDDELFRRTSLISMIHEPPFNQTPKIAFMFLTKGPVLLAPFWEKFFKGNEGMY  170

Query  939   SIYVHSSDPSYNETEPPE-SVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFI  763
             SIY+H S PS+N+T   E SVFHGRRIPSK V+WG+ +MIEAERRLLANALLDFSN+RF+
Sbjct  171   SIYIHPS-PSFNQTVYNERSVFHGRRIPSKEVKWGETSMIEAERRLLANALLDFSNQRFV  229

Query  762   LLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQW  583
             LLSE+CIPLFNFSTIY+Y+MNSNETF+E  +                 IK + W+KGSQW
Sbjct  230   LLSESCIPLFNFSTIYTYLMNSNETFVEANE-----------------IKNSQWKKGSQW  272

Query  582   FEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAK  403
             F++DR L L ++SD+TYF +F+ YC  PCYSDEHYLPT ++ + G+ NSNRTLTWVDW+K
Sbjct  273   FQIDRYLGLHIVSDKTYFSMFKKYCNTPCYSDEHYLPTFISNEFGKRNSNRTLTWVDWSK  332

Query  402   GGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLM  223
             GGPHP+ FT  DVT +FL +LR G+TCE+NG +T++CHLFARKFT HAL  L+  APKLM
Sbjct  333   GGPHPSSFTGKDVTTEFLERLRFGSTCEHNG-RTSICHLFARKFTPHALDILVRYAPKLM  391

Query  222   QFN  214
             QFN
Sbjct  392   QFN  394



>ref|XP_006344151.1| PREDICTED: uncharacterized protein LOC102582712 [Solanum tuberosum]
Length=305

 Score =   358 bits (919),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 174/297 (59%), Positives = 231/297 (78%), Gaps = 1/297 (0%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYV  928
             H+++DEEL+WRASM P+I + PF R+P+VAF+FLTRG LPLAPLWEMFF+G+ GLFSIY+
Sbjct  9     HSMNDEELMWRASMVPQIEKNPFNRIPRVAFLFLTRGRLPLAPLWEMFFKGHEGLFSIYI  68

Query  927   HSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEA  748
             H+S P +N   PP SVF+ RRIPS+ V+WG++ MI+AERRLLANALLD SNERFILLSE+
Sbjct  69    HTS-PDFNYEPPPSSVFYKRRIPSQAVQWGRSTMIDAERRLLANALLDISNERFILLSES  127

Query  747   CIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDR  568
             CIP FNF+TIY+Y+ NS+++F+  +D P  +GRGRY+ +M P I L+DWRKGSQWFE+ R
Sbjct  128   CIPFFNFTTIYTYLTNSDQSFLGSFDDPRKIGRGRYNKRMYPNITLSDWRKGSQWFEVHR  187

Query  567   RLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHP  388
             +LA++++SD  Y+P+F++YC  PCY DEHYLPTL+N       SNR++TW DW+ GG HP
Sbjct  188   KLAVKIVSDVMYYPVFKNYCVPPCYMDEHYLPTLVNKVCPGLTSNRSVTWADWSAGGSHP  247

Query  387   TKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQF  217
               F + DVT +FL  + +   C YNG+ +++C LF RKF    L  LL +APKL+ F
Sbjct  248   MTFLKKDVTEEFLKSVGSELNCSYNGKMSSICFLFGRKFHPSTLQPLLRIAPKLLGF  304



>ref|XP_010108861.1| hypothetical protein L484_027054 [Morus notabilis]
 gb|EXC20501.1| hypothetical protein L484_027054 [Morus notabilis]
Length=405

 Score =   361 bits (927),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 182/298 (61%), Positives = 235/298 (79%), Gaps = 3/298 (1%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYV  928
             H+++DEELL RASM P++ +   R  PKVAFMFLT+G LPLAPLWE FF+G+ G +SIYV
Sbjct  110   HDMNDEELLRRASMVPRVQDQHVR--PKVAFMFLTKGPLPLAPLWEKFFQGHEGFYSIYV  167

Query  927   HSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEA  748
             HS  PS+N+T P  SVF+GRRIPS+ V WG   MI+AERRLLANALLD SN+RF+LLSE+
Sbjct  168   HSH-PSFNDTMPESSVFYGRRIPSQPVYWGSITMIDAERRLLANALLDLSNQRFVLLSES  226

Query  747   CIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDR  568
             CIPLFNF+ IYSY++NSN +F+  +D P   GRGRY+ QM P IKL+DWRKG+QWFE+ R
Sbjct  227   CIPLFNFTAIYSYLINSNLSFLGSFDDPRSPGRGRYNPQMQPHIKLSDWRKGAQWFELHR  286

Query  567   RLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHP  388
              LA+ V+SD+ ++PLF+  C   CYSDEHYLPTL+NI  G+ N+NR++TWVDW++GGPHP
Sbjct  287   DLAVRVLSDRKFYPLFRDLCRPACYSDEHYLPTLVNILYGESNANRSVTWVDWSRGGPHP  346

Query  387   TKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
              +F   DVT +FLN++R G+ C YNG +T+MC LFARKF  +AL  LL ++P L+ F+
Sbjct  347   GRFGWGDVTDEFLNRIRFGSKCLYNGNETSMCFLFARKFLPNALEPLLRVSPVLLGFD  404



>ref|XP_004238913.2| PREDICTED: uncharacterized protein LOC101249916 [Solanum lycopersicum]
Length=351

 Score =   358 bits (919),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/297 (59%), Positives = 231/297 (78%), Gaps = 1/297 (0%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYV  928
             H+++DEEL+WRASM P+I + PF R+P+VAF+FLTRG LPLAPLWEMFF+G+ GLFSIY+
Sbjct  55    HSMNDEELMWRASMVPQIKKYPFNRIPRVAFLFLTRGRLPLAPLWEMFFKGHKGLFSIYI  114

Query  927   HSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEA  748
             H+S P +N   PP SVF+ RRIPS+ V+WG++ MI+AERRLLANALLD SNERFILLSE+
Sbjct  115   HTS-PDFNYEPPPSSVFYKRRIPSQAVQWGRSTMIDAERRLLANALLDISNERFILLSES  173

Query  747   CIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDR  568
             CIPLFNF+TIY+Y+ NS+++F+  +D P  +GRGRY+ +M P I L DWRKGSQWFE+ R
Sbjct  174   CIPLFNFTTIYTYLTNSDQSFLGSFDDPRKIGRGRYNKRMYPNITLFDWRKGSQWFEIHR  233

Query  567   RLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHP  388
              LA++++SD  Y+P+F+++C  PCY DEHYLPTL+N       SNR++TWVDW+ GG HP
Sbjct  234   ELAVKIVSDVLYYPVFKNHCVPPCYMDEHYLPTLVNKVCPGLTSNRSVTWVDWSAGGSHP  293

Query  387   TKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQF  217
               F + DVT +FL  + +   C YNG+ +++C LF RKF    L  LL +APKL+ F
Sbjct  294   MTFLKKDVTEEFLKSVGSELNCSYNGKMSSICFLFGRKFHPSTLQPLLRIAPKLLGF  350



>ref|XP_010681643.1| PREDICTED: uncharacterized protein LOC104896576 [Beta vulgaris 
subsp. vulgaris]
Length=393

 Score =   359 bits (922),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/298 (60%), Positives = 227/298 (76%), Gaps = 4/298 (1%)
 Frame = -3

Query  1101  LSDEELLWRASMSPKIGEMPFRRVP-KVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVH  925
             +SDEEL+ RAS  PK+ E+P ++VP K+AF+FL +G+LPL  LWE FF+G+ G +SIYVH
Sbjct  97    MSDEELMLRASKVPKMEELPLKKVPYKIAFLFLIKGSLPLQALWEEFFKGHEGFYSIYVH  156

Query  924   SSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEA  748
             S DPS+N +    + VFHGR+IPSK VEWGK +MIEAE RLLA AL D SN+RF+LLSE+
Sbjct  157   S-DPSFNFSNGVATGVFHGRKIPSKKVEWGKFSMIEAELRLLATALQDASNKRFVLLSES  215

Query  747   CIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDR  568
             CIPLFNFSTIY+Y++NS ++++E YD  GPV RGRY  +++PII + DWRKGSQWFEMDR
Sbjct  216   CIPLFNFSTIYTYLINSTQSYVEAYDKSGPVARGRYKHRLSPIITIRDWRKGSQWFEMDR  275

Query  567   RLALEVISDQTYFPLFQSYC-TGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPH  391
              LA+EVISDQ  F  F++ C    CY+DEHYLPT MN+     NSNR++TWVDW++GG H
Sbjct  276   ELAMEVISDQLQFLSFKTACNNSACYADEHYLPTWMNMYSRGRNSNRSVTWVDWSRGGCH  335

Query  390   PTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQF  217
             P K+ R  +T  FL  LR G TC+YNG++  +C LFARKF    L+RLL  APK+M F
Sbjct  336   PAKYRRMHITTKFLESLRVGKTCQYNGKRADICFLFARKFLPETLNRLLWFAPKVMDF  393



>ref|XP_008350857.1| PREDICTED: uncharacterized protein LOC103414237 [Malus domestica]
Length=405

 Score =   358 bits (920),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 231/315 (73%), Gaps = 6/315 (2%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
              GLK+ L  PP A H++++ ELLWRAS++P I E PF  VPKVAFMFLT+G + LAPLWE
Sbjct  93    TGLKDYL-KPPKAFHDMNNAELLWRASITPXIPEYPFHFVPKVAFMFLTKGPVVLAPLWE  151

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllana  793
              FF G+ GL+SIYVHSS PSYN +   E+ VF GRRIPS+ V WGK ++I AER LLANA
Sbjct  152   KFFAGHQGLYSIYVHSS-PSYNHSXYTETPVFGGRRIPSQXVXWGKVSLIAAERLLLANA  210

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SN+RF+LLSE+CIPL NF T+YSY+MNS +TF+EV+D P  VGRGRY       I 
Sbjct  211   LLDXSNQRFVLLSESCIPLXNFXTVYSYLMNSTQTFVEVFDDPSGVGRGRYELSDYRGIT  270

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             ++ WRKGS WF+ DR LALE +SD+ YFP+F   C G C++DEHYLPT + IK G  N+N
Sbjct  271   IDQWRKGSXWFQADRDLALEFVSDRIYFPVFMK-CKGYCFADEHYLPTFVYIKFGAKNAN  329

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRN--GNTCEYNGEKTTMCHLFARKFTLHA  259
             RTLTWVDW KGGPHPT++   +VT   L+ LRN  G  CEYNG  T +C LFARKF   A
Sbjct  330   RTLTWVDWEKGGPHPTEYASENVTAVLLSGLRNGFGRKCEYNGRTTDVCFLFARKFPPTA  389

Query  258   LSRLLILAPKLMQFN  214
             L  LL  AP++M FN
Sbjct  390   LDNLLKFAPEIMHFN  404



>ref|XP_004300972.1| PREDICTED: uncharacterized protein LOC101293100 [Fragaria vesca 
subsp. vesca]
Length=371

 Score =   357 bits (917),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 233/315 (74%), Gaps = 12/315 (4%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GLK  L  PP   H+++DEELLWRASM+P+I   PF RVPKVAFMFLT+G + LAPLWE 
Sbjct  62    GLKAYL-EPPNVMHDMNDEELLWRASMAPRI---PFHRVPKVAFMFLTKGPVHLAPLWEK  117

Query  966   FFRGNAGLFSIYVHSSDPSYN--ETEPPESVFHGRRIPSKGVEWGKANMIeaerrllana  793
             FF+G+ GL+SIYVH  DPSYN   + P   +F GRRIPS+ V+W + N+IEAERRL+ANA
Sbjct  118   FFKGHQGLYSIYVHP-DPSYNASSSHPESPIFQGRRIPSQIVKWAQVNVIEAERRLIANA  176

Query  792   lLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIK  613
             LLD SN RF+LLSEACIPL+NFSTIYSY++NS E F+EV+D P  VGRGRY+S   P+I 
Sbjct  177   LLDISNLRFVLLSEACIPLYNFSTIYSYLLNSQEIFVEVFDDPSSVGRGRYNSSYYPMIT  236

Query  612   LNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSN  433
             L+ WRKGSQW E+DR +A EVISD+TYFP F+      C++DEHYLPT +N K    NSN
Sbjct  237   LDQWRKGSQWVEIDRDIATEVISDRTYFPAFR-LGNRSCFADEHYLPTFVNQKFSAKNSN  295

Query  432   RTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGN--TCEYNGEKTTMCHLFARKFTLHA  259
             R+LTWVDW+  GPHP ++  N  T + L+ LRNGN   C YN   + +C LFARKF   A
Sbjct  296   RSLTWVDWSTHGPHPVEY--NSTTAELLDILRNGNGTRCLYNQRTSNICFLFARKFLPPA  353

Query  258   LSRLLILAPKLMQFN  214
             L  LL LAPK+M FN
Sbjct  354   LHSLLRLAPKIMHFN  368



>ref|XP_009344746.1| PREDICTED: uncharacterized protein LOC103936628 [Pyrus x bretschneideri]
Length=558

 Score =   363 bits (933),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 176/299 (59%), Positives = 233/299 (78%), Gaps = 1/299 (0%)
 Frame = -3

Query  1110  AHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIY  931
              HN+SD+EL  RA M P+I ++P++ VPKVAFMFLT+G LPL+PLWE FF G+ GL+SIY
Sbjct  260   VHNMSDKELFSRALMVPRIQDLPYKLVPKVAFMFLTKGPLPLSPLWEKFFEGHEGLYSIY  319

Query  930   VHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSE  751
             VH+  P +NE+ P +SVFH RRI S+ V WG ++M++AERRLLANALLD SN+RF+LLSE
Sbjct  320   VHAH-PDFNESVPEDSVFHSRRIHSQPVYWGTSSMLDAERRLLANALLDISNQRFVLLSE  378

Query  750   ACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMD  571
             +CIPLFNF+T Y Y++NSN +F+  +D P   GRGRY+ QM P+I + DWRKGSQWFE+ 
Sbjct  379   SCIPLFNFTTAYHYLINSNLSFLNSFDDPRKPGRGRYNPQMYPMINITDWRKGSQWFEVH  438

Query  570   RRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPH  391
             R LA+ ++SD+ Y+P+FQ YC  PCY DEHY+PTL+N+   + NSNR++TWVDW++GGPH
Sbjct  439   RELAVHIVSDRKYYPIFQQYCNPPCYIDEHYIPTLVNLMYTELNSNRSVTWVDWSRGGPH  498

Query  390   PTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             P KF   D+T +FLN++R G+ C YNG  T++C LFARKF   AL  LL +AP L+ F+
Sbjct  499   PGKFGWMDITDEFLNRIRFGSECTYNGNTTSVCFLFARKFLPDALEPLLRVAPLLLGFD  557



>ref|XP_007227633.1| hypothetical protein PRUPE_ppa022907mg [Prunus persica]
 gb|EMJ28832.1| hypothetical protein PRUPE_ppa022907mg [Prunus persica]
Length=378

 Score =   357 bits (916),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 183/308 (59%), Positives = 230/308 (75%), Gaps = 5/308 (2%)
 Frame = -3

Query  1128  MAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNA  949
             + PP   HN++D ELLWRASM+P+I E PF RVPKV FMF+TRG + LAPLWE FF+G+ 
Sbjct  71    IKPPKVFHNMNDTELLWRASMTPRISEYPFHRVPKVTFMFMTRGPVVLAPLWEKFFKGHR  130

Query  948   GLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNE  772
             GL+SIYVHS  PSYN +  PES VFHGRRIPS+ VEWG+ + IEAERRLLANALLD +N+
Sbjct  131   GLYSIYVHSK-PSYNASSHPESPVFHGRRIPSQEVEWGRVSQIEAERRLLANALLDIANQ  189

Query  771   RFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKG  592
             R +LLSE+CIPL+NF T+YSY+++SNETF+EVYD P   GR RY     P I L+ W KG
Sbjct  190   RVVLLSESCIPLYNFYTVYSYLIHSNETFVEVYDDPSVDGRDRYYFIDYPGITLDQWSKG  249

Query  591   SQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVD  412
             SQWFE+DR LA+EV+SD+ YFPLF   C G C+++EHYLPT +++K    ++ R+LTW D
Sbjct  250   SQWFEIDRDLAIEVVSDRIYFPLFLR-CKGECFAEEHYLPTFVHMKFAANSAYRSLTWAD  308

Query  411   WAKGGPHPTKFTRNDVTVDFLNKLRN--GNTCEYNGEKTTMCHLFARKFTLHALSRLLIL  238
             W KGG HPT++   +VT + LN LRN  G  CEYNG  + +C LFARKF    L  LL +
Sbjct  309   WTKGGAHPTEYPSTNVTFELLNSLRNGYGRRCEYNGRSSDVCFLFARKFPPTTLDGLLRI  368

Query  237   APKLMQFN  214
             AP +M F+
Sbjct  369   APNIMHFS  376



>ref|XP_009345696.1| PREDICTED: uncharacterized protein LOC103937474 [Pyrus x bretschneideri]
Length=411

 Score =   358 bits (918),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 232/299 (78%), Gaps = 1/299 (0%)
 Frame = -3

Query  1110  AHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIY  931
              HN+SD+EL  RA M P+I ++P++ VPKVAFMFLT+G LPL+PLWE FF G+ GL+SIY
Sbjct  113   VHNMSDKELFSRALMVPRIQDLPYKLVPKVAFMFLTKGPLPLSPLWEKFFEGHEGLYSIY  172

Query  930   VHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSE  751
             VH+  P +NE+ P +SVFH RRI S+ V WG ++M++AERRLLANALLD SN+RF+LLSE
Sbjct  173   VHA-HPDFNESVPEDSVFHSRRIHSQPVYWGTSSMLDAERRLLANALLDISNQRFVLLSE  231

Query  750   ACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMD  571
             +CIPLFNF+T Y Y++NSN +F+  +D P   GRGRY+ QM P+I + DWRKGSQWFE+ 
Sbjct  232   SCIPLFNFTTAYHYLINSNLSFLNSFDDPRKPGRGRYNPQMYPMINITDWRKGSQWFEVH  291

Query  570   RRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPH  391
             R LA+ ++SD+ Y+P+FQ YC  PCY DEHY+PTL+N+   + NSNR++TWVDW++GGPH
Sbjct  292   RELAVHIVSDRKYYPIFQQYCNPPCYIDEHYIPTLVNLMYTELNSNRSVTWVDWSRGGPH  351

Query  390   PTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             P KF   D+T +FLN++R G+ C YNG  T++  LFARKF   AL  LL +AP L+ F+
Sbjct  352   PGKFGWMDITDEFLNRIRFGSECTYNGNTTSVFFLFARKFLPDALEPLLRVAPLLLGFD  410



>ref|XP_009360140.1| PREDICTED: uncharacterized protein LOC103950635 [Pyrus x bretschneideri]
 ref|XP_009345483.1| PREDICTED: uncharacterized protein LOC103937281 [Pyrus x bretschneideri]
Length=403

 Score =   357 bits (916),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 177/300 (59%), Positives = 229/300 (76%), Gaps = 8/300 (3%)
 Frame = -3

Query  1101  LSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHS  922
             + D EL WRAS  P+IG+ P+ RVP++AFMFLT+G +PLAPLWEMFF G+ GL++IYVH 
Sbjct  103   VDDGELFWRASFVPRIGKFPYNRVPRIAFMFLTKGPIPLAPLWEMFFNGHEGLYNIYVHP  162

Query  921   SDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEACI  742
               PSY ++ P  SVF+GRRIPSK VEWG   MI+ ERRLLA+ALLDF+NERF+LLSE+CI
Sbjct  163   -HPSYVDSWPQNSVFYGRRIPSKAVEWGSPTMIDGERRLLASALLDFTNERFVLLSESCI  221

Query  741   PLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRL  562
             PLFNF+TIYSY+MN++E+ I  YD P  VGRGRY+ +M P I ++DWRKGSQWFE+ R+L
Sbjct  222   PLFNFTTIYSYLMNASESNIGSYDDPRKVGRGRYNPRMWPEINISDWRKGSQWFEVSRKL  281

Query  561   ALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTK  382
             A+E+ISD  Y+P+F+ +C+ PCY DEHY+PTL+NI   + NSNR++TWVDW+K GPHP +
Sbjct  282   AVEIISDNKYYPIFKEHCSPPCYMDEHYIPTLVNIIGPEKNSNRSVTWVDWSKSGPHPGR  341

Query  381   FTRNDVTVDFLNKLRNGNTCEYNGEKT-------TMCHLFARKFTLHALSRLLILAPKLM  223
             F RNDV+   LN++R G+ C  +G          +MC LFARKF    L  LL +AP L+
Sbjct  342   FGRNDVSEVILNQIRFGSNCSCSGNSNANSTITCSMCFLFARKFMGDTLRPLLQIAPMLL  401



>ref|XP_010265068.1| PREDICTED: uncharacterized protein LOC104602905 [Nelumbo nucifera]
Length=409

 Score =   356 bits (913),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 176/295 (60%), Positives = 228/295 (77%), Gaps = 1/295 (0%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYV  928
             H + DEEL WRASM P+I   P+   PKVAFMFLT+G LPLA LWE FFRG+ G ++IYV
Sbjct  112   HGMDDEELFWRASMVPRITVFPYSLTPKVAFMFLTKGPLPLALLWEKFFRGHEGFYNIYV  171

Query  927   HSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEA  748
             H   P + ++ P +SVF+ RRIPSK VEWG++ MI+AERRLLANALLDFSNERF+LLSE+
Sbjct  172   HP-HPGFVDSTPEDSVFYRRRIPSKAVEWGRSTMIDAERRLLANALLDFSNERFVLLSES  230

Query  747   CIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDR  568
             CIPLFNF+T+Y+Y++NSN +F+  +D P   GRGRY+  M PI+ + +WRKGSQWFE+ R
Sbjct  231   CIPLFNFTTVYNYLINSNVSFLGSFDDPRKAGRGRYNRLMWPIVNITEWRKGSQWFEVHR  290

Query  567   RLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHP  388
              LA+E+I+D+ Y+P+FQ+YCT  CY DEHYLPTL+N+   + NSNR++TWVDW++ GPHP
Sbjct  291   DLAVEIIADRKYYPVFQNYCTPSCYMDEHYLPTLVNMIAPELNSNRSVTWVDWSRPGPHP  350

Query  387   TKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLM  223
              KF  ND+T +FLN++R G  C YNG  T++C LFARKF   AL  LL + P L+
Sbjct  351   GKFGWNDMTDEFLNRIRYGTNCTYNGLPTSICFLFARKFLPSALEPLLRITPLLL  405



>ref|XP_006842356.1| hypothetical protein AMTR_s00079p00179880 [Amborella trichopoda]
 gb|ERN04031.1| hypothetical protein AMTR_s00079p00179880 [Amborella trichopoda]
Length=376

 Score =   354 bits (909),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 173/305 (57%), Positives = 226/305 (74%), Gaps = 1/305 (0%)
 Frame = -3

Query  1137  ELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFR  958
             E +  P  A HN++DEEL+W+ASM   + + P+ RVPKVAFM+LTRG +PL PLWE FF+
Sbjct  69    EEVAKPTDAMHNMTDEELMWQASMVSHVRQYPYSRVPKVAFMYLTRGPMPLGPLWERFFK  128

Query  957   GNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFS  778
             G+ GL+SIYVH   PSY    PP+SVF  R++PSK VEWG+A MI+AERRLLANALLDFS
Sbjct  129   GHNGLYSIYVHCP-PSYTVEAPPDSVFFRRKVPSKVVEWGRATMIDAERRLLANALLDFS  187

Query  777   NERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWR  598
             NERF+LLSE+CIPLFNF+T YSY++NS+ +F+  +D P   GRGRY+  M P I L++WR
Sbjct  188   NERFVLLSESCIPLFNFTTAYSYLINSHHSFVGSFDDPRHCGRGRYNKTMAPEILLSEWR  247

Query  597   KGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTW  418
             KGSQWFE++R LA+E++SD  Y+ +F+ +C  PCY DEHYLPT +       NSNR+  W
Sbjct  248   KGSQWFEVNRALAIEIVSDTKYYAIFREHCNPPCYMDEHYLPTFVTKNFPSSNSNRSFMW  307

Query  417   VDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLIL  238
             VDW++GG HP  F   D T  FLN++RN   C YNG  T++C LFARK+  +AL  LL +
Sbjct  308   VDWSRGGSHPATFRSGDATERFLNQIRNSENCTYNGNPTSICFLFARKWAPNALQPLLRI  367

Query  237   APKLM  223
             AP+++
Sbjct  368   APRVL  372



>ref|XP_010099263.1| hypothetical protein L484_015453 [Morus notabilis]
 gb|EXB77527.1| hypothetical protein L484_015453 [Morus notabilis]
Length=372

 Score =   354 bits (909),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 177/306 (58%), Positives = 232/306 (76%), Gaps = 2/306 (1%)
 Frame = -3

Query  1128  MAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNA  949
             +AP    H++SD+ELLWRASM PK+ E P+ R PK+AFMFL++G LPLAPLWE FF G  
Sbjct  67    IAPKELWHSMSDQELLWRASMVPKVVEYPYNRTPKLAFMFLSKGRLPLAPLWEKFFNGYE  126

Query  948   GLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNER  769
              L+SIY+H+S P Y    P  SVF+ RRIPS+ V+WG+  MI+AERRLLANALLDFSNER
Sbjct  127   DLYSIYLHTS-PEYTYEPPESSVFYKRRIPSQPVQWGRKTMIDAERRLLANALLDFSNER  185

Query  768   FILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGS  589
             FILLSE CIP+FNF+TIY+++MNSN++F+ ++D P  VGRGRY+ +M P + L++WRKGS
Sbjct  186   FILLSETCIPIFNFTTIYNHLMNSNQSFVGLFDDPRYVGRGRYNKRMWPTVSLSNWRKGS  245

Query  588   QWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDW  409
             QWFE  RRLA+E++SD  Y+P+F  +C  PCY DEHYL TL+ I   +  SN ++TWVDW
Sbjct  246   QWFEAHRRLAVEIVSDVRYYPVFVEHCKPPCYMDEHYLATLVYIVCPEMTSNWSITWVDW  305

Query  408   AKG-GPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAP  232
             ++G G HPT F R +++ +FLN++R+G  C YNG  +T+C LFARKF    L  LL +AP
Sbjct  306   SRGTGSHPTTFVRREISQEFLNRIRHGFNCTYNGRMSTICFLFARKFHPSTLKPLLKIAP  365

Query  231   KLMQFN  214
              L+ FN
Sbjct  366   DLLGFN  371



>ref|XP_004301821.1| PREDICTED: uncharacterized protein LOC101311681 [Fragaria vesca 
subsp. vesca]
Length=403

 Score =   355 bits (911),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 181/304 (60%), Positives = 230/304 (76%), Gaps = 6/304 (2%)
 Frame = -3

Query  1107  HNLSDE-ELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIY  931
             HNL D+ EL WRAS  P+I E P+ RVPKVAFMFLT+G +PLAPLWEMFF+ + GL++IY
Sbjct  100   HNLDDDLELFWRASFVPRITEFPYNRVPKVAFMFLTKGRIPLAPLWEMFFKDHQGLYTIY  159

Query  930   VHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSE  751
             VH   PSY ++ P +S F+  RIPSK V+WGK  MI+AERRLLA+ALLD SNERF+LLSE
Sbjct  160   VHPH-PSYVDSWPEDSAFYRTRIPSKQVDWGKPTMIDAERRLLASALLDISNERFVLLSE  218

Query  750   ACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMD  571
              CIPLFNF+TIY+ +MNSNE+FI  YD P  VGRGRY+ QM P+I + DWRKGSQWFE++
Sbjct  219   TCIPLFNFTTIYNCLMNSNESFIASYDDPRKVGRGRYNPQMAPMITVADWRKGSQWFEVN  278

Query  570   RRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPH  391
             R+LA+E++SD  Y+P+F+ YC+ PCY DEHY+PTL+NI     NSNR++TWVDW+K GPH
Sbjct  279   RKLAIEIVSDTKYYPIFKEYCSHPCYMDEHYIPTLVNIIGPGHNSNRSVTWVDWSKSGPH  338

Query  390   PTKFTRNDVTVDFLNKLRNGN--TCEYNGEKTT--MCHLFARKFTLHALSRLLILAPKLM  223
             P +F R+ V+ + LN++R G   TC++     T  MC LFARKF   AL  LL + P L+
Sbjct  339   PGRFGRSHVSAEVLNQIRFGTNETCDHGDVNITSSMCFLFARKFMPDALQPLLQIVPMLV  398

Query  222   QFNG  211
               N 
Sbjct  399   GSNS  402



>gb|KDP34129.1| hypothetical protein JCGZ_07700 [Jatropha curcas]
Length=386

 Score =   353 bits (907),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 170/310 (55%), Positives = 222/310 (72%), Gaps = 1/310 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
              L   +  P    H ++DEELLWRAS+ P+I + PF+RVPK+AFMFLT+G LPLAPLWE 
Sbjct  78    ALDRWIKPPSNLLHKMNDEELLWRASLVPRIKKYPFKRVPKIAFMFLTKGPLPLAPLWER  137

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             F RG+ GL+SIY+HS  P++    PP SVFHGR++PS+  EWGK NM +AERRLLANALL
Sbjct  138   FLRGHEGLYSIYIHSL-PTFEAKFPPSSVFHGRQVPSQISEWGKMNMCDAERRLLANALL  196

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE FILLSE+CIPL+NF+ IY Y+M S  +F+  +D PGP GRGRY+  M P + ++
Sbjct  197   DISNEWFILLSESCIPLYNFTVIYHYIMRSKYSFVGAFDDPGPYGRGRYNENMAPEVNIS  256

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++RRLA+ ++ D  Y+P F+ +C   CY DEHY PT++NI+     +NR+
Sbjct  257   QWRKGSQWFEVNRRLAVTIVEDTKYYPKFEEFCKPNCYVDEHYFPTMLNIQAAHLIANRS  316

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             LTWVDW++GG HP  F R D+T DF  K   G  C YN + +++C LF RKF   AL  L
Sbjct  317   LTWVDWSRGGAHPATFGRADITEDFFRKFFEGQHCTYNNQPSSICFLFGRKFAPSALEPL  376

Query  246   LILAPKLMQF  217
             L +AP ++ F
Sbjct  377   LHIAPSVLGF  386



>ref|XP_006651782.1| PREDICTED: uncharacterized protein LOC102702183 [Oryza brachyantha]
Length=330

 Score =   350 bits (899),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 169/297 (57%), Positives = 223/297 (75%), Gaps = 1/297 (0%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYV  928
             H +SDEELLWRAS +P++G  P+RRVP+VAFMFLTRG LPLAPLWE FFRG+ G +S+YV
Sbjct  34    HAMSDEELLWRASFAPRVGGYPYRRVPRVAFMFLTRGPLPLAPLWERFFRGHEGRYSVYV  93

Query  927   HSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEA  748
             H+  PSY      +SVF+ R+IPSK  EWG+  M +AERRLLANALLD SNE F+L+SE+
Sbjct  94    HAL-PSYRANFTSDSVFYRRQIPSKVAEWGEMTMCDAERRLLANALLDISNEWFVLVSES  152

Query  747   CIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDR  568
             CIP+FNF+T Y Y+ NS+++F+  +D PGP GRGRY+  M P ++L  WRKGSQWFE+DR
Sbjct  153   CIPIFNFNTTYRYLQNSSQSFVMAFDDPGPYGRGRYNWNMTPEVELEQWRKGSQWFEVDR  212

Query  567   RLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHP  388
              LA+ ++ D  Y+P F+ +C   CY DEHY PT++ I+  Q  +NR++TWVDW++GG HP
Sbjct  213   ELAIAIVKDTLYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSITWVDWSRGGAHP  272

Query  387   TKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQF  217
               F R D+T +FL +++ G TC YNG+ +TMC LFARKF   +L  LL LAP ++ F
Sbjct  273   ATFGRGDITEEFLRRVQEGRTCLYNGQNSTMCFLFARKFAPSSLEPLLELAPTVLGF  329



>emb|CDP02764.1| unnamed protein product [Coffea canephora]
Length=295

 Score =   349 bits (896),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 176/296 (59%), Positives = 227/296 (77%), Gaps = 2/296 (1%)
 Frame = -3

Query  1101  LSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHS  922
             ++DEEL WRASM P+I E P + +PKVAFMFLT G LPLAPLWE FF+G  GL+SIY+H 
Sbjct  1     MTDEELFWRASMVPQIKEFPHKFLPKVAFMFLTPGPLPLAPLWEKFFKGYQGLYSIYLHP  60

Query  921   SDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEACI  742
               PSYN++ P  SVF+GRRIPSK V WG+ NMI+AERRLLANALLDFSN+RF+LLS++CI
Sbjct  61    H-PSYNDSWPQGSVFYGRRIPSKPVSWGRINMIDAERRLLANALLDFSNQRFVLLSDSCI  119

Query  741   PLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRL  562
             PLFNF+T+Y Y+++SN++F+  +D P   GRGRY+ QM P I +  WRKGSQWFE+ R L
Sbjct  120   PLFNFTTVYDYLLSSNQSFLGSFDDPRKPGRGRYNRQMFPTITIEQWRKGSQWFEVHRDL  179

Query  561   ALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTK  382
             A+ ++SD  Y+ +F  YC  PCY+DEHYLPTL+NI   + +SNR++TWVDW+KGG HP K
Sbjct  180   AVGIVSDAKYYRVFHQYCLAPCYNDEHYLPTLVNILYPEMSSNRSITWVDWSKGGSHPRK  239

Query  381   FTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             + R DVT + LN +R   TC+YNGE T  C LFARKF  + +  LL +AP ++ F+
Sbjct  240   YGRADVTDELLNGMRR-RTCKYNGETTKNCFLFARKFLPNTIEPLLRVAPSVVGFD  294



>ref|XP_008459241.1| PREDICTED: uncharacterized protein LOC103498396 [Cucumis melo]
Length=384

 Score =   352 bits (903),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 175/268 (65%), Positives = 211/268 (79%), Gaps = 1/268 (0%)
 Frame = -3

Query  1026  KVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGV  847
             KVAFMFLTRG LPL P WE FF GN GL+SIYVHS DPS+N T P  SVFHGR IPSK V
Sbjct  115   KVAFMFLTRGDLPLRPFWERFFNGNEGLYSIYVHS-DPSFNATFPLNSVFHGRTIPSKVV  173

Query  846   EWGKANMIeaerrllanalLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDL  667
             EWG+ +MIEAERRLL+NALLD SN+RF+LLSE+CIP+FNF+T+Y+Y+M S   F+E YDL
Sbjct  174   EWGQPSMIEAERRLLSNALLDVSNQRFLLLSESCIPVFNFTTVYTYLMGSAHIFVESYDL  233

Query  666   PGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSD  487
             PG +GR RY S+M P I    WRKGSQWFEMDRR A  V+ D+ YFPLFQ YC   C SD
Sbjct  234   PGRLGRNRYRSKMQPTIIETQWRKGSQWFEMDRRTATVVVEDRKYFPLFQKYCRPNCISD  293

Query  486   EHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGE  307
             EHYL T+M+I+ G+ NSNRTLTW DW+K GPHPT F   DVTV+ L ++R+G+ CEYNGE
Sbjct  294   EHYLATMMSIEFGERNSNRTLTWTDWSKHGPHPTGFESEDVTVELLERIRDGSMCEYNGE  353

Query  306   KTTMCHLFARKFTLHALSRLLILAPKLM  223
             ++ +C+LFARKF   AL+RLL +A ++M
Sbjct  354   RSRICYLFARKFMGSALNRLLEIASQIM  381



>ref|XP_002321482.2| hypothetical protein POPTR_0015s03840g [Populus trichocarpa]
 gb|EEF05609.2| hypothetical protein POPTR_0015s03840g [Populus trichocarpa]
Length=404

 Score =   353 bits (905),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 177/303 (58%), Positives = 228/303 (75%), Gaps = 6/303 (2%)
 Frame = -3

Query  1119  PGAAHNLSDEELLWRASMSPKIGEMPFRR---VPKVAFMFLTRGALPLAPLWEMFFRGNA  949
             P   H + D+EL  RASM    G   F R   V KVAFMFLT+G +PLAPLWE FFRG+ 
Sbjct  105   PPLVHKMDDDELFSRASMIR--GSQNFGRDQHVRKVAFMFLTKGPIPLAPLWEKFFRGHE  162

Query  948   GLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNER  769
             GL++IYVH   PSYN++ P  SVFHGRRIPSK VEWG+ +MI+AERRLLANALLD SNER
Sbjct  163   GLYTIYVHHH-PSYNDSVPEGSVFHGRRIPSKPVEWGRPSMIDAERRLLANALLDVSNER  221

Query  768   FILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGS  589
             F+LLSE CIP+FNF+T+Y+Y++N+ E+FI  YD P  VGRGRY+ +M P I ++DWRKGS
Sbjct  222   FVLLSETCIPIFNFTTVYNYLVNAKESFIGSYDDPRKVGRGRYNPKMLPAITISDWRKGS  281

Query  588   QWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDW  409
             QWFE+ R+LA+E+ISD  Y+ +F  YC+ PCY DEHY+PTL+NI+  + NSNR++TWVDW
Sbjct  282   QWFEVHRKLAVEIISDTKYYRIFSEYCSPPCYMDEHYIPTLVNIRCPEQNSNRSITWVDW  341

Query  408   AKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPK  229
             +K GPHP +F + D++ +FL+++R G  C YNG  +++C LFARKF    L   L LAP 
Sbjct  342   SKAGPHPGRFVKQDISDEFLDRIRFGENCTYNGNASSLCFLFARKFLPGTLQPFLHLAPT  401

Query  228   LMQ  220
             L+ 
Sbjct  402   LLH  404



>emb|CDO98418.1| unnamed protein product [Coffea canephora]
Length=294

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 226/294 (77%), Gaps = 2/294 (1%)
 Frame = -3

Query  1101  LSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHS  922
             + D EL WRASM P + E  +   PKVAFMFL +G +PLAPLWE FF G+ G +SIYVHS
Sbjct  1     MDDSELFWRASMVPMVEEFAYEYAPKVAFMFLAKGPIPLAPLWERFFHGHNGSYSIYVHS  60

Query  921   SDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEACI  742
              DPSY   EP +SVFH RR+PSK V+WG A+MI+AERRLLANALLDF+NERF+LLSE CI
Sbjct  61    -DPSYIGEEPEDSVFHRRRVPSKPVQWGTASMIDAERRLLANALLDFTNERFVLLSETCI  119

Query  741   PLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRL  562
             PLFNF+TIY+Y++ SN +FI   D P   GRGRY+  M+P I ++ WRKGSQWFE++R++
Sbjct  120   PLFNFTTIYNYLIRSNHSFIGSADDPRKSGRGRYNKAMSPAISISQWRKGSQWFEVNRKV  179

Query  561   ALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTK  382
             A+ +ISD+ Y+P+F  +C+ PCY+DEHY+PTL+NI L + NSNR++TWVDW++ GPHP +
Sbjct  180   AIRIISDRKYYPIFAEHCSPPCYNDEHYIPTLVNILLPEENSNRSVTWVDWSREGPHPGR  239

Query  381   FTRNDVTVDFLNKLRNGNT-CEYNGEKTTMCHLFARKFTLHALSRLLILAPKLM  223
             F   +V  +F+N++R G T C YNG+ ++ C LFARKF  ++L RLL L+P L 
Sbjct  240   FDWRNVNAEFMNQVRFGTTNCTYNGKNSSSCFLFARKFVPNSLKRLLELSPLLF  293



>dbj|BAK05476.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93216.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   352 bits (903),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 171/311 (55%), Positives = 226/311 (73%), Gaps = 1/311 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL+     P  A H ++DEELLWRAS +P++   PFRRVPKVAFMFLTRG LPLAPLWE 
Sbjct  82    GLERWTRPPARARHAMTDEELLWRASFAPRVRPYPFRRVPKVAFMFLTRGPLPLAPLWER  141

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FFRG+ G +S+YVH+  PSY      +SVF+ R+I SK  EWG+ +M +AERRLLANALL
Sbjct  142   FFRGHEGRYSVYVHAL-PSYRANFTKDSVFYQRQIASKVAEWGQMSMCDAERRLLANALL  200

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE F+L+SE+CIP+F+F+T Y Y  NS+++F+ V+D PGP GRGRY+  M P ++L 
Sbjct  201   DISNEWFVLVSESCIPIFDFNTTYEYFQNSSQSFVMVFDDPGPYGRGRYNYNMTPEVELT  260

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE+DR L +E+I D  Y+P F+ +C   CY DEHY PT++ I+  Q  +NR+
Sbjct  261   QWRKGSQWFEVDRDLGIEIIRDTRYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRS  320

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TWVDW++GG HP  F R D++ +FL +++ G TC YN + TT C LFARKF   AL  L
Sbjct  321   VTWVDWSRGGAHPATFGRGDISEEFLRRVQTGRTCLYNNQNTTTCFLFARKFAPSALQPL  380

Query  246   LILAPKLMQFN  214
             L+LAP ++ + 
Sbjct  381   LVLAPTVLGYG  391



>ref|XP_004981886.1| PREDICTED: uncharacterized protein LOC101780921 [Setaria italica]
Length=389

 Score =   351 bits (901),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/311 (55%), Positives = 226/311 (73%), Gaps = 1/311 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL+     P    H ++DEELLWRAS +P++   PFRRVPKVAFMFLTRG LPLAPLWE 
Sbjct  80    GLERWTRPPARVEHAMTDEELLWRASFAPRLRGYPFRRVPKVAFMFLTRGPLPLAPLWER  139

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FFRG+ G +SIYVH+  PSY+     ESVF+ R+IPSK  EWG+  M +AERRLLANALL
Sbjct  140   FFRGHEGRYSIYVHAL-PSYHANFTSESVFYRRQIPSKVAEWGQMTMCDAERRLLANALL  198

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE F+L+SE+CIP+F+F+T Y Y  NS+++F+  +D PGP GRGRY+  M P ++L+
Sbjct  199   DISNEWFVLVSESCIPIFDFNTTYKYFQNSSQSFLMAFDDPGPYGRGRYNWNMTPEVELD  258

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE+DR LA+ ++ D  Y+P F+ +C   CY DEHY PT++ I+     +NR+
Sbjct  259   QWRKGSQWFEVDRELAVAIVKDTVYYPKFKEFCRPHCYVDEHYFPTMLTIEAPHSLANRS  318

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TWVDW++GG HP  F R D++ +FL ++R G TC YN + +TMC LFARKF+  AL  L
Sbjct  319   VTWVDWSRGGAHPATFGRGDISEEFLRRVREGRTCLYNNQNSTMCFLFARKFSPSALEPL  378

Query  246   LILAPKLMQFN  214
             L LAP ++ F 
Sbjct  379   LELAPTVLGFG  389



>gb|EEE59868.1| hypothetical protein OsJ_12453 [Oryza sativa Japonica Group]
Length=383

 Score =   351 bits (900),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/311 (55%), Positives = 226/311 (73%), Gaps = 1/311 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL+     P    H ++D ELLWRAS  P++   P+RRVPKVAFMFLTRG LPLAPLWE 
Sbjct  74    GLERWTRGPDRVEHAMADGELLWRASFVPRVPGYPYRRVPKVAFMFLTRGPLPLAPLWER  133

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FFRG+ GL+S+YVH+  PSY      +SVF+ R+IPSK  EWG+  M +AERRLLANALL
Sbjct  134   FFRGHDGLYSVYVHAL-PSYRANFTTDSVFYRRQIPSKVAEWGEMTMCDAERRLLANALL  192

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE F+L+SE+CIP+FNF+T Y Y+ NS+++F+  +D PGP GRGRY+  M P ++L 
Sbjct  193   DISNEWFVLVSESCIPIFNFNTTYRYLQNSSQSFVMAFDDPGPYGRGRYNWNMTPEVELT  252

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++R LA+E++ D  Y+P F+ +C   CY DEHY PT++ I+  Q  +NR+
Sbjct  253   QWRKGSQWFEVNRELAIEIVRDTLYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRS  312

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TWVDW++GG HP  F R D+T +FL +++ G TC YNG+ +TMC LFARKF   AL  L
Sbjct  313   ITWVDWSRGGAHPATFGRGDITEEFLRRVQEGRTCLYNGQNSTMCFLFARKFAPSALEPL  372

Query  246   LILAPKLMQFN  214
             L LAP ++ F 
Sbjct  373   LELAPTVLGFG  383



>ref|XP_002305172.2| hypothetical protein POPTR_0004s09690g [Populus trichocarpa]
 gb|EEE85683.2| hypothetical protein POPTR_0004s09690g [Populus trichocarpa]
Length=356

 Score =   350 bits (897),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 179/300 (60%), Positives = 224/300 (75%), Gaps = 1/300 (0%)
 Frame = -3

Query  1113  AAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSI  934
             A HN+SDEELL RASM P + E   ++ PKVAFMFLT G LPL+ LWE FF G+ GL+SI
Sbjct  57    AMHNMSDEELLRRASMVPIVQESAQKQAPKVAFMFLTNGPLPLSLLWEKFFEGHEGLYSI  116

Query  933   YVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLS  754
             YVH   PSYN++ P  SVF GRRIPS+ V WG   MI+AERRLLANALLD SN+RF+LLS
Sbjct  117   YVHP-HPSYNDSWPRSSVFFGRRIPSQAVYWGTGTMIDAERRLLANALLDSSNQRFVLLS  175

Query  753   EACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEM  574
             E+CIPLFNF T Y ++MNSN +F+  +D P   GRGRY+ +M P I + DWRKGSQWFE+
Sbjct  176   ESCIPLFNFKTTYDHLMNSNISFLGSFDDPRKPGRGRYNPRMWPAINITDWRKGSQWFEV  235

Query  573   DRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGP  394
              R +A+ +ISDQ Y+ +FQ +C  PCY DEHY PTL+NI   + NSNR++TWVDW++GGP
Sbjct  236   HRDIAVHIISDQKYYQVFQEHCHPPCYMDEHYFPTLVNILYPELNSNRSITWVDWSRGGP  295

Query  393   HPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             HP KF   D+T +FLN++R+G+ C YNG  T+MC+LFARKF    L  LL +AP L  F+
Sbjct  296   HPGKFRWADITDEFLNQIRHGSECVYNGNTTSMCYLFARKFLPQTLEPLLRIAPLLHVFD  355



>ref|XP_006286517.1| hypothetical protein CARUB_v10001158mg [Capsella rubella]
 gb|EOA19415.1| hypothetical protein CARUB_v10001158mg [Capsella rubella]
Length=386

 Score =   350 bits (898),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 170/310 (55%), Positives = 226/310 (73%), Gaps = 1/310 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             G  + ++ P    HN+SDEELLWRAS  P+  E PF+RVPK+AFMFLT+G LPLA LWE 
Sbjct  78    GFSQWILPPAVLMHNMSDEELLWRASFWPRRKEYPFKRVPKIAFMFLTKGPLPLALLWER  137

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FF+G+ GL+S+Y+H   PS+    P  SVFH R+IPS+  EWG+ +M +AE+RLLANALL
Sbjct  138   FFKGHNGLYSVYLHP-HPSFTAKFPANSVFHRRQIPSQVAEWGRMSMCDAEKRLLANALL  196

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE FIL+SE+CIPL+NF+TIYSY+  S  +F+  +D PGP GRGRY+S M P + + 
Sbjct  197   DISNEWFILVSESCIPLYNFTTIYSYLSRSKHSFMGAFDDPGPYGRGRYNSNMEPEVPIT  256

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++R LA  ++ D  Y+P F+ +C   CY DEHY PT++ I+  +  +NR+
Sbjct  257   KWRKGSQWFEINRDLAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPEVLANRS  316

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             LTWVDW++GGPHP  F R+DVT +F  K+ +G  C YNG  T+MC+LFARKF   AL  L
Sbjct  317   LTWVDWSRGGPHPATFGRSDVTENFFVKIFDGRNCTYNGRNTSMCYLFARKFAPSALEPL  376

Query  246   LILAPKLMQF  217
             L ++PK++ F
Sbjct  377   LSISPKILGF  386



>ref|XP_007160978.1| hypothetical protein PHAVU_001G033200g [Phaseolus vulgaris]
 gb|ESW32972.1| hypothetical protein PHAVU_001G033200g [Phaseolus vulgaris]
Length=380

 Score =   350 bits (897),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 221/301 (73%), Gaps = 1/301 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL + +  P    HN+SD+ELLWRAS  P+I   P+ RVPK+AFMFLT+G +PLAPLWE 
Sbjct  71    GLDKWIKPPLSLIHNMSDKELLWRASFVPRIKNYPYPRVPKIAFMFLTKGPMPLAPLWER  130

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             F +G+  LFSIY+HS  PSY    PP SVF+GR+IPS+  EWG+ +M +AERRLLANALL
Sbjct  131   FLKGHEKLFSIYIHSL-PSYQPQFPPSSVFYGRQIPSQVSEWGRMSMCDAERRLLANALL  189

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             DFSNE FILLSE+CIP++NFS IY Y+M S  +F+  +D PGP GRGRY+  M P++ + 
Sbjct  190   DFSNEWFILLSESCIPIYNFSFIYHYIMKSKHSFVGAFDDPGPFGRGRYNENMAPLVNIT  249

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++R+LA+ ++ D T+ P+F+ YC   CY DEHY PT++ I+     +NR+
Sbjct  250   KWRKGSQWFEVNRKLAITIVEDSTFHPIFEQYCRPACYVDEHYFPTMLTIQAANVLANRS  309

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TWVDW++GG HP  F RND+  +F N++R G+TC YN   +++C LFARKF   AL  L
Sbjct  310   ITWVDWSRGGAHPATFGRNDINEEFFNRVRGGHTCLYNNRNSSVCVLFARKFAPSALEPL  369

Query  246   L  244
             L
Sbjct  370   L  370



>ref|XP_010682059.1| PREDICTED: uncharacterized protein LOC104896962 [Beta vulgaris 
subsp. vulgaris]
Length=421

 Score =   351 bits (900),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 178/306 (58%), Positives = 221/306 (72%), Gaps = 2/306 (1%)
 Frame = -3

Query  1131  LMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGN  952
             L+ P    HNLSDEELLWRASM PK+ E PF+RVPKVAFMFLTRG LPL PLWE FF+G 
Sbjct  117   LVHPKELNHNLSDEELLWRASMVPKVVEYPFKRVPKVAFMFLTRGPLPLLPLWERFFKGY  176

Query  951   AGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNE  772
                +SIYVH+  P +     P+SVF GR+IPSK V WG  ++ +AE+RLLANALLDFSNE
Sbjct  177   EQYYSIYVHTI-PGFVLEVSPDSVFFGRQIPSKEVSWGNVSLADAEKRLLANALLDFSNE  235

Query  771   RFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKG  592
             RF+LLSE+CIP++NF T+Y Y+  S  TF+E YD P   GRGRY   M P I ++ WRKG
Sbjct  236   RFVLLSESCIPIYNFQTVYKYLTESTHTFVESYDDPTRFGRGRYDRHMRPSIMIDQWRKG  295

Query  591   SQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVD  412
             +QWFE++R L +E+ISD  Y+ LF+ YC  PC+ DEHY+PT +NI     NSNRTLT VD
Sbjct  296   AQWFEINRALGIEIISDYKYYDLFRKYCHPPCFPDEHYIPTYLNIFHAPFNSNRTLTKVD  355

Query  411   WAKGGPHPTKFTRNDVTVDFLNKLRNG-NTCEYNGEKTTMCHLFARKFTLHALSRLLILA  235
             W+ GGPHPT F R+++T  F+  +RN    C YN + TT+C+LFARKF   AL  LL L+
Sbjct  356   WSLGGPHPTTFVRDNITEGFIQNIRNNKKKCLYNSKSTTVCYLFARKFAPSALEPLLDLS  415

Query  234   PKLMQF  217
              K+M F
Sbjct  416   LKVMGF  421



>ref|XP_010519868.1| PREDICTED: uncharacterized protein LOC104799181 [Tarenaya hassleriana]
Length=384

 Score =   349 bits (896),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/310 (55%), Positives = 220/310 (71%), Gaps = 1/310 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL   +  P    H +SDEELLWRAS  P+  E PF RVPK+AFMFLT+G LPL+PLWE 
Sbjct  76    GLDRWIRPPSDLMHEMSDEELLWRASFVPRRKEYPFNRVPKIAFMFLTKGPLPLSPLWER  135

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             F +G  GL+S+Y+HS  PS+    PP SVF+ R+IPSK  EWG+  M +AERRLLANALL
Sbjct  136   FLKGYEGLYSVYIHS-HPSFTAKFPPSSVFYRRQIPSKAAEWGRMTMCDAERRLLANALL  194

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE F+LLSE CIPLFNF+TI+ Y+  S  +F+  +D PGP GRGRY+S M P + + 
Sbjct  195   DISNEWFVLLSETCIPLFNFTTIHRYITKSKHSFVGSFDDPGPYGRGRYNSSMAPEMDIT  254

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++R LA+ ++ D  Y+P F+ +C   CY DEHY PT++N++     +NR+
Sbjct  255   QWRKGSQWFEVNRELAVTIVKDTVYYPKFRDFCRPACYVDEHYFPTMLNVEKPGLLANRS  314

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TWVDW++GG HP  F R+D+T DF  ++  G  C YNG  T+MC+LFARKF   AL  L
Sbjct  315   VTWVDWSRGGAHPATFGRSDMTEDFFGRIHGGRNCSYNGHNTSMCYLFARKFAPSALEPL  374

Query  246   LILAPKLMQF  217
             L LAPK++ F
Sbjct  375   LHLAPKVLGF  384



>gb|KHN37013.1| hypothetical protein glysoja_009041 [Glycine soja]
Length=324

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/311 (54%), Positives = 225/311 (72%), Gaps = 2/311 (1%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL + +  P    HN+SDEELLWRAS  P+I   P+ RVPK+AFMFLT+G LPLAPLWE 
Sbjct  15    GLDKWIRPPSSLIHNMSDEELLWRASFVPRIKGYPYPRVPKIAFMFLTKGPLPLAPLWER  74

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             F +G+   +SIY+HS  PSY    PP SVF+ R+IPS+  EWG+ +M +AERRLLANALL
Sbjct  75    FLKGHEKFYSIYIHSL-PSYQPQFPPSSVFYSRQIPSQVSEWGRMSMCDAERRLLANALL  133

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE FILLSE+CIPL+NFS +Y Y+M S  +F+  +D PGP GRGRY+  M P++ + 
Sbjct  134   DISNEWFILLSESCIPLYNFSFVYHYIMKSKHSFVGAFDDPGPYGRGRYNEHMAPLVNVT  193

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++R+LA+ ++ D T+ P+F+ YC   CY DEHY PT++ I+     +NR+
Sbjct  194   KWRKGSQWFEVNRKLAITIVEDTTFHPIFEQYCRPACYVDEHYFPTMLTIQAANVLANRS  253

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TWVDW++GG HP  F RND+T +F N++R G+TC YN   +++C LFARKF   AL  L
Sbjct  254   ITWVDWSRGGAHPATFGRNDITEEFFNRVRRGHTCLYNNRNSSVCALFARKFAPSALEPL  313

Query  246   L-ILAPKLMQF  217
             L ++  K++ F
Sbjct  314   LHMVDSKVLDF  324



>ref|NP_001143764.1| uncharacterized protein LOC100276526 [Zea mays]
 gb|ACG35102.1| hypothetical protein [Zea mays]
Length=389

 Score =   349 bits (895),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/311 (55%), Positives = 225/311 (72%), Gaps = 1/311 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL+     P    H ++D+ELLWRAS +P++   PFRRVPKVAFMFLTRG LPLAPLWE 
Sbjct  80    GLERWTRPPARVEHAMTDQELLWRASFAPRVRGYPFRRVPKVAFMFLTRGPLPLAPLWER  139

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FFRG+ G +SIYVH+  PSY+     ESVF+ R+IPSK  EWG+  M +AERRLLANALL
Sbjct  140   FFRGHEGRYSIYVHAL-PSYHANFTSESVFYRRQIPSKVAEWGQMTMCDAERRLLANALL  198

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE F+L+SE+CIP+F+F+T Y Y  NSN++F+  +D PGP GRGRY+  M P ++L+
Sbjct  199   DISNEWFVLVSESCIPIFDFNTTYRYFRNSNQSFLMAFDDPGPYGRGRYNWNMTPEVELD  258

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE+ R LA+E++ D  Y+P F+ +C   CY DEHY PT++ I+     +NR+
Sbjct  259   QWRKGSQWFEVHRELAIEIVKDTVYYPKFKEFCRPHCYVDEHYFPTMLTIEAPNRLANRS  318

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TWVDW++GG HP  F R D+T++FL ++R G TC +N + +TMC LFARKF    L  L
Sbjct  319   VTWVDWSRGGAHPATFGRRDITLEFLRRVREGRTCLHNNQNSTMCFLFARKFAPSTLEPL  378

Query  246   LILAPKLMQFN  214
             L LAP ++ F 
Sbjct  379   LELAPTVLGFG  389



>tpg|DAA51164.1| TPA: hypothetical protein ZEAMMB73_778026 [Zea mays]
Length=389

 Score =   349 bits (895),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/311 (55%), Positives = 225/311 (72%), Gaps = 1/311 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL+     P    H ++D+ELLWRAS +P++   PFRRVPKVAFMFLTRG LPLAPLWE 
Sbjct  80    GLERWTRPPARVEHAMTDQELLWRASFAPRVRGYPFRRVPKVAFMFLTRGPLPLAPLWER  139

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FFRG+ G +SIYVH+  PSY+     ESVF+ R+IPSK  EWG+  M +AERRLLANALL
Sbjct  140   FFRGHEGRYSIYVHAL-PSYHANFTSESVFYRRQIPSKVAEWGQMTMCDAERRLLANALL  198

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE F+L+SE+CIP+F+F+T Y Y  NSN++F+  +D PGP GRGRY+  M P ++L+
Sbjct  199   DISNEWFVLVSESCIPIFDFNTTYRYFRNSNQSFLMAFDDPGPYGRGRYNWNMTPEVELD  258

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE+ R LA+E++ D  Y+P F+ +C   CY DEHY PT++ I+     +NR+
Sbjct  259   QWRKGSQWFEVHRELAIEIVKDTVYYPKFKEFCRPHCYVDEHYFPTMLTIEAPNRLANRS  318

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TWVDW++GG HP  F R D+T++FL ++R G TC +N + +TMC LFARKF    L  L
Sbjct  319   VTWVDWSRGGAHPATFGRGDITLEFLRRVREGRTCLHNNQNSTMCFLFARKFAPSTLEPL  378

Query  246   LILAPKLMQFN  214
             L LAP ++ F 
Sbjct  379   LELAPTVLGFG  389



>gb|AAT77886.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF98696.1| expressed protein [Oryza sativa Japonica Group]
Length=398

 Score =   349 bits (895),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/310 (55%), Positives = 225/310 (73%), Gaps = 1/310 (0%)
 Frame = -3

Query  1143  LKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMF  964
             L+     P    H ++D ELLWRAS  P++   P+RRVPKVAFMFLTRG LPLAPLWE F
Sbjct  90    LERWTRGPDRVEHAMADGELLWRASFVPRVPGYPYRRVPKVAFMFLTRGPLPLAPLWERF  149

Query  963   FRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLD  784
             FRG+ GL+S+YVH+  PSY      +SVF+ R+IPSK  EWG+  M +AERRLLANALLD
Sbjct  150   FRGHDGLYSVYVHAL-PSYRANFTTDSVFYRRQIPSKVAEWGEMTMCDAERRLLANALLD  208

Query  783   FSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLND  604
              SNE F+L+SE+CIP+FNF+T Y Y+ NS+++F+  +D PGP GRGRY+  M P ++L  
Sbjct  209   ISNEWFVLVSESCIPIFNFNTTYRYLQNSSQSFVMAFDDPGPYGRGRYNWNMTPEVELTQ  268

Query  603   WRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTL  424
             WRKGSQWFE++R LA+E++ D  Y+P F+ +C   CY DEHY PT++ I+  Q  +NR++
Sbjct  269   WRKGSQWFEVNRELAIEIVRDTLYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSI  328

Query  423   TWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLL  244
             TWVDW++GG HP  F R D+T +FL +++ G TC YNG+ +TMC LFARKF   AL  LL
Sbjct  329   TWVDWSRGGAHPATFGRGDITEEFLRRVQEGRTCLYNGQNSTMCFLFARKFAPSALEPLL  388

Query  243   ILAPKLMQFN  214
              LAP ++ F 
Sbjct  389   ELAPTVLGFG  398



>ref|XP_011035090.1| PREDICTED: uncharacterized protein LOC105133011 [Populus euphratica]
Length=377

 Score =   348 bits (893),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 177/300 (59%), Positives = 223/300 (74%), Gaps = 1/300 (0%)
 Frame = -3

Query  1113  AAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSI  934
             A HN+SDEELL RAS  P + E   +  PKVAFMFLT G LPL+ LWE FF G+ GL+SI
Sbjct  78    AMHNMSDEELLRRASKVPIVQESAHKHAPKVAFMFLTYGPLPLSLLWEKFFEGHEGLYSI  137

Query  933   YVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLS  754
             Y+H   PSYN++ P  SVF+GRRIPS+ V WG   MI+AERRLLANALLD+SN+RF+LLS
Sbjct  138   YLHP-HPSYNDSWPRSSVFYGRRIPSQAVYWGTGTMIDAERRLLANALLDYSNQRFVLLS  196

Query  753   EACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEM  574
             E+CIPLFNF T Y +VMNSN +F+  +D P   GRGRY+ +M P I + DWRKGSQWFE+
Sbjct  197   ESCIPLFNFKTTYDHVMNSNLSFLGSFDDPRKPGRGRYNPRMWPAINITDWRKGSQWFEV  256

Query  573   DRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGP  394
              R +A+ +ISD+ Y+ +FQ +C  PCY DEHY PTL+NI   + NSNR++TWVDW++GGP
Sbjct  257   HRDMAVHIISDKKYYQVFQEHCHPPCYMDEHYFPTLVNILYPELNSNRSITWVDWSRGGP  316

Query  393   HPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             HP KF   D+T +FLN++R G+ C YNG  T+MC+LFARKF    L  LL +AP L  F+
Sbjct  317   HPAKFGWADITDEFLNQIRLGSECVYNGNTTSMCYLFARKFLPQTLEPLLRIAPLLHVFD  376



>ref|XP_010230469.1| PREDICTED: uncharacterized protein LOC100843610 [Brachypodium 
distachyon]
Length=390

 Score =   348 bits (894),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 224/303 (74%), Gaps = 1/303 (0%)
 Frame = -3

Query  1122  PPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGL  943
             P  A H ++DEELLWRAS +P++   PF RVPKVAFMFLTRG LPLAPLWE FFRG+ G 
Sbjct  89    PARARHAMTDEELLWRASFAPRVRPYPFARVPKVAFMFLTRGPLPLAPLWERFFRGHEGR  148

Query  942   FSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFI  763
             +SIYVH+  PSY      +SVF+ R+I SK  EWG+  M +AERRLLANALLD SNE F+
Sbjct  149   YSIYVHAL-PSYRANFTSDSVFYHRQIASKVAEWGQMTMCDAERRLLANALLDISNEWFV  207

Query  762   LLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQW  583
             L+SE+CIP+F+F+T Y Y  NS+++F+ V+D PGP GRGRY+  M P +++  WRKGSQW
Sbjct  208   LVSESCIPIFDFNTTYEYFQNSSQSFVMVFDDPGPYGRGRYNDNMTPEVEITQWRKGSQW  267

Query  582   FEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAK  403
             FE+DR LA+E++ D  Y+P F+ +C   CY DEHY PT++ I+  Q  +NR++TWVDW++
Sbjct  268   FEVDRELAIEIVKDTRYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSVTWVDWSR  327

Query  402   GGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLM  223
             GG HP  F R D+T +FL ++++ +TC YN + +TMC LFARKF   AL  LL+LAP ++
Sbjct  328   GGAHPATFGRGDITEEFLRRVQSKHTCLYNNQNSTMCFLFARKFAPSALEPLLVLAPTVL  387

Query  222   QFN  214
              + 
Sbjct  388   GYG  390



>ref|XP_002466520.1| hypothetical protein SORBIDRAFT_01g009220 [Sorghum bicolor]
 gb|EER93518.1| hypothetical protein SORBIDRAFT_01g009220 [Sorghum bicolor]
Length=386

 Score =   348 bits (894),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 172/311 (55%), Positives = 223/311 (72%), Gaps = 1/311 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL+     P    H ++DEELLWRAS +P++   PFRRVPKVAFMFLTRG LPLAPLWE 
Sbjct  77    GLERWTRPPARVEHAMTDEELLWRASFAPRVRGYPFRRVPKVAFMFLTRGPLPLAPLWER  136

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FFRG+ G +SIYVH+  PSY+     ESVF+ R+IPSK  EWG+  M +AERRLLANALL
Sbjct  137   FFRGHEGRYSIYVHAL-PSYHANFTSESVFYRRQIPSKVAEWGQMTMCDAERRLLANALL  195

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE F+L+SE+CIP+F+F+T Y Y  NSN +F+  +D  GP GRGRY+  M P ++L+
Sbjct  196   DISNEWFVLVSESCIPIFDFNTTYRYFQNSNRSFLMAFDDHGPYGRGRYNWNMTPEVELD  255

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE+ R LA+E++ D  Y+P F+ +C   CY DEHY PT++ I+     +NR+
Sbjct  256   QWRKGSQWFEVHRELAIEIVKDTVYYPKFKEFCRPHCYVDEHYFPTMLTIEAPNSLANRS  315

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TWVDW++GG HP  F R D+T +FL +++ G TC YN + +TMC LFARKF   AL  L
Sbjct  316   VTWVDWSRGGAHPATFGRGDITEEFLRRVQKGRTCLYNNQNSTMCFLFARKFAPSALEPL  375

Query  246   LILAPKLMQFN  214
             L LAP ++ F 
Sbjct  376   LELAPTVLGFG  386



>ref|XP_002466518.1| hypothetical protein SORBIDRAFT_01g009200 [Sorghum bicolor]
 gb|EER93516.1| hypothetical protein SORBIDRAFT_01g009200 [Sorghum bicolor]
Length=380

 Score =   348 bits (893),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 170/301 (56%), Positives = 224/301 (74%), Gaps = 1/301 (0%)
 Frame = -3

Query  1116  GAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFS  937
             G  H+++DEELLWRAS +P +   PFRRVPKVAFMFLTRG LPLAPLWE FFRGN G +S
Sbjct  81    GLEHSMTDEELLWRASFAPGVRRYPFRRVPKVAFMFLTRGPLPLAPLWERFFRGNDGRYS  140

Query  936   IYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILL  757
             IYVH+  PSY      ESVF+ R+IPSK  EWG+  M +AERRLLANALLD SNE F+L+
Sbjct  141   IYVHAL-PSYRANFTSESVFYRRQIPSKVAEWGQMTMCDAERRLLANALLDISNEWFVLV  199

Query  756   SEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFE  577
             SE+CIP+F+F+T Y Y +NS+++F+   D PGP GRGRY+  M P ++L+ WRKGSQWFE
Sbjct  200   SESCIPIFDFNTTYQYFLNSSQSFVMAIDDPGPYGRGRYNWNMTPEVELDQWRKGSQWFE  259

Query  576   MDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGG  397
             ++R LA+E++ D  Y+P F+ +C   CYSDEHY+ T+++I+  Q  +NR++TWVDW++  
Sbjct  260   VNRELAIEIVKDTVYYPKFKEFCRPSCYSDEHYIQTMLSIETPQSLANRSVTWVDWSRIA  319

Query  396   PHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQF  217
              HP +F R D+T +FL ++R G TC YN + +T+C LFARKF   AL  LL LAP ++ F
Sbjct  320   AHPARFGRGDITEEFLREVREGQTCLYNEQNSTLCFLFARKFAPSALGPLLELAPTVLGF  379

Query  216   N  214
              
Sbjct  380   G  380



>ref|XP_009337144.1| PREDICTED: uncharacterized protein LOC103929645 [Pyrus x bretschneideri]
 ref|XP_009337145.1| PREDICTED: uncharacterized protein LOC103929645 [Pyrus x bretschneideri]
Length=389

 Score =   348 bits (893),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/310 (54%), Positives = 222/310 (72%), Gaps = 1/310 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL   +  P    H ++DEELLWRAS +P+I + PF RVPK+AFMFLT+G LPLAPLWE 
Sbjct  81    GLDRWIKPPSSVKHTMNDEELLWRASFTPRIKKYPFERVPKIAFMFLTKGPLPLAPLWER  140

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             F +G+ GL+S+YVHS  PS+     P SVF+GR IPS+  EWG+ +M +AERRLLANALL
Sbjct  141   FLKGHEGLYSVYVHSL-PSFQPHFNPSSVFYGRHIPSQVAEWGRMSMCDAERRLLANALL  199

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNERFILLSE+CIPL+NFS IY Y+M S  +++  +D PGP GRGRY+  M P +K++
Sbjct  200   DISNERFILLSESCIPLYNFSVIYHYLMKSKYSYVGAFDDPGPYGRGRYNDNMAPEVKIS  259

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++R+LA+ ++ D  ++P F+ +C   CY DEHY PT++ I+ G   +NR+
Sbjct  260   KWRKGSQWFEVNRKLAITIVEDTKFYPKFKEFCRPACYVDEHYFPTMLTIEAGNSLANRS  319

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TWVDW++GGPHP  F R  +T +FL ++     C YN   +T+C LF RKF   A+  L
Sbjct  320   ITWVDWSRGGPHPATFGRAHITGEFLKRIFETQRCTYNDRNSTICFLFGRKFAPSAMEPL  379

Query  246   LILAPKLMQF  217
             L LAPK + F
Sbjct  380   LHLAPKFLGF  389



>ref|XP_003550286.1| PREDICTED: uncharacterized protein LOC100785919 [Glycine max]
Length=381

 Score =   348 bits (892),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 168/311 (54%), Positives = 225/311 (72%), Gaps = 2/311 (1%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL + +  P    HN+SDEELLWRAS  P+I   P+ RVPK+AFMFLT+G LPLAPLWE 
Sbjct  72    GLDKWIRPPSSLIHNMSDEELLWRASFVPRIKGYPYPRVPKIAFMFLTKGPLPLAPLWER  131

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             F +G+   +SIY+HS  PSY    PP SVF+ R+IPS+  EWG+ +M +AERRLLANALL
Sbjct  132   FLKGHEKFYSIYIHSL-PSYQPQFPPSSVFYSRQIPSQVSEWGRMSMCDAERRLLANALL  190

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE FILLSE+CIPL+NFS +Y Y+M S  +F+  +D PGP GRGRY+  M P++ + 
Sbjct  191   DISNEWFILLSESCIPLYNFSFVYHYIMKSKHSFVGAFDDPGPYGRGRYNEHMAPLVNVT  250

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++R+LA+ ++ D T+ P+F+ YC   CY DEHY PT++ I+     +NR+
Sbjct  251   KWRKGSQWFEVNRKLAITIVEDTTFHPIFEQYCRPACYVDEHYFPTMLTIQAANVLANRS  310

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TWVDW++GG HP  F RND+T +F N++R G+TC YN   +++C LFARKF   AL  L
Sbjct  311   ITWVDWSRGGAHPATFGRNDITEEFFNRVRRGHTCLYNNRNSSVCALFARKFAPSALEPL  370

Query  246   L-ILAPKLMQF  217
             L ++  K++ F
Sbjct  371   LHMVDSKVLDF  381



>ref|XP_010049161.1| PREDICTED: uncharacterized protein LOC104437817 [Eucalyptus grandis]
 gb|KCW81640.1| hypothetical protein EUGRSUZ_C03002 [Eucalyptus grandis]
Length=385

 Score =   348 bits (892),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 168/310 (54%), Positives = 226/310 (73%), Gaps = 1/310 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
              L   +  P    HN+SD+EL WRA++ PKI + PFRRVPK+AFMFLT+G LPLAPLWE 
Sbjct  77    SLDRWIQPPSDLLHNMSDKELFWRATLVPKIKKYPFRRVPKIAFMFLTKGPLPLAPLWER  136

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FF+G+ GL+SIY+HS  PS++    P SVF+ R+IPS+  EWG+ +M +AE+RLLANALL
Sbjct  137   FFKGHEGLYSIYIHS-HPSFHAHFHPWSVFNRRQIPSQVSEWGRMSMCDAEKRLLANALL  195

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNERFILLSE+CIPL+NFS IY Y+M S  +F+  +D PGP GRGRY+  M P + ++
Sbjct  196   DISNERFILLSESCIPLYNFSLIYHYIMKSGYSFMGAFDDPGPYGRGRYNLNMAPEVNIS  255

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++R+LA+ ++ D TY P F+++C   CY DEHY PT++ I+ G   +NR+
Sbjct  256   QWRKGSQWFEINRKLAINIVEDATYHPKFETFCRPACYVDEHYFPTMLTIQAGHLLANRS  315

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TWVDW++GG HP  F R+D+T +FL ++     C YN   ++ C LFARKF   AL  L
Sbjct  316   ITWVDWSRGGAHPATFGRSDITEEFLRRISKNQRCTYNKRNSSTCFLFARKFAPSALHPL  375

Query  246   LILAPKLMQF  217
             L LAPK++ +
Sbjct  376   LELAPKVLGY  385



>ref|XP_009357886.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103948560 
[Pyrus x bretschneideri]
Length=496

 Score =   352 bits (902),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 171/299 (57%), Positives = 231/299 (77%), Gaps = 2/299 (1%)
 Frame = -3

Query  1110  AHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIY  931
              HN+SDEEL  RASM P+I   P++ VPKVAFMFLT+G LPL+PLWE FF+G+ GL+SIY
Sbjct  199   VHNMSDEELFRRASMVPRIQYFPYKLVPKVAFMFLTKGPLPLSPLWEKFFKGHEGLYSIY  258

Query  930   VHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSE  751
             VH+  P +NE+ P +SVFHGRRI S+ V WG ++M++AERRLLAN LLD SN+RF+LLSE
Sbjct  259   VHA-HPDFNESVPEDSVFHGRRIHSQPVYWGTSSMLDAERRLLANGLLDISNQRFVLLSE  317

Query  750   ACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMD  571
             +CIPLFNF+T Y Y++NSN++F+  +D P   GRGRY+ QM P+I + +WRKGSQWFE+ 
Sbjct  318   SCIPLFNFTTAYDYLINSNQSFLNSFDDPRKPGRGRYNPQMYPMINITNWRKGSQWFEV-  376

Query  570   RRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPH  391
              R A+ ++SD+ Y+P+FQ YC  PCY DEHY+PTL+N+   + +S R++TWVDW++GGPH
Sbjct  377   HRXAVHIVSDRKYYPIFQQYCNPPCYIDEHYIPTLVNLLYTELSSKRSVTWVDWSRGGPH  436

Query  390   PTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             P KF   D++ + LN++R G+ C YNG  T++C LFARKF  + L  LL +AP L+ F+
Sbjct  437   PGKFGWIDISNELLNRIRFGSKCTYNGNTTSVCFLFARKFLPNTLEPLLRVAPLLLGFD  495



>ref|XP_008645560.1| PREDICTED: uncharacterized protein LOC103626979 [Zea mays]
 gb|AFW71055.1| hypothetical protein ZEAMMB73_279959 [Zea mays]
Length=464

 Score =   350 bits (899),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 230/295 (78%), Gaps = 5/295 (2%)
 Frame = -3

Query  1092  EELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHSSDP  913
             EEL+ RA+ +P+  E+P    P+VAF+FLTR  LP+ PLW+MFFRG+  L+++YVHS DP
Sbjct  173   EELMARAASAPR--EVPAGTTPRVAFLFLTRWDLPMEPLWDMFFRGHRSLYNVYVHS-DP  229

Query  912   SYNETEPPE-SVFHGRRIPSKGVEWGKANMIeaerrllanalLD-FSNERFILLSEACIP  739
             ++N +EPPE S F+ RRIPSK V+WG+ +M+EAERRLLA+ALLD  +N RF+LLSE  +P
Sbjct  230   AFNGSEPPETSAFYRRRIPSKDVKWGEISMMEAERRLLAHALLDDHANARFVLLSETHVP  289

Query  738   LFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRLA  559
             LF+F T+YSY++NS + ++E YD PGP GRGRYS +M+P++    WRKGSQWF++DR LA
Sbjct  290   LFDFPTVYSYLVNSTKLYLESYDQPGPTGRGRYSRRMSPVVAAGQWRKGSQWFDLDRGLA  349

Query  558   LEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTKF  379
             ++V++D+ YFPLF  +C   CY+DEHYLPTL+NI+     +NR+LTWVDW+ GGPHP +F
Sbjct  350   VDVVADRVYFPLFHRFCRRSCYADEHYLPTLLNIRRPAAGANRSLTWVDWSHGGPHPARF  409

Query  378   TRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             TR +VTVDFL  LR G+TC YNG  TT+C LFARKF  ++L+R L  APK+M F 
Sbjct  410   TRMEVTVDFLRWLRGGSTCTYNGRTTTVCFLFARKFLPNSLTRFLRFAPKVMGFG  464



>ref|NP_177522.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase-like 
protein [Arabidopsis thaliana]
 gb|AAG52068.1|AC012679_6 hypothetical protein; 83152-80450 [Arabidopsis thaliana]
 gb|AEE35511.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase-like 
protein [Arabidopsis thaliana]
 gb|AHL38878.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=418

 Score =   348 bits (894),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 180/314 (57%), Positives = 226/314 (72%), Gaps = 6/314 (2%)
 Frame = -3

Query  1149  VGLK-ELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLW  973
             VG K   LM P    HN+++EELL RAS   KI E   +   K AFMFLTRG LPLA LW
Sbjct  108   VGQKGHYLMMPENVVHNMTEEELLLRAS---KIQEKTLKMTKKAAFMFLTRGKLPLAKLW  164

Query  972   EMFFRGNAGLFSIYVHSSDPSYNETEPPE-SVFHGRRIPSKGVEWGKANMIeaerrllan  796
             E FF+G+ GLFSIY+H+SDP Y +   PE S F+ RRIPSK V WG  +M+ AERRLLAN
Sbjct  165   ERFFKGHEGLFSIYIHTSDPFYFDDHTPETSPFYRRRIPSKEVGWGMVSMVAAERRLLAN  224

Query  795   alLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPII  616
             ALLD  N RF+LLSE+ IPLFNFSTIYSY++NS  ++++VYDLPGP GRGRY+ +M+P+I
Sbjct  225   ALLDAGNHRFVLLSESDIPLFNFSTIYSYLINSQHSYVDVYDLPGPAGRGRYNRRMSPVI  284

Query  615   KLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNS  436
                +WRKGSQWFE+DR +AL V+SD TYFP+F+ YC   CY+DEHYL T ++      N+
Sbjct  285   SRTNWRKGSQWFEIDREVALAVVSDTTYFPVFEKYCLWNCYADEHYLSTFVHAMFPGKNA  344

Query  435   NRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNT-CEYNGEKTTMCHLFARKFTLHA  259
             NR+LTW DW++ GPHP K+TR  VT +FL ++RN    C YNG+K+  C+LFARKF    
Sbjct  345   NRSLTWTDWSRRGPHPRKYTRRSVTGEFLRRVRNREQGCVYNGKKSEKCYLFARKFDGST  404

Query  258   LSRLLILAPKLMQF  217
             L +LL  A  +M F
Sbjct  405   LDKLLYFAHSVMGF  418



>ref|XP_010244357.1| PREDICTED: uncharacterized protein LOC104588211 [Nelumbo nucifera]
 ref|XP_010244358.1| PREDICTED: uncharacterized protein LOC104588211 [Nelumbo nucifera]
Length=385

 Score =   347 bits (891),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 165/306 (54%), Positives = 224/306 (73%), Gaps = 1/306 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
              L+  +  P    H +SD+EL WRAS  P++ + PFRRVPK+AF+FLTRG LPLAPLWE 
Sbjct  77    SLERWIRPPSSLIHKMSDQELFWRASFVPRVKKYPFRRVPKIAFLFLTRGPLPLAPLWER  136

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             F +G+AGL+SIY+HS  PSY+   PP SVF+ R+IPS+  EWGK +M +AERRLLANALL
Sbjct  137   FLKGHAGLYSIYIHSL-PSYDAKFPPTSVFYRRQIPSQVSEWGKMSMCDAERRLLANALL  195

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE F+L+SE+CIPL+NFS IY+Y+  S  +FI  +D PGP GRGRY+  M P + + 
Sbjct  196   DISNEWFVLVSESCIPLYNFSIIYNYIARSRYSFIGAFDDPGPYGRGRYNENMAPEVNIT  255

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++R+LA+ ++ D  ++P F+ +C   CY DEHY PT++ I+  Q  +NR+
Sbjct  256   QWRKGSQWFEINRKLAINIVGDVIFYPKFEEFCKPNCYVDEHYFPTMLTIQAAQLLANRS  315

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TWVDW++GG HP  F R D+T DF+ ++  G++C YN + +++C+LFARKF   AL  L
Sbjct  316   ITWVDWSRGGAHPATFGRADITEDFVKRILEGHSCLYNNQPSSVCYLFARKFAPSALEPL  375

Query  246   LILAPK  229
               LAPK
Sbjct  376   FFLAPK  381



>ref|XP_002516477.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45818.1| conserved hypothetical protein [Ricinus communis]
Length=371

 Score =   346 bits (888),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/309 (54%), Positives = 219/309 (71%), Gaps = 1/309 (0%)
 Frame = -3

Query  1143  LKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMF  964
             L   +  P    H ++DEELLWRA+  PKI + PF RVPK+AFMFLT+G LPLAPLWE F
Sbjct  64    LDRWIKPPSNIVHKMNDEELLWRATFVPKIKKYPFERVPKIAFMFLTKGPLPLAPLWERF  123

Query  963   FRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLD  784
              +G+ GL+SIYVHS  P++    PP SVFH R+IPS+  EWGK +M +AERRLLANALLD
Sbjct  124   LKGHEGLYSIYVHSL-PTFEAKFPPSSVFHRRQIPSQISEWGKMSMCDAERRLLANALLD  182

Query  783   FSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLND  604
              SNERFILLSE+CIPL+NFS IY Y+M S  +FI  +D  GP GRGRY+  M P + +  
Sbjct  183   ISNERFILLSESCIPLYNFSVIYHYIMKSRYSFIGAFDDHGPYGRGRYNENMAPEVNITQ  242

Query  603   WRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTL  424
             WRKGSQWFE++RRLA+ ++ D T++P F+ +C   CY DEHY PT++ I+     +NR++
Sbjct  243   WRKGSQWFEINRRLAVNIVEDTTFYPKFEEFCKPHCYVDEHYFPTMLTIQAAHLLANRSI  302

Query  423   TWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLL  244
             TWVDW++GG HP  F R D+T DF  ++  G  C YN + ++ C LFARKF   AL  LL
Sbjct  303   TWVDWSRGGAHPATFGRGDITEDFFRRIHAGQNCTYNNQPSSTCFLFARKFAPSALEPLL  362

Query  243   ILAPKLMQF  217
             +++ K + F
Sbjct  363   LVSSKFLGF  371



>ref|XP_010553652.1| PREDICTED: uncharacterized protein LOC104823674 [Tarenaya hassleriana]
Length=402

 Score =   347 bits (891),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 226/307 (74%), Gaps = 1/307 (0%)
 Frame = -3

Query  1137  ELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFR  958
             E  + P   +H ++DEELLWRASM P   E P+ RVPKVAFMFLTRG LP+ PLWE FF+
Sbjct  97    EGFLRPENLSHRMTDEELLWRASMVPVKEEYPYERVPKVAFMFLTRGPLPMLPLWEKFFK  156

Query  957   GNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFS  778
             G+   FS+YVH+  P Y+     +S FHGR IPS+ VEWG A + +AE+RLLANALLDFS
Sbjct  157   GHEKFFSVYVHAP-PGYDMNVSIDSPFHGRLIPSQRVEWGTALLTDAEKRLLANALLDFS  215

Query  777   NERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWR  598
             NERF+LLSE+CIP+ NF T+Y Y++ SN +F+E YD P   GRGRYS +M P IKL+ WR
Sbjct  216   NERFLLLSESCIPIHNFPTVYRYLIGSNYSFVESYDEPTRYGRGRYSRKMLPHIKLHQWR  275

Query  597   KGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTW  418
             KGSQWFE +R++A  +ISD  Y+ LF+ YC   CY DEHY+PT +N+  G  N+NRT+TW
Sbjct  276   KGSQWFEANRKIATYIISDTKYYSLFKKYCRPACYPDEHYIPTFLNMFHGSDNANRTVTW  335

Query  417   VDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLIL  238
             VDW+ GGPHP ++   ++T  F+ ++R+  +C YNGE T++C+LFARKF  +AL+ L+ L
Sbjct  336   VDWSFGGPHPARYNAENITESFIQQIRSNGSCLYNGEVTSLCYLFARKFAPNALAPLMNL  395

Query  237   APKLMQF  217
             +  +M+F
Sbjct  396   SSTVMEF  402



>gb|KEH39949.1| core-2/I-branching enzyme [Medicago truncatula]
Length=376

 Score =   346 bits (888),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/312 (53%), Positives = 224/312 (72%), Gaps = 2/312 (1%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
              GL++ +  P    HN+SD+ELLWRAS+ PKI   PF RVPK+AFMFLT+G LPLAP+WE
Sbjct  66    AGLEQWIKPPSNLIHNMSDKELLWRASLVPKIKNYPFERVPKIAFMFLTKGPLPLAPVWE  125

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              F +G+   +S+YVH + PSY    PP SVF+ R+IPS+  EWG+ +M +AERRLLANAL
Sbjct  126   RFLKGHESRYSVYVHPT-PSYQAHFPPSSVFYKRQIPSQIAEWGRMSMCDAERRLLANAL  184

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SNERFILLSE+CIPL+ FS +Y+Y+M S  +F+  +D PGP GRGRY+  M P++ +
Sbjct  185   LDISNERFILLSESCIPLYKFSLVYNYLMKSKFSFVGAFDDPGPYGRGRYNPNMAPLVDV  244

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
               WRKGSQWFE+ R+LA+ ++ D  ++P F+ YC   CY DEHY PT++ I+ G   +NR
Sbjct  245   AKWRKGSQWFEVSRKLAINIVEDTAFYPKFEQYCRPACYVDEHYFPTMLTIQAGSALANR  304

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             ++TWVDW++GG HP  F R D+T +F +++R G  C YN   +T+C LFARKF   AL  
Sbjct  305   SVTWVDWSRGGAHPATFGRTDITNEFFDRVRGGQKCLYNNRNSTLCSLFARKFAPSALEP  364

Query  249   LL-ILAPKLMQF  217
             LL ++  K++ F
Sbjct  365   LLDMVNSKVLDF  376



>ref|XP_006853920.1| hypothetical protein AMTR_s00036p00191120 [Amborella trichopoda]
 gb|ERN15387.1| hypothetical protein AMTR_s00036p00191120 [Amborella trichopoda]
Length=327

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/295 (57%), Positives = 219/295 (74%), Gaps = 1/295 (0%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYV  928
             H +SDEEL WRASM  +I + PF RVPKVAFMFLTRG LPL+PLWE F  G+  LFSIY+
Sbjct  32    HKMSDEELFWRASMVSRIKKYPFERVPKVAFMFLTRGPLPLSPLWEKFLSGHQKLFSIYI  91

Query  927   HSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEA  748
             H+  PSY    PP SVF+ R+IPSK  EWG+ +M +AERRLLANALLDFSNERF+LLSE+
Sbjct  92    HAL-PSYKAEFPPTSVFYRRQIPSKVAEWGEMSMCDAERRLLANALLDFSNERFVLLSES  150

Query  747   CIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDR  568
             CIP+ NF+T+Y Y+M S  +F+  +D P   GRGRY+  M P + + +WRKGSQWFE++R
Sbjct  151   CIPIMNFTTVYHYLMRSRHSFVGSFDDPSVYGRGRYNENMAPEVNITEWRKGSQWFEVNR  210

Query  567   RLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHP  388
             +LAL +I D TY+P F+++C   CY DEHY PT+  IK     +NR++TWVDW++GG HP
Sbjct  211   KLALTLIEDTTYYPKFKNFCRPACYVDEHYFPTMFTIKAPYHIANRSITWVDWSRGGAHP  270

Query  387   TKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLM  223
               F + D+TV+F+ ++ NGN C+YN + +++C LFARKF   AL  LL LAPK +
Sbjct  271   ATFGKVDITVEFIARIVNGNECKYNNQSSSVCFLFARKFAPSALVPLLDLAPKFI  325



>emb|CDX69735.1| BnaA10g20840D [Brassica napus]
Length=386

 Score =   346 bits (888),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/310 (54%), Positives = 220/310 (71%), Gaps = 1/310 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
              L + +  P    HN++DEELLWRAS  P+  E PF+RVPK+AFMFLT+G LPLA LWE 
Sbjct  78    SLSKWIQPPAVLMHNMTDEELLWRASFWPRRKEYPFQRVPKIAFMFLTKGPLPLALLWER  137

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             F +G+ GL+S+YVH   PS+    P  SVFH R+IPS+  EWG+  M +AE+RLLANALL
Sbjct  138   FLKGHKGLYSVYVHP-HPSFTAKFPAGSVFHQRQIPSQVAEWGRMTMCDAEKRLLANALL  196

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE F+L+SE+CIPLFNF+TIYSY+  S  +F+  +D PGP GRGRY+  M P + + 
Sbjct  197   DISNEWFVLVSESCIPLFNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNDNMEPEVPIT  256

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++R LA  ++ D  Y+P F+ +C   CY DEHY PT++ I+     +NR+
Sbjct  257   KWRKGSQWFEINRELAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPMALANRS  316

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             LTWVDW++GGPHP  F R+D+T  F  K+ +G  C YNG  T+MC+LFARKF   AL  L
Sbjct  317   LTWVDWSRGGPHPATFGRSDITEKFFEKILDGKNCVYNGRNTSMCYLFARKFAPSALESL  376

Query  246   LILAPKLMQF  217
             L +APK++ +
Sbjct  377   LHIAPKILGY  386



>emb|CDX97141.1| BnaC09g44840D [Brassica napus]
Length=386

 Score =   346 bits (888),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 220/309 (71%), Gaps = 1/309 (0%)
 Frame = -3

Query  1143  LKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMF  964
             L + +  P    HN+SDEELLWRAS  P+  E PF+RVPKVAFMFLT+G LPLA LWE F
Sbjct  79    LGKWIQPPAVLMHNMSDEELLWRASFWPRRKEYPFQRVPKVAFMFLTKGPLPLALLWERF  138

Query  963   FRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLD  784
              +G+ GL+S+YVH   PS+    P  SVFH R+IPS+  EWG+  M +AE+RLLANALLD
Sbjct  139   LKGHKGLYSVYVHP-HPSFTAKFPATSVFHQRQIPSQVAEWGRMTMCDAEKRLLANALLD  197

Query  783   FSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLND  604
              SNE F+L+SE+CIPLFNF+TIYSY+  S  +F+  +D PGP GRGRY+  M P + +  
Sbjct  198   ISNEWFVLVSESCIPLFNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNHNMEPEVPITK  257

Query  603   WRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTL  424
             WRKGSQWFE++R LA  ++ D  Y+P F+ +C   CY DEHY PT++ I+     +NR+L
Sbjct  258   WRKGSQWFEINRELAATIVKDTLYYPKFKDFCRPACYVDEHYFPTMLTIEKPMALANRSL  317

Query  423   TWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLL  244
             TWVDW++GGPHP  F R+D+T  F  K+ +G  C YNG  T+MC+LFARKF   AL  LL
Sbjct  318   TWVDWSRGGPHPATFGRSDITERFFEKILDGKNCIYNGRNTSMCYLFARKFAPSALESLL  377

Query  243   ILAPKLMQF  217
              +APK++ +
Sbjct  378   HIAPKILGY  386



>ref|XP_006390505.1| hypothetical protein EUTSA_v10018603mg [Eutrema salsugineum]
 gb|ESQ27791.1| hypothetical protein EUTSA_v10018603mg [Eutrema salsugineum]
Length=426

 Score =   347 bits (891),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 177/301 (59%), Positives = 224/301 (74%), Gaps = 6/301 (2%)
 Frame = -3

Query  1131  LMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGN  952
             LM P    HN+++EELL RASM+    E P +   KVAFMFLTRG LPLA LWE FF+G+
Sbjct  128   LMEPQNVMHNMTEEELLSRASMN---QEKPLKTTKKVAFMFLTRGKLPLAKLWERFFQGH  184

Query  951   AGLFSIYVHSSDPSYNETEPPE-SVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSN  775
               LFSIY+H+SDP Y + + P+ S F+ RRIPSKGVEWG  +M+EAERRLLANALL+  N
Sbjct  185   QDLFSIYIHASDPLYVDDDIPQTSPFYRRRIPSKGVEWGMVSMVEAERRLLANALLNAEN  244

Query  774   ERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRK  595
              RF+LLSE+ IPLFNFSTIYSY++NS  + +++YD+PGP GRGRY+ +M+P+I   +WRK
Sbjct  245   HRFVLLSESDIPLFNFSTIYSYLINSQHSHVDIYDIPGPAGRGRYNRRMSPVISRRNWRK  304

Query  594   GSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWV  415
             GSQWFE+DR +AL V+SD TYFPLFQ +C   CY+DEHYLPT +++   + N+NR+LTW 
Sbjct  305   GSQWFEIDREVALAVVSDTTYFPLFQKHCRF-CYADEHYLPTFVHVMFPEKNANRSLTWT  363

Query  414   DWAKGGPHPTKFTRNDVTVDFLNKLRNGNT-CEYNGEKTTMCHLFARKFTLHALSRLLIL  238
             DW++ GPHP K+TR  VT  F   LRN    C YNGEK   C+LFARKF   +L RL+  
Sbjct  364   DWSRRGPHPKKYTRRLVTAQFFRNLRNRKEGCVYNGEKINKCYLFARKFDDSSLDRLIHF  423

Query  237   A  235
             A
Sbjct  424   A  424



>ref|NP_001130080.1| uncharacterized protein LOC100191173 [Zea mays]
 gb|ACF78203.1| unknown [Zea mays]
Length=365

 Score =   345 bits (885),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/312 (54%), Positives = 224/312 (72%), Gaps = 1/312 (0%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +G+     A  G  H+++DEELLWRAS +P +   PFRRVPKVAFMFLTRG LPLAPLWE
Sbjct  55    LGVSPTAAAAEGLEHSMTDEELLWRASFAPGVRRYPFRRVPKVAFMFLTRGPLPLAPLWE  114

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FFRGN G +SIYVH+  PSY      ESVF+ R+IPSK  EWG+  M +AERRLLANAL
Sbjct  115   RFFRGNKGRYSIYVHAL-PSYRANFTSESVFYRRQIPSKVAEWGQMTMCDAERRLLANAL  173

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SNE F+L+SE+CIP+F+F+T Y Y +NS+++F+   D PGP GRGRY   M P + +
Sbjct  174   LDISNEWFVLVSESCIPIFDFNTTYQYFLNSSQSFVMAIDDPGPYGRGRYDWNMTPEVDV  233

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
               WRKGSQWFE++R + +E++ D  Y+P F+ +C   CYSDEHY+ T+++I+  Q  +NR
Sbjct  234   TQWRKGSQWFEVNREVGIEIVKDTVYYPKFKEFCRPSCYSDEHYIQTMLSIETPQSLANR  293

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             ++TWVDW++   HP +F R D+T +FL ++R G TC YN + +T+C LFARKF   AL  
Sbjct  294   SVTWVDWSRIAAHPARFGRVDITEEFLREVREGQTCLYNEKNSTLCFLFARKFAPSALEP  353

Query  249   LLILAPKLMQFN  214
             LL LAP ++ F 
Sbjct  354   LLELAPTVLGFG  365



>ref|NP_196734.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 emb|CAB87691.1| putative protein [Arabidopsis thaliana]
 gb|AAM13183.1| putative protein [Arabidopsis thaliana]
 gb|AAP68292.1| At5g11730 [Arabidopsis thaliana]
 dbj|BAE99143.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91715.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AHL38636.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=386

 Score =   346 bits (887),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 222/309 (72%), Gaps = 1/309 (0%)
 Frame = -3

Query  1143  LKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMF  964
             L + +  P    HN+SDEELLWRAS  P+  E PF+RVPKVAFMFLT+G LPLA LWE F
Sbjct  79    LSKWIQPPAVLMHNMSDEELLWRASFWPRRKEYPFKRVPKVAFMFLTKGPLPLASLWERF  138

Query  963   FRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLD  784
              +G+ GL+S+Y+H   PS+    P  SVFH R+IPS+  EWG+ +M +AE+RLLANALLD
Sbjct  139   LKGHKGLYSVYLHP-HPSFTAKFPASSVFHRRQIPSQVAEWGRMSMCDAEKRLLANALLD  197

Query  783   FSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLND  604
              SNE F+L+SE+CIPL+NF+TIYSY+  S  +F+  +D PGP GRGRY+  M P + L  
Sbjct  198   VSNEWFVLVSESCIPLYNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNGNMEPEVPLTK  257

Query  603   WRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTL  424
             WRKGSQWFE++R LA  ++ D  Y+P F+ +C   CY DEHY PT++ I+     +NR+L
Sbjct  258   WRKGSQWFEVNRDLAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPTVLANRSL  317

Query  423   TWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLL  244
             TWVDW++GGPHP  F R+D+T +F  K+ +G  C YNG  T+MC+LFARKF   AL  LL
Sbjct  318   TWVDWSRGGPHPATFGRSDITENFFGKIFDGRNCSYNGRNTSMCYLFARKFAPSALEPLL  377

Query  243   ILAPKLMQF  217
              +APK++ F
Sbjct  378   HIAPKILGF  386



>gb|ACF85887.1| unknown [Zea mays]
 tpg|DAA51168.1| TPA: hypothetical protein ZEAMMB73_675219 [Zea mays]
Length=365

 Score =   345 bits (885),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 169/312 (54%), Positives = 224/312 (72%), Gaps = 1/312 (0%)
 Frame = -3

Query  1149  VGLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWE  970
             +G+     A  G  H+++DEELLWRAS +P +   PFRRVPKVAFMFLTRG LPLAPLWE
Sbjct  55    LGVSPTAAAAEGLEHSMTDEELLWRASFAPGVRRYPFRRVPKVAFMFLTRGPLPLAPLWE  114

Query  969   MFFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanal  790
              FFRGN G +SIYVH+  PSY      ESVF+ R+IPSK  EWG+  M +AERRLLANAL
Sbjct  115   RFFRGNEGRYSIYVHAL-PSYRANFTSESVFYRRQIPSKVAEWGQMTMCDAERRLLANAL  173

Query  789   LDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKL  610
             LD SNE F+L+SE+CIP+F+F+T Y Y +NS+++F+   D PGP GRGRY   M P + +
Sbjct  174   LDISNEWFVLVSESCIPIFDFNTTYQYFLNSSQSFVMAIDDPGPYGRGRYDWNMTPEVDV  233

Query  609   NDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNR  430
               WRKGSQWFE++R + +E++ D  Y+P F+ +C   CYSDEHY+ T+++I+  Q  +NR
Sbjct  234   TQWRKGSQWFEVNREVGIEIVKDTVYYPKFKEFCRPSCYSDEHYIQTMLSIETPQSLANR  293

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSR  250
             ++TWVDW++   HP +F R D+T +FL ++R G TC YN + +T+C LFARKF   AL  
Sbjct  294   SVTWVDWSRIAAHPARFGRVDITEEFLREVREGQTCLYNEKNSTLCFLFARKFAPSALEP  353

Query  249   LLILAPKLMQFN  214
             LL LAP ++ F 
Sbjct  354   LLELAPTVLGFG  365



>emb|CDX97139.1| BnaC09g44860D [Brassica napus]
Length=386

 Score =   346 bits (887),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 220/309 (71%), Gaps = 1/309 (0%)
 Frame = -3

Query  1143  LKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMF  964
             L + +  P    HN+SDEELLWRAS  P+  E PF+RVPKVAFMFLT+G LPLA LWE F
Sbjct  79    LGKWIQPPAVLMHNMSDEELLWRASFWPRRKEYPFQRVPKVAFMFLTKGPLPLALLWERF  138

Query  963   FRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLD  784
              +G+ GL+S+YVH   PS+    P  SVFH R+IPS+  EWG+  M +AE+RLLANALLD
Sbjct  139   LKGHKGLYSVYVHP-HPSFTAKFPAGSVFHQRQIPSQVAEWGRMTMCDAEKRLLANALLD  197

Query  783   FSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLND  604
              SNE F+L+SE+CIPLFNF+TIYSY+  S  +F+  +D PGP GRGRY+  M P + +  
Sbjct  198   ISNEWFVLVSESCIPLFNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNHNMEPEVPITK  257

Query  603   WRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTL  424
             WRKGSQWFE++R LA  ++ D  Y+P F+ +C   CY DEHY PT++ I+     +NR+L
Sbjct  258   WRKGSQWFEINRELAATIVKDTLYYPKFKDFCRPACYVDEHYFPTMLTIEKPMALANRSL  317

Query  423   TWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLL  244
             TWVDW++GGPHP  F R+D+T  F  K+ +G  C YNG  T+MC+LFARKF   AL  LL
Sbjct  318   TWVDWSRGGPHPATFGRSDITERFFEKILDGKNCIYNGRNTSMCYLFARKFAPSALESLL  377

Query  243   ILAPKLMQF  217
              +APK++ +
Sbjct  378   HIAPKILGY  386



>ref|XP_006836850.1| hypothetical protein AMTR_s00099p00078200 [Amborella trichopoda]
 gb|ERM99703.1| hypothetical protein AMTR_s00099p00078200 [Amborella trichopoda]
Length=401

 Score =   346 bits (888),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 224/306 (73%), Gaps = 2/306 (1%)
 Frame = -3

Query  1131  LMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGN  952
              + P    H+++DEEL WRASM PK  E P++RVPKVAFMFLTRG LPLAP W+ FF+G+
Sbjct  97    FIKPEKLLHSMTDEELFWRASMVPKKREYPYKRVPKVAFMFLTRGPLPLAPFWDKFFQGH  156

Query  951   AGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNE  772
              G +S+YVH+  P Y  +    S F+GR+IPS+ V+WG  NM + ERRLLANALLDFSNE
Sbjct  157   EGHYSVYVHTL-PDYRLSVSTTSAFYGRQIPSQEVKWGTINMADGERRLLANALLDFSNE  215

Query  771   RFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKG  592
             RF+LLSE+CIP++NF T+Y+Y++ S E+F++ YD P   GRGRYS  M P IKL+ WRKG
Sbjct  216   RFVLLSESCIPMYNFPTVYNYLITSKESFVDSYDDPSRYGRGRYSRNMAPDIKLHQWRKG  275

Query  591   SQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVD  412
             SQWFE  R +A+ ++SD  Y+ +F+ YC   CY DEHY+PT +N+  G  NSNR++TWVD
Sbjct  276   SQWFEAHRDVAVNIVSDSKYYTIFKKYCKPSCYPDEHYIPTYLNMFYGSLNSNRSVTWVD  335

Query  411   WAKGGPHPTKFTRNDVTVDFLNKLR-NGNTCEYNGEKTTMCHLFARKFTLHALSRLLILA  235
             W++GGPHP  F   D+T DF+  +R NG TC +N E T++C+LFARKF   AL  LL L+
Sbjct  336   WSRGGPHPATFGGPDITEDFIFAIRNNGTTCFHNSEPTSLCYLFARKFAPSALGPLLNLS  395

Query  234   PKLMQF  217
               +M+F
Sbjct  396   STVMEF  401



>ref|XP_011100115.1| PREDICTED: uncharacterized protein LOC105178347 [Sesamum indicum]
Length=403

 Score =   346 bits (888),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 227/301 (75%), Gaps = 1/301 (0%)
 Frame = -3

Query  1116  GAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFS  937
             G  HN+SD+ELL RAS  P I +    +  KVAFMFLT G LPL+P W+ FF+G+ G++S
Sbjct  103   GLMHNMSDDELLMRASKVPGIDQDVPGKQQKVAFMFLTPGPLPLSPFWDRFFKGHEGMYS  162

Query  936   IYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILL  757
             +YVH   PSYN++ PP+S F+GRRIPS+ V WG  +MI+AERRLL NALLD SN+RF+LL
Sbjct  163   VYVHPH-PSYNDSVPPDSAFYGRRIPSQPVYWGTMSMIDAERRLLGNALLDPSNQRFVLL  221

Query  756   SEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFE  577
             S++CIPLFNF+T+Y Y+M +N +F+  +D P   GRGRY+ QM P I +  WRKGSQWFE
Sbjct  222   SDSCIPLFNFTTVYDYLMRTNHSFLGSFDDPRKPGRGRYNRQMWPTITIEQWRKGSQWFE  281

Query  576   MDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGG  397
             + R LAL+V+SDQ Y+P+F+ +C  PCY+DEHYLPTL NI   + NSNRT+TWVDW++GG
Sbjct  282   LHRDLALKVVSDQKYYPVFREFCHPPCYNDEHYLPTLANILYPEMNSNRTVTWVDWSRGG  341

Query  396   PHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQF  217
             PHP KF   DV V+ LN++R G+ C YNG KT MC+LFARKF  + +  LL + P+L+ F
Sbjct  342   PHPRKFGWIDVRVELLNQIRFGSECMYNGNKTNMCNLFARKFLPNTIGPLLRVGPQLLGF  401

Query  216   N  214
             +
Sbjct  402   D  402



>ref|XP_010318628.1| PREDICTED: uncharacterized protein LOC101267221 isoform X2 [Solanum 
lycopersicum]
Length=282

 Score =   341 bits (875),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 170/268 (63%), Positives = 207/268 (77%), Gaps = 2/268 (1%)
 Frame = -3

Query  1017  FMFLTRGALPLAPLWEMFFRGNAGLFSIYVHSSDPSYNETEPPES-VFHGRRIPSKGVEW  841
             F    RG+LPLAPLWE FF+G+ GL+SIY+HS  PS+N + P E  +FH RR+ SK VEW
Sbjct  15    FTISQRGSLPLAPLWERFFQGHEGLYSIYIHSQ-PSFNGSAPQEGPIFHDRRVASKKVEW  73

Query  840   GKANMIeaerrllanalLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPG  661
             GK NM+EAERRLLANALLD SNERF+LLSE+CIPL++F+TIY Y++NS  TF+E YDL  
Sbjct  74    GKFNMVEAERRLLANALLDISNERFVLLSESCIPLYDFTTIYDYIINSANTFMESYDLIS  133

Query  660   PVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEH  481
             PVGRGRY+ +M P++ L  WRKGSQWFE+DR +A+++ISDQ Y  LF+ +C   CYSDEH
Sbjct  134   PVGRGRYNKKMKPLVTLAQWRKGSQWFEVDREIAIDIISDQKYSNLFKRFCRPACYSDEH  193

Query  480   YLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKT  301
             YLPT + +K    N NRTLTWVDWAKGGPHPTKF R DVT D L  +RNG  CEYNG+ +
Sbjct  194   YLPTFVTMKYWWKNENRTLTWVDWAKGGPHPTKFIRPDVTEDLLYGMRNGTKCEYNGQPS  253

Query  300   TMCHLFARKFTLHALSRLLILAPKLMQF  217
              MC+LFARKF    L RLL  APK+M+F
Sbjct  254   NMCYLFARKFLPSTLDRLLRFAPKIMKF  281



>ref|XP_010669159.1| PREDICTED: uncharacterized protein LOC104886401 [Beta vulgaris 
subsp. vulgaris]
Length=382

 Score =   345 bits (884),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 168/310 (54%), Positives = 221/310 (71%), Gaps = 1/310 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL   +  P    H +SDEEL WRA++ P+I + PF R PK+AFMFLT+G LPLAPLWE 
Sbjct  74    GLDRWIRPPSNLMHTMSDEELFWRATLVPRIRKYPFNRTPKIAFMFLTKGPLPLAPLWER  133

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FF+G+ G +SIY+HS  PSY+E  PP SVF+ R IPS+  +WG  ++ +AERRLLANALL
Sbjct  134   FFKGHEGRYSIYIHSL-PSYDEEFPPTSVFYRRNIPSQLTQWGTMSLCDAERRLLANALL  192

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNERFILLSE+CIPL+ F+ I +Y+ NS  +FI  +D  GP GRGRY   M P + + 
Sbjct  193   DISNERFILLSESCIPLYKFNFIQNYITNSKYSFIGAFDDVGPFGRGRYDENMAPEVNIT  252

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
             +WRKGSQWFE++RRLA+ ++ D  ++P F+++C   CY DEHY PT++ I+     +NR+
Sbjct  253   EWRKGSQWFEINRRLAINIVEDTIFYPKFEAFCKPNCYVDEHYFPTMLTIRAANLLANRS  312

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +T VDW++GG HP  F + DVTVDFL K+R   TC YNG  TT+C+LFARKF    L  L
Sbjct  313   ITLVDWSRGGSHPATFGKGDVTVDFLKKIREKTTCTYNGRNTTVCYLFARKFAPSTLEPL  372

Query  246   LILAPKLMQF  217
             L +APK+  F
Sbjct  373   LEVAPKVFDF  382



>ref|XP_010693288.1| PREDICTED: uncharacterized protein LOC104906249 [Beta vulgaris 
subsp. vulgaris]
Length=391

 Score =   345 bits (884),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 178/300 (59%), Positives = 225/300 (75%), Gaps = 3/300 (1%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYV  928
             HN+SD+ELL RASM P+I   P   +PKVAFMFLT+G LPLAPLWE+FF+G+ G +SIYV
Sbjct  92    HNMSDKELLRRASMVPQIEGYPLDILPKVAFMFLTKGPLPLAPLWELFFKGHQGFYSIYV  151

Query  927   HSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEA  748
             H+  PSYN++ P  SVF+GRRIPS+ V WG  +MI+AE+RLLANA LD SN+RFILLSE+
Sbjct  152   HT-HPSYNDSWPQSSVFYGRRIPSQEVIWGTMSMIDAEKRLLANAFLDQSNQRFILLSES  210

Query  747   CIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDR  568
             CIPLFNF+TIY+Y+MNS  +F+  +D P   GRGRY+ +M P I + DWRKGSQWFE+ R
Sbjct  211   CIPLFNFTTIYNYLMNSKVSFLASFDDPRKQGRGRYNPKMLPNITIQDWRKGSQWFELHR  270

Query  567   RLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKL-GQGNSNRTLTWVDWAKGGPH  391
              LA+ VISDQ Y+ +F+ YC  PCY+DEHYLPTL  I    Q + NR +TWVDW+    H
Sbjct  271   ELAILVISDQKYYSIFEQYCHPPCYNDEHYLPTLAKILFPDQISKNRGITWVDWSHVASH  330

Query  390   PTKFTRNDVTVDFLNKLRNGNT-CEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
             P +F ++D+T +FLN +R G T C YNG  T+MC LFARKF    L  LL +APKL+ F+
Sbjct  331   PGRFIKSDITQEFLNLIRFGLTNCTYNGNVTSMCFLFARKFVGDTLKPLLQIAPKLLGFD  390



>emb|CDX70416.1| BnaC03g05000D [Brassica napus]
Length=437

 Score =   346 bits (888),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 183/351 (52%), Positives = 236/351 (67%), Gaps = 18/351 (5%)
 Frame = -3

Query  1131  LMAPPGA-AHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRG  955
             L+ PPG   HN+SDEELLWRAS   +    PF+RVPK+AFMFLT+G LPLA LWE F +G
Sbjct  79    LIQPPGVLMHNMSDEELLWRASFWARRKGYPFKRVPKIAFMFLTKGPLPLASLWERFLKG  138

Query  954   NAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGV-EWGKANMIeaerrllanalLDFS  778
             + GL+S+YVH  DPS+N   P +SVFH R+IPS+ V EWG+  M +AE+RLLANALLD S
Sbjct  139   HKGLYSVYVHP-DPSFNAKFPADSVFHKRQIPSQQVAEWGRMTMCDAEKRLLANALLDIS  197

Query  777   NERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWR  598
             NE F+L+SE+CIPL+NF+TIY+Y+  S  +FI   D PGP GRGRY+ +M P + +  WR
Sbjct  198   NEWFVLVSESCIPLYNFTTIYTYLSQSKHSFIGAVDDPGPFGRGRYNEKMEPEVPITKWR  257

Query  597   KGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTW  418
             KG QWFE+DR LA  ++ D  Y   F+ +C   CYSDEHY PT++ I+     +NR++TW
Sbjct  258   KGPQWFEVDRDLAATIVKDTLYHHKFREFCRPACYSDEHYFPTMLTIEKPTALANRSVTW  317

Query  417   VDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLIL  238
              DW++GGPHP  F R+D+T +F  K+ +G  C YNG  T+MC+LFARKF   AL  LL +
Sbjct  318   TDWSRGGPHPATFGRSDITEEFFGKIFDGENCSYNGRNTSMCYLFARKFAPSALEPLLHI  377

Query  237   APKLMQFNGY*TLKQC----------LNCVHSL*HEIGTRLLRECIHFSSI  115
             APK+M  NG  T  Q           LNC       I  R+   CIH+S I
Sbjct  378   APKIMGGNGNITRTQVSYPLFSSLFDLNCFCI---NISPRVF--CIHYSII  423



>ref|XP_010942037.1| PREDICTED: uncharacterized protein LOC105060116 isoform X1 [Elaeis 
guineensis]
Length=384

 Score =   344 bits (883),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 168/310 (54%), Positives = 224/310 (72%), Gaps = 1/310 (0%)
 Frame = -3

Query  1143  LKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMF  964
             L+  +  P    HN+SDE+L WRAS +P++ + PF+RVPKVAF+FLTRG LPL+PLWE F
Sbjct  76    LRRWIKPPRTLMHNMSDEQLFWRASFAPQVKKYPFQRVPKVAFLFLTRGPLPLSPLWERF  135

Query  963   FRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLD  784
             F G+  L+SIY+HS  P Y    PP SVF+ R+IPSK  EWGK +M +AERRLLANALLD
Sbjct  136   FEGHEELYSIYIHSL-PGYQPDFPPSSVFYKRQIPSKVTEWGKMSMCDAERRLLANALLD  194

Query  783   FSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLND  604
              SNERF+LLSE+CIPL+NFS  Y Y+M S  +F+  +D PGP GRGRY+ +M P + +  
Sbjct  195   LSNERFVLLSESCIPLYNFSITYRYLMRSRYSFVGSFDDPGPHGRGRYNLRMKPEVNIAQ  254

Query  603   WRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTL  424
             WRKG+QWFE++R+LA+ +ISD  Y+P F+ +C   CY DEHY PT++ I+     +NR++
Sbjct  255   WRKGAQWFEVNRKLAINIISDAKYYPKFRDFCKPGCYVDEHYFPTMLAIESPHLMANRSV  314

Query  423   TWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLL  244
             TWVDW++GG HP  F + D+T  FL K+  G +C YN + +++C LFARKF  +AL  LL
Sbjct  315   TWVDWSRGGAHPATFGKRDITEAFLKKILEGKSCFYNAQPSSVCFLFARKFAPNALEPLL  374

Query  243   ILAPKLMQFN  214
              LAP L+ F 
Sbjct  375   QLAPSLLGFK  384



>ref|XP_008796992.1| PREDICTED: uncharacterized protein LOC103712290 [Phoenix dactylifera]
 ref|XP_008796993.1| PREDICTED: uncharacterized protein LOC103712290 [Phoenix dactylifera]
 ref|XP_008796994.1| PREDICTED: uncharacterized protein LOC103712290 [Phoenix dactylifera]
Length=384

 Score =   344 bits (883),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 167/310 (54%), Positives = 223/310 (72%), Gaps = 1/310 (0%)
 Frame = -3

Query  1143  LKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMF  964
             L+ L+  P    H +S+EEL WRAS +P++ + PF+RVPKVAFMFLT+G LPL+PLWE F
Sbjct  76    LRRLIEPPTNLMHKMSEEELFWRASFAPQVKKYPFKRVPKVAFMFLTKGPLPLSPLWENF  135

Query  963   FRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLD  784
             F+G+ GL+SIY+HS  P Y    PP SVF+ R+IPSK  EWG+ +M +AERRLLANALLD
Sbjct  136   FKGHEGLYSIYIHSL-PDYQPNFPPTSVFYNRQIPSKVAEWGRMSMCDAERRLLANALLD  194

Query  783   FSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLND  604
              SNERF+LLSE+CIPL+NFS IY Y+M S  +F+  +D PGP GRGRY+ +M P + +  
Sbjct  195   LSNERFVLLSESCIPLYNFSIIYHYLMRSRYSFVGSFDDPGPYGRGRYNLRMAPEVNIMQ  254

Query  603   WRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTL  424
             WRKG+QWFE++R+LA++++ D  Y+P F  +C   CY DEHY PT++ I+     +NRT+
Sbjct  255   WRKGAQWFEVNRKLAIDIVRDTKYYPKFNEFCRPSCYVDEHYFPTMLTIESPHLIANRTI  314

Query  423   TWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLL  244
             TWVDW++GG HP  F + D+T  FL K+  G TC YN + +++C LFARKF   AL  LL
Sbjct  315   TWVDWSRGGAHPATFGKGDITEAFLKKILEGKTCLYNDQPSSVCFLFARKFAPSALEPLL  374

Query  243   ILAPKLMQFN  214
               A  L+ F 
Sbjct  375   QFATSLLGFE  384



>ref|XP_006391144.1| hypothetical protein EUTSA_v10018660mg [Eutrema salsugineum]
 gb|ESQ28430.1| hypothetical protein EUTSA_v10018660mg [Eutrema salsugineum]
Length=400

 Score =   345 bits (884),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 187/313 (60%), Positives = 228/313 (73%), Gaps = 13/313 (4%)
 Frame = -3

Query  1134  LLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRG  955
              L  P    HN+ D+EL WRASM PKI   PF R PKVAFMFLTRG LPLAPLWE FFRG
Sbjct  94    FLRPPKSIMHNMEDKELFWRASMVPKIRNYPFPRTPKVAFMFLTRGPLPLAPLWERFFRG  153

Query  954   NAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSN  775
             + GLF+IYVH+ +P YNE+ P  SVFHGRRIPSK V WG ANM++AERRLLANALLD +N
Sbjct  154   HEGLFTIYVHT-NPFYNESVPQGSVFHGRRIPSKRVNWGNANMVDAERRLLANALLDINN  212

Query  774   ERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRK  595
             ERF+LLSE+CIPLFNF+T+YS ++NS +T +E YDL  P+GR RY+ +M P I ++ WRK
Sbjct  213   ERFLLLSESCIPLFNFTTLYSDLINSTQTHVESYDL--PIGRVRYNHRMYPHIHMHHWRK  270

Query  594   GSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNI---KLGQGNSNRTL  424
             GSQWFE+DR +ALE +SD  Y+P+F++Y   P   DEHY PTL+N+   +LG  NSNRTL
Sbjct  271   GSQWFELDRAMALEAVSDTFYWPIFKAYSRCP---DEHYFPTLLNLMPSQLGSRNSNRTL  327

Query  423   TWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNT--CEYNGE--KTTMCHLFARKFTLHAL  256
             TW DW K   HP  F   +V V FL  LR  +   CE+NGE  KT +C LFARKF+ +AL
Sbjct  328   TWTDWGKRRAHPRTFGALEVNVGFLEWLRRSDKEYCEHNGEVNKTRLCFLFARKFSPNAL  387

Query  255   SRLLILAPKLMQF  217
              +LL  A  +M F
Sbjct  388   DKLLQFASTVMHF  400



>gb|AAL38356.1| unknown protein [Arabidopsis thaliana]
 gb|AAO29975.1| unknown protein [Arabidopsis thaliana]
Length=418

 Score =   345 bits (886),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 179/314 (57%), Positives = 225/314 (72%), Gaps = 6/314 (2%)
 Frame = -3

Query  1149  VGLK-ELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLW  973
             VG K   LM P    HN+++EELL RAS   KI E   +   K AFMFLTRG LPLA LW
Sbjct  108   VGQKGHYLMMPENVVHNMTEEELLLRAS---KIQEKTLKMTKKAAFMFLTRGKLPLAKLW  164

Query  972   EMFFRGNAGLFSIYVHSSDPSYNETEPPE-SVFHGRRIPSKGVEWGKANMIeaerrllan  796
             E FF+G+ GLFSIY+H+SDP Y +   PE S F+ RRIPSK V WG  +M+ AERRLLAN
Sbjct  165   ERFFKGHEGLFSIYIHTSDPFYFDDHTPETSPFYRRRIPSKEVGWGMVSMVAAERRLLAN  224

Query  795   alLDFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPII  616
             ALLD  N RF+LLSE+ IPLFNFSTIYSY++NS  ++++VYDLP P GRGRY+ +M+P+I
Sbjct  225   ALLDAGNHRFVLLSESDIPLFNFSTIYSYLINSQHSYVDVYDLPRPAGRGRYNRRMSPVI  284

Query  615   KLNDWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNS  436
                +WRKGSQWFE+DR +AL V+SD TYFP+F+ YC   CY+DEHYL T ++      N+
Sbjct  285   SRTNWRKGSQWFEIDREVALAVVSDTTYFPVFEKYCLWNCYADEHYLSTFVHAMFPGKNA  344

Query  435   NRTLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNT-CEYNGEKTTMCHLFARKFTLHA  259
             NR+LTW DW++ GPHP K+TR  VT +FL ++RN    C YNG+K+  C+LFARKF    
Sbjct  345   NRSLTWTDWSRRGPHPRKYTRRSVTGEFLRRVRNREQGCVYNGKKSEKCYLFARKFDGST  404

Query  258   LSRLLILAPKLMQF  217
             L +LL  A  +M F
Sbjct  405   LDKLLYFAHSVMGF  418



>ref|XP_010942042.1| PREDICTED: uncharacterized protein LOC105060116 isoform X2 [Elaeis 
guineensis]
Length=298

 Score =   341 bits (874),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/298 (56%), Positives = 220/298 (74%), Gaps = 1/298 (0%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYV  928
             HN+SDE+L WRAS +P++ + PF+RVPKVAF+FLTRG LPL+PLWE FF G+  L+SIY+
Sbjct  2     HNMSDEQLFWRASFAPQVKKYPFQRVPKVAFLFLTRGPLPLSPLWERFFEGHEELYSIYI  61

Query  927   HSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEA  748
             HS  P Y    PP SVF+ R+IPSK  EWGK +M +AERRLLANALLD SNERF+LLSE+
Sbjct  62    HSL-PGYQPDFPPSSVFYKRQIPSKVTEWGKMSMCDAERRLLANALLDLSNERFVLLSES  120

Query  747   CIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDR  568
             CIPL+NFS  Y Y+M S  +F+  +D PGP GRGRY+ +M P + +  WRKG+QWFE++R
Sbjct  121   CIPLYNFSITYRYLMRSRYSFVGSFDDPGPHGRGRYNLRMKPEVNIAQWRKGAQWFEVNR  180

Query  567   RLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHP  388
             +LA+ +ISD  Y+P F+ +C   CY DEHY PT++ I+     +NR++TWVDW++GG HP
Sbjct  181   KLAINIISDAKYYPKFRDFCKPGCYVDEHYFPTMLAIESPHLMANRSVTWVDWSRGGAHP  240

Query  387   TKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQFN  214
               F + D+T  FL K+  G +C YN + +++C LFARKF  +AL  LL LAP L+ F 
Sbjct  241   ATFGKRDITEAFLKKILEGKSCFYNAQPSSVCFLFARKFAPNALEPLLQLAPSLLGFK  298



>ref|XP_002888947.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65206.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score =   345 bits (885),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 226/307 (74%), Gaps = 5/307 (2%)
 Frame = -3

Query  1131  LMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGN  952
             L+ P    HN+++EEL  RAS   KI E   ++  KVAFMFLTRG LPLA LWE FF+G+
Sbjct  115   LVKPENVMHNMTEEELFLRAS---KIQEKTLKKTKKVAFMFLTRGKLPLAKLWERFFKGH  171

Query  951   AGLFSIYVHSSDPSYNETEPPE-SVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSN  775
              GLFSIY+H+SDP Y + + PE S  + RRIPSK V WG  +M+EAERRLLANALLD  N
Sbjct  172   DGLFSIYIHTSDPFYVDDDIPETSPLYRRRIPSKEVGWGMVSMVEAERRLLANALLDAGN  231

Query  774   ERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRK  595
              RF+LLSE+ IPLFNFSTIYSY+ NS  ++++VYDLPGP GRGRY+ +M+P+I   +WRK
Sbjct  232   HRFVLLSESDIPLFNFSTIYSYLTNSQHSYVDVYDLPGPAGRGRYNRRMSPVISRRNWRK  291

Query  594   GSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWV  415
             GSQWFE+DR +AL V+SD  YFP+F+ +C   CYSDEHYL TL+++     N+NR+LTW 
Sbjct  292   GSQWFEIDREVALAVVSDTIYFPVFKKHCLSNCYSDEHYLATLVHVMFPGKNANRSLTWT  351

Query  414   DWAKGGPHPTKFTRNDVTVDFLNKLRNGNT-CEYNGEKTTMCHLFARKFTLHALSRLLIL  238
             DW++ GPHP K+TR  VT +FL ++RN    C YNG+K+  C+LFARKF    L +LL  
Sbjct  352   DWSRRGPHPRKYTRGSVTGEFLRRVRNREQGCVYNGKKSENCYLFARKFDGGCLDKLLYF  411

Query  237   APKLMQF  217
             A +++ F
Sbjct  412   AHRVLGF  418



>ref|XP_006399687.1| hypothetical protein EUTSA_v10013787mg [Eutrema salsugineum]
 gb|ESQ41140.1| hypothetical protein EUTSA_v10013787mg [Eutrema salsugineum]
Length=386

 Score =   344 bits (882),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/310 (54%), Positives = 221/310 (71%), Gaps = 1/310 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL   +  P    HN++DEELLWRAS  P+  E PF+RVPK+AFMFLT+G LPLA LWE 
Sbjct  78    GLSRWIQPPLVLMHNMTDEELLWRASFWPRRKEYPFKRVPKIAFMFLTKGPLPLALLWER  137

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             F +G+ GL+S+Y+H   PS+    P  SVF+ R+IPS+  EWG+  M +AE+RLLANALL
Sbjct  138   FLKGHKGLYSVYIHP-HPSFTSKFPSSSVFYRRQIPSQVAEWGRMTMCDAEKRLLANALL  196

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE F+L+SE+CIPLFNF+TIYSY+  S  +F+  +D PGP GRGRY+  M P + + 
Sbjct  197   DISNEWFVLVSESCIPLFNFTTIYSYLSQSKHSFMGAFDDPGPFGRGRYNPNMEPEVPIT  256

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++R LA  ++ D  Y+P F+ +C   CY DEHY PT++ I+     +NR+
Sbjct  257   KWRKGSQWFEINRELAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPVVLANRS  316

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             LTWVDW++GGPHP  F R+D+T +F  K+ +G  C YNG  T+MC+LFARKF   AL  L
Sbjct  317   LTWVDWSRGGPHPATFGRSDITENFFGKIFDGRNCTYNGRNTSMCYLFARKFAPSALEPL  376

Query  246   LILAPKLMQF  217
             L +APK++ F
Sbjct  377   LHIAPKILGF  386



>gb|KHG10617.1| Putative non-structural 4 [Gossypium arboreum]
Length=388

 Score =   344 bits (882),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 223/302 (74%), Gaps = 1/302 (0%)
 Frame = -3

Query  1122  PPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGL  943
             P    H++SD+ELLWRAS  P+I + PF R+PK+AFMFLT+G LPLAPLWE FF+G+ GL
Sbjct  88    PSSLLHSMSDKELLWRASFVPRIKKYPFNRLPKIAFMFLTKGPLPLAPLWERFFKGHEGL  147

Query  942   FSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFI  763
             +S+Y+HS  PS+    P  SVF+ R+IPS+  EWG+ +M +AERRLLANALLD SNE FI
Sbjct  148   YSVYIHSL-PSFEAEFPSSSVFYRRQIPSQVAEWGRMSMCDAERRLLANALLDISNEWFI  206

Query  762   LLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQW  583
             LLSE+CIPL+NFS IY Y+M S  +F+  +D PGP GRGRY+  M P + ++ WRKGSQW
Sbjct  207   LLSESCIPLYNFSVIYQYIMKSKHSFMGAFDDPGPFGRGRYNYNMVPEVNISKWRKGSQW  266

Query  582   FEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAK  403
             FE++R+LA+ ++ D TY+P F+ +C   CY DEHY PT++ I+     +NR++TWVDW++
Sbjct  267   FEVNRKLAINIVEDVTYYPKFEQFCRPACYVDEHYFPTMLTIQTPNLLANRSITWVDWSR  326

Query  402   GGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLM  223
             GGPHP  F R+D+T DF N++  G  C YN + +++C LFARKF   A+  LL +A K++
Sbjct  327   GGPHPGTFGRSDITEDFFNRILEGRQCRYNDQPSSICFLFARKFAPSAMEPLLQIAQKVL  386

Query  222   QF  217
              F
Sbjct  387   GF  388



>ref|XP_009105383.1| PREDICTED: uncharacterized protein LOC103831251 [Brassica rapa]
Length=396

 Score =   344 bits (882),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 188/314 (60%), Positives = 228/314 (73%), Gaps = 13/314 (4%)
 Frame = -3

Query  1137  ELLMAPP--GAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMF  964
             E+ + PP     HN+ D EL WRASM PKI   PF R PKVAFMFLTRG LPLAPLWE F
Sbjct  89    EMFLRPPKINIMHNMEDNELFWRASMDPKIRSYPFSRTPKVAFMFLTRGPLPLAPLWERF  148

Query  963   FRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLD  784
             FRG  GLF+IY+H+ +PSY E+ P  SVF GRRIPSK V+W  ANM++AERRLLANALLD
Sbjct  149   FRGCEGLFTIYIHT-NPSYKESMPQGSVFLGRRIPSKRVDWANANMVDAERRLLANALLD  207

Query  783   FSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLND  604
              +NERF+LLSE+CIPLFNF+TIYSY++NS +T ++ YDL  P GR RYS +M P I L+ 
Sbjct  208   INNERFLLLSESCIPLFNFTTIYSYLINSTQTHVDSYDL--PFGRVRYSRRMYPHIHLHH  265

Query  603   WRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNI--KLGQGNSNR  430
             WRKGSQWFE+DR +ALE +SD  Y+P+F++YC  P   DEHY PTL+N+   LG  NSNR
Sbjct  266   WRKGSQWFELDRPMALETVSDTFYWPIFRAYCRCP---DEHYFPTLLNLTPSLGSRNSNR  322

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNT--CEYNG-EKTTMCHLFARKFTLHA  259
             TLTW DW K   HP  F   +V V+FLN LR  +   CE+ G +KT  C LFARKF+ +A
Sbjct  323   TLTWTDWGKRRAHPRSFGGPEVNVEFLNWLRRSDKEYCEHKGVDKTRPCFLFARKFSSNA  382

Query  258   LSRLLILAPKLMQF  217
             L +LL  A  +M F
Sbjct  383   LDKLLRFASTVMYF  396



>ref|XP_009106038.1| PREDICTED: uncharacterized protein LOC103831856 [Brassica rapa]
Length=409

 Score =   344 bits (882),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 171/298 (57%), Positives = 224/298 (75%), Gaps = 4/298 (1%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYV  928
             HN ++EEL+WRAS   K+ E P     KVAFMFLTRG LPLA LWE FF G+ GLFS+YV
Sbjct  115   HNTTEEELMWRAS---KVQERPSTVKKKVAFMFLTRGKLPLAKLWERFFNGHQGLFSVYV  171

Query  927   HSSDPSYNETEPPE-SVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSE  751
             H+S+ SY +   PE S F+ RRIPSK V+WG  +M+EAERRL+ANALLD +N+RF+LLSE
Sbjct  172   HTSNLSYVDDGIPERSPFYRRRIPSKEVKWGMVSMVEAERRLIANALLDAANQRFVLLSE  231

Query  750   ACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMD  571
               IPLFNFSTIYSY++NS  +F+++YDLPGP GRGRY+ +M+P+I  + WRKGSQWFE+D
Sbjct  232   TDIPLFNFSTIYSYLINSQHSFVDLYDLPGPAGRGRYNRRMSPVITRSKWRKGSQWFEID  291

Query  570   RRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPH  391
             R +A+ V+SD+TYFPLF+ +C   CY+DEHYLPT +++     N+NR+LTW DW++ GPH
Sbjct  292   REIAVAVVSDKTYFPLFKKHCRWGCYADEHYLPTFVHVMFPGKNANRSLTWTDWSRRGPH  351

Query  390   PTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQF  217
             P K+TR  V  + L KLRN   C YNG+++  C+LFARKF    +  L+  A ++M F
Sbjct  352   PRKYTRRSVRAELLTKLRNREGCVYNGKESNNCYLFARKFDDSCIDTLIHFAGRIMGF  409



>ref|XP_009601239.1| PREDICTED: uncharacterized protein LOC104096562 [Nicotiana tomentosiformis]
Length=388

 Score =   343 bits (880),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/297 (55%), Positives = 216/297 (73%), Gaps = 1/297 (0%)
 Frame = -3

Query  1107  HNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYV  928
             H +SD+ELLWRASM P+I + PF+RVPK+AFMFLT+G LP+AP+WE FF+GN G +SIY+
Sbjct  93    HTMSDKELLWRASMVPRIKKYPFKRVPKIAFMFLTKGPLPMAPIWERFFKGNQGRYSIYI  152

Query  927   HSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEA  748
             HS  PS+    P  SVF+ R+IPS+  EWGK +M +AERRL+ANALLD SNE F+LLSE+
Sbjct  153   HSL-PSFEADFPSSSVFYKRQIPSQVTEWGKMSMCDAERRLIANALLDISNEWFVLLSES  211

Query  747   CIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDR  568
             CIPL+NF+ IY Y+  S  +FI  +D PGP GRGRY   M P + + DWRKGSQWFE++R
Sbjct  212   CIPLYNFNVIYKYISQSKHSFIGAFDDPGPYGRGRYDENMLPEVNITDWRKGSQWFEINR  271

Query  567   RLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHP  388
             +LAL ++ D  ++P F  +C   CY DEHY PT++ I+     +NR++TWVDW++GG HP
Sbjct  272   KLALYIVEDTKFYPKFAEFCKPACYVDEHYFPTMLTIQASNLLANRSITWVDWSRGGAHP  331

Query  387   TKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILAPKLMQF  217
               F ++D+T +F+ ++  G  C YN   T+MC LFARKF   AL  L +LAPK + F
Sbjct  332   ATFGKSDITEEFMKRMLAGRNCTYNERNTSMCFLFARKFAPSALEPLFLLAPKYLGF  388



>ref|XP_007012231.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY29850.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=392

 Score =   343 bits (880),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 166/310 (54%), Positives = 220/310 (71%), Gaps = 1/310 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
              L   +  P    H ++D+ELLWRAS  P+I + PF R+PK+AFMFLT+G LPL+PLWE 
Sbjct  80    SLNRWIKPPSNLLHTMNDKELLWRASFVPRIKKYPFNRLPKIAFMFLTKGPLPLSPLWER  139

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             F +G+ GL+SIY+HS  PSYN   PP SVF+GR+IPS+  EWG+ +M +AERRLLANALL
Sbjct  140   FLKGHEGLYSIYIHSL-PSYNAEFPPSSVFYGRQIPSQVSEWGRMSMCDAERRLLANALL  198

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE FILLSE+CIPL+NFS IY Y+  S  +FI  +D PGP GRGRY+  M P + + 
Sbjct  199   DISNEWFILLSESCIPLYNFSVIYHYIKKSKYSFIGAFDDPGPYGRGRYNENMAPEVNIT  258

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++RRLAL ++ D TY+P F+ +C   CY DEHY PT++ I+     +NR+
Sbjct  259   QWRKGSQWFEINRRLALNIVEDSTYYPKFEQFCRPACYVDEHYFPTMLTIQASNLIANRS  318

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TWVDW++GG HP  F R D+T +   ++   + C YN + + +C LFARKF   AL  L
Sbjct  319   ITWVDWSRGGAHPATFGRADITEELFKRIFEDHQCRYNDQPSLVCFLFARKFAPSALEPL  378

Query  246   LILAPKLMQF  217
             L +APK++ F
Sbjct  379   LQIAPKILGF  388



>ref|XP_011081713.1| PREDICTED: uncharacterized protein LOC105164695 [Sesamum indicum]
 ref|XP_011081714.1| PREDICTED: uncharacterized protein LOC105164695 [Sesamum indicum]
Length=385

 Score =   343 bits (879),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/309 (52%), Positives = 225/309 (73%), Gaps = 1/309 (0%)
 Frame = -3

Query  1143  LKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMF  964
             L++ +  P    H +SDEEL WRAS  P++ + PF+RVPK+AFMFLT+G LPLAPLWE F
Sbjct  78    LEQWIKPPTNLMHKMSDEELFWRASFVPRVKKYPFQRVPKIAFMFLTKGQLPLAPLWERF  137

Query  963   FRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLD  784
             F+G+ G +SIY+HS  PS+    P  SVF+ R+IPS+  EWGK +M++AERRLLANALLD
Sbjct  138   FKGHEGQYSIYIHSL-PSFEADFPSSSVFYKRQIPSQVSEWGKMSMVDAERRLLANALLD  196

Query  783   FSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLND  604
              SNE F+LLSE+CIPL+NFS +Y+Y+  S  +FI  +D PGP GRGRY+  M P + + D
Sbjct  197   ISNEWFVLLSESCIPLYNFSMVYNYITGSKYSFIGAFDDPGPYGRGRYNDNMLPEVNITD  256

Query  603   WRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTL  424
             WRKGSQWFE++++LAL ++ D  ++P F  +C   CY DEHY PT++ I+     +NR++
Sbjct  257   WRKGSQWFEINKKLALYIVEDTKFYPKFSEFCKPACYVDEHYFPTMLTIQAATLLANRSI  316

Query  423   TWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLL  244
             TWVDW++GG HP  F  +D+T +F  K+ +G +C YN + +++C+LFARKF+  AL  L 
Sbjct  317   TWVDWSRGGAHPATFGGSDITEEFFKKIFDGRSCLYNNKPSSICYLFARKFSPSALEALF  376

Query  243   ILAPKLMQF  217
             +LAPK + F
Sbjct  377   LLAPKFLGF  385



>ref|XP_010428318.1| PREDICTED: uncharacterized protein LOC104712998 isoform X1 [Camelina 
sativa]
 ref|XP_010428319.1| PREDICTED: uncharacterized protein LOC104712998 isoform X2 [Camelina 
sativa]
 ref|XP_010428320.1| PREDICTED: uncharacterized protein LOC104712998 isoform X3 [Camelina 
sativa]
Length=419

 Score =   343 bits (881),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 226/307 (74%), Gaps = 5/307 (2%)
 Frame = -3

Query  1131  LMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGN  952
             L+ P    HN+++EEL  RAS   KI EM      KVAFMFL RG LPLA LWE FF+G+
Sbjct  116   LVEPENVMHNMTEEELFRRAS---KIQEMTLNMTKKVAFMFLARGKLPLAKLWERFFQGH  172

Query  951   AGLFSIYVHSSDPSYNETEPPE-SVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSN  775
              GLFSIY+HSSDP Y +   PE S F+ RRIPSK V+WG  +M+EAERRLLANALLD  N
Sbjct  173   EGLFSIYIHSSDPFYVDDSTPETSPFYRRRIPSKEVKWGMVSMVEAERRLLANALLDAGN  232

Query  774   ERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRK  595
              RF+LLSE+ IPLFNFST+YSY++NS  +++++YDLPGP GRGRY+ +M+P+I  + WRK
Sbjct  233   HRFVLLSESDIPLFNFSTVYSYLVNSQHSYVDIYDLPGPAGRGRYNRRMSPVISRSKWRK  292

Query  594   GSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWV  415
             GSQWFE+DR +A  V+SD  Y P+F+ +C   CY+DEHYLPTL+++     ++NR+LTW 
Sbjct  293   GSQWFEIDREVAEAVVSDTIYIPVFKKHCLLGCYADEHYLPTLVHVMFPGKSANRSLTWT  352

Query  414   DWAKGGPHPTKFTRNDVTVDFLNKLRNGNT-CEYNGEKTTMCHLFARKFTLHALSRLLIL  238
             DW++ GPHP K+TR  VT +FL+KLRN    C YNG+K+  C+LFARKF    L +LL  
Sbjct  353   DWSRRGPHPRKYTRRSVTGEFLSKLRNRREGCVYNGKKSEKCYLFARKFDNSCLDKLLYF  412

Query  237   APKLMQF  217
             A ++M F
Sbjct  413   AHRVMGF  419



>ref|XP_009414639.1| PREDICTED: uncharacterized protein LOC103995706 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414640.1| PREDICTED: uncharacterized protein LOC103995706 [Musa acuminata 
subsp. malaccensis]
Length=386

 Score =   342 bits (878),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 166/306 (54%), Positives = 221/306 (72%), Gaps = 2/306 (1%)
 Frame = -3

Query  1131  LMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGN  952
              ++P    H++SD+EL WR SM+PK+ E PF RVPKVAFMF+TRG LPLA LW+ FF+G+
Sbjct  82    FLSPAHLMHSMSDKELFWRVSMAPKMKEYPFERVPKVAFMFMTRGPLPLARLWDRFFKGH  141

Query  951   AGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNE  772
              GL+S+YVH+  P Y    P  S F+GR+IPS+ V WG   +++AE+RLLANALLDFSNE
Sbjct  142   EGLYSVYVHTI-PDYKLNAPESSAFYGRQIPSEEVSWGSVTLVDAEKRLLANALLDFSNE  200

Query  771   RFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKG  592
             RFILLSE+CIP++NF T+Y Y++NS  +F+E YD     GRGRYS  M P IKL+ WRKG
Sbjct  201   RFILLSESCIPVYNFPTVYEYLINSAHSFVESYDENSQQGRGRYSRHMFPTIKLHQWRKG  260

Query  591   SQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVD  412
             S+WFE++R LA+ V++D  Y+ +F  YC   CY DEHY+PT +N+  G  N+NRT+TWVD
Sbjct  261   SEWFELNRELAVNVVADYKYYSIFSKYCKPSCYPDEHYIPTFLNMFHGSLNANRTITWVD  320

Query  411   WAKGGPHPTKFTRNDVTVDFLNKLR-NGNTCEYNGEKTTMCHLFARKFTLHALSRLLILA  235
             W++GGPHP  +   ++T DF+  +R NG +C YN   T++C LFARKF   +L  LL L 
Sbjct  321   WSRGGPHPATYGAPNITPDFIQSIRNNGTSCMYNSRPTSVCFLFARKFAPSSLDPLLNLT  380

Query  234   PKLMQF  217
               +M F
Sbjct  381   STVMGF  386



>gb|KHG05757.1| hypothetical protein F383_31190 [Gossypium arboreum]
Length=387

 Score =   342 bits (878),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 222/309 (72%), Gaps = 1/309 (0%)
 Frame = -3

Query  1143  LKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMF  964
             +   +  P    HN++D ELLWRAS  P+I + PF+RVPK+AFMFLT+G LPLAPLW+ F
Sbjct  80    IDNFIRPPSNLMHNMNDTELLWRASFVPQIKDYPFKRVPKIAFMFLTKGPLPLAPLWDRF  139

Query  963   FRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLD  784
             F+G+  L+SIYVH+  PSY    PP S F+GR+IPS+ VEWG+ +M EAERRLLANALLD
Sbjct  140   FKGHEELYSIYVHAL-PSYTAGYPPSSPFYGRQIPSQMVEWGRMSMCEAERRLLANALLD  198

Query  783   FSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLND  604
              SNE FILLSE+CIPL NFS IY Y+  S  +F+  +D PGP GRGRY+  M P + L+ 
Sbjct  199   ISNEWFILLSESCIPLHNFSIIYHYISRSRYSFMGSFDEPGPYGRGRYNPHMEPEVTLSQ  258

Query  603   WRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTL  424
             WRKGSQWFE++R+LA++++ D TY+P F+ +C   CY DEHY PT++ I+     +NRTL
Sbjct  259   WRKGSQWFEVNRKLAIDIVVDTTYYPKFKKFCRPACYVDEHYFPTMLTIQSPHLLANRTL  318

Query  423   TWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLL  244
             TW DW++GG HP  F + D+T  F  K+  G  C YNG+ +T+C+LFARKF   AL  LL
Sbjct  319   TWTDWSRGGAHPATFGKADITEGFFKKIFEGQVCLYNGQPSTVCYLFARKFAPSALDPLL  378

Query  243   ILAPKLMQF  217
              LA K+ ++
Sbjct  379   GLASKVFRY  387



>emb|CDX96026.1| BnaA07g27050D [Brassica napus]
Length=396

 Score =   342 bits (878),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 187/314 (60%), Positives = 228/314 (73%), Gaps = 13/314 (4%)
 Frame = -3

Query  1137  ELLMAPP--GAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMF  964
             E+ + PP     HN+ D EL WRASM PKI   PF R PKVAFMFLTRG LPLAPLWE F
Sbjct  89    EMFLRPPKINIMHNMEDNELFWRASMDPKIRSYPFSRTPKVAFMFLTRGPLPLAPLWERF  148

Query  963   FRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLD  784
             FRG  GLF+IY+H+ +PSY E+ P  SVF GRRIPSK V+W  ANM++AERRLLANALLD
Sbjct  149   FRGCEGLFTIYIHT-NPSYKESMPQGSVFLGRRIPSKRVDWANANMVDAERRLLANALLD  207

Query  783   FSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLND  604
              +NERF+LLSE+CIPLFNF+TIYSY++NS +T ++ YDL  P GR RY+ +M P I L+ 
Sbjct  208   INNERFLLLSESCIPLFNFTTIYSYLINSTQTHVDSYDL--PFGRVRYNRRMYPHIHLHH  265

Query  603   WRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNI--KLGQGNSNR  430
             WRKGSQWFE+DR +ALE +SD  Y+P+F++YC  P   DEHY PTL+N+   LG  NSNR
Sbjct  266   WRKGSQWFELDRPMALETVSDTFYWPIFRAYCRCP---DEHYFPTLLNLTPSLGSRNSNR  322

Query  429   TLTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNT--CEYNG-EKTTMCHLFARKFTLHA  259
             TLTW DW K   HP  F   +V V+FLN LR  +   CE+ G +KT  C LFARKF+ +A
Sbjct  323   TLTWTDWGKRRAHPRSFGGPEVNVEFLNWLRRSDKEYCEHKGVDKTRPCFLFARKFSSNA  382

Query  258   LSRLLILAPKLMQF  217
             L +LL  A  +M F
Sbjct  383   LDKLLRFASTVMYF  396



>ref|XP_008393325.1| PREDICTED: uncharacterized protein LOC103455512 [Malus domestica]
Length=403

 Score =   343 bits (879),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 175/300 (58%), Positives = 224/300 (75%), Gaps = 8/300 (3%)
 Frame = -3

Query  1101  LSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGNAGLFSIYVHS  922
             + D EL WRAS  P+IG+ P+ RVP++AFMFLT+G +PLAPLWEMFF G+ GL++IY H 
Sbjct  103   VDDGELFWRASFVPRIGKFPYNRVPRIAFMFLTKGPIPLAPLWEMFFNGHEGLYNIYXHP  162

Query  921   SDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNERFILLSEACI  742
               PSY E+ P  SVF+GRRIPSK VEWG   MI+ ERRLLA+ALLDF+NERF+LLSE+CI
Sbjct  163   -HPSYVESWPQNSVFYGRRIPSKAVEWGSPTMIDGERRLLASALLDFTNERFVLLSESCI  221

Query  741   PLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKGSQWFEMDRRL  562
             PLFNF+TIYSY+ N++E+ I  YD P  VGRGRY+ +M P I ++DWRKGSQWFE+ R+L
Sbjct  222   PLFNFTTIYSYLXNASESNIGSYDDPRKVGRGRYNPRMWPEINISDWRKGSQWFEVSRKL  281

Query  561   ALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVDWAKGGPHPTK  382
             A+E+ISD  Y+P+F+ +C+ PCY DEHY+PTL+NI   + NSNR++TWVDW+K GPHP +
Sbjct  282   AVEIISDNKYYPIFKEHCSPPCYMDEHYIPTLVNIIGPEENSNRSVTWVDWSKSGPHPGR  341

Query  381   FTRNDVTVDFLNKLR------NGNTCEYNGEKT-TMCHLFARKFTLHALSRLLILAPKLM  223
             F RNDV+   LN++R             N   T +MC LFARKF    L  LL +AP L+
Sbjct  342   FGRNDVSEVILNQIRFGSNCSCSGNSSANSTTTCSMCFLFARKFMGDTLRPLLQIAPMLL  401



>ref|XP_004498923.1| PREDICTED: uncharacterized protein LOC101515236 [Cicer arietinum]
Length=377

 Score =   342 bits (876),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 166/312 (53%), Positives = 224/312 (72%), Gaps = 3/312 (1%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL++ +  P    HN+SD ELLWRAS+ PKI   PF RVPK+AFMFLT+G LPLAPLWE 
Sbjct  67    GLEQWIKPPLKLIHNMSDNELLWRASLVPKIKNYPFERVPKIAFMFLTKGPLPLAPLWER  126

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FF+G+   F+IY+HS  PSY    PP SVF+ R+IPS+  EWG+ +M +AERRLLANALL
Sbjct  127   FFKGHESFFTIYIHSL-PSYQAQFPPSSVFYKRQIPSQIAEWGRMSMCDAERRLLANALL  185

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE FILLSE+CIPL+ FS +Y YV  S  +F+  +D PGP GRGRY+  M P++ + 
Sbjct  186   DISNEWFILLSESCIPLYKFSVVYHYVKKSKHSFVGAFDDPGPYGRGRYNPNMAPLVNIT  245

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++R+LA+ ++ D T++P F+ YC   CY DEHY PT++ I+     +NR+
Sbjct  246   KWRKGSQWFEVNRKLAINIVEDTTFYPKFEQYCRPACYVDEHYFPTMLTIQAEGALANRS  305

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEK-TTMCHLFARKFTLHALSR  250
             +TWVDW++GG HP  F R D++ +F N++R G+ C YN  + +++C LFARKF   AL  
Sbjct  306   ITWVDWSRGGAHPATFGRTDISEEFFNRVRGGHECVYNNNRNSSVCFLFARKFAPSALEP  365

Query  249   LL-ILAPKLMQF  217
             LL ++  K++ F
Sbjct  366   LLDMVDSKVLDF  377



>ref|XP_010941940.1| PREDICTED: uncharacterized protein LOC105060052 [Elaeis guineensis]
Length=384

 Score =   342 bits (877),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 167/310 (54%), Positives = 221/310 (71%), Gaps = 1/310 (0%)
 Frame = -3

Query  1143  LKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMF  964
             L+  +  P    H +S+EEL WRAS  P++ + PF+RVPKVAFMFLT+G LPL PLWE F
Sbjct  76    LRRWIKPPRSLMHKMSEEELFWRASFVPQVKKYPFKRVPKVAFMFLTKGPLPLFPLWEKF  135

Query  963   FRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLD  784
             F+G+  L+SIY+HS  P Y    PP SVF+ R+IPSK  EWGK NM +AERRLLANALLD
Sbjct  136   FKGHEELYSIYIHSL-PDYQPNFPPSSVFYNRQIPSKVAEWGKMNMCDAERRLLANALLD  194

Query  783   FSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLND  604
              SNE F+LLSE+CIPL+NFS IY Y+M S  +F+  +D PGP GRGRY+ +M P I +  
Sbjct  195   LSNEWFVLLSESCIPLYNFSIIYQYLMRSRYSFVGSFDDPGPYGRGRYNLRMAPEIDITQ  254

Query  603   WRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTL  424
             WRKG+QWFE++R+LA++++ D  Y+P F+ +C   CY DEHY PT++ I+     +NRTL
Sbjct  255   WRKGAQWFEVNRKLAIDIVRDTKYYPKFKEFCKPSCYVDEHYFPTMLTIESPHLIANRTL  314

Query  423   TWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLL  244
             TWVDW++GG HP  F + D+T  FL K+  G +C YN + +++C LFARKF   A++ LL
Sbjct  315   TWVDWSRGGAHPATFGKGDITEAFLKKIFEGKSCLYNDQPSSVCFLFARKFAPSAMAPLL  374

Query  243   ILAPKLMQFN  214
               AP L+ F 
Sbjct  375   QFAPSLLGFE  384



>gb|AFO66494.1| hypothetical protein [Brassica napus]
Length=386

 Score =   342 bits (877),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 164/310 (53%), Positives = 220/310 (71%), Gaps = 1/310 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
              L + +  P    HN++DEELLWRAS  P+  E PF+RVPK+AFMFLT+G LPLA LWE 
Sbjct  78    SLSKWIQPPAVLMHNMTDEELLWRASFWPRRKEYPFQRVPKIAFMFLTKGPLPLALLWER  137

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             F +G+ GL+S+YVH   PS+    P  SVF+ R+IPS+  EWG+  M +AE+RLLANALL
Sbjct  138   FLKGHKGLYSVYVHP-HPSFTAKFPAGSVFYQRQIPSQVAEWGRMTMCDAEKRLLANALL  196

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE F+L+SE+CIPLFNF+TIYSY+  +  +F+  +D PGP GRGRY+  M P + + 
Sbjct  197   DISNEWFVLVSESCIPLFNFTTIYSYLSRTKHSFMGAFDDPGPFGRGRYNDNMEPEVPIT  256

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++R LA  ++ D  Y+P F+ +C   CY DEHY PT++ I+     +NR+
Sbjct  257   KWRKGSQWFEINRELAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPMALANRS  316

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             LTWVDW++GGPHP  F R+D+T  F  ++ +G  C YNG  T+MC+LFARKF   AL  L
Sbjct  317   LTWVDWSRGGPHPATFGRSDITEKFFERILDGKNCVYNGRNTSMCYLFARKFAPSALESL  376

Query  246   LILAPKLMQF  217
             L +APK++ +
Sbjct  377   LHIAPKILGY  386



>ref|XP_007222675.1| hypothetical protein PRUPE_ppa008602mg [Prunus persica]
 gb|EMJ23874.1| hypothetical protein PRUPE_ppa008602mg [Prunus persica]
Length=325

 Score =   340 bits (871),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 165/310 (53%), Positives = 220/310 (71%), Gaps = 1/310 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL   +  P    H ++D+ELLWRAS+ P+I + PF RVPK+AFMFLTRG LPLAPLWE 
Sbjct  17    GLDRWIKPPSNLQHTMTDKELLWRASLMPRIKKYPFERVPKIAFMFLTRGPLPLAPLWER  76

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             F +G+ G +SIYVHS  PS+       SVF+GR IPS+  EWG+ +M +AERRLLANALL
Sbjct  77    FLKGHEGRYSIYVHSL-PSFQPHFHTSSVFYGRHIPSQVSEWGRMSMCDAERRLLANALL  135

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE FIL+SE+CIPL+NFS IY Y+M S  +FI  +D PGP GRGRY++ M P + + 
Sbjct  136   DISNEWFILVSESCIPLYNFSVIYHYLMKSKYSFIGAFDDPGPFGRGRYNNNMAPEVNIT  195

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++R+LA+ ++ D T++  F+ +C   CY DEHY PT++ I+ G   +NR+
Sbjct  196   QWRKGSQWFEVNRKLAISIVEDTTFYQKFEKFCRPACYVDEHYFPTMLTIQAGNSLANRS  255

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TWVDW++GGPHP  F R D+T +F  ++  G+ C YN   +++C LF RKF   A+  L
Sbjct  256   ITWVDWSRGGPHPATFGRADITEEFFKRMLEGHRCTYNDRNSSICFLFGRKFAPSAMEPL  315

Query  246   LILAPKLMQF  217
             L LAPK + F
Sbjct  316   LHLAPKFLGF  325



>ref|XP_002871492.1| hypothetical protein ARALYDRAFT_909140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47751.1| hypothetical protein ARALYDRAFT_909140 [Arabidopsis lyrata subsp. 
lyrata]
Length=387

 Score =   342 bits (876),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/309 (54%), Positives = 221/309 (72%), Gaps = 1/309 (0%)
 Frame = -3

Query  1143  LKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMF  964
             L + +  P    HN+SDEELLWRAS  P+  E PF+RVPK+AFMFLT+G LPLA LWE F
Sbjct  80    LSKWIQPPAVLMHNMSDEELLWRASFWPRRKEYPFKRVPKIAFMFLTKGPLPLALLWERF  139

Query  963   FRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLD  784
              +G+ GL+S+Y+H   PS+    P  SVF+ R+IPS+  EWG+ +M +AE+RLLANALLD
Sbjct  140   LKGHKGLYSVYLHP-HPSFTAKFPSSSVFYRRQIPSQVAEWGRMSMCDAEKRLLANALLD  198

Query  783   FSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLND  604
              SNE F+L+SE+CIPLFNF+TIYSY+  S  +F+  +D PGP GRGRY+  M P + L+ 
Sbjct  199   ISNEWFVLVSESCIPLFNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNGNMEPEVPLSK  258

Query  603   WRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTL  424
             WRKGSQWFE+DR LA  ++ D  Y+P F+ +C   CY DEHY PT++ I+     +NR+L
Sbjct  259   WRKGSQWFEVDRDLAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPTVLANRSL  318

Query  423   TWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLL  244
             TWVDW++GGPHP  F R+D+T  F  ++ +G  C YNG  T+MC+LFARKF    L  LL
Sbjct  319   TWVDWSRGGPHPATFGRSDITEKFFERIFDGRNCSYNGGNTSMCYLFARKFAPSTLEPLL  378

Query  243   ILAPKLMQF  217
              +APK++ F
Sbjct  379   HIAPKVLGF  387



>ref|XP_010536211.1| PREDICTED: uncharacterized protein LOC104811254 [Tarenaya hassleriana]
Length=387

 Score =   342 bits (876),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/310 (53%), Positives = 218/310 (70%), Gaps = 1/310 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL++ +  P    H +SD ELLWRAS  P+  E PFRRVPK+AFMFLT+G LPLAPLWE 
Sbjct  79    GLEKWIKPPSDLMHKMSDGELLWRASFVPRRKEYPFRRVPKIAFMFLTKGPLPLAPLWER  138

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             F +G  GL+S+Y+HS  PS+    PP SVF+ R+IPS+  EWG+  M +AERRLLANALL
Sbjct  139   FLKGQEGLYSVYIHS-HPSFTAKFPPSSVFYRRQIPSQVAEWGRMTMCDAERRLLANALL  197

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE F+LLSE CIPLFNF+TIY Y+  S ++FI  +D  GP GRGRY+  M P + + 
Sbjct  198   DISNEWFVLLSETCIPLFNFTTIYRYISKSKQSFIGAFDDHGPYGRGRYNDNMAPEVGIT  257

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++R LA  ++ D  Y+P F+ +C   CY DEHY PT++ I+     +NR+
Sbjct  258   QWRKGSQWFEINRELAATIVKDTVYYPKFRDFCRPACYVDEHYFPTMLTIEKPSLLANRS  317

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TWVDW++GG HP  F R D+  +F  ++  G+ C YNG  T+MC++FARKF   +L  L
Sbjct  318   VTWVDWSRGGAHPATFGRADIKEEFFRRIYGGHNCTYNGRNTSMCYVFARKFAPSSLEPL  377

Query  246   LILAPKLMQF  217
             L +APK++ F
Sbjct  378   LHIAPKILGF  387



>ref|XP_010471453.1| PREDICTED: uncharacterized protein LOC104751239 [Camelina sativa]
Length=415

 Score =   342 bits (878),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 172/306 (56%), Positives = 224/306 (73%), Gaps = 4/306 (1%)
 Frame = -3

Query  1131  LMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGN  952
             L+ P    HN+++EEL   AS   KI E   +   KVAFMFL RG LPLA LWE FF+G+
Sbjct  113   LVEPENVMHNMTEEELFRLAS---KIQEKTLKMTKKVAFMFLARGKLPLAKLWERFFQGH  169

Query  951   AGLFSIYVHSSDPSYNETEPPESV-FHGRRIPSKGVEWGKANMIeaerrllanalLDFSN  775
              GLFSIY+H+SDP Y +   PES  F+ RRIPSK V+WG  +M+EAERRLLANALLD  N
Sbjct  170   EGLFSIYIHTSDPFYVDDSTPESSPFYRRRIPSKEVKWGMVSMVEAERRLLANALLDAGN  229

Query  774   ERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRK  595
              RF+LLSE+ IPLFNFST+YSY++NS  +++++YDLPGP GRGRY+ +M+P+I   +WRK
Sbjct  230   HRFVLLSESDIPLFNFSTVYSYLVNSQHSYVDIYDLPGPAGRGRYNRRMSPVISRGNWRK  289

Query  594   GSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWV  415
             GSQWFE+DR +A  V+SD  Y P+F+ +C   CY+DEHYLPTL+++     ++NR+LTW 
Sbjct  290   GSQWFEIDREVAEAVVSDTIYIPVFKKHCLLGCYADEHYLPTLVHVMFPGKSANRSLTWT  349

Query  414   DWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRLLILA  235
             DW++ GPHP K+TR  VT +FL KLRN   C YNG+K+  C+LFARKF    L +LL  A
Sbjct  350   DWSRRGPHPRKYTRRSVTGEFLYKLRNREGCVYNGKKSEKCYLFARKFDNSCLDKLLYFA  409

Query  234   PKLMQF  217
              ++M F
Sbjct  410   HRVMGF  415



>ref|XP_010491917.1| PREDICTED: uncharacterized protein LOC104769408 [Camelina sativa]
Length=387

 Score =   341 bits (875),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/310 (53%), Positives = 222/310 (72%), Gaps = 1/310 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL + +  P    HN+SDEELLWRAS  P+  E PF+RVPK+AFMFLT+G LPLA LWE 
Sbjct  79    GLSKWIQPPAVLMHNMSDEELLWRASFWPRRKEYPFKRVPKIAFMFLTKGPLPLALLWER  138

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             F +G+ GL+S+Y+H   PS+    P  SVFH R+IPS+  EWG+ +M +AE+RLLANALL
Sbjct  139   FLKGHNGLYSVYLHP-HPSFTAKFPANSVFHRRQIPSQVAEWGRMSMCDAEKRLLANALL  197

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE F+L+SE+CIPL+NF+TIYSY+  S  +F+  +D PGP GRGRY+  M P + + 
Sbjct  198   DISNEWFVLVSESCIPLYNFTTIYSYLSRSKHSFMGAFDDPGPYGRGRYNGNMEPEVPVT  257

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++R LA  ++ D  Y+P F+ +C   CY DEHY PT++ I+     +NR+
Sbjct  258   KWRKGSQWFEINRDLAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPAVLANRS  317

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
             +TWVDW++GGPHP  F R+D+T  F  ++ +G  C YNG  T++C+LFARKF   AL  L
Sbjct  318   ITWVDWSRGGPHPATFGRSDITEKFFGRIFDGRNCTYNGRNTSICYLFARKFAPSALEPL  377

Query  246   LILAPKLMQF  217
             L +APK++ F
Sbjct  378   LHIAPKILGF  387



>ref|XP_010273586.1| PREDICTED: uncharacterized protein LOC104609074 [Nelumbo nucifera]
 ref|XP_010273587.1| PREDICTED: uncharacterized protein LOC104609074 [Nelumbo nucifera]
Length=405

 Score =   342 bits (876),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/306 (54%), Positives = 223/306 (73%), Gaps = 2/306 (1%)
 Frame = -3

Query  1131  LMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEMFFRGN  952
              + P    H+++D+ELLWRAS+ PK    P++RVPKVAFMFLTRG LPL+PLW+ FF+G+
Sbjct  101   FINPGHLTHSMTDDELLWRASLVPKKEVYPYKRVPKVAFMFLTRGPLPLSPLWDRFFQGH  160

Query  951   AGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalLDFSNE  772
               LFS+YVH+  P Y       S F+GR+IPS+ V+WG   + + ERRLLANALLDFSNE
Sbjct  161   ENLFSVYVHAL-PGYELNVSRSSAFYGRQIPSQDVQWGSVTLSDGERRLLANALLDFSNE  219

Query  771   RFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLNDWRKG  592
             RF+LLSE+CIP+++F T+Y Y++NS  +F++ YD P   GRGRYS +M P IKL  WRKG
Sbjct  220   RFVLLSESCIPVYDFLTVYKYLINSAYSFVDSYDDPSRYGRGRYSRKMLPDIKLFQWRKG  279

Query  591   SQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRTLTWVD  412
             SQWFE++R LA+ +++D  Y+ LF+ YC   CY DEHYLPT +N+  G  N+NR++TWVD
Sbjct  280   SQWFELNRTLAVNIVADDKYYSLFRKYCKPSCYPDEHYLPTFLNMFYGSMNANRSVTWVD  339

Query  411   WAKGGPHPTKFTRNDVTVDFLNKLR-NGNTCEYNGEKTTMCHLFARKFTLHALSRLLILA  235
             W++GGPHP  F + D+T  F+  ++ NG TC YN E+T +C+LFARKF   AL  LL L 
Sbjct  340   WSRGGPHPATFGKEDITEGFIQSIKNNGTTCSYNSEQTLVCYLFARKFAPSALEPLLNLT  399

Query  234   PKLMQF  217
               +++F
Sbjct  400   STVLRF  405



>ref|XP_006450782.1| hypothetical protein CICLE_v10008613mg [Citrus clementina]
 ref|XP_006450783.1| hypothetical protein CICLE_v10008613mg [Citrus clementina]
 ref|XP_006475972.1| PREDICTED: uncharacterized protein LOC102614541 isoform X1 [Citrus 
sinensis]
 ref|XP_006475973.1| PREDICTED: uncharacterized protein LOC102614541 isoform X2 [Citrus 
sinensis]
 gb|ESR64022.1| hypothetical protein CICLE_v10008613mg [Citrus clementina]
 gb|ESR64023.1| hypothetical protein CICLE_v10008613mg [Citrus clementina]
 gb|KDO79995.1| hypothetical protein CISIN_1g016651mg [Citrus sinensis]
 gb|KDO79996.1| hypothetical protein CISIN_1g016651mg [Citrus sinensis]
Length=385

 Score =   341 bits (874),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/310 (53%), Positives = 222/310 (72%), Gaps = 1/310 (0%)
 Frame = -3

Query  1146  GLKELLMAPPGAAHNLSDEELLWRASMSPKIGEMPFRRVPKVAFMFLTRGALPLAPLWEM  967
             GL   +  P    H +SD+EL WRAS  P++ E PF+RVPK+AFMFLT+G LPL PLWE 
Sbjct  77    GLDYWINPPSNLMHTMSDKELFWRASFVPRVKEYPFKRVPKIAFMFLTKGPLPLGPLWEK  136

Query  966   FFRGNAGLFSIYVHSSDPSYNETEPPESVFHGRRIPSKGVEWGKANMIeaerrllanalL  787
             FF+G+ GL+SIYVHS  P++    P  SVF+ R+IPS+  EWGK +M +AERRLLANALL
Sbjct  137   FFKGHEGLYSIYVHSL-PTFENKFPSSSVFYNRQIPSQISEWGKMSMCDAERRLLANALL  195

Query  786   DFSNERFILLSEACIPLFNFSTIYSYVMNSNETFIEVYDLPGPVGRGRYSSQMNPIIKLN  607
             D SNE FIL+SE+CIPL+NFS IY Y+  S  +F+  +D PGP GRGRY++ M P++ + 
Sbjct  196   DISNEWFILVSESCIPLYNFSLIYHYIKKSKHSFMGSFDDPGPYGRGRYNANMAPVVNIT  255

Query  606   DWRKGSQWFEMDRRLALEVISDQTYFPLFQSYCTGPCYSDEHYLPTLMNIKLGQGNSNRT  427
              WRKGSQWFE++RRLA+ ++ D TY+P F  +C  PCY DEHY PT+++I++    +NR+
Sbjct  256   QWRKGSQWFEINRRLAVNIVEDTTYYPKFAEFCRPPCYVDEHYFPTMLSIQMPNLLANRS  315

Query  426   LTWVDWAKGGPHPTKFTRNDVTVDFLNKLRNGNTCEYNGEKTTMCHLFARKFTLHALSRL  247
              TWVDW++GG HP  F R D+T +F  K+  G  C+YN + +T+C LF RKF   AL  L
Sbjct  316   STWVDWSRGGAHPATFGRADITEEFFKKVYGGQHCKYNNQPSTVCFLFGRKFAPSALQPL  375

Query  246   LILAPKLMQF  217
             + ++ K++ F
Sbjct  376   MNISSKVLGF  385



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4554914126840