BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1571_g1_i1 len=1610 path=[1:0-1609]

Length=1610
                                                                      Score     E

ref|XP_009597113.1|  PREDICTED: uncharacterized protein LOC104093106  97.8    9e-19   
emb|CDP20015.1|  unnamed protein product                              92.8    6e-17   
ref|XP_004310225.1|  PREDICTED: uncharacterized protein LOC101307273  92.4    7e-17   
ref|XP_008450122.1|  PREDICTED: uncharacterized protein LOC103491...  91.3    2e-16   
ref|XP_009771786.1|  PREDICTED: uncharacterized protein LOC104222...  89.7    4e-16   
gb|KGN58162.1|  hypothetical protein Csa_3G565330                     89.7    4e-16   
ref|XP_008450129.1|  PREDICTED: uncharacterized protein LOC103491...  89.4    5e-16   
ref|XP_009771785.1|  PREDICTED: uncharacterized protein LOC104222...  87.0    3e-15   
ref|XP_002512909.1|  conserved hypothetical protein                   86.3    6e-15   Ricinus communis
ref|XP_010656172.1|  PREDICTED: uncharacterized protein LOC100266...  85.9    9e-15   
ref|XP_011099004.1|  PREDICTED: uncharacterized protein LOC105177516  85.9    1e-14   
ref|XP_010656174.1|  PREDICTED: uncharacterized protein LOC100266...  84.7    3e-14   
ref|XP_009591285.1|  PREDICTED: uncharacterized protein LOC104088330  84.3    3e-14   
ref|XP_006447030.1|  hypothetical protein CICLE_v10018081mg           84.3    3e-14   
gb|KDP41789.1|  hypothetical protein JCGZ_26807                       84.0    4e-14   
ref|XP_010556118.1|  PREDICTED: uncharacterized protein LOC104825488  84.0    4e-14   
gb|KHG01154.1|  ethylene insensitive 3 -like protein                  83.2    7e-14   
emb|CAN72196.1|  hypothetical protein VITISV_014980                   83.6    1e-13   Vitis vinifera
emb|CBI21326.3|  unnamed protein product                              83.6    1e-13   
gb|AFK45721.1|  unknown                                               81.6    2e-13   
ref|XP_010090655.1|  hypothetical protein L484_017461                 82.8    2e-13   
ref|XP_010660738.1|  PREDICTED: uncharacterized protein LOC104881...  81.6    2e-13   
gb|KCW61917.1|  hypothetical protein EUGRSUZ_H04615                   81.3    3e-13   
ref|XP_010028982.1|  PREDICTED: uncharacterized protein LOC104419127  80.5    5e-13   
ref|XP_006599015.1|  PREDICTED: uncharacterized protein LOC102666543  80.5    6e-13   
gb|KDP26836.1|  hypothetical protein JCGZ_17994                       79.7    1e-12   
ref|XP_010250652.1|  PREDICTED: uncharacterized protein LOC104592840  79.7    1e-12   
ref|XP_011036107.1|  PREDICTED: uncharacterized protein LOC105133719  79.7    1e-12   
ref|XP_010112393.1|  hypothetical protein L484_010798                 79.7    2e-12   
ref|XP_009771615.1|  PREDICTED: uncharacterized protein LOC104222123  79.0    2e-12   
ref|XP_007142600.1|  hypothetical protein PHAVU_007G001200g           79.0    2e-12   
ref|XP_002299323.2|  hypothetical protein POPTR_0001s13570g           79.0    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_009757313.1|  PREDICTED: uncharacterized protein LOC104210...  78.2    2e-12   
ref|XP_010543090.1|  PREDICTED: uncharacterized protein LOC104816116  77.4    3e-12   
ref|XP_003622164.1|  hypothetical protein MTR_7g028590                78.6    3e-12   
ref|XP_004239242.1|  PREDICTED: uncharacterized protein LOC101252392  77.8    4e-12   
gb|KHN28283.1|  hypothetical protein glysoja_040163                   77.8    5e-12   
ref|XP_010543088.1|  PREDICTED: uncharacterized protein LOC104816114  77.4    7e-12   
ref|XP_008222202.1|  PREDICTED: uncharacterized protein LOC103322...  77.0    9e-12   
ref|XP_007223089.1|  hypothetical protein PRUPE_ppa007017mg           77.0    1e-11   
gb|EYU31831.1|  hypothetical protein MIMGU_mgv11b019719mg             76.3    1e-11   
ref|XP_004148010.1|  PREDICTED: uncharacterized protein LOC101218873  76.3    1e-11   
ref|XP_006604154.1|  PREDICTED: uncharacterized protein LOC102665678  76.3    2e-11   
ref|XP_006575827.1|  PREDICTED: uncharacterized protein LOC102660341  75.9    2e-11   
ref|XP_009757314.1|  PREDICTED: uncharacterized protein LOC104210...  75.5    2e-11   
ref|XP_006399919.1|  hypothetical protein EUTSA_v10013936mg           75.5    2e-11   
ref|XP_002303775.1|  hypothetical protein POPTR_0003s16710g           74.3    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010660737.1|  PREDICTED: uncharacterized protein LOC104881...  74.7    4e-11   
gb|KDO81827.1|  hypothetical protein CISIN_1g015546mg                 75.1    4e-11   
ref|XP_006437983.1|  hypothetical protein CICLE_v10031707mg           75.1    5e-11   
ref|XP_008231191.1|  PREDICTED: uncharacterized protein LOC103330395  74.7    5e-11   
ref|XP_007043918.1|  Uncharacterized protein TCM_008615               75.1    6e-11   
ref|XP_008222201.1|  PREDICTED: uncharacterized protein LOC103322...  74.3    7e-11   
gb|KDO63890.1|  hypothetical protein CISIN_1g047473mg                 73.9    8e-11   
ref|XP_006589802.1|  PREDICTED: uncharacterized protein LOC102661485  73.6    1e-10   
gb|EYU34820.1|  hypothetical protein MIMGU_mgv1a022125mg              72.4    1e-10   
gb|KHN37253.1|  hypothetical protein glysoja_013468                   73.6    1e-10   
ref|XP_010027268.1|  PREDICTED: uncharacterized protein LOC104417743  73.2    2e-10   
ref|XP_006288042.1|  hypothetical protein CARUB_v10001273mg           72.8    2e-10   
ref|XP_008459858.1|  PREDICTED: uncharacterized protein LOC103498856  72.4    2e-10   
ref|NP_196913.2|  uncharacterized protein                             72.0    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007139293.1|  hypothetical protein PHAVU_008G017100g           72.0    3e-10   
ref|XP_011020800.1|  PREDICTED: uncharacterized protein LOC105123041  72.4    3e-10   
ref|XP_009121698.1|  PREDICTED: uncharacterized protein LOC103846512  71.6    3e-10   
ref|XP_003551814.1|  PREDICTED: uncharacterized protein LOC100795...  71.6    4e-10   
ref|XP_007161667.1|  hypothetical protein PHAVU_001G088600g           72.0    4e-10   
gb|KGN46453.1|  hypothetical protein Csa_6G094710                     72.0    4e-10   
ref|XP_009343132.1|  PREDICTED: uncharacterized protein LOC103935107  71.2    6e-10   
gb|KEH21972.1|  WRKY transcription factor-like protein                68.9    1e-09   
ref|XP_008379747.1|  PREDICTED: uncharacterized protein LOC103442710  69.7    2e-09   
ref|XP_011000964.1|  PREDICTED: uncharacterized protein LOC105108...  70.1    2e-09   
ref|XP_002871601.1|  hypothetical protein ARALYDRAFT_488241           69.7    2e-09   
ref|XP_004157635.1|  PREDICTED: uncharacterized protein LOC101232263  69.7    2e-09   
gb|KHN27188.1|  hypothetical protein glysoja_025472                   69.7    2e-09   
ref|XP_007031921.1|  Regulator of nonsense transcripts 3A, putative   70.1    2e-09   
ref|XP_010492202.1|  PREDICTED: uncharacterized protein LOC104769639  68.9    3e-09   
gb|KHN13847.1|  hypothetical protein glysoja_016131                   68.6    4e-09   
ref|XP_006603013.1|  PREDICTED: uncharacterized protein LOC100795...  68.6    4e-09   
ref|XP_010682717.1|  PREDICTED: uncharacterized protein LOC104897530  68.6    4e-09   
ref|XP_008362102.1|  PREDICTED: uncharacterized protein LOC103425...  68.6    5e-09   
ref|XP_011086830.1|  PREDICTED: uncharacterized protein LOC105168442  68.6    5e-09   
ref|XP_002514886.1|  conserved hypothetical protein                   68.6    5e-09   Ricinus communis
ref|XP_010453523.1|  PREDICTED: uncharacterized protein LOC104735...  67.8    7e-09   
ref|XP_006606602.1|  PREDICTED: uncharacterized protein LOC102663986  67.4    9e-09   
gb|KFK25639.1|  hypothetical protein AALP_AA8G140900                  67.4    9e-09   
ref|XP_010453522.1|  PREDICTED: uncharacterized protein LOC104735...  67.4    1e-08   
ref|XP_010550214.1|  PREDICTED: uncharacterized protein LOC104821...  67.0    1e-08   
ref|XP_008454016.1|  PREDICTED: uncharacterized protein LOC103494565  67.0    2e-08   
gb|KCW55813.1|  hypothetical protein EUGRSUZ_I01630                   66.2    2e-08   
ref|XP_007217685.1|  hypothetical protein PRUPE_ppa019356mg           66.2    2e-08   
ref|XP_008389910.1|  PREDICTED: uncharacterized protein LOC103452...  66.2    2e-08   
ref|XP_008362103.1|  PREDICTED: uncharacterized protein LOC103425...  66.2    3e-08   
gb|KCW86956.1|  hypothetical protein EUGRSUZ_B03523                   64.7    4e-08   
ref|XP_004156994.1|  PREDICTED: probable WRKY transcription facto...  65.9    4e-08   
gb|KGN53042.1|  hypothetical protein Csa_4G012380                     65.5    5e-08   
ref|XP_009344241.1|  PREDICTED: uncharacterized protein LOC103936127  65.1    6e-08   
emb|CDX78559.1|  BnaA03g04710D                                        64.7    7e-08   
ref|XP_010420032.1|  PREDICTED: uncharacterized protein LOC104705678  64.7    8e-08   
ref|XP_010044846.1|  PREDICTED: uncharacterized protein LOC104433701  64.3    9e-08   
ref|XP_009131385.1|  PREDICTED: uncharacterized protein LOC103856058  63.9    1e-07   
emb|CDX70541.1|  BnaC03g06250D                                        63.5    2e-07   
ref|XP_002300122.1|  hypothetical protein POPTR_0001s33510g           63.5    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_008389909.1|  PREDICTED: uncharacterized protein LOC103452...  63.5    2e-07   
ref|XP_011000963.1|  PREDICTED: uncharacterized protein LOC105108...  62.8    3e-07   
ref|XP_004516561.1|  PREDICTED: uncharacterized protein LOC101513155  62.4    3e-07   
ref|XP_010249079.1|  PREDICTED: uncharacterized protein LOC104591...  62.8    4e-07   
ref|XP_009630530.1|  PREDICTED: uncharacterized protein LOC104120...  61.6    4e-07   
ref|XP_008389908.1|  PREDICTED: uncharacterized protein LOC103452...  62.0    6e-07   
ref|XP_009372251.1|  PREDICTED: uncharacterized protein LOC103961...  61.2    1e-06   
ref|XP_003622154.1|  hypothetical protein MTR_7g028350                60.1    2e-06   
gb|AES72068.2|  WRKY transcription factor-like protein                60.1    2e-06   
ref|XP_009630531.1|  PREDICTED: uncharacterized protein LOC104120...  58.9    3e-06   
ref|XP_010543095.1|  PREDICTED: uncharacterized protein LOC104816121  58.9    3e-06   
ref|XP_008389907.1|  PREDICTED: uncharacterized protein LOC103452...  59.3    4e-06   
emb|CDX69606.1|  BnaA10g19550D                                        58.9    5e-06   
ref|XP_010249078.1|  PREDICTED: uncharacterized protein LOC104591...  58.5    8e-06   
ref|XP_010679995.1|  PREDICTED: uncharacterized protein LOC104895240  58.2    9e-06   
emb|CDY58415.1|  BnaC09g54600D                                        57.8    1e-05   
gb|AES77964.2|  WRKY transcription factor-like protein                57.8    1e-05   
ref|XP_008808109.1|  PREDICTED: uncharacterized protein LOC103720272  57.0    2e-05   
ref|XP_011097397.1|  PREDICTED: uncharacterized protein LOC105176330  56.6    3e-05   
ref|XP_010550213.1|  PREDICTED: uncharacterized protein LOC104821...  56.2    4e-05   
ref|XP_003621746.1|  hypothetical protein MTR_7g022360                55.8    5e-05   
ref|XP_003601817.1|  hypothetical protein MTR_3g085710                55.8    5e-05   
gb|AES78372.2|  WRKY transcription factor-like protein, putative      54.7    1e-04   
dbj|BAB08288.1|  unnamed protein product                              53.9    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006338807.1|  PREDICTED: uncharacterized protein LOC102585754  52.8    3e-04   
emb|CDP13369.1|  unnamed protein product                              53.1    4e-04   
ref|XP_004492060.1|  PREDICTED: uncharacterized protein LOC101497033  52.8    5e-04   



>ref|XP_009597113.1| PREDICTED: uncharacterized protein LOC104093106 [Nicotiana tomentosiformis]
Length=355

 Score = 97.8 bits (242),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 137/364 (38%), Positives = 180/364 (49%), Gaps = 41/364 (11%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVKN------RTSFDPS-----HPTYGFSGNPNTTCTYQKVIK  203
             MKLLGWMHRK K N NE+ KN       TSF           YG   N + T + Q   K
Sbjct  1     MKLLGWMHRKAKQNSNESAKNIILGNSATSFSAGTLFEEQEYYG-EANYSFTISKQPACK  59

Query  204   ETE-----EKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITD  368
             E +          E+FHGFLSIGTLG    E       T   P         E    I D
Sbjct  60    EVKSTETELALEEELFHGFLSIGTLGS---ETIKSDPPTPTLPMHLEHVIHGEVKLDIKD  116

Query  369   QDLKLITIELEKFLEAEEDAQSSKRSSYASIITLTDKTQQ-DSSSSPTLL---LDCPLQK  536
              +LKLI  ELEKFLEAE   +SS+RSS+ASIITL+   Q  + +  P      ++ PLQK
Sbjct  117   NELKLINDELEKFLEAEVAHESSERSSHASIITLSGGKQLIEEAELPETYDNSVEFPLQK  176

Query  537   YFFG----LSESDMAVKNEEEASL---SEDLQEVVVVKGNDKKRAGKAQFAKNFmkkmlk  695
             Y FG    LSE+++  K  +   L   +    E  + K   +K+  K + A +FMKKMLK
Sbjct  177   YLFGSSVELSETEVEGKKSKGELLIKRNNIAGEHHIGKDGKEKKQTKGRHAMHFMKKMLK  236

Query  696   slnsnskskTHMHAPNESAPPTknkfp-kvlkmlkkkvHPERYIGEKGAE-KDENR---V  860
             +L+S SKS T   + + + P +  +   +VLKMLK+KVHP   + +K    KDE R    
Sbjct  237   NLHSKSKSCTDPSSGDVNEPVSSKRKLPQVLKMLKRKVHPAEGLTDKNKPLKDEIRNIFC  296

Query  861   KGSRLRSSSDTTGNIWFRQMISPEEEELIMTTSQSCSGSGRGGAFMENNGHWIKTDADYL  1040
             +  +L ++ +   N  F     P +   I+  S+             N  HWIKTDADYL
Sbjct  297   EAGKLGANGEP--NNMFSNASVPTK---ILHASEVYPSDMEYDVSAVNREHWIKTDADYL  351

Query  1041  VLEL  1052
             VLEL
Sbjct  352   VLEL  355



>emb|CDP20015.1| unnamed protein product, partial [Coffea canephora]
Length=394

 Score = 92.8 bits (229),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 108/225 (48%), Gaps = 39/225 (17%)
 Frame = +3

Query  27   YKLSADSLMKMKLLGWMHRKLKHNCNEAVKNRTSFDP----------------SHPTYGF  158
            Y       M ++LLGWMHRKL  N  + + N T+ +P                + PTY F
Sbjct  13   YAQKISDYMFLQLLGWMHRKLNQNRADPMMNFTTGNPPNCYSARKPFDEKLYHAEPTYSF  72

Query  159  --SGNPNTTC-TYQKVIK------ETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstde  311
              SG P+  C  +   I+        +E   +E+FHGFL+IGTLG  S     L      
Sbjct  73   AQSGQPSRICGRFSNEIRGNGIEESFQEDSSDELFHGFLAIGTLGLES-----LNTEPPT  127

Query  312  pptptfptsfeetttQITDQDLKLITIELEKFLEAEEDA---QSSKRSSYASIITLTDKT  482
            P  P    +  +   +IT+ +LKLI  EL KFLEAE      +SS RSS ASIIT ++K 
Sbjct  128  PTFPKPFENMTDKEVKITEDELKLINNELAKFLEAEAKEVADESSARSSQASIITFSNK-  186

Query  483  QQDSSSSPTLL--LDCPLQKYFFGLS---ESDMAVKNEEEASLSE  602
            Q D + +  L     CPLQ Y FG S       AV  +E+ SL E
Sbjct  187  QHDETDAEDLADSTTCPLQTYLFGSSIELPEMAAVPKKEKTSLEE  231



>ref|XP_004310225.1| PREDICTED: uncharacterized protein LOC101307273 [Fragaria vesca 
subsp. vesca]
Length=389

 Score = 92.4 bits (228),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 119/404 (29%), Positives = 172/404 (43%), Gaps = 87/404 (22%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAV--KNRTSFDPSH----PTYG----------------FSGNP  170
             MKLLGWMHRK + N NE V    + S D         YG                F+G  
Sbjct  1     MKLLGWMHRKFRQNSNEPVFLIGQPSLDDQQYYGKANYGNKPFKQGQRDHQLRNSFAGLE  60

Query  171   NTTCTYQKVIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeet  350
             +     +   ++      +E+FHGFL+IGT G     +  +      P       +  E 
Sbjct  61    SAKVDQEDYFEDESYAAASELFHGFLAIGTFG-----SDQVITEPSTPTLGMSVENITEK  115

Query  351   ttQITDQDLKLITIELEKFLEAEEDAQ------------SSKRSSYASIITLTDKTQQDS  494
              T+ T+ +LKLI  ELEK L AE   +            S+ RSS+ S ITL+ K  +  
Sbjct  116   ETEATENELKLINDELEKVLVAEAKDEICNDSSGRNSHVSNGRSSHGSTITLSGKMLEVP  175

Query  495   SSSPTL-LLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGN--------  635
              S+ T     CPLQ Y FG    L E+    K E+  SL E  Q+  + + N        
Sbjct  176   ESNGTNGTTVCPLQGYLFGSAYELPETTTVAKKEQRTSLGELFQKSKLTEENYSGAKLSK  235

Query  636   DKKRAGKAQFAKNFmkkmlkslnsnskskTHMHAPNESAPPTknkfpkvlkmlk------  797
             ++KRA + +  K+    +        K   HM+A + S+           K+ K      
Sbjct  236   EEKRADQKEADKS---SIHLMKKKLMKKVLHMNASSRSSTAAGEPGSAETKLNKILQMFH  292

Query  798   kkvHPERYI-GEKGA--EKDENRVKGSRLRSSSDTTGNIWFRQMISPEEEELIMTTSQSC  968
             +KVHPE    GEK    +K EN+      R SSD   N   R  + P+++++++   Q  
Sbjct  293   RKVHPENSTAGEKSGKYQKSENKK-----RRSSDGISN--HRDQVFPDDQDIMLYPEQVS  345

Query  969   SGSGRGGAF-------------MENNG---HWIKTDADYLVLEL  1052
             S +     +             +++NG   HWIKTDADYLVLEL
Sbjct  346   SSNQIMRRYKSQSNPPQFALGALDSNGNKEHWIKTDADYLVLEL  389



>ref|XP_008450122.1| PREDICTED: uncharacterized protein LOC103491804 isoform X1 [Cucumis 
melo]
 ref|XP_008450123.1| PREDICTED: uncharacterized protein LOC103491804 isoform X1 [Cucumis 
melo]
 ref|XP_008450124.1| PREDICTED: uncharacterized protein LOC103491804 isoform X1 [Cucumis 
melo]
 ref|XP_008450125.1| PREDICTED: uncharacterized protein LOC103491804 isoform X1 [Cucumis 
melo]
 ref|XP_008450126.1| PREDICTED: uncharacterized protein LOC103491804 isoform X1 [Cucumis 
melo]
 ref|XP_008450127.1| PREDICTED: uncharacterized protein LOC103491804 isoform X1 [Cucumis 
melo]
 ref|XP_008450128.1| PREDICTED: uncharacterized protein LOC103491804 isoform X1 [Cucumis 
melo]
Length=386

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 118/393 (30%), Positives = 171/393 (44%), Gaps = 82/393 (21%)
 Frame = +3

Query  54    KMKLLGWMHRKLKHNCNEAVKNRTSFDPS----------------HPTYGFSGNPNTTCT  185
             KMKLLGWMH K   +  E+VK+ T  +P                  P +GF+   + +  
Sbjct  16    KMKLLGWMHNKFWQSGIESVKDFTIANPCMCLTLQTPVDDEDIYLKPGFGFTTMQSDSRN  75

Query  186   YQKVIKETEEKPL----------NEVFHGFLSIGTLGGGSEEAAALFNstdepptptfpt  335
             Y++     E   +          +++FHGFL+IGTLG  SE A   F+   E        
Sbjct  76    YEQSSLGVEANNVLEKSGDLSNSSDIFHGFLTIGTLG--SEPATPTFSLAFENMIELPD-  132

Query  336   sfeetttQITDQDLKLITIELEKFLEAE--EDA--QSSKRSSYASIITLTDKTQ---QDS  494
                    ++T+ D+KLI  ELEKFLEAE  ED   QS  R+S+ASIITL  K     +D 
Sbjct  133   -------EVTEDDIKLINYELEKFLEAETKEDRCDQSPGRTSHASIITLAGKHMEETEDE  185

Query  495   SSSPTLLLDCPLQKYFFG--LSESDMAVKNEEEASLSEDLQEVVVV-----KGNDKKRAG  653
             +   TL   CPLQ Y FG  +   D  +   +E   S +L +  +      K N +K+  
Sbjct  186   NDGKTLT--CPLQGYLFGSTIELPDKMIDMRKEKPSSPELFQGTIAENESFKLNIEKKEA  243

Query  654   KAQFAKNFmkkmlkslnsnskskTHMHAPNESAP--PTknkfpkvlkmlkkkvHPERYIG  827
               + +       +K +     + +H  +  +S     TK K  KVL+ L +K+HPE    
Sbjct  244   LVKHSNKSALSFVKKMLKKLCTSSHGSSTYDSGDSYSTKKKLQKVLRKLNRKIHPETSTA  303

Query  828   EKGAEKDENRV----------KGSRLRSSSDTTGNIWFRQMISPEEEELIMT--------  953
                 +K +  +           G  +    D  G  + ++ IS EE     T        
Sbjct  304   TDDCQKSQKYIFENVSFDNFNDGRVMNRVED--GITYCQEFISKEEMCYWKTNLGLPLYG  361

Query  954   TSQSCSGSGRGGAFMENNGHWIKTDADYLVLEL  1052
                + S + RG        HWIKTDA+YLVLEL
Sbjct  362   VDTNVSSANRG--------HWIKTDAEYLVLEL  386



>ref|XP_009771786.1| PREDICTED: uncharacterized protein LOC104222269 isoform X2 [Nicotiana 
sylvestris]
Length=354

 Score = 89.7 bits (221),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 97/198 (49%), Gaps = 37/198 (19%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN------RTSFDPS----------HPTYGFSGNPNTTCTY  188
            MKLLGWMHRK K N NE+ KN       TSF                Y F+ +    C  
Sbjct  1    MKLLGWMHRKAKQNSNESAKNIILENSATSFSAGTLFEEQEYYGEANYSFTISKQPAC--  58

Query  189  QKVIKETE-EKPLNEVFHGFLSIGTLGG---GSEEAAALFNstdepptptfptsfeettt  356
             K +K TE E  L ++FHGFLSIGTLG     S+     F      P         E   
Sbjct  59   -KEVKSTETEMALEKLFHGFLSIGTLGSQTIKSDPPTPTF------PMHLEHVIHGEVKL  111

Query  357  QITDQDLKLITIELEKFLEAEEDAQSSKRSSYASIITLTDKTQQ-DSSSSPTLL---LDC  524
             I + +LK I  ELEKF+EAE   +SS+RSS+ASIITL+   Q  +    P      +  
Sbjct  112  DIKENELKRINDELEKFVEAEVAHESSERSSHASIITLSGGKQLIEEVELPETYGNSVQF  171

Query  525  PLQKYFFG----LSESDM  566
            PLQKY FG    LSE+++
Sbjct  172  PLQKYLFGSSVELSETEV  189



>gb|KGN58162.1| hypothetical protein Csa_3G565330 [Cucumis sativus]
Length=369

 Score = 89.7 bits (221),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 119/391 (30%), Positives = 171/391 (44%), Gaps = 81/391 (21%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVKNRTSFDPS----------------HPTYGFSGNPNTTCTY  188
             MKLLGWMH K   +  E+VK+ T  +P                  P +GF+   + +  Y
Sbjct  1     MKLLGWMHNKFWQSGIESVKDFTIANPCMCLTLQKPVDDEDIYLKPGFGFTTVQSDSRNY  60

Query  189   QKVIKETEEKPL----------NEVFHGFLSIGTLGGGSEEAAALFNstdepptptfpts  338
             ++     E   +          +++FHGFL+IGTLG  SE A   F+   E         
Sbjct  61    EQSSLGVEANNVLEKCGDLSNSSDIFHGFLTIGTLG--SEPATPTFSLAFENMIELPD--  116

Query  339   feetttQITDQDLKLITIELEKFLEAE--EDA--QSSKRSSYASIITLTDKTQQDSSSSP  506
                   ++T+ DLKLI  ELEKFLEAE  ED   QS  R+S+ASIITL  K  +++    
Sbjct  117   ------EVTEDDLKLINYELEKFLEAETKEDRCDQSPGRTSHASIITLAGKHMEETKDEN  170

Query  507   TLLLDCPLQKYFFGLS---ESDMAVKNEEEASLSEDLQEVVV----VKGNDKKRAGKAQF  665
                  CPLQ Y FG +      M    +E  S  E  Q+ +      K N +K+    + 
Sbjct  171   DGKTTCPLQGYLFGSTIELPDKMIDMRKETPSSPELFQDTIAENESFKLNIEKKKALVKH  230

Query  666   AKNFmkkmlkslnsnskskTHMHAPNES--APPTknkfpkvlkmlkkkvHPE--------  815
             +       +K +     + +H  +  +S  +  TK K  KVL+ L +K+HPE        
Sbjct  231   SNKSALTFVKKMLKKLCTSSHGSSTYDSGDSHSTKKKLQKVLRKLNRKIHPETSTAMDEC  290

Query  816   ----RYIGEKGAEKDENRVKGSRLRSSSDTTGNIWFRQMISPEEEELIMT--------TS  959
                 +YI E  +  + N    S +    D  G  + ++ IS EE     T          
Sbjct  291   QKSQKYIFENVSFDNFNN--DSVMNRVED--GITYCQEFISKEEMCYWKTNLGLPLYGID  346

Query  960   QSCSGSGRGGAFMENNGHWIKTDADYLVLEL  1052
              + S + RG        HWIKTDA+YLVLEL
Sbjct  347   TNVSSANRG--------HWIKTDAEYLVLEL  369



>ref|XP_008450129.1| PREDICTED: uncharacterized protein LOC103491804 isoform X2 [Cucumis 
melo]
 ref|XP_008450130.1| PREDICTED: uncharacterized protein LOC103491804 isoform X2 [Cucumis 
melo]
 ref|XP_008450131.1| PREDICTED: uncharacterized protein LOC103491804 isoform X2 [Cucumis 
melo]
Length=370

 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 117/392 (30%), Positives = 170/392 (43%), Gaps = 82/392 (21%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVKNRTSFDPS----------------HPTYGFSGNPNTTCTY  188
             MKLLGWMH K   +  E+VK+ T  +P                  P +GF+   + +  Y
Sbjct  1     MKLLGWMHNKFWQSGIESVKDFTIANPCMCLTLQTPVDDEDIYLKPGFGFTTMQSDSRNY  60

Query  189   QKVIKETEEKPL----------NEVFHGFLSIGTLGGGSEEAAALFNstdepptptfpts  338
             ++     E   +          +++FHGFL+IGTLG  SE A   F+   E         
Sbjct  61    EQSSLGVEANNVLEKSGDLSNSSDIFHGFLTIGTLG--SEPATPTFSLAFENMIELPD--  116

Query  339   feetttQITDQDLKLITIELEKFLEAE--EDA--QSSKRSSYASIITLTDKTQ---QDSS  497
                   ++T+ D+KLI  ELEKFLEAE  ED   QS  R+S+ASIITL  K     +D +
Sbjct  117   ------EVTEDDIKLINYELEKFLEAETKEDRCDQSPGRTSHASIITLAGKHMEETEDEN  170

Query  498   SSPTLLLDCPLQKYFFG--LSESDMAVKNEEEASLSEDLQEVVVV-----KGNDKKRAGK  656
                TL   CPLQ Y FG  +   D  +   +E   S +L +  +      K N +K+   
Sbjct  171   DGKTLT--CPLQGYLFGSTIELPDKMIDMRKEKPSSPELFQGTIAENESFKLNIEKKEAL  228

Query  657   AQFAKNFmkkmlkslnsnskskTHMHAPNESAP--PTknkfpkvlkmlkkkvHPERYIGE  830
              + +       +K +     + +H  +  +S     TK K  KVL+ L +K+HPE     
Sbjct  229   VKHSNKSALSFVKKMLKKLCTSSHGSSTYDSGDSYSTKKKLQKVLRKLNRKIHPETSTAT  288

Query  831   KGAEKDENRV----------KGSRLRSSSDTTGNIWFRQMISPEEEELIMT--------T  956
                +K +  +           G  +    D  G  + ++ IS EE     T         
Sbjct  289   DDCQKSQKYIFENVSFDNFNDGRVMNRVED--GITYCQEFISKEEMCYWKTNLGLPLYGV  346

Query  957   SQSCSGSGRGGAFMENNGHWIKTDADYLVLEL  1052
               + S + RG        HWIKTDA+YLVLEL
Sbjct  347   DTNVSSANRG--------HWIKTDAEYLVLEL  370



>ref|XP_009771785.1| PREDICTED: uncharacterized protein LOC104222269 isoform X1 [Nicotiana 
sylvestris]
Length=355

 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 97/198 (49%), Gaps = 37/198 (19%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN------RTSFDPS----------HPTYGFSGNPNTTCTY  188
            ++LLGWMHRK K N NE+ KN       TSF                Y F+ +    C  
Sbjct  2    LQLLGWMHRKAKQNSNESAKNIILENSATSFSAGTLFEEQEYYGEANYSFTISKQPAC--  59

Query  189  QKVIKETE-EKPLNEVFHGFLSIGTLGG---GSEEAAALFNstdepptptfptsfeettt  356
             K +K TE E  L ++FHGFLSIGTLG     S+     F      P         E   
Sbjct  60   -KEVKSTETEMALEKLFHGFLSIGTLGSQTIKSDPPTPTF------PMHLEHVIHGEVKL  112

Query  357  QITDQDLKLITIELEKFLEAEEDAQSSKRSSYASIITLTDKTQQ-DSSSSPTLL---LDC  524
             I + +LK I  ELEKF+EAE   +SS+RSS+ASIITL+   Q  +    P      +  
Sbjct  113  DIKENELKRINDELEKFVEAEVAHESSERSSHASIITLSGGKQLIEEVELPETYGNSVQF  172

Query  525  PLQKYFFG----LSESDM  566
            PLQKY FG    LSE+++
Sbjct  173  PLQKYLFGSSVELSETEV  190



>ref|XP_002512909.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49412.1| conserved hypothetical protein [Ricinus communis]
Length=364

 Score = 86.3 bits (212),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 118/380 (31%), Positives = 178/380 (47%), Gaps = 64/380 (17%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVKN-----------------------RTSFDPSHPTYGFSGN  167
             M++LGWMH KL+H   E  K+                       R  FD  +  Y    N
Sbjct  1     MRILGWMHNKLRHTSIEPFKDFTIGTYCACLSATTSRDEKISHTRPRFDSRYEKYE---N  57

Query  168   PNTTCTYQKVIKETEEKP---LNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfpts  338
               +    ++V +  E++    + E FHGFL+IGTLG     + A+      P  P    +
Sbjct  58    TLSEVEAKRVEENYEDETSAVMYEPFHGFLAIGTLGSKQITSEAV-----TPTLPVSFEN  112

Query  339   feetttQITDQDLKLITIELEKFLEAEEDA----QSSKRSSYASIITLTD-KTQQDSSSS  503
              E+  T++T+ +LKL+  ELEKFLEAE +     +S  RSSY S ITL+  +T++ S+  
Sbjct  113   IEDEKTEVTENELKLLNDELEKFLEAEAEEEGCNESLARSSYVSTITLSGIQTEEASAED  172

Query  504   PTLLLDCPLQKYFFGLSESDMAVKNE---EEASLSE-----DLQEVVVVKGNDK-----K  644
               +   CPLQ Y FG S     ++ E   E+ASL+E      + E + ++  +K     K
Sbjct  173   NGITAFCPLQGYLFGSSIDLPELRVESKKEKASLAEMFHRTKITEEISLEVEEKGEMHAK  232

Query  645   RAGKA--QFAKNFmkkmlkslnsnskskTHMHAPNESAPPTknkfpkvlkmlkkkvHPER  818
             +A K      K  ++K   S  +   S +H     +++  TK +  KVL+M  +KVHPE 
Sbjct  233   QAHKPVRHLIKKILQKFYASSKNPILSSSH---DADTSVSTKKRLNKVLRMFHRKVHPEN  289

Query  819   YIGEKGAEKDENRVKGSRLRSSSDTT--GNIWFRQMISPEEEELIMTTSQSCSGSGRGGA  992
              I EK   +   ++K + L  + D         R +   +  E +     + SGS     
Sbjct  290   PIAEKVFAESNAKIKKN-LHHNVDMVYQDQDSIRFLPGSKSMERVRCYKNNLSGSNSS--  346

Query  993   FMENNGHWIKTDADYLVLEL  1052
                N  +WIKTDADYLVLEL
Sbjct  347   --RNREYWIKTDADYLVLEL  364



>ref|XP_010656172.1| PREDICTED: uncharacterized protein LOC100266157 isoform X1 [Vitis 
vinifera]
 emb|CBI27683.3| unnamed protein product [Vitis vinifera]
Length=381

 Score = 85.9 bits (211),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 103/221 (47%), Gaps = 41/221 (19%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN----RTSFDPS--HP--TYG--------------FSGNP  170
            MKLLGWMHRK + N +E +K+    + S D    +P   YG              F+G  
Sbjct  1    MKLLGWMHRKFRQNSSEPLKDFAIGQRSLDDQQYYPKSNYGTKPLRQRDYYLRKSFAGLE  60

Query  171  NTTCTYQKVIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeet  350
                  +   +E     ++E+FHGFL+IGTLG     +  + N    P       +  E 
Sbjct  61   AAREEEEDDFEEESSAAISELFHGFLAIGTLG-----SDPVVNDPSTPTFAISVENITEK  115

Query  351  ttQITDQDLKLITIELEKFL--EAEEDAQSS--------KRSSYASIITLTDKTQQDSSS  500
             T++T+ +LKLI  ELEK L  EA+ED  SS         RSS+ S ITL+ K  + + S
Sbjct  116  ETEVTENELKLINDELEKVLGAEAKEDGYSSGRNSHVSTGRSSHGSTITLSGKPMEGTES  175

Query  501  SPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQ  611
            +      CPLQ Y FG    L E+    K E   SL E  Q
Sbjct  176  NGNGTTVCPLQGYLFGSAIELPETTTVAKKEHRTSLGELFQ  216



>ref|XP_011099004.1| PREDICTED: uncharacterized protein LOC105177516 [Sesamum indicum]
Length=399

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 124/379 (33%), Positives = 174/379 (46%), Gaps = 70/379 (18%)
 Frame = +3

Query  60    KLLGWMHRKLKHNCNEAVKN------------RTSFDPSH----PTYGFS----GNPNTT  179
             K LGWMHRKL  N  E +KN            +T FD  +    PT         +P ++
Sbjct  41    KFLGWMHRKLMQNSTEPMKNSKTGAHSACLSVQTLFDDQNYHVEPTSNLPHSNINSPKSS  100

Query  180   CTYQK-----VIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfe  344
               ++      + +E   +P +     FL+IGT G        L N+    PT   P    
Sbjct  101   HRFKANMVEVLFQEESFEPFD-----FLAIGTFG------RELLNTDPPTPTLPMPNEAL  149

Query  345   etttQITDQDLKLITIELEKFLEAEEDAQS---SKRSSYASIITLTDKTQQDSSSSPTLL  515
                 +IT+ DL+LI  ELEKFLEAEE   +   S R S ASIITL+ K    +     + 
Sbjct  150   TDQQEITEYDLQLINYELEKFLEAEEKEIANDISGRDSEASIITLSSKPIMGAHPEGHMY  209

Query  516   L-DCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGN---------DKKRAG  653
             +  CPLQ Y F     L+E++  VK +E+ SL E  +   +V  +           ++  
Sbjct  210   MAACPLQNYLFATCIELAETNKEVK-KEKTSLEELFKRNNIVHDDPIGKCEGAEQPRKRN  268

Query  654   KAQFAKNFmkkmlkslnsnskskTHMHAPNESAPPTknkfpkvlkmlkkkvHPERYIG--  827
              A+F K  +KK   S +S++ S  +  A + S    K K  K LKM +KKVHPE      
Sbjct  269   AARFLKKVLKKFHSSSSSSTVSFKNDAAVSIS---IKKKLSKALKMFQKKVHPEEMTEKQ  325

Query  828   ----EKGAEKDENRVKGSRLRSSSDTTGNIWFRQMISPEEEELIMTTSQSCSGSGRGGAF  995
                 +KG +KD +   G ++  +     N    Q  S + E+ IM   + CS S    A 
Sbjct  326   IAKLQKGYKKDFSDEDGRQIGHNE----NKMVHQAASKKSEKNIM---KLCSNSTCKDAS  378

Query  996   MENNGHWIKTDADYLVLEL  1052
                 GHWIKTD+DYLVLEL
Sbjct  379   TTTGGHWIKTDSDYLVLEL  397



>ref|XP_010656174.1| PREDICTED: uncharacterized protein LOC100266157 isoform X2 [Vitis 
vinifera]
Length=381

 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 75/221 (34%), Positives = 103/221 (47%), Gaps = 41/221 (19%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN----RTSFDPS--HP--TYG--------------FSGNP  170
            M+LLGWMHRK + N +E +K+    + S D    +P   YG              F+G  
Sbjct  1    MQLLGWMHRKFRQNSSEPLKDFAIGQRSLDDQQYYPKSNYGTKPLRQRDYYLRKSFAGLE  60

Query  171  NTTCTYQKVIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeet  350
                  +   +E     ++E+FHGFL+IGTLG     +  + N    P       +  E 
Sbjct  61   AAREEEEDDFEEESSAAISELFHGFLAIGTLG-----SDPVVNDPSTPTFAISVENITEK  115

Query  351  ttQITDQDLKLITIELEKFL--EAEEDAQSSKR--------SSYASIITLTDKTQQDSSS  500
             T++T+ +LKLI  ELEK L  EA+ED  SS R        SS+ S ITL+ K  + + S
Sbjct  116  ETEVTENELKLINDELEKVLGAEAKEDGYSSGRNSHVSTGRSSHGSTITLSGKPMEGTES  175

Query  501  SPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQ  611
            +      CPLQ Y FG    L E+    K E   SL E  Q
Sbjct  176  NGNGTTVCPLQGYLFGSAIELPETTTVAKKEHRTSLGELFQ  216



>ref|XP_009591285.1| PREDICTED: uncharacterized protein LOC104088330 [Nicotiana tomentosiformis]
Length=381

 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 109/396 (28%), Positives = 165/396 (42%), Gaps = 79/396 (20%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNP--NTTCTYQKV-----------  197
             MKLLGWMHRK + N +E +K+   F   +P    +G P  +    YQK            
Sbjct  1     MKLLGWMHRKFRQNSSEPLKD---FSVGNPCTCLTGQPSLDDLQGYQKPNFYNKPLSKGQ  57

Query  198   ---------------------IKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdep  314
                                  ++E     L+E+FHGFL+IGTLG        L +    P
Sbjct  58    RDNHRRKSFAGLEAAARADEDLEEESSAALSELFHGFLAIGTLG-----TDPLLDDPSTP  112

Query  315   ptptfptsfeetttQITDQDLKLITIELEKFL--EAEEDA----------QSSKRSSYAS  458
                    +  E  T++T+ +LKLI  ELEK L  EA++DA           S+ RSS+ S
Sbjct  113   TFSISVENIAEKDTEVTENELKLINDELEKVLGIEAKDDACNLSSGRNSYVSTGRSSHGS  172

Query  459   IITLTDKTQQDSSSSPTLLLDCPLQKYFF----GLSESDMA--VKNEEEASLSEDLQEVV  620
              ITL+ K  + + ++      CPLQ Y F    GL E+  A   K E   SL E  Q+  
Sbjct  173   TITLSGKPFESTENNGNGTTVCPLQGYLFGSTVGLPETSPAASAKKEHRPSLGELFQKTK  232

Query  621   VVKGNDKKRAGKAQFAKNFmkkmlkslnsnskskTHMHAPNESAPPTknkfpkvlkmlkk  800
             + + N   ++ + +   +    +        K   H  + N  A           + L K
Sbjct  233   LAEENYGAKSDRGEKRTDDKSAVNLMKKILKKKMLHASSRNSVASGGTVDSVSAERKLNK  292

Query  801   kvHP-ERYIGEKGAEKDENRVKGSRLRSSSDTTGNIWFRQMISPEEEELIMTTSQSCS-G  974
              +H   R +  + +   +   K S+   + D       R  +S   E++ +      S  
Sbjct  293   ILHMFHRKVHPESSTAAQKSDKSSKNERAHD-------RGRLSLAREDITIIPHHRLSKD  345

Query  975   SGRGGAFME-------NNGH---WIKTDADYLVLEL  1052
             S +G + M+       +NG+   WIKTDA+YLVLEL
Sbjct  346   SIKGQSNMQQFTLDGDSNGNRECWIKTDAEYLVLEL  381



>ref|XP_006447030.1| hypothetical protein CICLE_v10018081mg [Citrus clementina]
 gb|ESR60270.1| hypothetical protein CICLE_v10018081mg [Citrus clementina]
Length=380

 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 126/397 (32%), Positives = 183/397 (46%), Gaps = 85/397 (21%)
 Frame = +3

Query  60    KLLGWMHRKLKHNCNEAVKNRT-----------------SFDPSHPT----YGFSGNPNT  176
             ++LGW H++ + N  E  K+ T                  +D S P     YG   + ++
Sbjct  3     QILGWKHQRKRQNSVEPFKDFTLGNYCICLSAQSTLDYQDYD-SKPNFGSRYGSKSSKHS  61

Query  177   TCTYQKVIKETEEKP------------LNEVFHGFLSIGTLGG---GSEEAAALFNstde  311
                Y+    E E +             ++E FHGFL+IGTLG     SE A   F     
Sbjct  62    RREYENSTSELEAEEAKESFNEETSAVISEPFHGFLTIGTLGMEPISSEPATPTF-----  116

Query  312   pptptfptsfeetttQITDQDLKLITIELEKFL----EAEEDAQSSKRSSYASIITLTDK  479
                     +  +  T++T+ DLKLI  +LEKFL    E EE+ ++S R+SY SI+TL D 
Sbjct  117   ---AISGENIIDEKTEVTEYDLKLINDQLEKFLEAEAEEEENIETSGRNSYVSIVTLCDN  173

Query  480   TQQDSSSSPT-LLLDCPLQKYFFGLS----ESDMAVKNEEEASLSEDLQEVVVVKGNDKK  644
               + ++S     ++ CPLQ Y FG S    E+ + VK +E+ASL E          +  +
Sbjct  174   PMEGANSEDYGKMMVCPLQGYLFGSSIEFPETIIEVK-KEKASLMELFHRRETTDKSSME  232

Query  645   RAGKAQF--------AKNFmkkmlkslnsnskskTHMHAPNESAPP---Tknkfpkvlkm  791
             ++ K +          KN +KKM K   ++SKS T    P++S      TK K  KV++M
Sbjct  233   KSSKVEMPAKQKHKSVKNLIKKMFKKFRASSKSPT----PSDSDTAFVSTKKKLHKVIQM  288

Query  792   lkkkvHPERYIGEKGAEKDENRVKGSRLRSSSDTTGNIWFRQMISP---EEEELI-----  947
               +K+HPE+ I EK  +   N++K S       T G +      SP   E ++ I     
Sbjct  289   FHRKIHPEKSIAEKELKSRTNKIKSSPYE-GVHTDGGLDNDNKSSPPGCESKDQIEYHKI  347

Query  948   --MTTSQSCSGSGRGGAFMENNGHWIKTDADYLVLEL  1052
               M +     GS   G    N  HWIKTDADYLVLEL
Sbjct  348   EKMLSQYGLRGSTSSG----NREHWIKTDADYLVLEL  380



>gb|KDP41789.1| hypothetical protein JCGZ_26807 [Jatropha curcas]
Length=364

 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 115/392 (29%), Positives = 159/392 (41%), Gaps = 94/392 (24%)
 Frame = +3

Query  75    MHRKLKHNCNEAVKNRT----------------SFDPSHPTYGFSGNPNTTCTYQKVIKE  206
             MH KL+H   E  K+ T                   P  P +G         +Y+     
Sbjct  1     MHNKLRHTSIEPFKDFTIENYCACLSAKSLPDDKVSPKRPRFGSRYEKCENTSYKAEATR  60

Query  207   TEEK------PLNEVFHGFLSIGTLGG---GSEEAAALFNstdepptptfptsfeetttQ  359
              +E       P++E++HGFL+IGTLG     SE A A F+ + E               +
Sbjct  61    ADENNDETSIPMSELYHGFLAIGTLGSKPVNSESAPATFHMSLENIADEKT--------E  112

Query  360   ITDQDLKLITIELEKFLEAEEDA----QSSKRSSYASIITLT----DKTQQDSSSSPTLL  515
             +T  DLKLI  ELEKFL+AE +     +S  RSSY S ITL     + T  D +    + 
Sbjct  113   VTQNDLKLINDELEKFLDAEAEEEGCNESLARSSYVSTITLNGMQMEGTDTDGNEKTAI-  171

Query  516   LDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGNDKKRAGKAQFAKNFmk  683
               CPLQ Y F     L E+ + +K +E+ SL E  ++  +      +  GK +   +  +
Sbjct  172   --CPLQGYLFRSSIELPETRVELK-KEKTSLGEMFRKTKITDEISAETEGKGK--THTRE  226

Query  684   kmlkslnsnskskTHMHAPNESAP----------PTknkfpkvlkmlkkkvHPERYIGEK  833
                 + +   K     HA     P          PTK K  KVL+ML +KVHPE    EK
Sbjct  227   AHKSAKHLIKKILRKFHASRNPVPPSSEGASNSVPTKKKLNKVLRMLHRKVHPENPTAEK  286

Query  834   G-------------------AEKDENRVKGSRLRSSSDTTGNIWFRQMISPEEEELIMTT  956
                                   +DE+  K   L       G  W++  +   +  L    
Sbjct  287   EFTTSRKEKIKMDLHHKADLVHQDEDNRKF--LPGFKSVEGIKWYKNNLKLSQYAL----  340

Query  957   SQSCSGSGRGGAFMENNGHWIKTDADYLVLEL  1052
                C+ SG       N  HWIKTDADYLVLEL
Sbjct  341   -GGCNSSG-------NREHWIKTDADYLVLEL  364



>ref|XP_010556118.1| PREDICTED: uncharacterized protein LOC104825488 [Tarenaya hassleriana]
Length=385

 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 127/400 (32%), Positives = 179/400 (45%), Gaps = 83/400 (21%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVKN--------RTSFDPSH--------PTYG---FSGNP---  170
             MKLLGWMHRK + N NE +K+          S  P H        P YG   +  NP   
Sbjct  1     MKLLGWMHRKFRQNSNEPLKDFVMENVGTHMSGQPPHHQQYCYAKPIYGTKFYEQNPAYF  60

Query  171   -------NTTCTYQKVIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptf  329
                     TT   ++  ++ E   ++E+F GFL+IGTLG     +A            + 
Sbjct  61    RKSFTGIETTQVEEEDHEDEESPAISEIFDGFLAIGTLGSDPNISAP-----------ST  109

Query  330   ptsfeetttQITDQDLKLITIELEKFLEAEE-----DAQSSK-------RSSYASIITLT  473
             PT       ++T+++LKL+   LEK L AE      DA S++       RSS  S ITL+
Sbjct  110   PTFTISLENEVTEKELKLLNDNLEKILGAEVKEDICDASSARNSHVSAGRSSQGSTITLS  169

Query  474   DKTQQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVK----  629
              KT +   ++      CPLQ Y FG    +SE+   VK E   SL E  Q+  +      
Sbjct  170   GKTLEIPEANHNGSNVCPLQGYLFGSAIEMSET-TTVKKEHRTSLRELFQKTKITDEYGG  228

Query  630   ---GNDKKRAGK--AQFAKNFmkkmlksln-snskskTHMHAPNESAPPTknkfpkvlkm  791
                  D+KR  K   + A N MK+MLK      S+S T  +    ++ P + K  K+L +
Sbjct  229   GRCERDEKRTEKDADKSAVNMMKRMLKKRVPHLSRSSTAAYGRPANSSPAETKLNKILHI  288

Query  792   lkkkvHPERYIGEKGAEKDENRVKGSRLRSSSDTTGNIWFRQMISPEEEELIMTT-----  956
               +KVHPE     K   K     K  R   SSD   N   R    P+ E + ++      
Sbjct  289   FHRKVHPESSTSSKTHMKLPKEKKKHR-SISSDGASNYQCRTF--PKGETMALSQGVIPH  345

Query  957   --SQSCSGSGRGGAFM---ENNGH---WIKTDADYLVLEL  1052
               +++C  S     F    ++NG+   WIK+DADYLVLEL
Sbjct  346   KGTRNCYKSQFNPQFALKSDSNGNREFWIKSDADYLVLEL  385



>gb|KHG01154.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=365

 Score = 83.2 bits (204),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 122/379 (32%), Positives = 180/379 (47%), Gaps = 61/379 (16%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVK-----NRTSFDPSHPTYGFS-----GNPNTTCTYQKV---  197
             MKLLGWM  KL+ +  E  K     N  +   +H + G +     G+  +T + Q++   
Sbjct  1     MKLLGWMQHKLRPSNIEPFKDFTIGNYCTCLLAHSSLGDNQRYEYGSRYSTLSQQEMENS  60

Query  198   IKETEEK------------PLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsf  341
             I E + K             ++E+F GFL+IGTLG     +  + +  + P       + 
Sbjct  61    ITEFQGKGGEDNFGDETSNVISELFQGFLTIGTLG-----SQQIMSEPETPTFKVSLDNI  115

Query  342   eetttQITDQDLKLITIELEKFLEAEEDA----QSSKRSSYASIITLTDKTQQDSSS---  500
              E  T++T+ DLKLI  EL +FLEAE +     +SS R+S  S ITL+ K  Q ++S   
Sbjct  116   TEDETEVTENDLKLINDELGRFLEAEAEEHGSNESSGRNSQVSTITLSGKAIQAAASVEE  175

Query  501   -SPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVK---GNDKKRAGK  656
                T+L  CPLQ Y FG    L E    VK +E+ASL+E      V +    N  +++GK
Sbjct  176   CGKTIL--CPLQGYLFGSSVELPEPRFEVK-KEKASLAELFYRTKVAEEYNNNPMEKSGK  232

Query  657   AQFAKNFmkkmlkslnsnskskTHMHAPNE--SAPPTknkfpkvlkmlkkkvHPERYIGE  830
                      K +K L      K H  +  E  ++  TK K  KV+K+  +K+HPE  I E
Sbjct  233   EDTQTKQTTKPVKHLIKKILKKFHASSGKEETNSFSTKKKLQKVIKLFHRKIHPENSIAE  292

Query  831   KGAEKDENRVKGSRLRSSSDTTGNIWFRQMISPEEEELIMTTSQSCSGSGRGG-----AF  995
             +     E+++  +   S +D TG    R       +  +    ++ S   + G     A 
Sbjct  293   R-----ESKMNNAPY-SDNDYTGGDNMRFPQGSRSKAGLGNNKKTISKLPQYGLTGCTAA  346

Query  996   MENNGHWIKTDADYLVLEL  1052
              EN  HWIKTDADYLVLEL
Sbjct  347   TENGEHWIKTDADYLVLEL  365



>emb|CAN72196.1| hypothetical protein VITISV_014980 [Vitis vinifera]
Length=458

 Score = 83.6 bits (205),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 75/221 (34%), Positives = 103/221 (47%), Gaps = 41/221 (19%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN----RTSFDPS--HP--TYG--------------FSGNP  170
            M+LLGWMHRK + N +E +K+    + S D    +P   YG              F+G  
Sbjct  67   MQLLGWMHRKFRQNSSEPLKDFAIGQRSLDDQQYYPKSNYGTKPLRQRDYYLRKSFAGLE  126

Query  171  NTTCTYQKVIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeet  350
                  +   +E     ++E+FHGFL+IGTLG     +  + N    P       +  E 
Sbjct  127  AAREEEEDDFEEESSAAISELFHGFLAIGTLG-----SDPVVNDPSTPTFAISVENITEK  181

Query  351  ttQITDQDLKLITIELEKFL--EAEEDAQSSKR--------SSYASIITLTDKTQQDSSS  500
             T++T+ +LKLI  ELEK L  EA+ED  SS R        SS+ S ITL+ K  + + S
Sbjct  182  ETEVTENELKLINDELEKVLGAEAKEDGYSSGRNSHVSTGRSSHGSTITLSGKPMEGTES  241

Query  501  SPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQ  611
            +      CPLQ Y FG    L E+    K E   SL E  Q
Sbjct  242  NGNGTTVCPLQGYLFGSAIELPETTTVAKKEHRTSLGELFQ  282



>emb|CBI21326.3| unnamed protein product [Vitis vinifera]
Length=453

 Score = 83.6 bits (205),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 104/232 (45%), Gaps = 54/232 (23%)
 Frame = +3

Query  54   KMKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGN---------PNTTCTY------  188
            KMKLL WMH KL+ N  E  K+   F   +     SG          P  TC +      
Sbjct  98   KMKLLRWMHHKLRQNSIEPFKD---FKIGNSCSCLSGQQWLDDQPYYPTPTCGFRHFKQP  154

Query  189  ----QKVIKETEEKPLNE------------VFHGFLSIGTLGGGSEEAAALFNstdeppt  320
                QK I E E K + E            +FHGFL+IGTLG  +E +   F  + E  T
Sbjct  155  QKECQKKISECEAKRVEEDYEEESSNVVSDLFHGFLAIGTLGS-NEPSTPTFGVSSENMT  213

Query  321  ptfptsfeetttQITDQDLKLITIELEKFLEAEE----DAQSSKRSSYASIITLTDKTQQ  488
                        ++T+ DLKLI  ELEKFLEAE       +S  R+S+ SIITL  K  +
Sbjct  214  EKET--------EVTEIDLKLINDELEKFLEAEAKDEGSIESPGRNSHVSIITLCGKQME  265

Query  489  --DSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVV  626
              D   S  +++ CPLQ Y FG    L E+      + +ASL E  Q   + 
Sbjct  266  AADVEESGKMIV-CPLQGYLFGSSIELPETRSTEVKKGKASLGELFQRTKIA  316



>gb|AFK45721.1| unknown [Medicago truncatula]
 gb|AES78382.2| WRKY transcription factor-like protein [Medicago truncatula]
Length=342

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 111/368 (30%), Positives = 162/368 (44%), Gaps = 62/368 (17%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVKNRTSFDP----------SHPTYGFSGNPNTTCTYQKVIKE  206
             MKL  W+HRKL+ N N+  K+    +P          S     FS   N  C  +   +E
Sbjct  1     MKLFQWVHRKLRQNDNDTFKDVKLGNPCACLTLDSQYSQTKQSFSS-INQLCFVKSHHQE  59

Query  207   TE---------EKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQ  359
             ++            ++E+F GFL+IGTLG     A A+ N    P   T   +       
Sbjct  60    SQTSWRREEETSAVVSELFEGFLTIGTLG-----AEAVINEPATPTFATPSENIPMKDAD  114

Query  360   ITDQDLKLITIELEKFLEAEEDA--QSSKRSSYASIITL------TDKTQQDSSSSPTLL  515
             +T+ +LKLI+ ELEKFLE EE++  +SS R+S  S+  +      TD ++ +   +  + 
Sbjct  115   VTENELKLISYELEKFLETEEESFNESSGRNSRLSLSNIKISGKQTDGSEDEDCGNKDV-  173

Query  516   LDCPLQKYFFGLS-ESDMAVK-NEEEASLSEDLQ------EVVVVKGNDKKRAGKAQFAK  671
               CPLQ Y  G S E    V+  +E ASL+E  Q      E  +  G    +  +A  + 
Sbjct  174   --CPLQGYLLGSSFEIPEKVQVRKERASLAELFQRTKTANEDCIETGVKDTQVKQAHKSP  231

Query  672   NFmkkmlkslnsnskskTHMHAPNESAPPTknkfpkvlkmlkkkvHPERYIGEKGAEKDE  851
               + K +  +   S    +       +  T  K  KVL+   +KVHPE  +  K   K  
Sbjct  232   MHIMKKMLKMVHISSKSCNTSENIADSTTTNKKLSKVLRKFHRKVHPEDTLNAKSVTKSH  291

Query  852   NRVKGSRLRSSSDTTGNI-WFRQMISPEEEELIMTTSQSCSGSGRGGAFMENNGHWIKTD  1028
                  +  R   D    I W     +P +++L       CSGS        NN HWIKTD
Sbjct  292   KDKIKNLPRECFDEHCEINW-----NPPQDDLC------CSGSTG------NNEHWIKTD  334

Query  1029  ADYLVLEL  1052
             A+YLVLEL
Sbjct  335   AEYLVLEL  342



>ref|XP_010090655.1| hypothetical protein L484_017461 [Morus notabilis]
 gb|EXB40319.1| hypothetical protein L484_017461 [Morus notabilis]
Length=445

 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 79/242 (33%), Positives = 108/242 (45%), Gaps = 64/242 (26%)
 Frame = +3

Query  63   LLGWMHRKLKHNCNEAVK----NRTSFDP----SHPTYGFSGNPNTTCTYQKVIK-----  203
            LL WMHRK + N NEA+K     ++S D     + P YG     NTT   ++V +     
Sbjct  40   LLCWMHRKFRQNTNEALKALVIGQSSIDDQQYFTKPNYG-----NTTRPLKQVQRDNYNN  94

Query  204  --------------------ETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptp  323
                                E     ++++FHGFL+IGTL  GS +   + +    P   
Sbjct  95   NNNLRKSFNGLEDQEDYEDHEESSDAISDLFHGFLAIGTL--GSNDQINITDHPATPTFS  152

Query  324  tfptsfeetttQITDQDLKLITIELEKFLEAE-------------EDAQSSKRSSYASII  464
                +  E  T++T+ +LKLI  ELEK L AE                 S+ RSS+ SII
Sbjct  153  ISVENITEKETEVTENELKLINDELEKVLSAEAPDDGFNEYSSGRNSHVSNGRSSHGSII  212

Query  465  TLTDKTQQDSSSSPTLLLDCPLQKYFFG----LSESDMAV---KNEEEASLSEDLQEVVV  623
            TL+ K  QD +++      CPLQ Y FG    LSE+   V   K E   SL E  Q   V
Sbjct  213  TLSGKADQDGNTTAV----CPLQGYLFGSAIELSETTTTVVQAKKEHRTSLGELFQRSKV  268

Query  624  VK  629
            V+
Sbjct  269  VE  270



>ref|XP_010660738.1| PREDICTED: uncharacterized protein LOC104881647 isoform X2 [Vitis 
vinifera]
Length=356

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 103/230 (45%), Gaps = 54/230 (23%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGN---------PNTTCTY-------  188
            MKLL WMH KL+ N  E  K+   F   +     SG          P  TC +       
Sbjct  1    MKLLRWMHHKLRQNSIEPFKD---FKIGNSCSCLSGQQWLDDQPYYPTPTCGFRHFKQPQ  57

Query  189  ---QKVIKETEEKPLNE------------VFHGFLSIGTLGGGSEEAAALFNstdepptp  323
               QK I E E K + E            +FHGFL+IGTLG  +E +   F  + E  T 
Sbjct  58   KECQKKISECEAKRVEEDYEEESSNVVSDLFHGFLAIGTLGS-NEPSTPTFGVSSENMTE  116

Query  324  tfptsfeetttQITDQDLKLITIELEKFLEAEE----DAQSSKRSSYASIITLTDKTQQ-  488
                       ++T+ DLKLI  ELEKFLEAE       +S  R+S+ SIITL  K  + 
Sbjct  117  KET--------EVTEIDLKLINDELEKFLEAEAKDEGSIESPGRNSHVSIITLCGKQMEA  168

Query  489  -DSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVV  623
             D   S  +++ CPLQ Y FG    L E+      + +ASL E  Q   +
Sbjct  169  ADVEESGKMIV-CPLQGYLFGSSIELPETRSTEVKKGKASLGELFQRTKI  217



>gb|KCW61917.1| hypothetical protein EUGRSUZ_H04615, partial [Eucalyptus grandis]
Length=380

 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 107/229 (47%), Gaps = 47/229 (21%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN--RTSFDPSHPTYGFS-----GNPNTTCTYQKVIKET--  209
            MKLLGWMHRKL+ N +E +K+   T+  P      FS     G  +   + ++V++++  
Sbjct  1    MKLLGWMHRKLRQNGHEPLKDFGATAGQPCLDDQKFSQRRSCGAEHLKQSQREVLRKSFA  60

Query  210  -------------EEKPL----NEVFHGFLSIGTLGGGSEEAAALFNstdepptptfpts  338
                         +E+PL     ++FHGFL+IGTLG       AL +    P       +
Sbjct  61   CLESAISQDDEHYKEEPLAAEITDLFHGFLAIGTLGS----EPALGHDPATPTFSYSLEN  116

Query  339  feetttQITDQDLKLITIELEKFLEAEEDAQ-------------SSKRSSYASIITLTDK  479
              E  T++T+ DLKLI  ELEK L AE +               S+ RSS+ S ITL  K
Sbjct  117  ITEKETEVTENDLKLINEELEKVLAAEANKDEWGNQSSGRNSHVSTGRSSHVSTITLGGK  176

Query  480  TQQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQE  614
             +   ++S      CPLQ Y FG    + E+    K E   SL E  Q+
Sbjct  177  VEAQETNSSNGSAVCPLQGYLFGSAVEVLEAPKVDKKEHRTSLGELFQK  225



>ref|XP_010028982.1| PREDICTED: uncharacterized protein LOC104419127 [Eucalyptus grandis]
Length=368

 Score = 80.5 bits (197),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 106/229 (46%), Gaps = 41/229 (18%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRT--------SFDPSHPTYGFSGNPNTTCTYQKVIKET-  209
            MKLLGWMH+KL+ N  E  ++          S    H        PN +  Y     E+ 
Sbjct  1    MKLLGWMHQKLRQNSIETFRDFAIGSYCTCLSAQQPHDEKDLFTMPNFSSRYAPKSSESP  60

Query  210  ----------EEKPLNEVFHGFLSIGTLG---GGSEEAAALFNstdepptptfptsfeet  350
                      E +   E+FHGFL+IG LG     SE A   F             +  + 
Sbjct  61   AEEYGNSISLEPETSTELFHGFLAIGFLGSEAAPSEPATPTF--------AVTLDNMTKE  112

Query  351  ttQITDQDLKLITIELEKFLEA---EEDAQSSKRSSYASIITLTDKTQQDS--SSSPTLL  515
              ++T+ DLK+I  ELEKFLEA   EE  + S R+SYAS ITL D  Q ++     P   
Sbjct  113  AVEVTEDDLKVINNELEKFLEAESQEEGHKGSSRNSYASTITL-DSPQMEAVEDEGPADT  171

Query  516  LDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGNDKKRA  650
            +  PLQ Y FG    L E+ + +K +++ASL +  QE     G+  K++
Sbjct  172  VVFPLQGYLFGSSVELPETKIEMK-KQKASLLQLFQETRKTGGDCSKKS  219



>ref|XP_006599015.1| PREDICTED: uncharacterized protein LOC102666543 [Glycine max]
Length=382

 Score = 80.5 bits (197),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 72/228 (32%), Positives = 103/228 (45%), Gaps = 50/228 (22%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDP------------------------SHPTYGFSG  164
            MKL  W+HRKL+ N  +  K  T  +P                        + P++    
Sbjct  1    MKLFQWVHRKLRQNSIDPFKGFTLGNPCTCLTVQPTLDNQYSQTKPSFSSINQPSFSKPH  60

Query  165  NPNTTCTYQKVIKETEEKP-------LNEVFHGFLSIGTLGGGSEEAAALFNstdepptp  323
            +     +Y  ++   E+KP       + E+F GFL+IGTLG     A  + N    P   
Sbjct  61   HQENQTSYSGLVDSREDKPQEETPAIVAELFEGFLTIGTLG-----AETVTNEPGTPTFA  115

Query  324  tfptsfeetttQITDQDLKLITIELEKFLEAEED---AQSSKRSSYASIITLTDK-----  479
                +    + ++T+ +LKLI+ ELEKFLEAE++     SS R+SY SIITL  K     
Sbjct  116  MPSENITLRSEEVTENELKLISYELEKFLEAEKEESSYDSSGRNSYVSIITLCGKEIDGP  175

Query  480  TQQDSSSSPTLLLDCPLQKYFFGLSESDMAVKNE--EEASLSEDLQEV  617
              +D  +      DCPLQ Y  G S      K E  E ASL+E L ++
Sbjct  176  KAEDYRNKD----DCPLQGYLLGSSFELPETKQERKERASLAELLYKI  219



>gb|KDP26836.1| hypothetical protein JCGZ_17994 [Jatropha curcas]
Length=390

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 79/244 (32%), Positives = 109/244 (45%), Gaps = 58/244 (24%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN------------RTSFDPSH----PTYG-----------  155
            MKLLGWMHRK + N +E +K+            + S D       P YG           
Sbjct  1    MKLLGWMHRKFRQNSSEQLKDFAIGHACNCLIGQPSLDDQQYYPKPNYGTRQFKQAQKDH  60

Query  156  ----FSG--NPNTTCTYQKVIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepp  317
                F+G     T    +   +E     ++E+FHGFL+IGTLG     +  +      P 
Sbjct  61   IRKSFAGLEAARTEEEDEDDYEEESSAAISELFHGFLAIGTLG-----SDPVNTDPSTPT  115

Query  318  tptfptsfeetttQITDQDLKLITIELEKFL--EAEEDA----------QSSKRSSYASI  461
                  +  E  T++T+ +LKLI  ELEK L  EA ED            S+ RSS+ S 
Sbjct  116  FAISVENITEKETEVTENELKLINDELEKVLGAEAREDCCNDSSGRSSYVSAGRSSHGST  175

Query  462  ITLTDKTQ--QDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVV  623
            ITL+ K    QD++++ T +  CPLQ Y FG    LSE+    K E   SL E  Q   +
Sbjct  176  ITLSGKPMEGQDTNANGTAI--CPLQGYLFGSAIELSETTTMAKKEHRTSLGELFQRTKM  233

Query  624  VKGN  635
             + N
Sbjct  234  AEEN  237



>ref|XP_010250652.1| PREDICTED: uncharacterized protein LOC104592840 [Nelumbo nucifera]
Length=383

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 79/250 (32%), Positives = 105/250 (42%), Gaps = 62/250 (25%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNPNTTCTYQKVIK-----------  203
            MKLL WMHRK +HN  E +K+   F   HP    SG  +     Q + +           
Sbjct  1    MKLLDWMHRKFRHNSGEPLKD---FTIGHPCNCLSGQSSLQDEQQYLARPSFSSRTLRQH  57

Query  204  ------------------------ETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstde  311
                                    E+     +E+F G L+IGT G     A   FN + E
Sbjct  58   QKERVRRNSFAGLEATSVEGEFEDESSAAASSELFDGLLTIGTFGS-DPAATPSFNFSVE  116

Query  312  pptptfptsfeetttQITDQDLKLITIELEKFL--EAEEDA--QSSKRSSYASIITLTDK  479
              T            ++T+ DLKLI  ELEK L  EA+ED    SS RSS+ S ITL+ K
Sbjct  117  NITEKET--------EVTENDLKLINEELEKVLVAEAKEDGCNLSSGRSSHVSTITLSGK  168

Query  480  TQQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGN----  635
              + +  + +    CPLQ+Y FG    L E+ M  K E   SL E   +  +   N    
Sbjct  169  QLEATDHTGSGTAICPLQEYLFGSPIELPETTMVAKKEHRMSLGELFLKSKMADDNSAGK  228

Query  636  ---DKKRAGK  656
               D+KRA K
Sbjct  229  CDKDEKRAEK  238



>ref|XP_011036107.1| PREDICTED: uncharacterized protein LOC105133719 [Populus euphratica]
Length=390

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 77/244 (32%), Positives = 107/244 (44%), Gaps = 63/244 (26%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNP------------NTTCTYQKVI  200
            MKLLGWMHRKL+ N +E +K+   F   +P     G P            N T T+++  
Sbjct  1    MKLLGWMHRKLRQNGSETLKD---FAIGNPCNCLIGQPSLDDQQHYTKPNNGTRTFRQAQ  57

Query  201  KETEEK---------------------------PLNEVFHGFLSIGTLGGGSEEAAALFN  299
            KE   K                            ++E+FHGFL+IGTLG     +  +  
Sbjct  58   KEHLRKSFAGLEAARVEEEEGEEEEDYEEESSAAISELFHGFLAIGTLG-----SEPVNT  112

Query  300  stdepptptfptsfeetttQITDQDLKLITIELEKFL--EAEEDAQ------SSKRSSYA  455
                P  P    +  E  T++T+ +LKLI  ELEK L  +   D+       S+ RSS+ 
Sbjct  113  DPSTPTFPISVENITEKETEVTENELKLINDELEKVLAEDCSNDSSGRNSHVSAGRSSHG  172

Query  456  SIITLTDKTQQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVV  623
            S ITL+ K  +   S+      CPLQ Y FG    LSE+    K E   SL E  Q+  +
Sbjct  173  STITLSGKPMEGRDSNAV----CPLQGYLFGSAIELSETAPVAKKEHRTSLGELFQKTKI  228

Query  624  VKGN  635
             + N
Sbjct  229  AEEN  232



>ref|XP_010112393.1| hypothetical protein L484_010798 [Morus notabilis]
 gb|EXC33388.1| hypothetical protein L484_010798 [Morus notabilis]
Length=479

 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 74/232 (32%), Positives = 104/232 (45%), Gaps = 43/232 (19%)
 Frame = +3

Query  51   MKMKLLGWMHRKLKHNCNEAVKN------------RTSFDP----SHPTYGFSGNPNTT-  179
            +KMK+L WMH K +HN  +  K+            +TS D     + P YG     N+  
Sbjct  79   IKMKILEWMHHKFRHNSIKPFKDLNIGNSCMRLSVQTSLDDQDPYTKPNYGSRDGFNSMK  138

Query  180  ----------CTYQKVIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptf  329
                      C ++   +E     ++E+FHGFL+IGTLG     + A  N  + P   T 
Sbjct  139  QPKQEEEKYFCQFEAKKEEETSAVISELFHGFLTIGTLG-----SDASINEPETPTFATP  193

Query  330  ptsfeetttQITDQDLKLITIELEKFLEAEEDA-----QSSKRSSYASIITLTDKTQQDS  494
              +  +   ++T+  LKLI  ELEKFLEAE        +SS R+S  S ITL  K  + +
Sbjct  194  SENITDGRIKVTENHLKLINYELEKFLEAESKEEEGSDESSARNSNVSAITLGGKQMERA  253

Query  495  SSSPTLLLD-CPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGN  635
                      CPLQ Y FG    L E  +  K +E+ASL E      +   N
Sbjct  254  KDEDYWKTKVCPLQGYLFGSSIELPEERIEFK-KEKASLGELFHRTKIAAEN  304



>ref|XP_009771615.1| PREDICTED: uncharacterized protein LOC104222123 [Nicotiana sylvestris]
Length=381

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 77/242 (32%), Positives = 109/242 (45%), Gaps = 57/242 (24%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNP--NTTCTYQKV----------I  200
            MKLLGWMHRK + N +E +K+   F   +P    +G P  +    YQK            
Sbjct  1    MKLLGWMHRKFRQNSSEPLKD---FSVGNPCTCLTGQPSLDDLQGYQKPNFYNKPLSKGQ  57

Query  201  KETEEK-------------------PLNEVFHGFLSIGTLGGGSEEAAALFNstdepptp  323
            +E+  +                    L+E+FHGFL+IGTLG        L +    P   
Sbjct  58   RESHRRKSFAGLEAAARADEEESSAALSELFHGFLAIGTLG-----TDPLLDDPSTPTFS  112

Query  324  tfptsfeetttQITDQDLKLITIELEKFL--EAEEDA----------QSSKRSSYASIIT  467
                +  E  T++T+ +LKLI  ELEK L  EA++D+           S+ RSS+ S IT
Sbjct  113  ISVENIAEKDTEVTENELKLINDELEKVLGTEAKDDSCNLSSGRNSYVSTGRSSHGSTIT  172

Query  468  LTDKTQQDSSSSPTLLLDCPLQKYFF----GLSESDMAV--KNEEEASLSEDLQEVVVVK  629
            L+ K  + S ++      CPLQ Y F    GL E+  A   K E   SL E  Q+  + +
Sbjct  173  LSGKPFESSENNGNGTTVCPLQGYLFGSTVGLPETSPAASSKKEHRPSLGELFQKTKLAE  232

Query  630  GN  635
             N
Sbjct  233  EN  234



>ref|XP_007142600.1| hypothetical protein PHAVU_007G001200g [Phaseolus vulgaris]
 gb|ESW14594.1| hypothetical protein PHAVU_007G001200g [Phaseolus vulgaris]
Length=370

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 73/222 (33%), Positives = 106/222 (48%), Gaps = 45/222 (20%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRT--SFDPSHPTYGFSGNPNTTCTYQKVIKETEEK----  218
            MKLLGWMHRK + N  E  K+    S D  H       NP  +    K +K+++++    
Sbjct  1    MKLLGWMHRKFRQNSTEPFKDLVIGSCDDEHNY----PNPKGSFGNYKHVKQSQKEQNLR  56

Query  219  -----------------PLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfee  347
                              + E+FHGFL+IGTLG  SE+  +  + +  P       +  E
Sbjct  57   KSFAGVEDDEYEEDSAGAMYELFHGFLAIGTLG--SEQVVS--DPSTTPTFAISVENITE  112

Query  348  tttQITDQDLKLITIELEKFLEAEEDAQ-------SSKRSSYASIITLTDKTQQDSSSSP  506
               ++T+ +LKLI  ELEK L A++++        S+ RSS+ SIITL+ K   +  S+ 
Sbjct  113  KEDEVTENELKLINDELEKVLGADDESSCGRNSHVSNGRSSHGSIITLSGKPLLEGESNG  172

Query  507  TLLLDCPLQKYFFG----LSESD---MAVKNEEEASLSEDLQ  611
                 CPLQ Y FG    LSE+    +A + E   SL E  Q
Sbjct  173  NGSAVCPLQGYLFGSAIELSETTTVAVAKQKEHRTSLGELFQ  214



>ref|XP_002299323.2| hypothetical protein POPTR_0001s13570g [Populus trichocarpa]
 gb|EEE84128.2| hypothetical protein POPTR_0001s13570g [Populus trichocarpa]
Length=390

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 76/241 (32%), Positives = 108/241 (45%), Gaps = 57/241 (24%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYG--------FSGNPNT-TCTYQKVIKET  209
            MKLLGWMHRKL+ N +E +K+    +P +   G        +   PN  T T+++  KE 
Sbjct  1    MKLLGWMHRKLRQNGSETLKDFAIGNPCNCLIGQPSLDDQQYYTKPNYGTRTFRQAQKEH  60

Query  210  EEK---------------------------PLNEVFHGFLSIGTLGGGSEEAAALFNstd  308
              K                            ++E+FHGFL+IGTLG     +  +     
Sbjct  61   LRKSFAGLEAARVEEEEGEEEEDFEEESSAAISELFHGFLAIGTLG-----SEPVNTDPS  115

Query  309  epptptfptsfeetttQITDQDLKLITIELEKFL--EAEEDAQ------SSKRSSYASII  464
             P  P    +  E  T++T+ +LKLI  ELEK L  +   D+       S+ RSS+ S I
Sbjct  116  TPTFPISVENITEKETEVTENELKLINDELEKVLAEDCSNDSSGRNSHVSAGRSSHGSTI  175

Query  465  TLTDKTQQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKG  632
            TL+ K  +   S+      CPLQ Y FG    LSE+    K E   SL E  Q+  + + 
Sbjct  176  TLSGKPMEGRDSNAV----CPLQGYLFGSAIELSETAPVAKKEHRTSLGELFQKTKIAEE  231

Query  633  N  635
            N
Sbjct  232  N  232



>ref|XP_009757313.1| PREDICTED: uncharacterized protein LOC104210188 isoform X1 [Nicotiana 
sylvestris]
Length=347

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 128/383 (33%), Positives = 174/383 (45%), Gaps = 87/383 (23%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNPNTTCTYQKVIKE-TEEKPLNEV  233
             MKLLGWMH KLK   NE   N    + S  ++           Y++V     E +P +E+
Sbjct  1     MKLLGWMHSKLKQKGNEPANNTPIVENSITSFS---------VYKEVKSNGAEMEPFDEL  51

Query  234   FHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIELEKFLE  413
             F GFL+IGTLG               PPTPTFP  F+ + T IT+++LK I  ELEK+L 
Sbjct  52    FPGFLAIGTLGDYQTTNTD-------PPTPTFPLPFDHSETDITEKELKFINDELEKYL-  103

Query  414   AEEDAQSSKRSSYASIITLTDKTQQDSSSSP------------TLL---LDC--------  524
              EE        S  SIITL+DK     S  P             LL   L C        
Sbjct  104   -EEKVNKVAYESSESIITLSDKRAARCSKLPQCEGSGEGPNRKALLNAALPCITLSDNHI  162

Query  525   --------------PLQKYFFGLSESDMAVKNEEEASLSEDLQEVVVVK--------GND  638
                           PLQKY  G S   +A   +++  + E  +   +V+        G +
Sbjct  163   ETGATECYSNMEEYPLQKYLLGSSIELLAEVQQQKGFIEELFKRTNIVQESHVGTHDGKE  222

Query  639   KKRAGKAQFAKNFmkkmlkslnsnskskTHMHAPN--ESAPPTknkfpkvlkmlkkkvHP  812
             KK+A K + A +FMKKML++L+  SKS T  H+      +  +K K P+VLKM K+KVHP
Sbjct  223   KKQA-KRKHAVDFMKKMLQNLHYKSKSSTTAHSKGNVNGSVSSKRKLPQVLKMFKRKVHP  281

Query  813   ERYIGEKGAEKDEN---RVKGSRLRSSSDTTGNIWFRQMISPEEEELIMTTSQSCSGSGR  983
             E  + E   + +E      K + LR++S                 E+    S + +    
Sbjct  282   EGLMNENILQDNETSNISCKTNNLRANS-----------------EVNKKNSPAATTKKE  324

Query  984   GGAFMENNGHWIKTDADYLVLEL  1052
               A   N  HWIKTD+DYLVLEL
Sbjct  325   LNALTVNREHWIKTDSDYLVLEL  347



>ref|XP_010543090.1| PREDICTED: uncharacterized protein LOC104816116 [Tarenaya hassleriana]
 ref|XP_010523254.1| PREDICTED: uncharacterized protein LOC104801637 [Tarenaya hassleriana]
Length=309

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 75/235 (32%), Positives = 106/235 (45%), Gaps = 52/235 (22%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN--------RTSFDPSH--------PTYG---FSGNP---  170
            MKLLGWMHRK + N NE++K+             P H        P YG   +  NP   
Sbjct  1    MKLLGWMHRKFRQNSNESLKDFVIENSGTHVPGQPPHPEQYCYAKPIYGTKFYGQNPPDY  60

Query  171  --------NTTCTYQKVIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptpt  326
                      T   ++  ++ E   ++E+FHGFL+IGTLG          ++   P    
Sbjct  61   FRKSFAGIEATQVDEEDHEDEESAVVSEIFHGFLAIGTLGSDPN-----VSTPSTPTFTI  115

Query  327  fptsfeetttQITDQDLKLITIELEKFLEAEE-----DAQSSK-------RSSYASIITL  470
               +     T++T+++LKL+   LEK L AE      DA S +       RSS  S ITL
Sbjct  116  SLENETGKETEVTERELKLLNDNLEKILGAEVKEEICDASSGRNSHVSAGRSSQGSTITL  175

Query  471  TDKTQQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVV  623
            T KT +   ++ +    CPLQ Y FG    +SE+  A K E   SL E  Q+  +
Sbjct  176  TGKTLEIPETNRSGSNVCPLQGYLFGSAIEMSETTTA-KKEHRTSLRELFQKTKI  229



>ref|XP_003622164.1| hypothetical protein MTR_7g028590 [Medicago truncatula]
Length=405

 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 109/367 (30%), Positives = 161/367 (44%), Gaps = 62/367 (17%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVKNRTSFDP----------SHPTYGFSGNPNTTCTYQKVIKE  206
             MKL  W+HRKL+ N N+  K+    +P          S     FS   N  C  +   +E
Sbjct  1     MKLFQWVHRKLRQNDNDTFKDVKLGNPCACLTLDSQYSQTKQSFSS-INQLCFVKSHHQE  59

Query  207   TE---------EKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQ  359
             ++            ++E+F GFL+IGTLG     A A+ N    P   T   +       
Sbjct  60    SQTSWRREEETSAVVSELFEGFLTIGTLG-----AEAVINEPATPTFATPSENIPMKDAD  114

Query  360   ITDQDLKLITIELEKFLEAEEDA--QSSKRSSYASIITL------TDKTQQDSSSSPTLL  515
             +T+ +LKLI+ ELEKFLE EE++  +SS R+S  S+  +      TD ++ +   +  + 
Sbjct  115   VTENELKLISYELEKFLETEEESFNESSGRNSRLSLSNIKISGKQTDGSEDEDCGNKDV-  173

Query  516   LDCPLQKYFFGLS-ESDMAVK-NEEEASLSEDLQ------EVVVVKGNDKKRAGKAQFAK  671
               CPLQ Y  G S E    V+  +E ASL+E  Q      E  +  G    +  +A  + 
Sbjct  174   --CPLQGYLLGSSFEIPEKVQVRKERASLAELFQRTKTANEDCIETGVKDTQVKQAHKSP  231

Query  672   NFmkkmlkslnsnskskTHMHAPNESAPPTknkfpkvlkmlkkkvHPERYIGEKGAEKDE  851
               + K +  +   S    +       +  T  K  KVL+   +KVHPE  +  K   K  
Sbjct  232   MHIMKKMLKMVHISSKSCNTSENIADSTTTNKKLSKVLRKFHRKVHPEDTLNAKSVTKSH  291

Query  852   NRVKGSRLRSSSDTTGNI-WFRQMISPEEEELIMTTSQSCSGSGRGGAFMENNGHWIKTD  1028
                  +  R   D    I W     +P +++L       CSGS        NN HWIKTD
Sbjct  292   KDKIKNLPRECFDEHCEINW-----NPPQDDLC------CSGS------TGNNEHWIKTD  334

Query  1029  ADYLVLE  1049
             A+YLVL+
Sbjct  335   AEYLVLD  341



>ref|XP_004239242.1| PREDICTED: uncharacterized protein LOC101252392 [Solanum lycopersicum]
Length=380

 Score = 77.8 bits (190),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 75/245 (31%), Positives = 107/245 (44%), Gaps = 60/245 (24%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNP---NTTCT-----YQKVIKETE  212
            MKLLGWMHRK + N +E +K    F   +P    +G P   +  C      Y K + +T+
Sbjct  1    MKLLGWMHRKFRQNSSEPLKE---FSVGNPCTCLTGQPSLDDIHCYPKSNFYNKSLSKTQ  57

Query  213  EK---------------------------PLNEVFHGFLSIGTLGGGSEEAAALFNstde  311
                                          L+E+FHGFL+IGTLG        L +    
Sbjct  58   RDNHLRKSFAGLEAAARADHYDLEEESSAALSELFHGFLAIGTLG-----TDPLLDDPST  112

Query  312  pptptfptsfeetttQITDQDLKLITIELEKFL--EAEEDA----------QSSKRSSYA  455
            P       +  E  T++T+ +LKLI  ELEK L  EA++D            S+ RSS+ 
Sbjct  113  PTFSISVENIAEKDTEVTENELKLINDELEKVLGAEAKDDTCNLSSGRNSYVSTGRSSHG  172

Query  456  SIITLTDKTQQDSSSSPTLLLDCPLQKYFFG----LSESDMA-VKNEEEASLSEDLQEVV  620
            S ITL+ K  + + ++      CPLQ Y FG    + E+  A  K E   SL E  Q+  
Sbjct  173  STITLSGKQLESAENNGNGTTVCPLQGYLFGSTVEMQETTSASAKKEHRPSLGELFQKTK  232

Query  621  VVKGN  635
            + + N
Sbjct  233  LAEEN  237



>gb|KHN28283.1| hypothetical protein glysoja_040163, partial [Glycine soja]
Length=382

 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 70/228 (31%), Positives = 103/228 (45%), Gaps = 50/228 (22%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDP------------------------SHPTYGFSG  164
            ++L  W+HRKL+ N  +  K  T  +P                        + P++    
Sbjct  1    LQLFQWVHRKLRQNSIDPFKGFTLGNPCTCLTVQPTLDNQYSQTKPSFSSINQPSFSKPH  60

Query  165  NPNTTCTYQKVIKETEEKP-------LNEVFHGFLSIGTLGGGSEEAAALFNstdepptp  323
            +     +Y  ++   E+KP       + E+F GFL+IGTLG     A  + N    P   
Sbjct  61   HQENQTSYSGLVDSREDKPQEETPAIVAELFEGFLTIGTLG-----AETVTNEPGTPTFA  115

Query  324  tfptsfeetttQITDQDLKLITIELEKFLEAEED---AQSSKRSSYASIITLTDK-----  479
                +    + ++T+ +LKLI+ ELEKFLEAE++     SS R+SY SIITL  K     
Sbjct  116  MPSENITLRSEEVTENELKLISYELEKFLEAEKEESSYDSSGRNSYVSIITLCGKEIDGP  175

Query  480  TQQDSSSSPTLLLDCPLQKYFFGLSESDMAVKNE--EEASLSEDLQEV  617
              +D  +      DCPLQ Y  G S      K E  E ASL+E L ++
Sbjct  176  KAEDYRNKD----DCPLQGYLLGSSFELPETKQERKERASLAELLYKI  219



>ref|XP_010543088.1| PREDICTED: uncharacterized protein LOC104816114 [Tarenaya hassleriana]
 ref|XP_010523253.1| PREDICTED: uncharacterized protein LOC104801635 [Tarenaya hassleriana]
 ref|XP_010523256.1| PREDICTED: uncharacterized protein LOC104801639 [Tarenaya hassleriana]
 ref|XP_010527358.1| PREDICTED: uncharacterized protein LOC104804714 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527359.1| PREDICTED: uncharacterized protein LOC104804714 isoform X2 [Tarenaya 
hassleriana]
Length=393

 Score = 77.4 bits (189),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 75/236 (32%), Positives = 106/236 (45%), Gaps = 52/236 (22%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN--------RTSFDPSH--------PTYG---FSGNP---  170
            MKLLGWMHRK + N NE++K+             P H        P YG   +  NP   
Sbjct  1    MKLLGWMHRKFRQNSNESLKDFVIENSGTHVPGQPPHPEQYCYAKPIYGTKFYGQNPPDY  60

Query  171  --------NTTCTYQKVIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptpt  326
                      T   ++  ++ E   ++E+FHGFL+IGTLG          ++   P    
Sbjct  61   FRKSFAGIEATQVDEEDHEDEESAVVSEIFHGFLAIGTLGSDPN-----VSTPSTPTFTI  115

Query  327  fptsfeetttQITDQDLKLITIELEKFLEAEE-----DAQSSK-------RSSYASIITL  470
               +     T++T+++LKL+   LEK L AE      DA S +       RSS  S ITL
Sbjct  116  SLENETGKETEVTERELKLLNDNLEKILGAEVKEEICDASSGRNSHVSAGRSSQGSTITL  175

Query  471  TDKTQQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVV  626
            T KT +   ++ +    CPLQ Y FG    +SE+  A K E   SL E  Q+  + 
Sbjct  176  TGKTLEIPETNRSGSNVCPLQGYLFGSAIEMSETTTA-KKEHRTSLRELFQKTKIT  230



>ref|XP_008222202.1| PREDICTED: uncharacterized protein LOC103322099 isoform X2 [Prunus 
mume]
Length=386

 Score = 77.0 bits (188),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 95/229 (41%), Gaps = 52/229 (23%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNPNTTCTYQKVIKETE-----EKP  221
            MKLLGWMHRK + N NE  K      PS         PN      K  K+T+      K 
Sbjct  1    MKLLGWMHRKFRQNSNEPFKVFVIGQPSLDDQQCYPKPNCGT---KPFKQTQRDQHLRKS  57

Query  222  LN---------------------EVFHGFLSIGTLGGGSEEAAALFNstdepptptfpts  338
             N                     E+FHGFL+IGTLG     +  +      P       +
Sbjct  58   FNGLEAARAEEEYYEDESSAAASELFHGFLAIGTLG-----SEQVITEPSTPTLAISVEN  112

Query  339  feetttQITDQDLKLITIELEKFLEAEEDAQ-------------SSKRSSYASIITLTDK  479
              E  T++T+ +LKLI  ELEK L A+                 S+ RSS+ S ITL+ K
Sbjct  113  ITEKETEVTENELKLINDELEKVLAADSAKDEICNDSSGRNSHVSNGRSSHGSTITLSGK  172

Query  480  TQQDS-SSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQ  611
            T + S S+       CPLQ Y FG    LSE+    K E   SL E  Q
Sbjct  173  TLEGSESNGINGTTVCPLQGYLFGSAYELSETTTVAKKEHRTSLGELFQ  221



>ref|XP_007223089.1| hypothetical protein PRUPE_ppa007017mg [Prunus persica]
 gb|EMJ24288.1| hypothetical protein PRUPE_ppa007017mg [Prunus persica]
Length=386

 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 95/229 (41%), Gaps = 52/229 (23%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNPNTTCTYQKVIKETE-----EKP  221
            MKLLGWMHRK + N NE  K      PS         PN      K  K+T+      K 
Sbjct  1    MKLLGWMHRKFRQNSNEPFKVFVIGQPSLDDQQCYPKPNCGT---KPFKQTQRDQHLRKS  57

Query  222  LN---------------------EVFHGFLSIGTLGGGSEEAAALFNstdepptptfpts  338
             N                     E+FHGFL+IGTLG     +  +      P       +
Sbjct  58   FNGLEAARAEEEYYEDESSAAASELFHGFLAIGTLG-----SEQVITEPSTPTLAISVEN  112

Query  339  feetttQITDQDLKLITIELEKFLEAEEDAQ-------------SSKRSSYASIITLTDK  479
              E  T++T+ +LKLI  ELEK L A+                 S+ RSS+ S ITL+ K
Sbjct  113  ITEKETEVTENELKLINDELEKVLAADSAKDEICNDSSGRNSHVSNGRSSHGSTITLSGK  172

Query  480  TQQDS-SSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQ  611
            T + S S+       CPLQ Y FG    LSE+    K E   SL E  Q
Sbjct  173  TLEGSESNGINGTTVCPLQGYLFGSAYELSETTTVAKKEHRTSLGELFQ  221



>gb|EYU31831.1| hypothetical protein MIMGU_mgv11b019719mg, partial [Erythranthe 
guttata]
Length=349

 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 103/230 (45%), Gaps = 40/230 (17%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN----RTSFDPS----HPTYGFSGNPNTTC----------  182
            MK LGWMHRK+  N  E + N    +T FD       PT  FS + N  C          
Sbjct  1    MKFLGWMHRKVMQNSTELIANSKTVQTMFDEHSYYVKPTNSFS-HSNIKCQKYSKSNRME  59

Query  183  --TYQKVIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeettt  356
                +++I+E   +P N     FL+IGT G        L      P             T
Sbjct  60   ANNMEELIQEESFEPFN-----FLAIGTFG-----TELLNTDPPTPTFSIPFEESTNKQT  109

Query  357  QITDQDLKLITIELEKFLEAEEDA---QSSKRSSYASIITLTDKTQQDSSSSPTLLLD-C  524
             I + DLKLI  ELEKFLEA+E       S R + A+ ITL+ K  + + S   + +  C
Sbjct  110  GIIENDLKLINYELEKFLEAQEKEIGNDMSGRGNDANTITLSSKQLEGADSEDHMFMKTC  169

Query  525  PLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGNDKKRAGKAQ  662
            PLQ Y FG    L E+D  V+  E+ SL E  +   ++  + K ++  A+
Sbjct  170  PLQNYLFGTPVELVETDKEVQ-REKTSLEELFKRNNIIHDDFKTKSDAAE  218



>ref|XP_004148010.1| PREDICTED: uncharacterized protein LOC101218873 [Cucumis sativus]
 ref|XP_004161515.1| PREDICTED: uncharacterized LOC101218873 [Cucumis sativus]
Length=363

 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 100/308 (32%), Positives = 140/308 (45%), Gaps = 55/308 (18%)
 Frame = +3

Query  228   EVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIELEKF  407
             ++FHGFL+IGTLG  SE A   F+   E               ++T+ DLKLI  ELEKF
Sbjct  78    DIFHGFLTIGTLG--SEPATPTFSLAFENMIELPD--------EVTEDDLKLINYELEKF  127

Query  408   LEAE--EDA--QSSKRSSYASIITLTDKTQQDSSSSPTLLLDCPLQKYFFGLS---ESDM  566
             LEAE  ED   QS  R+S+ASIITL  K  +++         CPLQ Y FG +      M
Sbjct  128   LEAETKEDRCDQSPGRTSHASIITLAGKHMEETKDENDGKTTCPLQGYLFGSTIELPDKM  187

Query  567   AVKNEEEASLSEDLQEVVV----VKGNDKKRAGKAQFAKNFmkkmlkslnsnskskTHMH  734
                 +E  S  E  Q+ +      K N +K+    + +       +K +     + +H  
Sbjct  188   IDMRKETPSSPELFQDTIAENESFKLNIEKKKALVKHSNKSALTFVKKMLKKLCTSSHGS  247

Query  735   APNES--APPTknkfpkvlkmlkkkvHPE------------RYIGEKGAEKDENRVKGSR  872
             +  +S  +  TK K  KVL+ L +K+HPE            +YI E  +  + N    S 
Sbjct  248   STYDSGDSHSTKKKLQKVLRKLNRKIHPETSTAMDECQKSQKYIFENVSFDNFNN--DSV  305

Query  873   LRSSSDTTGNIWFRQMISPEEEELIMT--------TSQSCSGSGRGGAFMENNGHWIKTD  1028
             +    D  G  + ++ IS EE     T           + S + RG        HWIKTD
Sbjct  306   MNRVED--GITYCQEFISKEEMCYWKTNLGLPLYGIDTNVSSANRG--------HWIKTD  355

Query  1029  ADYLVLEL  1052
             A+YLVLEL
Sbjct  356   AEYLVLEL  363



>ref|XP_006604154.1| PREDICTED: uncharacterized protein LOC102665678 [Glycine max]
Length=382

 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 106/227 (47%), Gaps = 54/227 (24%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDP----------------SHPTYGFSGNPNTT---  179
            MKL  W+HRKL+ N  +  K+ T  +P                S P++  +  P+ +   
Sbjct  1    MKLFQWVHRKLRQNSIDPFKDFTLGNPCTCLTVQPTLDNQYSQSKPSFSSTNQPSFSKPH  60

Query  180  -----CTYQKVI-----KETEEKP--LNEVFHGFLSIGTLGGGSEEAAALFNstdepptp  323
                  +Y  ++     K  EE P  ++E+F GFL+IGTLG     A  + N    P   
Sbjct  61   HQENQTSYSGLVDSREDKSQEETPAIISELFEGFLTIGTLG-----AETVTNEPGTPTFA  115

Query  324  tfptsfeetttQITDQDLKLITIELEKFLEAEED---AQSSKRSSYASIITLTDK-----  479
                +    + ++T  +LKLI+ ELEKFLE E++     SS R+SY SIITL++K     
Sbjct  116  MPSENITSRSEEVTGNELKLISYELEKFLETEKEESLYDSSGRNSYVSIITLSEKEIDGP  175

Query  480  TQQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDL  608
              +D  +       CPLQ Y  G    L E+    K  E ASL+E L
Sbjct  176  KAEDYRNKAV----CPLQGYLLGSSFELPETKEVRK--ERASLAELL  216



>ref|XP_006575827.1| PREDICTED: uncharacterized protein LOC102660341 [Glycine max]
Length=358

 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 77/227 (34%), Positives = 103/227 (45%), Gaps = 47/227 (21%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN----RTSFDPSH----PTYGF-------SGNPNTTCTYQ  191
            MKLLGWMHRKL+ N +E  K+    +   D       P+ G         G+ N   ++ 
Sbjct  1    MKLLGWMHRKLRQNSSEPFKDLVIGQAPLDDEQVYQKPSLGVKLSKHAQKGHNNLRNSFA  60

Query  192  KV-IKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITD  368
             V     +E    E F GFL+IGTLG     +  + + +  P  P    S  E   ++T+
Sbjct  61   GVEAARVDEDYEGEYFPGFLAIGTLG-----SEPISDPSTTPSFPISVESITEKEDEVTE  115

Query  369  QDLKLITIELEKFLEAE--EDAQ------------------SSKRSSYASIITLTDKTQQ  488
             DLKLI  ELEK L AE  +D                    S+ RSS+ASIITL+ K  +
Sbjct  116  NDLKLINDELEKVLGAETKDDVSIDSSRRTSHVSTGRSSHVSTGRSSHASIITLSGKPIE  175

Query  489  DSSSSPTLLLDCPLQKYFFG----LSE--SDMAVKNEEEASLSEDLQ  611
             + ++      CPLQ Y FG    LSE  +  A K E   SL E  Q
Sbjct  176  GTEANGNGAAICPLQGYLFGTAIELSETTTTAAAKKEHRTSLGELFQ  222



>ref|XP_009757314.1| PREDICTED: uncharacterized protein LOC104210188 isoform X2 [Nicotiana 
sylvestris]
Length=339

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 129/384 (34%), Positives = 173/384 (45%), Gaps = 97/384 (25%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNPNTTCTYQKVIKE--TEEKPLNE  230
             MKLLGWMH KLK   NE         P++         NT     K +K    E +P +E
Sbjct  1     MKLLGWMHSKLKQKGNE---------PAN---------NTPIVVYKEVKSNGAEMEPFDE  42

Query  231   VFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIELEKFL  410
             +F GFL+IGTLG               PPTPTFP  F+ + T IT+++LK I  ELEK+L
Sbjct  43    LFPGFLAIGTLGDYQTTNTD-------PPTPTFPLPFDHSETDITEKELKFINDELEKYL  95

Query  411   EAEEDAQSSKRSSYASIITLTDKTQQDSSSSP------------TLL---LDC-------  524
               EE        S  SIITL+DK     S  P             LL   L C       
Sbjct  96    --EEKVNKVAYESSESIITLSDKRAARCSKLPQCEGSGEGPNRKALLNAALPCITLSDNH  153

Query  525   ---------------PLQKYFFGLSESDMAVKNEEEASLSEDLQEVVVVK--------GN  635
                            PLQKY  G S   +A   +++  + E  +   +V+        G 
Sbjct  154   IETGATECYSNMEEYPLQKYLLGSSIELLAEVQQQKGFIEELFKRTNIVQESHVGTHDGK  213

Query  636   DKKRAGKAQFAKNFmkkmlkslnsnskskTHMHAPN--ESAPPTknkfpkvlkmlkkkvH  809
             +KK+A K + A +FMKKML++L+  SKS T  H+      +  +K K P+VLKM K+KVH
Sbjct  214   EKKQA-KRKHAVDFMKKMLQNLHYKSKSSTTAHSKGNVNGSVSSKRKLPQVLKMFKRKVH  272

Query  810   PERYIGEKGAEKDEN---RVKGSRLRSSSDTTGNIWFRQMISPEEEELIMTTSQSCSGSG  980
             PE  + E   + +E      K + LR++S                 E+    S + +   
Sbjct  273   PEGLMNENILQDNETSNISCKTNNLRANS-----------------EVNKKNSPAATTKK  315

Query  981   RGGAFMENNGHWIKTDADYLVLEL  1052
                A   N  HWIKTD+DYLVLEL
Sbjct  316   ELNALTVNREHWIKTDSDYLVLEL  339



>ref|XP_006399919.1| hypothetical protein EUTSA_v10013936mg [Eutrema salsugineum]
 gb|ESQ41372.1| hypothetical protein EUTSA_v10013936mg [Eutrema salsugineum]
Length=357

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 109/379 (29%), Positives = 153/379 (40%), Gaps = 69/379 (18%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVKNRTSFD-----PSHP--------TYGFSGNPNTTCTYQKV  197
             MK  GWMH K + N  E +K+ T+ +      +HP        T   +G+   T + +++
Sbjct  1     MKFWGWMHHKFRENSKEPLKDATTGNNHFPLSAHPSLDSQDVYTAACAGSRYNTGSRKQL  60

Query  198   ----------IKETEEKPL-----NEVFHGFLSIGTLGGGSEEAAALFNstdepptptfp  332
                        KE  E+       ++ FHGFL+IGTLGG       L +    P      
Sbjct  61    NMFQESSFAGPKENTEENFKDGRNSDFFHGFLAIGTLGG-----ETLLDEPATPTFGMSF  115

Query  333   tsfeetttQITDQDLKLITIELEKFLEAEED-------AQSSKRSSYASIITLTDKTQQD  491
                     ++T+ DLKLI+ ELEKFLEAE +        ++S  ++ AS I   +    +
Sbjct  116   GDTATDNEEVTENDLKLISNELEKFLEAEANEGHNQPSGRNSDTNTIASTIEAAEGLDAE  175

Query  492   SSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGNDKKRAGKA  659
               + P   +  PLQ+Y FG      E+++A K +E ASL E  Q   V +  DK    K 
Sbjct  176   EDNQP---MKFPLQEYLFGSLIEFPETNIAGK-KERASLGELFQ---VTEMQDKHPENKC  228

Query  660   QFAKNFmkkmlkslnsnskskTHMHAPNESAPP--------TknkfpkvlkmlkkkvHPE  815
                K       KS     K       P    P         TK KF K+ ++  +KVHPE
Sbjct  229   GEKKKQTSSTHKSAKHLVKKVLKKLHPTSRIPANGKTEVASTKKKFHKMAQVFHRKVHPE  288

Query  816   RYIGEKGAEKDENRVKGSRLRSSSDTTGNIWFRQMISPEEEELIMTTSQSCSGSGRGGAF  995
               I E          K SR  S       +          +  I    +S   +G G   
Sbjct  289   DSIMESEIYNSMADPKHSRASSIGLVPAKM---NPCHETSKRWIQYELKSSPSAGNG---  342

Query  996   MENNGHWIKTDADYLVLEL  1052
                  HWIKTD DY VLEL
Sbjct  343   ----EHWIKTDEDYFVLEL  357



>ref|XP_002303775.1| hypothetical protein POPTR_0003s16710g [Populus trichocarpa]
 gb|EEE78754.1| hypothetical protein POPTR_0003s16710g [Populus trichocarpa]
Length=297

 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 103/241 (43%), Gaps = 57/241 (24%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVK--------NRTSFDPSHPTYGFSGNPNT-TCTYQKVIKE-  206
            MKLLGWMHRKL+ N +E +K        N  +  PS   +     PN  T T+++  KE 
Sbjct  1    MKLLGWMHRKLRQNGSEPLKDFAIGNACNCLTGQPSLDDHQHYRKPNYGTRTFRQAQKEQ  60

Query  207  --------------------------TEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstd  308
                                           ++E+FHGFL+IGT G     +  +     
Sbjct  61   LRNSFSGLEAARVEEEEKEEEGDYEEESSAAISELFHGFLAIGTFG-----SEPVNTDPS  115

Query  309  epptptfptsfeetttQITDQDLKLITIELEKFLEAEEDAQSSKRSSY--------ASII  464
             P  P    +  E  T++T+ +LKLI  ELEK L  +    SS R+SY         S I
Sbjct  116  TPTFPISVENITEKETEVTENELKLINDELEKVLAEDCCNDSSGRNSYVSAGRSSHGSTI  175

Query  465  TLTDKTQQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKG  632
            TL+ K  +   S+      CPLQ Y FG    LSE+    K E   SL E  Q+  + + 
Sbjct  176  TLSGKPMEGRDSNAV----CPLQGYLFGSSIELSETTPVAKKEHRTSLGELFQKTKIAEE  231

Query  633  N  635
            N
Sbjct  232  N  232



>ref|XP_010660737.1| PREDICTED: uncharacterized protein LOC104881647 isoform X1 [Vitis 
vinifera]
Length=369

 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 99/225 (44%), Gaps = 54/225 (24%)
 Frame = +3

Query  72   WMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGN---------PNTTCTY----------QK  194
            WMH KL+ N  E  K+   F   +     SG          P  TC +          QK
Sbjct  19   WMHHKLRQNSIEPFKD---FKIGNSCSCLSGQQWLDDQPYYPTPTCGFRHFKQPQKECQK  75

Query  195  VIKETEEKPLNE------------VFHGFLSIGTLGGGSEEAAALFNstdepptptfpts  338
             I E E K + E            +FHGFL+IGTLG  +E +   F  + E  T      
Sbjct  76   KISECEAKRVEEDYEEESSNVVSDLFHGFLAIGTLGS-NEPSTPTFGVSSENMTEKET--  132

Query  339  feetttQITDQDLKLITIELEKFLEAEE----DAQSSKRSSYASIITLTDKTQQ--DSSS  500
                  ++T+ DLKLI  ELEKFLEAE       +S  R+S+ SIITL  K  +  D   
Sbjct  133  ------EVTEIDLKLINDELEKFLEAEAKDEGSIESPGRNSHVSIITLCGKQMEAADVEE  186

Query  501  SPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVV  623
            S  +++ CPLQ Y FG    L E+      + +ASL E  Q   +
Sbjct  187  SGKMIV-CPLQGYLFGSSIELPETRSTEVKKGKASLGELFQRTKI  230



>gb|KDO81827.1| hypothetical protein CISIN_1g015546mg [Citrus sinensis]
Length=405

 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 104/241 (43%), Gaps = 60/241 (25%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN------------RTSFDPSH----PTYG-----------  155
            MKLLGWMHRK + N +E +K+            + S D       P+YG           
Sbjct  1    MKLLGWMHRKFRQNSSEPLKDFGIGNACNCLTGQPSLDDQQCYPKPSYGNKPFRQQQQAQ  60

Query  156  --------FSGNPNTTCTYQKVI---KETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNs  302
                    F+G        +  +   +E     ++E+FHGFL+IGTLG        + N 
Sbjct  61   KDQYLRKSFAGLEAAARAEESELDYDQEDSSSAISELFHGFLAIGTLGNSD---TNILN-  116

Query  303  tdepptptfptsfeetttQITDQDLKLITIELEKFLEAEEDAQ-------------SSKR  443
               P       +  E  T++T+ +LKLI  ELEK L AE + +             S+ R
Sbjct  117  PSTPTFGISVENITEQETEVTENELKLINDELEKVLGAEANKEDGCNDSSGRNSHVSNGR  176

Query  444  SSYASIITLTDKTQQDSSSSPTLLLDCPLQKYFFG----LSESDMAV-KNEEEASLSEDL  608
            SS+ S ITL+ K  +   ++      CPLQ Y FG    LSE+  AV K E   SL E  
Sbjct  177  SSHGSTITLSGKPIEGPETNGNGFTVCPLQGYLFGSAIELSETTTAVAKKEHRTSLGELF  236

Query  609  Q  611
            Q
Sbjct  237  Q  237



>ref|XP_006437983.1| hypothetical protein CICLE_v10031707mg [Citrus clementina]
 ref|XP_006484156.1| PREDICTED: uncharacterized protein LOC102622478 [Citrus sinensis]
 gb|ESR51223.1| hypothetical protein CICLE_v10031707mg [Citrus clementina]
Length=405

 Score = 75.1 bits (183),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 76/241 (32%), Positives = 103/241 (43%), Gaps = 60/241 (25%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN------------RTSFDPSH----PTYG-----------  155
            MKLLGWMHRK + N +E +K+            + S D       PTYG           
Sbjct  1    MKLLGWMHRKFRQNSSEPLKDFGIGNACNCLTGQPSLDDQQCYPKPTYGNKPFRQQQQAQ  60

Query  156  --------FSGNPNTTCTYQKVI---KETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNs  302
                    F+G           +   +E     ++E+FHGFL+IGTLG        + N 
Sbjct  61   KDQYLRKSFAGLEAAARAEDSELDYDQEDSSSAISELFHGFLAIGTLGNSD---TNILN-  116

Query  303  tdepptptfptsfeetttQITDQDLKLITIELEKFLEAEEDAQ-------------SSKR  443
               P       +  E  T++T+ +LKLI  ELEK L AE + +             S+ R
Sbjct  117  PSTPTFGISVENITEQETEVTENELKLINDELEKVLGAEANKEDGCNDSSGRNSHVSNGR  176

Query  444  SSYASIITLTDKTQQDSSSSPTLLLDCPLQKYFFG----LSESDMAV-KNEEEASLSEDL  608
            SS+ S ITL+ K  +   ++      CPLQ Y FG    LSE+  AV K E   SL E  
Sbjct  177  SSHGSTITLSGKPIEGPETNGNGFTVCPLQGYLFGSAIELSETTTAVAKKEHRTSLGELF  236

Query  609  Q  611
            Q
Sbjct  237  Q  237



>ref|XP_008231191.1| PREDICTED: uncharacterized protein LOC103330395 [Prunus mume]
Length=381

 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 94/199 (47%), Gaps = 38/199 (19%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDP-----SHPT---------------YGFSGNPNT  176
            M+ L W+H K +H   E +K+ +  DP     + P+               YG +     
Sbjct  1    MQFLQWVHHKFRHGSIEPLKDLSIGDPGIFLSAQPSVDDQHSYMKSSFGSSYGSTSLEPP  60

Query  177  TCTYQKVIKETEEKP-------LNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfpt  335
                +K   E+E          ++E+FHGFL+IGT G     +    N  + P   T   
Sbjct  61   KRDQEKSFSESEANREEETSAIISELFHGFLTIGTFG-----SEPNINEPETPTFATTLE  115

Query  336  sfeetttQITDQDLKLITIELEKFLEAEEDAQ----SSKRSSYASIITLTDKTQQDSSSS  503
            +  E  T++T  DLKLI+ ELEKFLEAE   +    SS R+S+AS ITL  K  ++S   
Sbjct  116  NLTEQKTEVTQNDLKLISYELEKFLEAETKEEGVRASSARNSHASTITLNGKQMEESEDE  175

Query  504  P--TLLLDCPLQKYFFGLS  554
               T  + CPL++Y FG S
Sbjct  176  EYWTTTVVCPLKEYLFGSS  194



>ref|XP_007043918.1| Uncharacterized protein TCM_008615 [Theobroma cacao]
 gb|EOX99749.1| Uncharacterized protein TCM_008615 [Theobroma cacao]
Length=499

 Score = 75.1 bits (183),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 107/243 (44%), Gaps = 54/243 (22%)
 Frame = +3

Query  48   LMKMKLLGWMHRKLKHNCNEAVKN------------RTSFDP----SHPTYG--------  155
            ++K++LLGWMHRK + N +E +K+            ++S D     S P YG        
Sbjct  64   VIKVELLGWMHRKFRQNSSEPLKDFAIGHSCNCLTGQSSLDDQQFYSKPNYGTKPFRQPQ  123

Query  156  -------FSGNPNTTCTYQKVIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdep  314
                   F+G        ++  +E     ++E+FHGFL+IGTLG               P
Sbjct  124  RDHLRKSFAG--VEAARVEEDYEEESSSAISELFHGFLAIGTLGSDPN-----IPDPSTP  176

Query  315  ptptfptsfeetttQITDQDLKLITIELEKFLEAEEDAQ------------SSKRSSYAS  458
                   +  E  T++T+ +LKLI  ELEK L AE   +            S+ RSS+ S
Sbjct  177  TFAISVENITEKETEVTENELKLINDELEKVLGAEVKEEGCNDSSGRNSHVSTGRSSHGS  236

Query  459  IITLTDKTQQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVV  626
             ITL+ K  +   ++    + CPLQ Y FG    LSE+    K E   SL E  Q   + 
Sbjct  237  TITLSGKPMEGPDTNGNGTIVCPLQGYLFGSAIELSETTTVAKKEHRTSLGELFQRTKIT  296

Query  627  KGN  635
            + N
Sbjct  297  EEN  299



>ref|XP_008222201.1| PREDICTED: uncharacterized protein LOC103322099 isoform X1 [Prunus 
mume]
Length=394

 Score = 74.3 bits (181),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 101/237 (43%), Gaps = 60/237 (25%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNP---NTTCTYQ-----KVIKETE  212
            MKLLGWMHRK + N NE  K    F   +     SG P   +  C  +     K  K+T+
Sbjct  1    MKLLGWMHRKFRQNSNEPFK---VFVIENSCACLSGQPSLDDQQCYPKPNCGTKPFKQTQ  57

Query  213  E-----KPLN---------------------EVFHGFLSIGTLGGGSEEAAALFNstdep  314
                  K  N                     E+FHGFL+IGTL  GSE+   +      P
Sbjct  58   RDQHLRKSFNGLEAARAEEEYYEDESSAAASELFHGFLAIGTL--GSEQ---VITEPSTP  112

Query  315  ptptfptsfeetttQITDQDLKLITIELEKFLEAEEDAQ-------------SSKRSSYA  455
                   +  E  T++T+ +LKLI  ELEK L A+                 S+ RSS+ 
Sbjct  113  TLAISVENITEKETEVTENELKLINDELEKVLAADSAKDEICNDSSGRNSHVSNGRSSHG  172

Query  456  SIITLTDKTQQDS-SSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQ  611
            S ITL+ KT + S S+       CPLQ Y FG    LSE+    K E   SL E  Q
Sbjct  173  STITLSGKTLEGSESNGINGTTVCPLQGYLFGSAYELSETTTVAKKEHRTSLGELFQ  229



>gb|KDO63890.1| hypothetical protein CISIN_1g047473mg, partial [Citrus sinensis]
Length=373

 Score = 73.9 bits (180),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 121/392 (31%), Positives = 177/392 (45%), Gaps = 85/392 (22%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVKNRT-----------------SFDPSHPT----YGFSGNPN  173
             M +LGW H++ + N  E  K+ T                  +D S P     YG   + +
Sbjct  1     MTILGWKHQRKRQNSVEPFKDFTLGNYCICLSAQSTLDYQDYD-SKPNFGSRYGSKSSKH  59

Query  174   TTCTYQKVIKETEEKP------------LNEVFHGFLSIGTLGG---GSEEAAALFNstd  308
             +   Y+    E E +             ++E FHGFL+IGTLG     SE A   F    
Sbjct  60    SRREYENSTSELEAEEAKESFNEETSAVISEPFHGFLTIGTLGMEPISSEPATPTF----  115

Query  309   epptptfptsfeetttQITDQDLKLITIELEKFL----EAEEDAQSSKRSSYASIITLTD  476
                      +  +  T++T+ DLKLI  +LEKFL    E EE+ ++S R+SY SI+TL D
Sbjct  116   ----AISGENIIDEKTEVTEYDLKLINDQLEKFLEAEAEEEENIETSGRNSYVSIVTLCD  171

Query  477   KTQQDSSSSPT-LLLDCPLQKYFFGLS----ESDMAVKNEEEASLSEDLQEVVVVKGNDK  641
                + ++S     ++ CPLQ Y FG S    E+ + VK +E+ASL E          +  
Sbjct  172   NPMEGANSEDYGKMMVCPLQGYLFGSSIEFPETIIEVK-KEKASLMELFHRRETTDKSSM  230

Query  642   KRAGKAQF--------AKNFmkkmlkslnsnskskTHMHAPNESAPP---Tknkfpkvlk  788
             +++ K +          KN +KKM K   ++SKS T    P++S      TK K  KV++
Sbjct  231   EKSSKVEMPAKQKHKSVKNLIKKMFKKFRASSKSPT----PSDSDTAFVSTKKKLHKVIQ  286

Query  789   mlkkkvHPERYIGEKGAEKDENRVKGSRLRSSSDTTGNIWFRQMISP---EEEELI----  947
             M  +K+HPE+ I EK  +   N++K S       T G +      SP   E ++ I    
Sbjct  287   MFHRKIHPEKSIAEKELKSRTNKIKSSPYE-GVHTDGGLDNDNKSSPPGCESKDQIEYHK  345

Query  948   ---MTTSQSCSGSGRGGAFMENNGHWIKTDAD  1034
                M +     GS   G    N  HWIKTDAD
Sbjct  346   IEKMLSQYGLRGSTSSG----NREHWIKTDAD  373



>ref|XP_006589802.1| PREDICTED: uncharacterized protein LOC102661485 [Glycine max]
Length=355

 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 103/231 (45%), Gaps = 48/231 (21%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNR----TSFDPSH----PTYGFSGNPNTTCTYQKVIK---  203
            MKLLGWMHRK + N  E  K+      S D  H     ++G   +      +QK ++   
Sbjct  1    MKLLGWMHRKFRQNSAEPFKDLIIGGNSCDEEHNYPKASFGNYKHVKQQSHHQKELRKSF  60

Query  204  ---ETEEK---PLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQIT  365
               E EE     + E+FHGFL+IGTLG  +                    +  E   ++T
Sbjct  61   DHDEYEEDSAGAMYELFHGFLAIGTLGSEASTTPTF---------AISLENITEKEDEVT  111

Query  366  DQDLKLITIELEKFLEAEED-----AQSSKRSSYASIITLTDKTQQDSSSSPTLL-----  515
            + +LKLI  ELEK L   ED     + S  RSS+ SIITL+    + +++  TLL     
Sbjct  112  ENELKLINDELEKVLVLGEDNDEPSSISCGRSSHGSIITLSGGGGKPAAA--TLLEGDQS  169

Query  516  ---LDCPLQKYFFG----LSE---SDMAVKNEEEASLSEDLQEVVVVKGND  638
                 CPLQ Y FG    LSE   +    K E   SL E  Q   + + N+
Sbjct  170  NGNAVCPLQGYLFGSAIELSETTTTVTVAKKEHRTSLGELFQRTKLAEENN  220



>gb|EYU34820.1| hypothetical protein MIMGU_mgv1a022125mg [Erythranthe guttata]
Length=302

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 98/207 (47%), Gaps = 51/207 (25%)
 Frame = +3

Query  57   MKLLGWMHRKLKHN-CNEAVKN-------------RTSFD-------PSHPTYGFSGNPN  173
            MKLLGWMHRKLKHN C EA+ N             +T FD       P+ P       P+
Sbjct  1    MKLLGWMHRKLKHNGCIEALNNNSTIGNGSTCFSVQTVFDEHKYYIEPAKPL------PH  54

Query  174  TTCTYQK--------VIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptf  329
            +   ++K        V++ + ++ L E F  FLSIGT G         F +    PT   
Sbjct  55   SNMIHRKSSNGYEGGVVEASYKEELFEPF-DFLSIGTFGYE-------FITDTPTPTLAV  106

Query  330  ptsfeetttQI---TDQDLKLITIELEKFLEAEEDAQSSKRSSYASIITLTDKTQQDSSS  500
                     QI   T+ D+ ++  EL+KF+EAEE A SS+R+S ASIITL+ K   +   
Sbjct  107  SIEKLTGQQQIEMITENDVNVMKNELDKFIEAEE-AVSSQRTSQASIITLSYKPIFEGED  165

Query  501  SPT----LLLDCPLQKYFFGLSESDMA  569
            S      ++  CPLQ Y F  S   +A
Sbjct  166  SIDGHMHMVATCPLQNYLFAASVELLA  192



>gb|KHN37253.1| hypothetical protein glysoja_013468 [Glycine soja]
Length=417

 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 103/231 (45%), Gaps = 48/231 (21%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNR----TSFDPSH----PTYGFSGNPNTTCTYQKVIK---  203
            MKLLGWMHRK + N  E  K+      S D  H     ++G   +      +QK ++   
Sbjct  1    MKLLGWMHRKFRQNSAEPFKDLIIGGNSCDEEHNYPKASFGNYKHVKQQSHHQKELRKSF  60

Query  204  ---ETEEK---PLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQIT  365
               E EE     + E+FHGFL+IGTLG  +                    +  E   ++T
Sbjct  61   DHDEYEEDSAGAMYELFHGFLAIGTLGSEASTTPTF---------AISLENITEKEDEVT  111

Query  366  DQDLKLITIELEKFLEAEED-----AQSSKRSSYASIITLTDKTQQDSSSSPTLL-----  515
            + +LKLI  ELEK L   ED     + S  RSS+ SIITL+    + +++  TLL     
Sbjct  112  ENELKLINDELEKVLVLGEDNDEPSSISCGRSSHGSIITLSGGGGKPAAA--TLLEGDQS  169

Query  516  ---LDCPLQKYFFG----LSE---SDMAVKNEEEASLSEDLQEVVVVKGND  638
                 CPLQ Y FG    LSE   +    K E   SL E  Q   + + N+
Sbjct  170  NGNAVCPLQGYLFGSAIELSETTTTVTVAKKEHRTSLGELFQRTKLAEENN  220



>ref|XP_010027268.1| PREDICTED: uncharacterized protein LOC104417743 [Eucalyptus grandis]
Length=395

 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 99/309 (32%), Positives = 138/309 (45%), Gaps = 36/309 (12%)
 Frame = +3

Query  222   LNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIELE  401
             + ++FHGFL+IGTLG       AL +    P       +  E  T++T+ DLKLI  ELE
Sbjct  91    ITDLFHGFLAIGTLGS----EPALGHDPATPTFSYSLENITEKETEVTENDLKLINEELE  146

Query  402   KFLEAEEDAQ-------------SSKRSSYASIITLTDKTQQDSSSSPTLLLDCPLQKYF  542
             K L AE +               S+ RSS+ S ITL  K +   ++S      CPLQ Y 
Sbjct  147   KVLAAEANKDEWGNQSSGRNSHVSTGRSSHVSTITLGGKVEAQETNSSNGSAVCPLQGYL  206

Query  543   FG----LSESDMAVKNEEEASLSEDLQEVVVVK-----GNDKKRAGKAQFAKNFmkkmlk  695
             FG    + E+    K E   SL E  Q+  + +     G     +    F K  +KK   
Sbjct  207   FGSAVEVLEAPKVDKKEHRTSLGELFQKTKMTEEEFGYGKKDWDSSMVHFVKKKLKKKAL  266

Query  696   slnsnskskTHMHAPNESAPPTknkfpkvlkmlkkkvHPER-YIGEKGAEKDENRVKGSR  872
               N  ++S +     +  +   + K  K+L M  KKVHPE     +K  E+ +  VK   
Sbjct  267   QANPAARSSSFDAGTSSDSGSAETKLHKILHMFHKKVHPENSSAAKKSYEQQKIEVKKKA  326

Query  873   LRSSSDTTGNIWFRQ---MISPEEEELIMTTSQSCSGSGRGGAFM---ENNGH---WIKT  1025
              R      GN    +   +I PE+  L     +  S S R    +   E+NG+   WIKT
Sbjct  327   TRGHGHNVGNQVLPEEDIVIVPEKILLKEKIRRLRSQSNRARILVTGDESNGNRECWIKT  386

Query  1026  DADYLVLEL  1052
             DADYLVLEL
Sbjct  387   DADYLVLEL  395



>ref|XP_006288042.1| hypothetical protein CARUB_v10001273mg [Capsella rubella]
 gb|EOA20940.1| hypothetical protein CARUB_v10001273mg [Capsella rubella]
Length=357

 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 107/379 (28%), Positives = 157/379 (41%), Gaps = 69/379 (18%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVKN------------RTSFDPS--HPTYGFSGNPNTTCTYQ-  191
             MK  GWMH K + N  E +K+             TS D    +PT       NT    Q 
Sbjct  1     MKFWGWMHHKFRENSKEPLKDATTGNSYAIVSAHTSLDSQDGYPTACAGSRYNTGFRKQV  60

Query  192   -------------KVIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfp  332
                           + +  +++  ++ F GFL+IGTLGG +     L N    P      
Sbjct  61    NLFQESSFAGPMENIEENIKDERTSDFFDGFLAIGTLGGET-----LLNEPATPTFGMSF  115

Query  333   tsfeetttQITDQDLKLITIELEKFLEAEE-------DAQSSKRSSYASIITLTDKTQQD  491
                      +T+ DLKLI+ ELEKFLEAE          ++S  ++ AS I   +    +
Sbjct  116   EDPALDNADVTENDLKLISNELEKFLEAEAKEGQHQPSGRNSDTNTIASTIEAIEGLDAE  175

Query  492   SSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGNDKKRAGKA  659
               + P   +  PLQ+Y FG      E+ +A K +E ASL E  Q   V   + +   GK 
Sbjct  176   EDNQP---MKFPLQEYLFGSLNEFPETKIAGK-KERASLGELFQITEVQDKHSENIYGKK  231

Query  660   QFAKNFmkkmlkslnsnskskTHMHAPNESA-------PPTknkfpkvlkmlkkkvHPER  818
             +  K        + +   K    +H  ++S+         TK KF K++++  +KVHPE 
Sbjct  232   K--KQTSSAHKSAKHLVKKVLKKIHPSSKSSVSGKTEVDSTKKKFQKMVQVFHRKVHPED  289

Query  819   YIGEKGAEKDENRVKGSRLRSSSDTTGNIWFRQMISPEEEELIMTTSQSC-SGSGRGGAF  995
              I E          + S+  S      +I F ++ S +E       S+ C     R    
Sbjct  290   SIMESEIYNSIANPENSKANSI-----DITFEKVNSCQE------ASKRCIQYELRSSRS  338

Query  996   MENNGHWIKTDADYLVLEL  1052
              +N  HWIKTD DY VLEL
Sbjct  339   AKNGEHWIKTDEDYFVLEL  357



>ref|XP_008459858.1| PREDICTED: uncharacterized protein LOC103498856 [Cucumis melo]
Length=385

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 107/232 (46%), Gaps = 46/232 (20%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN---------------RTSFDP-------SHPTYGFSGNP  170
            MKLLGWMHRK + N  E +K+               ++S  P        H    F+G  
Sbjct  1    MKLLGWMHRKFRQNSGEPLKDFAIGQQPLDDQQYISKSSIKPFKQSQREQHLRKSFAGLE  60

Query  171  NTTCTYQKVIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeet  350
            +      +  ++    P++E+FHGFL+IGTLG     +  + +    P       +  E 
Sbjct  61   SEVG--DEDYEDESSHPMSEIFHGFLAIGTLG-----SEQVISDPMTPKFSISVENITEN  113

Query  351  ttQITDQDLKLITIELEKFLEAE--EDA--QSSKRSSYASI--------ITLTDKTQQDS  494
             T++T+ +LKLI  ELEK L AE  +D    SS R+SY S+        ITL+ K     
Sbjct  114  ETEVTENELKLINDELEKVLGAETKDDGYNDSSGRNSYVSMGRSSHGSTITLSGKPMDGL  173

Query  495  SSSPTLLLDCPLQKYFFG----LSESDMAV-KNEEEASLSEDLQEVVVVKGN  635
             S+ +  + CPLQ Y FG    LSE+   V K E   SL E  Q   + + N
Sbjct  174  ESNLSGTIICPLQGYLFGSAIELSETTTTVAKKENRTSLGELFQRSKIAEEN  225



>ref|NP_196913.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAU44552.1| hypothetical protein AT5G14090 [Arabidopsis thaliana]
 gb|AAV63926.1| hypothetical protein At5g14090 [Arabidopsis thaliana]
 gb|AED91986.1| uncharacterized protein AT5G14090 [Arabidopsis thaliana]
Length=358

 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 109/376 (29%), Positives = 151/376 (40%), Gaps = 62/376 (16%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVK-----NRTSFDPSHPTYGFSGNPNTTCT-------YQKVI  200
             MK  GWMH K + N  E +K     N  S   +HP+        T C        ++K +
Sbjct  1     MKFWGWMHHKFRENSKEPLKDASTGNSYSILSAHPSLDSQEVYPTACAGSRYNTGFRKQV  60

Query  201   KETEEKPL----------------NEVFHGFLSIGTLGGGSEEAAALFNstdepptptfp  332
                +E                   ++ F GFL+IGTLGG       L      P      
Sbjct  61    NLFQESSFAGPKQYTEEDFKDERNSDFFDGFLAIGTLGG----ETLLDEQPATPTFGMSF  116

Query  333   tsfeetttQITDQDLKLITIELEKFLEAEE-------DAQSSKRSSYASIITLTDKTQQD  491
                      +T+ DLKLI+ EL+KFLEAE          ++S  ++ AS I   +    +
Sbjct  117   EDPAIDDADVTENDLKLISNELDKFLEAEAKEGHHQPSGRNSDTNTIASTIEAIEGVDDE  176

Query  492   SSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGNDKKRAGKA  659
               + P   +  PLQ+YFFG    L ES +A K ++ ASL E  Q   V     +   GK 
Sbjct  177   EDNQP---MKFPLQEYFFGSLIELPESKIAGK-KDRASLGELFQITEVQDKQSENIYGKK  232

Query  660   QFAKNFmkkmlkslnsnskskTHMHAPNE-SAPP----TknkfpkvlkmlkkkvHPERYI  824
             +   N   K  K L      K H  +    S  P    TK KF K++++  +KVHPE  I
Sbjct  233   KKQPNSAHKSAKHLVKKVLKKIHPSSRGSVSGKPEVDSTKKKFQKMVQVFHRKVHPEESI  292

Query  825   GEKGAEKDENRVKGSRLRSSSDTTGNIWFRQMISPEEEELIMTTSQSCSGSGRGGAFMEN  1004
              E          K S+  S   T   +      S    +  + +S+S           +N
Sbjct  293   METKIYSSVANPKSSKANSIDLTFEKVNHCHEASKRCIQYELRSSRSA----------KN  342

Query  1005  NGHWIKTDADYLVLEL  1052
               HWIKTD DY VLEL
Sbjct  343   GEHWIKTDEDYFVLEL  358



>ref|XP_007139293.1| hypothetical protein PHAVU_008G017100g [Phaseolus vulgaris]
 gb|ESW11287.1| hypothetical protein PHAVU_008G017100g [Phaseolus vulgaris]
Length=361

 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 95/232 (41%), Gaps = 53/232 (23%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVK--------NRTSFDPSHPTYGFSGNPNTTCTYQKVIKE--  206
            MKLLGWMHRK + N  E  K        N  S  P          PN      K  ++  
Sbjct  1    MKLLGWMHRKFRQNSGEPFKDLVIGNSCNCLSGQPPFDDEQIYQKPNLGIRLSKHAQKGH  60

Query  207  -------------TEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfee  347
                          +E    E F GFL+IGTL  GSE+ +        P  P    S  E
Sbjct  61   NLRNSFAGLEAARVDEDYEGEFFPGFLAIGTL--GSEQVS----DPSTPSFPISVESITE  114

Query  348  tttQITDQDLKLITIELEKFLEAE--EDAQ------------------SSKRSSYASIIT  467
               ++T+ DLKLI  ELEK L AE  +D                    S+ RSS+ SIIT
Sbjct  115  KEDEVTENDLKLINDELEKVLGAETKDDVSIDSSRRTSHVSTGRSSHVSTGRSSHVSIIT  174

Query  468  LTDKTQQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQ  611
            L+ K  + +  +      CPLQ Y FG    LSE+  A K E   SL E  Q
Sbjct  175  LSGKPIEGTEPNGNGAAICPLQGYLFGTAIELSETTAAAKKENRTSLGELFQ  226



>ref|XP_011020800.1| PREDICTED: uncharacterized protein LOC105123041 [Populus euphratica]
Length=384

 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 76/241 (32%), Positives = 102/241 (42%), Gaps = 57/241 (24%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVK--------NRTSFDPSHPTYGFSGNPNT-TCTYQKVIKET  209
            MKLLGWMHRKL+ N +E +K        N  +  PS   +     PN  T TY++  KE 
Sbjct  1    MKLLGWMHRKLRQNGSEPLKDFAIGNACNCLTGQPSLDDHQHYRKPNYGTRTYRQAQKEQ  60

Query  210  EEKPLN---------------------------EVFHGFLSIGTLGGGSEEAAALFNstd  308
                 +                           E+FHGFL+IGT G     +  +     
Sbjct  61   LRNSFSGLETARVEEEEKEEEGDYEEESSAEISELFHGFLAIGTFG-----SEPINTDPS  115

Query  309  epptptfptsfeetttQITDQDLKLITIELEKFLEAEEDAQSSKRSSYA--------SII  464
             P  P    +  E  T++T+ +LKLI  ELEK L  +    SS R+SY         S I
Sbjct  116  TPTFPISVENITEKETEVTENELKLINDELEKVLAEDCCNDSSGRNSYVSAGRSSHGSTI  175

Query  465  TLTDKTQQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKG  632
            TL+ K  +   S+      CPLQ Y FG    LSE+    K E   SL E  Q+  + + 
Sbjct  176  TLSGKPVEGRDSNAV----CPLQGYLFGSSIELSETTPVAKKEHRTSLGELFQKTKIAEE  231

Query  633  N  635
            N
Sbjct  232  N  232



>ref|XP_009121698.1| PREDICTED: uncharacterized protein LOC103846512 [Brassica rapa]
Length=339

 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 97/213 (46%), Gaps = 36/213 (17%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNPN-------TTCTYQ-KVIKETE  212
            MK  GWMH K + N  + +K+ T+ +   P    S +P+       T  + Q  + +E+ 
Sbjct  1    MKFWGWMHHKSRDNSKQLLKDATTGNGHFP---LSAHPSLDSPRYSTGISKQFNLFQESS  57

Query  213  EKPLNEV-----FHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQDL  377
               L+E      FHGFL+IGTLGG         +    P              ++T+ DL
Sbjct  58   FAGLSEAGNSDFFHGFLAIGTLGG-----ETFLDEPATPTFGMTSGDPATDNAEVTENDL  112

Query  378  KLITIELEKFLEAEE-------DAQSSKRSSYASIITLTDKTQQDSSSSPTLLLDCPLQK  536
            KLI+ ELEKFLEAE          ++S  ++ AS I   +    +    P   +  PLQ+
Sbjct  113  KLISNELEKFLEAEAKEGHNQPSGRNSDTTTIASTIEAAEGVDAEEDDQP---MKFPLQE  169

Query  537  YFFG----LSESDMAVKNEEEASLSEDLQEVVV  623
            Y FG     SE+ +A K +E ASL E  Q   V
Sbjct  170  YLFGSQIESSETKVAGK-KERASLGELFQATEV  201



>ref|XP_003551814.1| PREDICTED: uncharacterized protein LOC100795458 isoform X1 [Glycine 
max]
Length=357

 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 101/226 (45%), Gaps = 46/226 (20%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN----RTSFDPSH----PTYGF-------SGNPNTTCTYQ  191
            MKLLGWMHRKL+ N +E  K+    +   D       P  G         G+ N   ++ 
Sbjct  1    MKLLGWMHRKLRQNSSEPFKDLVIGQAPLDDEQVYQKPNLGIRLSKHAQKGHNNLRNSFA  60

Query  192  KV-IKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITD  368
             +     +E    E F GFL+IGTL  GSE  +   + +  P  P    S  E   ++T+
Sbjct  61   GLEAARVDEDYEGEYFPGFLAIGTL--GSERVS---DPSTTPSFPISVESITEKEDEVTE  115

Query  369  QDLKLITIELEKFLEAE--EDAQ------------------SSKRSSYASIITLTDKTQQ  488
             DLKLI  ELEK L AE  +D                    S+ RSS+ SIITL+ K  +
Sbjct  116  NDLKLINDELEKVLGAETKDDVSIDSSRRTSHVSTGRSSHVSTGRSSHVSIITLSGKPIE  175

Query  489  DSSSSPTLLLDCPLQKYFFG----LSESD-MAVKNEEEASLSEDLQ  611
             +  +      CPLQ Y FG    LSE+   A K E   SL E  Q
Sbjct  176  GTEPNGNGAAICPLQGYLFGTAIELSETTAAAAKKEHRTSLGELFQ  221



>ref|XP_007161667.1| hypothetical protein PHAVU_001G088600g [Phaseolus vulgaris]
 gb|ESW33661.1| hypothetical protein PHAVU_001G088600g [Phaseolus vulgaris]
Length=380

 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 70/222 (32%), Positives = 100/222 (45%), Gaps = 46/222 (21%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDP----------------------SHPTYGFSGNP  170
            MKL  W+HRKL+ N  E  K+    +P                      + P +  S N 
Sbjct  1    MKLFQWVHRKLRQNNIEPFKDSALGNPCTCLTVQPTLDNQYSQTKPCFITQPRFSKSDNQ  60

Query  171  NTTCTYQKVI-----KETEEKPL--NEVFHGFLSIGTLGGGSEEAAALFNstdepptptf  329
                +Y  ++     K  EE P   +++F GFL+IGTLG     A  + +    P     
Sbjct  61   ENQISYSGLVDSREDKSQEETPAISSQLFQGFLTIGTLG-----AETVTDEPGTPTFAMP  115

Query  330  ptsfeetttQITDQDLKLITIELEKFLEAEEDA---QSSKRSSYASIITLTDKTQQDSSS  500
              +    + ++T+ ++KLI+ ELEKFLEAE +     SS R+SY S ITL  K + D   
Sbjct  116  SKNITMRSEEVTENEIKLISYELEKFLEAEREESFHDSSGRNSYVSTITLGGK-EIDGPK  174

Query  501  SPTLL--LDCPLQKYFFG----LSESDMAVKNEEEASLSEDL  608
            +   +    CPLQ Y  G    L E+    K  E ASL+E L
Sbjct  175  AEEYINKAVCPLQGYLLGSSFELPETKQLRK--ERASLAELL  214



>gb|KGN46453.1| hypothetical protein Csa_6G094710 [Cucumis sativus]
Length=378

 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 73/230 (32%), Positives = 105/230 (46%), Gaps = 42/230 (18%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN----RTSFDPSHPTYGFSGNPNTTCTYQKVIKET-----  209
            MKLLGWMHRK + N  E +K+    + S D        S  P      ++ ++++     
Sbjct  1    MKLLGWMHRKFRQNSGEPLKDFAIGQQSLDDQQYISKSSIKPFKQSQREQHLRKSFAGLE  60

Query  210  -----------EEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeettt  356
                          P++E+FHGFL+IGTLG     +  +      P       +  E  T
Sbjct  61   SEVGDEDYEDESSHPMSEIFHGFLAIGTLG-----SEQVIGDPMTPKFSISVENITENET  115

Query  357  QITDQDLKLITIELEKFLEAE--EDA--QSSKRSSYASI--------ITLTDKTQQDSSS  500
            ++T+ +L+LI  ELEK L AE  +D    SS R+SY S+        ITL+ K      S
Sbjct  116  EVTENELRLINDELEKVLGAETKDDGYNDSSGRNSYVSMGRSSHGSTITLSGKPMDGLES  175

Query  501  SPTLLLDCPLQKYFFG----LSESDMAV-KNEEEASLSEDLQEVVVVKGN  635
            + +  + CPLQ Y FG    LSE+   V K E   SL E  Q   + + N
Sbjct  176  NLSGTIICPLQGYLFGSAIELSETTTTVAKKENRTSLGELFQRSKIAEEN  225



>ref|XP_009343132.1| PREDICTED: uncharacterized protein LOC103935107 [Pyrus x bretschneideri]
Length=384

 Score = 71.2 bits (173),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 72/226 (32%), Positives = 97/226 (43%), Gaps = 45/226 (20%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNPNT-TCTYQKVIKETE-EKPLN-  227
            MKLLGWMHRK + N N+  K      PS     +   PN  T ++++V ++    K  N 
Sbjct  1    MKLLGWMHRKFRQNSNDPFKVFVVGQPSLDDQQYYPKPNCGTKSFKQVPRDQHVRKSFNG  60

Query  228  --------------------EVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfee  347
                                E+FHGFL+IGTLG   +    L      P       +  E
Sbjct  61   LEAARTEEEYYEEESSAEASELFHGFLAIGTLGSSDQ----LTTEPSTPTLGISVENITE  116

Query  348  tttQITDQDLKLITIELEKFLEAEEDAQ-------------SSKRSSYASIITLTDKTQQ  488
              T+ T+ +LKLI  ELE+ L A+                 S+ RSS+ S ITL+ K  +
Sbjct  117  KETEATENELKLINDELERELVADPAKDDICNDSSGRNSYVSNGRSSHGSTITLSGKALE  176

Query  489  DS-SSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQ  611
             + S+       CPLQ Y FG    LSE+    K E   SL E  Q
Sbjct  177  GAESNGINGTAVCPLQGYLFGSAYELSETTSVTKKEHRTSLGELFQ  222



>gb|KEH21972.1| WRKY transcription factor-like protein [Medicago truncatula]
Length=272

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 103/214 (48%), Gaps = 38/214 (18%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDP----------SHPTYGFSGNPNTTCTYQKVIKE  206
            MKL  W+HRKL+ N N+  K+    +P          S     FS + N  C  +   +E
Sbjct  1    MKLFQWVHRKLRQNDNDTFKDVKLGNPCACLTLDSQYSQTKQSFS-SINQLCFVKSHHQE  59

Query  207  TE---------EKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQ  359
            ++            ++E+F GFL+IGTLG     A A+ N    P   T   +       
Sbjct  60   SQTSWRREEETSAVVSELFEGFLTIGTLG-----AEAVINEPATPTFATPSENIPMKDAD  114

Query  360  ITDQDLKLITIELEKFLEAEEDA--QSSKRSSYASIITL------TDKTQQDSSSSPTLL  515
            +T+ +LKLI+ ELEKFLE EE++  +SS R+S  S+  +      TD ++ +   +  + 
Sbjct  115  VTENELKLISYELEKFLETEEESFNESSGRNSRLSLSNIKISGKQTDGSEDEDCGNKDV-  173

Query  516  LDCPLQKYFFGLS-ESDMAVK-NEEEASLSEDLQ  611
              CPLQ Y  G S E    V+  +E ASL+E  Q
Sbjct  174  --CPLQGYLLGSSFEIPEKVQVRKERASLAELFQ  205



>ref|XP_008379747.1| PREDICTED: uncharacterized protein LOC103442710 [Malus domestica]
Length=343

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 72/135 (53%), Gaps = 14/135 (10%)
 Frame = +3

Query  222  LNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIELE  401
            ++E+FHGFL+IGTLG  S       N  + P   T   +  +   ++T+ DLKLI+ ELE
Sbjct  61   ISELFHGFLTIGTLGSESS-----INEPETPTFATTLENLTQQKAEVTENDLKLISYELE  115

Query  402  KFLEAEEDAQ----SSKRSSYASIITLTDKTQQDSSSSPTLLLDCPLQKYFFG----LSE  557
            KFLEAE   +    SS R S AS ITL+    ++S          PL+ Y FG    L E
Sbjct  116  KFLEAETKEEGVHASSARDSNASSITLSGMQMEESEDEEYWTAAYPLKGYLFGSSTELPE  175

Query  558  SDMAVKNEEEASLSE  602
            + M  K +E ASL E
Sbjct  176  TTMEAK-KERASLQE  189



>ref|XP_011000964.1| PREDICTED: uncharacterized protein LOC105108372 isoform X2 [Populus 
euphratica]
Length=386

 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 138/309 (45%), Gaps = 52/309 (17%)
 Frame = +3

Query  234   FHGFLSIGTLGG---GSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIELEK  404
             FHGFL+IGTLG     SE A   F             S  E   ++T+ +LK++  ELEK
Sbjct  94    FHGFLTIGTLGSEPITSEPATPTF--------AMSLESITEENIEVTENELKIMNNELEK  145

Query  405   FLEAEEDA----QSSKRSSYASIITLTDKTQQDSSSSPTL--LLDCPLQKYFFG----LS  554
             FLEAE +     +S  RSSY S ITL+   Q +++ +      + CPLQ Y FG    L 
Sbjct  146   FLEAEAEEEGCNESLARSSYVSTITLSG-MQMEATDAEDYGKTVACPLQGYLFGSSVELP  204

Query  555   ESDMAVKNEEEASLSEDLQEVVVVK--GNDKKRAGKAQFAKNFmkkmlkslnsnskskTH  728
             E+ + VK +E+ SL E  +   V     ++K+  G+ Q  K                +T 
Sbjct  205   ETRVGVK-KEKVSLGEMFRMTKVTDEIPSEKEVKGEMQAKKAHKSAKYLIKKILKMFRTT  263

Query  729   MHAPNES-------APPTknkfpkvlkmlkkkvHPERYIGEK---GAEKDENRVKGSRLR  878
                P  S       +  TK    KVLK+  +KVHPE  + E+    + KD+     +   
Sbjct  264   SGNPTPSTRDEASNSVSTKKTLNKVLKVFHRKVHPENPLAEREFTKSHKDKTMTTLNDGG  323

Query  879   SSSDTTGNIWFRQMISP--EEEELIMTTSQS---------CSGSGRGGAFMENNGHWIKT  1025
              +++ T  +  ++   P  +  E +     S         CS S   G +      WIKT
Sbjct  324   YNAELTHQVKEKRKFLPGYKSREGVQCHKNSLKVPQHDHICSNSSANGEY------WIKT  377

Query  1026  DADYLVLEL  1052
             DADYLVLEL
Sbjct  378   DADYLVLEL  386



>ref|XP_002871601.1| hypothetical protein ARALYDRAFT_488241 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47860.1| hypothetical protein ARALYDRAFT_488241 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 104/378 (28%), Positives = 152/378 (40%), Gaps = 66/378 (17%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVK-----NRTSFDPSHPTYGFSGNPNTTCT-------YQKVI  200
             MK  GWMH K + N  E +K     N  S   +HP+        T C        ++K +
Sbjct  1     MKFWGWMHHKFRENSKEPLKDASTGNSYSILSAHPSLDSQEVYPTACAGSRYNTGFRKQV  60

Query  201   KETEEKPL----------------NEVFHGFLSIGTLGGGSEEAAALFNstdepptptfp  332
                +E                   ++ F GFL+IGTLGG +     L      P      
Sbjct  61    NLFQESSFAGPKGYTEENFKDERNSDFFDGFLAIGTLGGET----LLDEQPATPTFGMSF  116

Query  333   tsfeetttQITDQDLKLITIELEKFLEAEE-------DAQSSKRSSYASIITLTDKTQQD  491
                      +T+ DLKLI+ ELEKFLEAE          ++S  ++ AS I   +    +
Sbjct  117   EDPAIDDADVTENDLKLISNELEKFLEAEAKEGHHQPSGRNSDTNTIASTIEAIEGLDDE  176

Query  492   SSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGNDKKRAGKA  659
               + P   +  PLQ+Y FG      E+ +A K +E ASL E  Q   V+  N +   GK 
Sbjct  177   KDNQP---MKFPLQEYLFGSLNEFPETKIAGK-KERASLGELFQITEVLDENSENIYGKK  232

Query  660   QFAKNFmkkmlkslnsnskskTHMHAPNESA-------PPTknkfpkvlkmlkkkvHPER  818
             +  K        + +   K    +H  + S+         TK KF K++++  +KVHPE 
Sbjct  233   K--KQTSSAHKSAKHLVKKVLKKIHPSSRSSVSGKTEVDSTKKKFQKMVQVFHRKVHPEE  290

Query  819   YIGEKGAEKDENRVKGSRLRSSSDTTGNIWFRQMISPEEEELIMTTSQSCSGSGRGGAFM  998
              I E          K S+  S   T       + ++P  E     +++      R     
Sbjct  291   SIMETEIYSSVANPKNSKANSIDLTF------EKVNPCHE----ASNRCIQYELRSSRSA  340

Query  999   ENNGHWIKTDADYLVLEL  1052
             +N  HWIKTD  Y VLEL
Sbjct  341   KNGEHWIKTDEAYFVLEL  358



>ref|XP_004157635.1| PREDICTED: uncharacterized protein LOC101232263, partial [Cucumis 
sativus]
Length=382

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 107/233 (46%), Gaps = 42/233 (18%)
 Frame = +3

Query  48   LMKMKLLGWMHRKLKHNCNEAVKN----RTSFDPSHPTYGFSGNPNTTCTYQKVIKET--  209
            + +++LLGWMHRK + N  E +K+    + S D        S  P      ++ ++++  
Sbjct  1    MEELQLLGWMHRKFRQNSGEPLKDFAIGQQSLDDQQYISKSSIKPFKQSQREQHLRKSFA  60

Query  210  --------------EEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfee  347
                             P++E+FHGFL+IGTLG     +  +      P       +  E
Sbjct  61   GLESEVGDEDYEDESSHPMSEIFHGFLAIGTLG-----SEQVIGDPMTPKFSISVENITE  115

Query  348  tttQITDQDLKLITIELEKFLEAE--EDA--QSSKRSSYASI--------ITLTDKTQQD  491
              T++T+ +L+LI  ELEK L AE  +D    SS R+SY S+        ITL+ K    
Sbjct  116  NETEVTENELRLINDELEKVLGAETKDDGYNDSSGRNSYVSMGRSSHGSTITLSGKPMDG  175

Query  492  SSSSPTLLLDCPLQKYFFG----LSESDMAV-KNEEEASLSEDLQEVVVVKGN  635
              S+ +  + CPLQ Y FG    LSE+   V K E   SL E  Q   + + N
Sbjct  176  LESNLSGTIICPLQGYLFGSAIELSETTTTVAKKENRTSLGELFQRSKIAEEN  228



>gb|KHN27188.1| hypothetical protein glysoja_025472, partial [Glycine soja]
Length=384

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 75/235 (32%), Positives = 101/235 (43%), Gaps = 55/235 (23%)
 Frame = +3

Query  57   MKLLGWMHRKLKHN-------------CN----------EAVKNRTSFDPSHPTYGFSGN  167
            ++LLGWMHRKL+ N             CN          E V  + S       +   G+
Sbjct  1    LQLLGWMHRKLRQNSSEPFKDLVIGNSCNCLSGQAPLDDEQVYQKPSLGVKLSKHAQKGH  60

Query  168  PNTTCTYQKV-IKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfe  344
             N   ++  V     +E    E F GFL+IGTLG     +  + + +  P  P    S  
Sbjct  61   NNLRNSFAGVEAARVDEDYEGEYFPGFLAIGTLG-----SEPISDPSTTPSFPISVESIT  115

Query  345  etttQITDQDLKLITIELEKFLEAE--EDAQ------------------SSKRSSYASII  464
            E   ++T+ DLKLI  ELEK L AE  +D                    S+ RSS+ASII
Sbjct  116  EKEDEVTENDLKLINDELEKVLGAETKDDVSIDSSRRTSHVSTGRSSHVSTGRSSHASII  175

Query  465  TLTDKTQQDSSSSPTLLLDCPLQKYFFG----LSE--SDMAVKNEEEASLSEDLQ  611
            TL+ K  + + ++      CPLQ Y FG    LSE  +  A K E   SL E  Q
Sbjct  176  TLSGKPIEGTEANGNGAAICPLQGYLFGTAIELSETTTTAAAKKEHRTSLGELFQ  230



>ref|XP_007031921.1| Regulator of nonsense transcripts 3A, putative [Theobroma cacao]
 gb|EOY02847.1| Regulator of nonsense transcripts 3A, putative [Theobroma cacao]
Length=513

 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 85/156 (54%), Gaps = 20/156 (13%)
 Frame = +3

Query  231  VFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIELEKFL  410
            +FHGFL+IGTLG      + L  S    PT        E   ++T+ DLK+I  ELEKFL
Sbjct  219  LFHGFLTIGTLG------SELIISEPVTPTFAMSLENSEDKAEVTENDLKIINDELEKFL  272

Query  411  EAEEDA----QSSKRSSYASIITLTDKTQQDSSS---SPTLLLDCPLQKYFFG----LSE  557
            EAE +     +SS R+S  S ITL+ K  Q++++     T++  CPLQ Y FG    L E
Sbjct  273  EAEAEEHGSNESSGRNSQVSTITLSGKPMQEANAKEYGKTIV--CPLQGYLFGSSIELPE  330

Query  558  SDMAVKNEEEASLSEDLQEVVVVKGNDKKRAGKAQF  665
            +   VK +E+ASL+E      + + +  ++ GK + 
Sbjct  331  ARFEVK-KEKASLAELFYRTKIAEESPTEKCGKEEM  365



>ref|XP_010492202.1| PREDICTED: uncharacterized protein LOC104769639 [Camelina sativa]
Length=357

 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 72/234 (31%), Positives = 100/234 (43%), Gaps = 51/234 (22%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRT-----SFDPSHPTY-----------------GFSGNP  170
            MKL GWMH K + N  E +K+ T     S   SHP+                  GF    
Sbjct  1    MKLWGWMHHKFRENSKEPLKDATTGNSYSILSSHPSLDSQDVYPAACAGSRYNTGFRKQV  60

Query  171  N--TTCTYQKVIKETEEKPLNE----VFHGFLSIGTLGGGSEEAAALFNstdepptptfp  332
            N     ++   ++  EE   +E     F GFL+IGTLGG       L +    P      
Sbjct  61   NLFQESSFAGPMENIEEHLKDERNSDFFDGFLAIGTLGG-----ETLHDEPATPTFGMSF  115

Query  333  tsfeetttQITDQDLKLITIELEKFLEAEE-------DAQSSKRSSYASIITLTDKTQQD  491
                     +T+ DLKLI+ ELEKFLEAE          ++S  ++ AS I   +    +
Sbjct  116  EDPALDNADVTENDLKLISNELEKFLEAEAKEGHHLPSGRNSDTNTIASTIEAIEGLDAE  175

Query  492  SSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGNDK  641
              + P   +  PLQ+Y FG      E+ +A K +E ASL E  Q   + +G DK
Sbjct  176  EDNQP---MKFPLQEYLFGSLNEFPETKIAGK-KERASLGELFQ---ITEGQDK  222



>gb|KHN13847.1| hypothetical protein glysoja_016131 [Glycine soja]
Length=365

 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 77/234 (33%), Positives = 101/234 (43%), Gaps = 54/234 (23%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN------------RTSFDPSH----PTYGF-------SGN  167
            MKLLGWMHRKL+ N +E  K+            +   D       P  G         G+
Sbjct  1    MKLLGWMHRKLRQNSSEPFKDLVIGNSCNCLSGQAPLDDEQVYQKPNLGIRLSKHAQKGH  60

Query  168  PNTTCTYQKV-IKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfe  344
             N   ++  +     +E    E F GFL+IGTLG  SE  +   + +  P  P    S  
Sbjct  61   NNLRNSFAGLEAARVDEDYEGEYFPGFLAIGTLG--SERVS---DPSTTPSFPISVESIT  115

Query  345  etttQITDQDLKLITIELEKFLEAE--EDAQ------------------SSKRSSYASII  464
            E   ++T+ DLKLI  ELEK L AE  +D                    S+ RSS+ SII
Sbjct  116  EKEDEVTENDLKLINDELEKVLGAETKDDVSIDSSRRTSHVSTGRSSHVSTGRSSHVSII  175

Query  465  TLTDKTQQDSSSSPTLLLDCPLQKYFFG----LSESD-MAVKNEEEASLSEDLQ  611
            TL+ K  + +  +      CPLQ Y FG    LSE+   A K E   SL E  Q
Sbjct  176  TLSGKPIEGTEPNGNGAAICPLQGYLFGTAIELSETTAAAAKKEHRTSLGELFQ  229



>ref|XP_006603013.1| PREDICTED: uncharacterized protein LOC100795458 isoform X2 [Glycine 
max]
Length=365

 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 77/234 (33%), Positives = 101/234 (43%), Gaps = 54/234 (23%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN------------RTSFDPSH----PTYGF-------SGN  167
            MKLLGWMHRKL+ N +E  K+            +   D       P  G         G+
Sbjct  1    MKLLGWMHRKLRQNSSEPFKDLVIGNSCNCLSGQAPLDDEQVYQKPNLGIRLSKHAQKGH  60

Query  168  PNTTCTYQKV-IKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfe  344
             N   ++  +     +E    E F GFL+IGTLG  SE  +   + +  P  P    S  
Sbjct  61   NNLRNSFAGLEAARVDEDYEGEYFPGFLAIGTLG--SERVS---DPSTTPSFPISVESIT  115

Query  345  etttQITDQDLKLITIELEKFLEAE--EDAQ------------------SSKRSSYASII  464
            E   ++T+ DLKLI  ELEK L AE  +D                    S+ RSS+ SII
Sbjct  116  EKEDEVTENDLKLINDELEKVLGAETKDDVSIDSSRRTSHVSTGRSSHVSTGRSSHVSII  175

Query  465  TLTDKTQQDSSSSPTLLLDCPLQKYFFG----LSESD-MAVKNEEEASLSEDLQ  611
            TL+ K  + +  +      CPLQ Y FG    LSE+   A K E   SL E  Q
Sbjct  176  TLSGKPIEGTEPNGNGAAICPLQGYLFGTAIELSETTAAAAKKEHRTSLGELFQ  229



>ref|XP_010682717.1| PREDICTED: uncharacterized protein LOC104897530 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 117/394 (30%), Positives = 162/394 (41%), Gaps = 80/394 (20%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVK----NRTSFDPSH----PTYGFSGNPNTTCTYQKVIKETE  212
             MKLL WMHRK K   +E +K     ++  D  H       G     + T        E E
Sbjct  1     MKLLTWMHRKFKQGNSETLKECPMGQSLLDDPHFYQKQIQGRKRRSSFTSVETSKFAEYE  60

Query  213   EKP----LNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQDLK  380
              K       E F GFL+IGTLG       ++ +  + P          E   ++T+ +L 
Sbjct  61    RKSSIDEFPEYFEGFLAIGTLGMRD----SVISEPETPTFAVSFEKLAEGEAEVTENELA  116

Query  381   LITIELEKFL--EAEEDAQ----------SSKRSSYASIITLTDKTQQDSSSSPTLLLDC  524
             LI  ELE+ L  EA++D            S+ R S+AS ITL+ K  +   S+   L+ C
Sbjct  117   LINDELERELAAEAKDDGYTDSSGRNSHVSNGRISHASTITLSGKPLEIPESTGNNLMYC  176

Query  525   PLQKYFFG----LSESDMAVKNEEEASL--------SEDLQEVVVVKG-----NDKKRAG  653
             PLQ+Y  G    L E   A K E   SL        +E+  EV   +G      D  +  
Sbjct  177   PLQEYLLGSAVDLPEKATAPKKENRTSLGELFEKHKAEESSEVKCKRGEKREDKDGDKTA  236

Query  654   KAQFAKNFmkkmlkslnsnskskTHMHAPNESAPPTknkfpkvlkmlkkkvHPERYIG--  827
                  K  + K   +L++ S++ T   A + SA P   K  K+L+   KKVHPE  I   
Sbjct  237   SMNLMKKILTKKKNALHAASRNSTRGTAESASAEP---KLCKILQKFHKKVHPECLISTE  293

Query  828   ----------------EKGAEKDENRVKGSRLRSSSDT---TGNIWFRQMISPEEEELIM  950
                             + G  KDE+  +     + S     +G +  R+ IS        
Sbjct  294   KSNKMHNAGIKNMVPWDAGYYKDEHAFRDESTTTFSQKPGQSGYMLCRKSIS-------N  346

Query  951   TTSQSCSGSGRGGAFMENNGHWIKTDADYLVLEL  1052
              T  S  GS   G+       WIKTDADYLVLEL
Sbjct  347   PTQFSEDGSDSNGS----RECWIKTDADYLVLEL  376



>ref|XP_008362102.1| PREDICTED: uncharacterized protein LOC103425780 isoform X1 [Malus 
domestica]
Length=379

 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 98/211 (46%), Gaps = 37/211 (18%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPS------HPTYGFSGNPNTTCT------YQKVI  200
            M+LL W+H K +H   E  K+ T   PS      +    F     +T         +K  
Sbjct  1    MQLLQWVHHKFRHGSIEPFKDLTIAQPSLDDQDAYMKSSFGSRYRSTSLEPPARDREKSF  60

Query  201  KETEEKP-------LNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQ  359
             E+E K        ++E+F GFL+IGTLG  S       N  + P   T   +  +   +
Sbjct  61   SESEAKREEETSAIISELFPGFLTIGTLGSESG-----INEPETPTFGTTLENLTQQKAE  115

Query  360  ITDQDLKLITIELEKFLEAEEDAQ----SSKRSSYASIITLTDKTQQDSSSSPTLLLD--  521
            +T+ DLKLI  ELEKFL+AE   +    SS R S+AS +T   K Q + S       D  
Sbjct  116  VTENDLKLIRYELEKFLDAETKEEGVRVSSARDSHASSVTPNGK-QMEESEDEEYWKDAA  174

Query  522  CPLQKYFFG----LSESDMAVKNEEEASLSE  602
            CPL+ Y FG    L E+  A K  E+ASL E
Sbjct  175  CPLKGYLFGSSTELPETMEAKK--EKASLQE  203



>ref|XP_011086830.1| PREDICTED: uncharacterized protein LOC105168442 [Sesamum indicum]
Length=388

 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 98/240 (41%), Gaps = 69/240 (29%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNPNT--------------------  176
            MKLLGWMHRK + N NE         P   + GF+G P+                     
Sbjct  1    MKLLGWMHRKFRQNSNET--------PKDFSIGFTGQPSLDDLQCYPKGSYCGKSLGKAQ  52

Query  177  ---------TCTYQKVIKETEEKPL-----NEVFHGFLSIGTLGG---GSEEAAALFNst  305
                     TC     ++E E +        E+FHGFL+IGTLG     ++ A   F+  
Sbjct  53   KDNYRRNSFTCLEAARVEEEELEEEPAAALTELFHGFLAIGTLGTEPITTDPATPTFS--  110

Query  306  depptptfptsfeetttQITDQDLKLITIELEKFLEAE------------EDAQSSKRSS  449
                         E  T+ T+ +LKLI  ELEK L AE                S+ R S
Sbjct  111  ------ISVDHIAEKETEATENELKLINDELEKVLGAEGRDESCNVSSGRNSHVSAGRMS  164

Query  450  YASIITLTDKTQQDSSSSPTLLLDCPLQKYFF----GLSESDMAVKNEEEASLSEDLQEV  617
            + S ITL+ K  + + +     + CPLQ Y F    GL ++   ++ E+  SL E  Q+ 
Sbjct  165  HCSTITLSGKPIESAENCGNGAIICPLQSYLFGSAIGLPDTAPPLRREQRTSLGELFQKT  224



>ref|XP_002514886.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47440.1| conserved hypothetical protein [Ricinus communis]
Length=388

 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 103/243 (42%), Gaps = 70/243 (29%)
 Frame = +3

Query  75   MHRKLKHNCNEAVKN------------RTSFDPSH----PTYGFSGNPNTTCTYQKVIKE  206
            MHRK + N +E +K+            + S D  H    P YG         +Y++  KE
Sbjct  1    MHRKFRQNSSEPLKDFAIGHACNCLIGQPSLDDQHYYPKPNYGAR-------SYKQAQKE  53

Query  207  TEEK------------------------PLNEVFHGFLSIGTLGGGSEEAAALFNstdep  314
               K                         ++E+FHGFL+IGTLG     +  +  +   P
Sbjct  54   HLRKSFAGMEAARIEEEEEEDYEEESSAAISELFHGFLAIGTLG-----SEPVHTNPSTP  108

Query  315  ptptfptsfeetttQITDQDLKLITIELEKFL--EAEED----------AQSSKRSSYAS  458
                   +  E  T++T+ +LKLI  ELEK L  EA ED            S+ RSS+ S
Sbjct  109  TFAISVENITEKETEVTENELKLINDELEKVLGAEAREDYCNDSSGRNSYVSAGRSSHGS  168

Query  459  IITLTDKTQQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVV  626
             ITL+ K  +   ++ T +  CPLQ Y FG    LSE+  A K E   SL E  Q   + 
Sbjct  169  TITLSGKPMEGQETNGTTV--CPLQGYLFGSAIELSETTTAAKKENRTSLGELFQRSKIA  226

Query  627  KGN  635
            + N
Sbjct  227  EEN  229



>ref|XP_010453523.1| PREDICTED: uncharacterized protein LOC104735426 isoform X2 [Camelina 
sativa]
Length=357

 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 99/234 (42%), Gaps = 51/234 (22%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRT-----SFDPSHPTY-----------------GFSGNP  170
            MK  GWMH K + N  E +K+ T     S   SHP+                  GF    
Sbjct  1    MKFWGWMHHKFRENSKEPLKDSTTGNSYSILSSHPSLDSQDVYPAACAGSRYNTGFRKQV  60

Query  171  N--TTCTYQKVIKETEEKPLNE----VFHGFLSIGTLGGGSEEAAALFNstdepptptfp  332
            N     ++   ++  EE   +E     F GFL+IGTLGG       L +    P      
Sbjct  61   NLFQESSFAGPMENIEEHLKDERNSDFFDGFLAIGTLGG-----ETLHDEPATPTFGMSF  115

Query  333  tsfeetttQITDQDLKLITIELEKFLEAEE-------DAQSSKRSSYASIITLTDKTQQD  491
                     +T+ DLKLI+ ELEKFLEAE          ++S  ++ AS I   +    +
Sbjct  116  EDPALDNADVTENDLKLISNELEKFLEAEAKEGHHQPSGRNSDTNTIASTIEAIEGLDAE  175

Query  492  SSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGNDK  641
              + P   +  PLQ+Y FG      E+ +A K +E ASL E  Q   + +G DK
Sbjct  176  EDNQP---MKFPLQEYLFGSLNEFPETKIAGK-KERASLGELFQ---ITEGQDK  222



>ref|XP_006606602.1| PREDICTED: uncharacterized protein LOC102663986 [Glycine max]
Length=359

 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 75/222 (34%), Positives = 97/222 (44%), Gaps = 48/222 (22%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEA------VKNRTSFDPSHPTY-----GFSGNPNTTCTYQKVIK  203
            MKLLGWMHRK + N  E       +    S D  H  Y     G   +       QK ++
Sbjct  1    MKLLGWMHRKFRQNSAEVPFKDLIIGGGNSCDEEHNNYPKASFGNYKHVKQQSHLQKEVR  60

Query  204  ------ETEEK---PLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeettt  356
                  E EE     + E+FHGFL+IGTLG  +                    +  E   
Sbjct  61   KSLDHDEYEEDSAGAMYELFHGFLAIGTLGSEASTTPTF---------AISVENITEKED  111

Query  357  QITDQDLKLITIELEKFL-----EAEEDAQSSKRSSYASIITLTDKTQQDSSSSPTLLLD  521
            ++T+ +LKLI  ELEK L       E  + S  RSS+ SIITL+    + +++  TLL D
Sbjct  112  EVTENELKLINDELEKVLVLGADHDESSSISCGRSSHGSIITLSGGGGKPAAA--TLLED  169

Query  522  -------CPLQKYFFG----LSESDMAV-KNEEEASLSEDLQ  611
                   CPLQ Y FG    LSE+   V K E   SL E  Q
Sbjct  170  QSNGNAVCPLQGYLFGSAIELSETTTTVAKKEHRTSLGELFQ  211



>gb|KFK25639.1| hypothetical protein AALP_AA8G140900 [Arabis alpina]
Length=356

 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 116/383 (30%), Positives = 155/383 (40%), Gaps = 78/383 (20%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVKNRT------------SFD-----PSH---PTYGFSGNPNT  176
             MK  GWMH K + N  E +K  T            S D     P+    P Y  +G  N 
Sbjct  1     MKFWGWMHHKFRENSKEPLKEATPGNSYFILSPHQSLDNQDMYPTACAVPRYS-TGVRNQ  59

Query  177   TCTYQKV-----IKETEEKPLN----EVFHGFLSIGTLGGGSEEAAALFNstdepptptf  329
                +Q       ++  EE   +    + FHGFL+IGTLGG         +    P     
Sbjct  60    QNLFQDRSFAGPMENAEENFKDHRNSDFFHGFLAIGTLGG-----ETFLDEPATPTFGIS  114

Query  330   ptsfeetttQITDQDLKLITIELEKFLEAEEDA---QSSKRSS----YASIITLTDKTQQ  488
                 E     +T+ DLKLI+ ELEKFLEAE      Q+S R+S     AS I   +    
Sbjct  115   SGDPETDYADMTENDLKLISNELEKFLEAEAKEGHNQTSGRNSDTNTIASTIEAIEGLDA  174

Query  489   DSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGNDKKRAGK  656
             +  S P   +  PLQ+Y FG      E+ +A K +E ASL E  Q   +   + +   GK
Sbjct  175   EEDSQP---MKFPLQEYLFGSLIEFPETKIAGK-KERASLGELFQTPEMQDTHSETTYGK  230

Query  657   AQFAKNFmkkmlkslnsnskskTHMHAPNE----SAPP----TknkfpkvlkmlkkkvHP  812
                 KN      KS     K       P+     S  P    TK KF K++++  +KVHP
Sbjct  231   ---KKNQTSSTHKSAKHLVKKVLKKLHPSSRSSASGKPEMASTKKKFQKMVQVFNRKVHP  287

Query  813   ERYIGEKGAEKDENRVKGSRLRSSSDTTGNIWFRQMISPEEE---ELIMTTSQSCSGSGR  983
             E  + E      EN          SD +      + ++P  E     I    +S   +  
Sbjct  288   EDSMMESKYSSMEN-------SKYSDASSIGLMSEKVNPCNETSKRWIQYELRSSRSASN  340

Query  984   GGAFMENNGHWIKTDADYLVLEL  1052
             GG       HWIKTD DY VLEL
Sbjct  341   GG-------HWIKTDEDYFVLEL  356



>ref|XP_010453522.1| PREDICTED: uncharacterized protein LOC104735426 isoform X1 [Camelina 
sativa]
Length=359

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 99/234 (42%), Gaps = 51/234 (22%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRT-----SFDPSHPTY-----------------GFSGNP  170
            MK  GWMH K + N  E +K+ T     S   SHP+                  GF    
Sbjct  1    MKFWGWMHHKFRENSKEPLKDSTTGNSYSILSSHPSLDSQDVYPAACAGSRYNTGFRKQV  60

Query  171  N--TTCTYQKVIKETEEKPLNE----VFHGFLSIGTLGGGSEEAAALFNstdepptptfp  332
            N     ++   ++  EE   +E     F GFL+IGTLGG       L +    P      
Sbjct  61   NLFQESSFAGPMENIEEHLKDERNSDFFDGFLAIGTLGG-----ETLHDEPATPTFGMSF  115

Query  333  tsfeetttQITDQDLKLITIELEKFLEAEE-------DAQSSKRSSYASIITLTDKTQQD  491
                     +T+ DLKLI+ ELEKFLEAE          ++S  ++ AS I   +    +
Sbjct  116  EDPALDNADVTENDLKLISNELEKFLEAEAKEGHHQPSGRNSDTNTIASTIEAIEGLDAE  175

Query  492  SSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGNDK  641
              + P   +  PLQ+Y FG      E+ +A K +E ASL E  Q   + +G DK
Sbjct  176  EDNQP---MKFPLQEYLFGSLNEFPETKIAGK-KERASLGELFQ---ITEGQDK  222



>ref|XP_010550214.1| PREDICTED: uncharacterized protein LOC104821129 isoform X2 [Tarenaya 
hassleriana]
Length=351

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 117/376 (31%), Positives = 166/376 (44%), Gaps = 69/376 (18%)
 Frame = +3

Query  57    MKLLGWMHRKLKHN----CNEAVKNRTSFDPSH-------PTYGFSG---------NPNT  176
             MK LGWM  K + N      + +     F  S         +Y  SG         N   
Sbjct  1     MKFLGWMRHKFRENNKAPWKDVITGNNCFRLSTHSSLADTASYAESGYNTEFMRQLNKFQ  60

Query  177   TCTYQKVIKETEE----KPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfe  344
               ++ +    TEE    + ++++FHGFL+IGTLGG   E A   +    P       +  
Sbjct  61    ESSFPESSDNTEENLEDEMISQLFHGFLAIGTLGG---EPAV--DEPGTPTFGMSLENPI  115

Query  345   etttQITDQDLKLITIELEKFLEAEEDA--QSSKRSSYASIITLTDKTQQDSSSSPTLLL  518
             E   ++T  DL  I+ ELEKF EAE +   Q S R+S A+ I  T K  +  ++   +  
Sbjct  116   EEKAEVTQNDLNFISDELEKFFEAEAEGHDQPSARNSNANTIASTIKPLEGENAKEDIKT  175

Query  519   DC-PLQKYFFGLSESDMAVK---NEEEASLSEDLQEVVVVKGNDKKRAGKA-------QF  665
                PLQ Y FG S      K    +E+ASL E  Q   + + ++ K   K        + 
Sbjct  176   TIFPLQGYLFGSSIELPKTKIGATKEKASLGELFQRTNIQENSEFKCENKLMQTNPAHRS  235

Query  666   AKNFmkkmlkslnsnskskTHMHAPNESAPPTknkfpkvlkmlkkkvHPERYIGE-----  830
             AKN MKK+LK+++S+S+  T        +P TK KF K++++  +KVHPE  I E     
Sbjct  236   AKNPMKKLLKTIHSSSRFST---GGKTDSPSTKKKFQKIIQIFHRKVHPENSITEREING  292

Query  831   --KGAEKDENRVKGSRLRSSSDTTGNIWFRQMISPEEEELIMTTSQSCSGSGRGGAFMEN  1004
               K AE  E    G  L S    + N+  ++ I              C   G   A   N
Sbjct  293   KMKTAESTEPDYLG--LISEKGNSSNVMSKRQI-------------QCEIKGSDSA--RN  335

Query  1005  NGHWIKTDADYLVLEL  1052
               HWIKTDA+Y VLEL
Sbjct  336   GEHWIKTDAEYFVLEL  351



>ref|XP_008454016.1| PREDICTED: uncharacterized protein LOC103494565 [Cucumis melo]
Length=381

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 95/208 (46%), Gaps = 28/208 (13%)
 Frame = +3

Query  57   MKLLGWMHRKLKHN-----CNEAVK-NRTSFDPSHPTYGFSGNPNTTCTYQKVIKETEEK  218
            MKLLGWMHRK + N       E V   +TS +  +     + NP         I  T+E 
Sbjct  1    MKLLGWMHRKFRQNNGQVPLKEFVNGQQTSDEQQYFPRTSTNNPFKQAHRDLDIARTDED  60

Query  219  -------PLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQDL  377
                    ++E+F GFL+IGT  G SE A   F+        +     E   T++T  +L
Sbjct  61   YEDESLISISEIFPGFLAIGTF-GSSEPATPKFS-------ISIDHITESDQTEVTKNEL  112

Query  378  KLITIELEKFLEAE--EDAQSSKRSSYASIITLTDKTQQDSSSSPTLLLDCPLQKYFFG-  548
            KLI  ELEK LE E  ++  S + SS+A+ +   +    +  S     + CPLQ+Y FG 
Sbjct  113  KLINDELEKVLEVEAKDEGGSRQDSSHANKV---ESNYNNVESGDHDAVVCPLQEYLFGS  169

Query  549  -LSESDMAVKNEEEASLSEDLQEVVVVK  629
             +  S    K E   SL E  Q   VV+
Sbjct  170  AVEMSTTMAKKENRTSLGELFQRSKVVE  197



>gb|KCW55813.1| hypothetical protein EUGRSUZ_I01630 [Eucalyptus grandis]
Length=324

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 80/153 (52%), Gaps = 22/153 (14%)
 Frame = +3

Query  228  EVFHGFLSIGTLG---GGSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIEL  398
            E+FHGFL+IG LG     SE A   F             +  +   ++T+ DLK+I  EL
Sbjct  33   ELFHGFLAIGFLGSEAAPSEPATPTF--------AVTLDNMTKEAVEVTEDDLKVINNEL  84

Query  399  EKFLEA---EEDAQSSKRSSYASIITLTDKTQQDS--SSSPTLLLDCPLQKYFFG----L  551
            EKFLEA   EE  + S R+SYAS ITL D  Q ++     P   +  PLQ Y FG    L
Sbjct  85   EKFLEAESQEEGHKGSSRNSYASTITL-DSPQMEAVEDEGPADTVVFPLQGYLFGSSVEL  143

Query  552  SESDMAVKNEEEASLSEDLQEVVVVKGNDKKRA  650
             E+ + +K +++ASL +  QE     G+  K++
Sbjct  144  PETKIEMK-KQKASLLQLFQETRKTGGDCSKKS  175



>ref|XP_007217685.1| hypothetical protein PRUPE_ppa019356mg, partial [Prunus persica]
 gb|EMJ18884.1| hypothetical protein PRUPE_ppa019356mg, partial [Prunus persica]
Length=357

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 67/117 (57%), Gaps = 11/117 (9%)
 Frame = +3

Query  222  LNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIELE  401
            ++E+FHGFL+IGTLG     +    N  + P   T   +  E  T++T  DLKLI+ ELE
Sbjct  50   ISELFHGFLTIGTLG-----SEPSINEPETPTFATTLENLSEPKTEVTQNDLKLISYELE  104

Query  402  KFLEAEEDAQ----SSKRSSYASIITLTDKTQQDSSSSP--TLLLDCPLQKYFFGLS  554
            KFLEAE   +    SS R+S+AS ITL  K  ++S      T  +  PL++Y FG S
Sbjct  105  KFLEAETKEEGVRASSARNSHASTITLNGKQMEESEDEEYWTTTVVRPLKEYLFGSS  161



>ref|XP_008389910.1| PREDICTED: uncharacterized protein LOC103452173 isoform X4 [Malus 
domestica]
Length=384

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 69/226 (31%), Positives = 93/226 (41%), Gaps = 45/226 (20%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNPNT-TCTYQKVIKETE-EKPLNE  230
            MKLLGWMHRK + N N+  K      PS     +   PN  T  +++  ++    K  N 
Sbjct  1    MKLLGWMHRKFRQNSNDPFKVFVVGQPSLDDQQYYPKPNCGTKPFKQAPRDQHVRKSFNG  60

Query  231  V---------------------FHGFLSIGTLGGGSEEAAALFNstdepptptfptsfee  347
            +                     FHGFL+IGTLG   +    +      P       +  E
Sbjct  61   LEAARTEEEYYEEESSAEASEYFHGFLAIGTLGSSDQ----VTTEPSTPTLGISVENITE  116

Query  348  tttQITDQDLKLITIELEKFLEAEEDAQ-------------SSKRSSYASIITLTDKTQQ  488
              T+ T+ +LKLI  ELE+ L A+                 S+ RSS+ S ITL+ K  +
Sbjct  117  KETEATENELKLINDELERELVADPAKDDICNDSSGRNSYVSNGRSSHGSTITLSGKALE  176

Query  489  DS-SSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQ  611
               S+       CPLQ Y FG    LSE+    K E   SL E  Q
Sbjct  177  GGESNGINGTAVCPLQGYLFGSAYELSETTSVTKKEHRTSLGELFQ  222



>ref|XP_008362103.1| PREDICTED: uncharacterized protein LOC103425780 isoform X2 [Malus 
domestica]
Length=387

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 100/219 (46%), Gaps = 45/219 (21%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDP-----SHPTY---------GFSGNPNTTCT---  185
            MKLL W+H K +H   E  K+ T  +P     + P+           F     +T     
Sbjct  1    MKLLQWVHHKFRHGSIEPFKDLTIGNPCVCLSAQPSLDDQDAYMKSSFGSRYRSTSLEPP  60

Query  186  ---YQKVIKETEEKP-------LNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfpt  335
                +K   E+E K        ++E+F GFL+IGTLG  S       N  + P   T   
Sbjct  61   ARDREKSFSESEAKREEETSAIISELFPGFLTIGTLGSESG-----INEPETPTFGTTLE  115

Query  336  sfeetttQITDQDLKLITIELEKFLEAEEDAQ----SSKRSSYASIITLTDKTQQDSSSS  503
            +  +   ++T+ DLKLI  ELEKFL+AE   +    SS R S+AS +T   K Q + S  
Sbjct  116  NLTQQKAEVTENDLKLIRYELEKFLDAETKEEGVRVSSARDSHASSVTPNGK-QMEESED  174

Query  504  PTLLLD--CPLQKYFFG----LSESDMAVKNEEEASLSE  602
                 D  CPL+ Y FG    L E+  A K  E+ASL E
Sbjct  175  EEYWKDAACPLKGYLFGSSTELPETMEAKK--EKASLQE  211



>gb|KCW86956.1| hypothetical protein EUGRSUZ_B03523 [Eucalyptus grandis]
Length=295

 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 75/243 (31%), Positives = 104/243 (43%), Gaps = 71/243 (29%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDP----------------SHPTYG-----------  155
            MKLLGWMHRK +    E +K+    +P                 H  YG           
Sbjct  1    MKLLGWMHRKFRQTGGEPLKDLVIGNPCNCLSGQRSIDDQEYYQHANYGVKPARHGQQEN  60

Query  156  -----FSGNPNTTCTYQKVIKETEEKPLNE--VFHGFLSIGTLGGG---SEEAAALFNst  305
                 F+        Y+   ++ EE  + E  +F GFL+IGTLG     S+ +   F+  
Sbjct  61   RLRKSFASLEVARAEYEN--RQQEEFLVGEPQLFPGFLAIGTLGSDTPLSDPSTPTFD--  116

Query  306  depptptfptsfeetttQITDQDLKLITIELEKFL--EAEEDAQ----------SSKRSS  449
                         E  T++T+ +L+LI  ELEK L  EA+ED+           S  RSS
Sbjct  117  ------NSVDYITEKETEMTENELRLINDELEKVLVAEAKEDSSNDSSGRSSQVSMGRSS  170

Query  450  YASIITLTDK-----TQQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSE  602
            + S ITL+ K      + ++ S+ T+    PLQ Y FG    LSE+  AVK E   SL E
Sbjct  171  HGSTITLSGKPILEGQETNNGSTNTVY---PLQGYLFGSAIELSETTAAVKKEHRTSLGE  227

Query  603  DLQ  611
              Q
Sbjct  228  LFQ  230



>ref|XP_004156994.1| PREDICTED: probable WRKY transcription factor 75-like [Cucumis 
sativus]
Length=497

 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 67/208 (32%), Positives = 96/208 (46%), Gaps = 27/208 (13%)
 Frame = +3

Query  57   MKLLGWMHRKLKHN-----CNEAVKN--RTSFDPSHPTYGFSGNPNTTCTYQKVIKETEE  215
            MKLLGWMHRK + N       E   N  + S +  +     + NP         I  ++ 
Sbjct  1    MKLLGWMHRKFRQNNGQLPLKEYFVNGQQASDEQQYFPRTSTNNPFKQAQRDLDIARSDH  60

Query  216  K--------PLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQ  371
            +         ++E+F GFL+IGTLG  SE A   F+ + +  T +  T       ++T  
Sbjct  61   EDYEDESLISISEIFPGFLAIGTLGS-SEPATPKFSISIDHITESDQT-------EVTKN  112

Query  372  DLKLITIELEKFLEAE-EDAQSSKRSSYASIITLTDKTQQDSSSSPTLLLDCPLQKYFFG  548
            +LKLI  ELEK LEAE +D   S++ S+A+ +          S     ++ CPLQ+Y FG
Sbjct  113  ELKLINDELEKVLEAEAKDEGGSRQDSHANKVESNIYNNYVESGDHDAVV-CPLQEYLFG  171

Query  549  --LSESDMAVKNEEEASLSEDLQEVVVV  626
              +  S    K E   SL E  Q   VV
Sbjct  172  SAVEMSTTMAKKENRTSLGELFQRSKVV  199



>gb|KGN53042.1| hypothetical protein Csa_4G012380 [Cucumis sativus]
Length=385

 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 97/209 (46%), Gaps = 27/209 (13%)
 Frame = +3

Query  57   MKLLGWMHRKLKHN-----CNEAVKN--RTSFDPSHPTYGFSGNPNTTCTYQKVIKETEE  215
            MKLLGWMHRK + N       E   N  + S +  +     + NP         I  ++ 
Sbjct  1    MKLLGWMHRKFRQNNGQLPLKEYFVNGQQASDEQQYFPRTSTNNPFKQAQRDLDIARSDH  60

Query  216  K--------PLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQ  371
            +         ++E+F GFL+IGTLG  SE A   F+ + +  T +  T       ++T  
Sbjct  61   EDYEDESLISISEIFPGFLAIGTLGS-SEPATPKFSISIDHITESDQT-------EVTKN  112

Query  372  DLKLITIELEKFLEAE-EDAQSSKRSSYASIITLTDKTQQDSSSSPTLLLDCPLQKYFFG  548
            +LKLI  ELEK LEAE +D   S++ S+A+ +          S     ++ CPLQ+Y FG
Sbjct  113  ELKLINDELEKVLEAEAKDEGGSRQDSHANKVESNIYNNYVESGDHDAVV-CPLQEYLFG  171

Query  549  --LSESDMAVKNEEEASLSEDLQEVVVVK  629
              +  S    K E   SL E  Q   VV+
Sbjct  172  SAVEMSTTMAKKENRTSLGELFQRSKVVE  200



>ref|XP_009344241.1| PREDICTED: uncharacterized protein LOC103936127 [Pyrus x bretschneideri]
Length=386

 Score = 65.1 bits (157),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 98/218 (45%), Gaps = 44/218 (20%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDP-----SHPTY---------GFSGNPNTTCT---  185
            MKLL W+H K +H   E  K+ T  +P     + P+           F     +T     
Sbjct  1    MKLLQWVHHKFRHGSIEPFKDLTIGNPCVCLSAQPSLDDQDAYMKSSFGSRYRSTSLEPP  60

Query  186  ---YQKVIKETEEKP------LNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfpts  338
                +K   E+E K       ++E+F GFL+IGTLG  S       N  + P   T   +
Sbjct  61   ARDQEKSFSESEAKREETSDIISELFPGFLTIGTLGSESG-----INEPETPTFGTTLEN  115

Query  339  feetttQITDQDLKLITIELEKFLEAEEDAQ----SSKRSSYASIITLTDKTQQDSSSSP  506
              +   ++T+ DLKLI  ELEKFLEAE   +    SS R S A  +T   K Q + S   
Sbjct  116  LTQQKAEVTENDLKLIRYELEKFLEAETKEEGVRVSSARDSQAGSVTPNGK-QMEESEDD  174

Query  507  TLLLD--CPLQKYFFG----LSESDMAVKNEEEASLSE  602
                D  CPL+ Y FG    L E+  A K  E+ASL E
Sbjct  175  EYWKDAACPLKGYLFGSSTELPETTEAKK--EKASLQE  210



>emb|CDX78559.1| BnaA03g04710D [Brassica napus]
Length=370

 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 108/378 (29%), Positives = 154/378 (41%), Gaps = 72/378 (19%)
 Frame = +3

Query  48    LMKMKLLGWMHR-KLKHNCNEAVKNRTSFDP-----SHPTY-------GFSGNPNTTCTY  188
             L+  +  GW+H  K   N  E  K+ T+ +      SHP+             P  +   
Sbjct  22    LIFWQFWGWIHHHKFPENSKEQFKDATTGNSRFSLSSHPSLDSNDVYPAACAGPRYSTGI  81

Query  189   QKVIKETEEKPL--------NEVFHGFLSIGTLGGGS---EEAAALFNstdepptptfpt  335
              K +   +E           ++ F GFL+IGTLGG +   E A   F             
Sbjct  82    TKQLNRFQENSFPGPKDERNSDFFDGFLAIGTLGGETYLDEPATPTFGDPAADNA-----  136

Query  336   sfeetttQITDQDLKLITIELEKFLEAEE---DAQSSKRSS----YASIITLTDKTQQDS  494
                    ++T+ DLKLI+ ELEKFLEAE    + Q S R+S     AS I   +    + 
Sbjct  137   -------EVTENDLKLISDELEKFLEAEAKEGNNQPSGRNSDTNTIASTIEAAEGLDAEE  189

Query  495   SSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGNDKKRAGKAQ  662
              + P   +  PLQ+Y FG    LSE+ +A K +E ASL E  Q     +  DK    K  
Sbjct  190   DNQP---MKFPLQEYLFGSLIELSETKVAGK-KERASLGELFQ---AAEMQDKHSENKYG  242

Query  663   FAKNFmkkmlkslnsnskskTHMHAPNESAP--------PTknkfpkvlkmlkkkvHPER  818
               K       KS     K       P+  +P         TK KF K+ ++ ++KV+PE 
Sbjct  243   EKKKQTSTTHKSAKHLVKKVLKKLHPSSKSPGSGKTEVASTKKKFQKMAQVFQRKVYPED  302

Query  819   YIGEKGAEKDENRVKGSRLRSSSDTTGNIWFRQMISPEEEELIMTTSQSCSGSGRGGAFM  998
              I E          K S+    +++TG +  +     E  +  +      S S + G   
Sbjct  303   SIMESEIHSSMTDPKNSQ----ANSTGLMSEKVSTCNEGSKPWIQYELGSSDSAKNGE--  356

Query  999   ENNGHWIKTDADYLVLEL  1052
                 HWIKTD DY VLEL
Sbjct  357   ----HWIKTDEDYFVLEL  370



>ref|XP_010420032.1| PREDICTED: uncharacterized protein LOC104705678 [Camelina sativa]
Length=357

 Score = 64.7 bits (156),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 67/233 (29%), Positives = 93/233 (40%), Gaps = 49/233 (21%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRT-----SFDPSHPTYGFSGNPNTTCT-------YQKVI  200
            MK  GWMH K + N  E +K+ T     S   SHP+          C        ++K +
Sbjct  1    MKFWGWMHHKFRENSKEPLKDATTGNSYSILSSHPSLDSQDIYPAACAGSRYNTGFRKQV  60

Query  201  KETEEKPL----------------NEVFHGFLSIGTLGGGSEEAAALFNstdepptptfp  332
               +E                   ++ F GFL+IGTLGG       L +    P      
Sbjct  61   NLFQESSFAGPTENIEEHLKDERNSDFFDGFLAIGTLGG-----ETLHDEPTTPTFGMSF  115

Query  333  tsfeetttQITDQDLKLITIELEKFLEAEE-------DAQSSKRSSYASIITLTDKTQQD  491
                     +T+ DLKLI+ ELEKFLEAE          ++S  ++ AS I   +    +
Sbjct  116  EDPALDNADVTENDLKLISNELEKFLEAEAKEGHHQPSGRNSDTNTIASTIEAIEGLDAE  175

Query  492  SSSSPTLLLDCPLQKYFFGLSESDMAVKN---EEEASLSEDLQEVVVVKGNDK  641
                P   +  PLQ+Y FG        KN   +E ASL E  Q   + +G DK
Sbjct  176  EDIQP---MKFPLQEYLFGSLNEFPETKNAGKKERASLGELFQ---ITEGQDK  222



>ref|XP_010044846.1| PREDICTED: uncharacterized protein LOC104433701 [Eucalyptus grandis]
Length=367

 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 75/243 (31%), Positives = 104/243 (43%), Gaps = 71/243 (29%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDP----------------SHPTYG-----------  155
            MKLLGWMHRK +    E +K+    +P                 H  YG           
Sbjct  1    MKLLGWMHRKFRQTGGEPLKDLVIGNPCNCLSGQRSIDDQEYYQHANYGVKPARHGQQEN  60

Query  156  -----FSGNPNTTCTYQKVIKETEEKPLNE--VFHGFLSIGTLGGG---SEEAAALFNst  305
                 F+        Y+   ++ EE  + E  +F GFL+IGTLG     S+ +   F+  
Sbjct  61   RLRKSFASLEVARAEYEN--RQQEEFLVGEPQLFPGFLAIGTLGSDTPLSDPSTPTFD--  116

Query  306  depptptfptsfeetttQITDQDLKLITIELEKFL--EAEEDAQ----------SSKRSS  449
                         E  T++T+ +L+LI  ELEK L  EA+ED+           S  RSS
Sbjct  117  ------NSVDYITEKETEMTENELRLINDELEKVLVAEAKEDSSNDSSGRSSQVSMGRSS  170

Query  450  YASIITLTDK-----TQQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSE  602
            + S ITL+ K      + ++ S+ T+    PLQ Y FG    LSE+  AVK E   SL E
Sbjct  171  HGSTITLSGKPILEGQETNNGSTNTVY---PLQGYLFGSAIELSETTAAVKKEHRTSLGE  227

Query  603  DLQ  611
              Q
Sbjct  228  LFQ  230



>ref|XP_009131385.1| PREDICTED: uncharacterized protein LOC103856058 [Brassica rapa]
Length=346

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 95/220 (43%), Gaps = 51/220 (23%)
 Frame = +3

Query  57   MKLLGWMHR-KLKHNCNEAVKNRTSFDP-----SHPTY-------GFSGNPNTTCTYQKV  197
            MK  GW+H  K   N  E  K+ T+ +      SHP+             P  +    K 
Sbjct  1    MKFWGWIHHHKFPENSKEQFKDATTGNSRFSLSSHPSLDSDDVYPAACAGPRYSTGITKQ  60

Query  198  IKETEEKPL--------NEVFHGFLSIGTLGGGS---EEAAALFNstdepptptfptsfe  344
            +   +E           ++ F GFL+IGTLGG +   E A   F                
Sbjct  61   LNRFQENSFPGPKDERNSDFFDGFLAIGTLGGETYLDEPATPTFGDPATDNA--------  112

Query  345  etttQITDQDLKLITIELEKFLEAEE---DAQSSKRSS----YASIITLTDKTQQDSSSS  503
                ++T+ DLKLI+ ELEKFLEAE    + Q S R+S     AS I   +    +  + 
Sbjct  113  ----EVTENDLKLISDELEKFLEAEAKEGNNQPSGRNSDTNTIASTIEAAEGLDAEEDNQ  168

Query  504  PTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQ  611
            P   +  PLQ+Y FG    LSE+ +A K +E ASL E  Q
Sbjct  169  P---MKFPLQEYLFGSLIELSETKVAGK-KERASLGELFQ  204



>emb|CDX70541.1| BnaC03g06250D [Brassica napus]
Length=363

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 105/385 (27%), Positives = 155/385 (40%), Gaps = 78/385 (20%)
 Frame = +3

Query  45    SLMKMKLLGWMHR-KLKHNCNEAVKNRTSFDP-----SHPTY-------GFSGNPNTTCT  185
             + + ++  GW+H  K   N  E  K+ T+ +      SHP+             P  +  
Sbjct  8     AFLVLQFWGWIHHHKFPENSKEQFKDATTGNSRFSLSSHPSLDSHDVYPAACAGPRYSTG  67

Query  186   YQKVIK--------------ETEEKPLNEVFHGFLSIGTLGGGS---EEAAALFNstdep  314
               K +               ET+++  ++ F GFL+IGTLGG +   E A   F      
Sbjct  68    ITKQLNRFQENSFPGPKDNTETKDERNSDFFDGFLAIGTLGGETYLDEPATPTFGDPATD  127

Query  315   ptptfptsfeetttQITDQDLKLITIELEKFLEAEE-------DAQSSKRSSYASIITLT  473
                           ++T+ DLKLI+ ELEKFLEAE          ++S  ++ AS I   
Sbjct  128   NA------------EVTENDLKLISDELEKFLEAEAKEGHNQPSGRNSDTNTIASTIEAA  175

Query  474   DKTQQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGNDK  641
             +    +  + P   +  PLQ+Y FG    LSE+ +A K +E ASL E  Q     +  DK
Sbjct  176   EGLDAEEDNQP---MKFPLQEYLFGSLIELSETKVAGK-KERASLGELFQ---AAEMQDK  228

Query  642   KRAGKAQFAKNFmkkmlkslnsnskskTHMHAPNESAP--------PTknkfpkvlkmlk  797
                 K    K       KS     K       P+  +P         TK KF K+ ++ +
Sbjct  229   HSENKYGEKKKQTSIAHKSAKHLVKKVLKKLHPSSKSPGNGKTEMASTKKKFQKMAQVFQ  288

Query  798   kkvHPERYIGEKGAEKDENRVKGSRLRSSSDTTGNIWFRQMISPEEEELIMTTSQSCSGS  977
             +KV+PE  I E          K S+  S+  T+  +        E  +  +      S S
Sbjct  289   RKVYPEDSIMESEIHSSMTDPKNSQANSTGLTSEKV----STCNEASKPWIQYELGSSDS  344

Query  978   GRGGAFMENNGHWIKTDADYLVLEL  1052
              + G       HWIKTD DY VLEL
Sbjct  345   AKNGE------HWIKTDEDYFVLEL  363



>ref|XP_002300122.1| hypothetical protein POPTR_0001s33510g [Populus trichocarpa]
 gb|EEE84927.1| hypothetical protein POPTR_0001s33510g [Populus trichocarpa]
Length=430

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 75/138 (54%), Gaps = 23/138 (17%)
 Frame = +3

Query  228  EVFHGFLSIGTLGG---GSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIEL  398
            ++FHGFL+IGTLG     SE A   F        P    S  E   ++T+ +LK++  EL
Sbjct  139  DLFHGFLTIGTLGSEPITSEPATPTF--------PMSSESITEENIEVTENELKIMNNEL  190

Query  399  EKFLEAEEDA----QSSKRSSYASIITLTDKTQQDSSSSPTL--LLDCPLQKYFFG----  548
            EKFLEAE +     +S  RSSY S ITL+   Q +++ +      + CPLQ Y FG    
Sbjct  191  EKFLEAEAEEEGCNESLARSSYVSTITLSG-MQMEATDAEDYGKTVACPLQGYLFGSSVE  249

Query  549  LSESDMAVKNEEEASLSE  602
            L E+ + VK +E+ SL E
Sbjct  250  LPETRVGVK-KEKVSLGE  266



>ref|XP_008389909.1| PREDICTED: uncharacterized protein LOC103452173 isoform X3 [Malus 
domestica]
Length=387

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 67/232 (29%), Positives = 95/232 (41%), Gaps = 45/232 (19%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNPNT-TCTYQKVIKETE-EKPLNE  230
            ++LLGWMHRK + N N+  K      PS     +   PN  T  +++  ++    K  N 
Sbjct  4    LQLLGWMHRKFRQNSNDPFKVFVVGQPSLDDQQYYPKPNCGTKPFKQAPRDQHVRKSFNG  63

Query  231  V---------------------FHGFLSIGTLGGGSEEAAALFNstdepptptfptsfee  347
            +                     FHGFL+IGTLG   +    +      P       +  E
Sbjct  64   LEAARTEEEYYEEESSAEASEYFHGFLAIGTLGSSDQ----VTTEPSTPTLGISVENITE  119

Query  348  tttQITDQDLKLITIELEKFLEAEEDAQ-------------SSKRSSYASIITLTDKTQQ  488
              T+ T+ +LKLI  ELE+ L A+                 S+ RSS+ S ITL+ K  +
Sbjct  120  KETEATENELKLINDELERELVADPAKDDICNDSSGRNSYVSNGRSSHGSTITLSGKALE  179

Query  489  DS-SSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVK  629
               S+       CPLQ Y FG    LSE+    K E   SL E  Q   + +
Sbjct  180  GGESNGINGTAVCPLQGYLFGSAYELSETTSVTKKEHRTSLGELFQRTKLAE  231



>ref|XP_011000963.1| PREDICTED: uncharacterized protein LOC105108372 isoform X1 [Populus 
euphratica]
Length=395

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 72/136 (53%), Gaps = 23/136 (17%)
 Frame = +3

Query  234  FHGFLSIGTLGG---GSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIELEK  404
            FHGFL+IGTLG     SE A   F             S  E   ++T+ +LK++  ELEK
Sbjct  94   FHGFLTIGTLGSEPITSEPATPTF--------AMSLESITEENIEVTENELKIMNNELEK  145

Query  405  FLEAEEDA----QSSKRSSYASIITLTDKTQQDSSSSPTL--LLDCPLQKYFFG----LS  554
            FLEAE +     +S  RSSY S ITL+   Q +++ +      + CPLQ Y FG    L 
Sbjct  146  FLEAEAEEEGCNESLARSSYVSTITLSG-MQMEATDAEDYGKTVACPLQGYLFGSSVELP  204

Query  555  ESDMAVKNEEEASLSE  602
            E+ + VK +E+ SL E
Sbjct  205  ETRVGVK-KEKVSLGE  219



>ref|XP_004516561.1| PREDICTED: uncharacterized protein LOC101513155 [Cicer arietinum]
Length=343

 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 87/192 (45%), Gaps = 32/192 (17%)
 Frame = +3

Query  57   MKLLGWMHRKLKH-------NCNEAVKNRTSFDPSH----PTYGFSGNP-----------  170
            MKLL W+HRKL         N    +  + +FD  +    P++     P           
Sbjct  1    MKLLQWVHRKLHPFKDFTLGNPCACLTVQLTFDSQYLQTKPSFSSINQPCFSKPHHQESQ  60

Query  171  NTTCTYQKVIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeet  350
             + C      +E     + E+F  FL+IGTLG     A A+ N    P       +   T
Sbjct  61   TSCCREDDDSQEETSAVIPELFQSFLTIGTLG-----AEAVTNEPATPTLSMPSENITMT  115

Query  351  ttQITDQDLKLITIELEKFLEAEEDA--QSSKRSSYASIITLTDKTQQDSSSSPTL--LL  518
              ++T+ +LKLI+ ELEKFLE E+++  +SS R+S    ITL+   Q D S +      +
Sbjct  116  DAEVTENELKLISFELEKFLETEDESFYESSGRNSRLRNITLSGN-QTDGSEAKDCGNKV  174

Query  519  DCPLQKYFFGLS  554
             CPLQ Y  G S
Sbjct  175  VCPLQGYLLGSS  186



>ref|XP_010249079.1| PREDICTED: uncharacterized protein LOC104591766 isoform X2 [Nelumbo 
nucifera]
Length=388

 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 66/216 (31%), Positives = 95/216 (44%), Gaps = 46/216 (21%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPS----HPTYGFSGNP---------NTTCTYQKV  197
            MKLL WMHRK +   NE  K+     PS     P Y +   P         N     +++
Sbjct  1    MKLLDWMHRKFRQYNNEPSKDFIIGQPSSPDDEPQYYYHTKPGYNGSRSSSNQMSQKERI  60

Query  198  IKE----TEEKPLNE---------VFHGFLSIGTLGGGSEEAAALFNstdepptptfpts  338
             ++    +E   ++E          F G L+IGT G     +  +              +
Sbjct  61   RRKSFAGSETTVVDEDLEAAAAAERFDGLLTIGTFG-----SDPVLADPTTSVFTFSVEN  115

Query  339  feetttQITDQDLKLITIELEKFL--EAEEDA--QSSKRSSYASIITLTDKTQQDSSSSP  506
              E  T++T+ DLKLI  ELEK L  E +ED    SS RSS+ S    T  T+ + +S+ 
Sbjct  116  ITEKETEVTESDLKLINEELEKVLVTEVKEDGCNLSSGRSSHVS----TKTTENNGNSTM  171

Query  507  TLLLDCPLQKYFFG----LSESDMAVKNEEEASLSE  602
             +   CPLQ+Y FG    + E+ M  K +   SLSE
Sbjct  172  AI---CPLQEYLFGSPIKIPETTMVAKKQHRMSLSE  204



>ref|XP_009630530.1| PREDICTED: uncharacterized protein LOC104120482 isoform X1 [Nicotiana 
tomentosiformis]
Length=285

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 93/200 (47%), Gaps = 40/200 (20%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNPNTTCTYQKVIKE-----TEEKP  221
            MKLLGWMH KLK   NE   N    + S  ++              V KE      E +P
Sbjct  1    MKLLGWMHSKLKQKGNEPANNTPIVENSITSFS-------------VFKEFKSNGAEMEP  47

Query  222  LNEVFHGFLSIGTLGG----GSEEAAALFNstdepptptfptsfeetttQITDQDLKLIT  389
             +E+F GFL+IGTLG      ++  A  F           P  F+   T IT+++LK I 
Sbjct  48   FDELFPGFLAIGTLGNYQTTNTDPPAPTF-----------PMPFDHGETDITEKELKFIN  96

Query  390  IELEKFLEAEEDAQSSKRSSYASIITLTDK-TQQDSSSSPTLLLDCPLQKYFFG--LSES  560
             ELEK+LE     + +K  S  SII L+D   +  ++   + + +  LQKY  G  +   
Sbjct  97   DELEKYLE----EKVNKYESSESIIALSDNHIEIGATECYSNIEEYSLQKYLLGSSIELP  152

Query  561  DMAVKNEEEASLSEDLQEVV  620
             + V+ +++    E+L  +V
Sbjct  153  KIEVEVQQQKRFIEELFNIV  172



>ref|XP_008389908.1| PREDICTED: uncharacterized protein LOC103452173 isoform X2 [Malus 
domestica]
Length=392

 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 69/242 (29%), Positives = 89/242 (37%), Gaps = 59/242 (24%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNPNTTCTYQKVIKETEEKPLNEV-  233
            MKLLGWMHRK + N N+  K    F   H     SG P+              KP  +  
Sbjct  1    MKLLGWMHRKFRQNSNDPFK---VFVVEHSCGCLSGQPSLDDQQYYPKPNCGTKPFKQAP  57

Query  234  ---------------------------------FHGFLSIGTLGGGSEEAAALFNstdep  314
                                             FHGFL+IGTLG   +    +      P
Sbjct  58   RDQHVRKSFNGLEAARTEEEYYEEESSAEASEYFHGFLAIGTLGSSDQ----VTTEPSTP  113

Query  315  ptptfptsfeetttQITDQDLKLITIELEKFLEAEEDAQ-------------SSKRSSYA  455
                   +  E  T+ T+ +LKLI  ELE+ L A+                 S+ RSS+ 
Sbjct  114  TLGISVENITEKETEATENELKLINDELERELVADPAKDDICNDSSGRNSYVSNGRSSHG  173

Query  456  SIITLTDKTQQDS-SSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVV  620
            S ITL+ K  +   S+       CPLQ Y FG    LSE+    K E   SL E  Q   
Sbjct  174  STITLSGKALEGGESNGINGTAVCPLQGYLFGSAYELSETTSVTKKEHRTSLGELFQRTK  233

Query  621  VV  626
            + 
Sbjct  234  LA  235



>ref|XP_009372251.1| PREDICTED: uncharacterized protein LOC103961434 isoform X1 [Pyrus 
x bretschneideri]
Length=418

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 116/398 (29%), Positives = 166/398 (42%), Gaps = 92/398 (23%)
 Frame = +3

Query  69    GWMHRKLKHNCNEAVKNRTSFDPS--HPTYGFSGNPNTTCTYQKVIKETEEKPLNEV---  233
             GWMHR  + N N+  K      PS     Y    N  T    Q    +   K  N +   
Sbjct  43    GWMHRMFRQNSNDPFKVSVVGQPSLDDQQYYQKSNWGTKPFTQAPKDQHLGKSFNSLEAA  102

Query  234   ------------------FHGFLSIGTLGG----GSEEAAALFNstdepptptfptsfee  347
                               FHGFL+IGTLG      +E +  +              +   
Sbjct  103   RTEEEYYEEESSAEASELFHGFLAIGTLGSLDQVNTEPSTPMLG--------ISVENITA  154

Query  348   tttQITDQDLKLITIELEKFLEAE-------------EDAQSSKRSSYASIITLTDKT--  482
               T+  + +L LI  ELEK L A+                 S+ RSS  S ITL+ K   
Sbjct  155   KETEAAENELNLINDELEKVLVADPAKDDICNDSSGRNSYVSNGRSSQGSTITLSGKALE  214

Query  483   -QQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVV---VKG--  632
               +++ ++ T +  CPLQ Y FG    LSE+ +  K E   SL E  Q   +   + G  
Sbjct  215   GAENNGNNGTAV--CPLQGYLFGSGYVLSETIIVAKQEHRTSLGELFQRTKLAEEISGAE  272

Query  633   --NDKKRAGKAQFAKNFmkkmlkslnsnskskTHMHAPNESAPPTknkfpkvlkmlkkkv  806
                ++K+A K+  A + +KKMLK    ++ S+    A + ++  T  K  K+L M ++KV
Sbjct  273   LIKEEKQADKS--AMHLIKKMLKKKMLHASSRGSGIAADHASAET--KLNKILHMFRRKV  328

Query  807   HPERYIGEKGAEKDENRVKG--SRLRSSSDTTGN--------IWFRQMISPEEEELIMTT  956
             HPE       AE+   + KG  SR + SS+ T N        + + Q      + + +  
Sbjct  329   HPET----SAAERKPGKYKGNQSRKKPSSEGTYNNGDQDEDILLYPQQGFSSNQSMRLYK  384

Query  957   SQS------CSGSGRGGAFMENNGHWIKTDADYLVLEL  1052
             SQS       SG        EN GHWIKT ADYL+LEL
Sbjct  385   SQSNPPQFVLSGMNSN----ENRGHWIKTGADYLILEL  418



>ref|XP_003622154.1| hypothetical protein MTR_7g028350 [Medicago truncatula]
Length=350

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 64/208 (31%), Positives = 92/208 (44%), Gaps = 65/208 (31%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFS-GNPNTTCTYQKVI--KETEEKP--  221
            MKLL W+HRKL+         +T+ DP      F+ GNP    T Q  +  K ++ KP  
Sbjct  1    MKLLQWVHRKLR---------QTNLDPFK---DFTIGNPCACLTVQLTLDTKYSQTKPSF  48

Query  222  ---------------------------------LNEVFHGFLSIGTLGGGSEEAAALFNs  302
                                             ++E F GFL+IGTLG  +E A   F  
Sbjct  49   SSINESDFFKPHDHESQKFWFREDKSQEETSEVISEKFQGFLTIGTLG--AEPATPTF--  104

Query  303  tdepptptfptsfeetttQITDQDLKLITIELEKFLEAEEDA--QSSKRSSYASIITLTD  476
                   +   +       +T+  LKLI+ ELEKF+EA+E+   +SS R S+ S +TL+ 
Sbjct  105  ------ASPLGNIPMKDAAVTETQLKLISYELEKFVEADEECFYESSGRISFRSNVTLSR  158

Query  477  KTQQDSSSSPTL--LLDCPLQKYFFGLS  554
            K + D   +  L   + CPLQ+Y  G S
Sbjct  159  K-KTDGLETEDLGNKVICPLQEYLLGSS  185



>gb|AES72068.2| WRKY transcription factor-like protein [Medicago truncatula]
Length=371

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 83/191 (43%), Gaps = 36/191 (19%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN-----RTSFDPSHPTYGFSGNPNTTCTYQK---------  194
            MKLLGWMHRKL+ N  E  K+      TS D  +  Y +      +C Y K         
Sbjct  1    MKLLGWMHRKLRQNSTEPFKDLVTGQATSVDEENNYYYYLKPKFGSCKYVKQTQKEQFKL  60

Query  195  ------------VIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfpts  338
                        V +E +++  + VF GFL+IGTLG  ++ +           + +    
Sbjct  61   RKSFEAVGSGRAVDEEEDKEAWSGVFPGFLAIGTLGLETDPSPL-----TPSFSISVENI  115

Query  339  feetttQITDQDLKLITIELEKFLE-AEEDAQSSKRSSYASIITLTDKTQQDSSSSPTLL  515
              E   ++T+++LK+I  ELEK L     +  SS R+S+ S        +    S+    
Sbjct  116  ITEREAEVTEKELKVINNELEKVLVLTNNNDDSSGRNSHVSTAGRNSHGRISIESNSI--  173

Query  516  LDCPLQKYFFG  548
              CPLQ Y FG
Sbjct  174  --CPLQGYLFG  182



>ref|XP_009630531.1| PREDICTED: uncharacterized protein LOC104120482 isoform X2 [Nicotiana 
tomentosiformis]
Length=277

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 89/197 (45%), Gaps = 42/197 (21%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNPNTTCTYQKVIKE--TEEKPLNE  230
            MKLLGWMH KLK   NE                     NT     K  K    E +P +E
Sbjct  1    MKLLGWMHSKLKQKGNEPAN------------------NTPIVVFKEFKSNGAEMEPFDE  42

Query  231  VFHGFLSIGTLGG----GSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIEL  398
            +F GFL+IGTLG      ++  A  F           P  F+   T IT+++LK I  EL
Sbjct  43   LFPGFLAIGTLGNYQTTNTDPPAPTF-----------PMPFDHGETDITEKELKFINDEL  91

Query  399  EKFLEAEEDAQSSKRSSYASIITLTDK-TQQDSSSSPTLLLDCPLQKYFFG--LSESDMA  569
            EK+LE     + +K  S  SII L+D   +  ++   + + +  LQKY  G  +    + 
Sbjct  92   EKYLE----EKVNKYESSESIIALSDNHIEIGATECYSNIEEYSLQKYLLGSSIELPKIE  147

Query  570  VKNEEEASLSEDLQEVV  620
            V+ +++    E+L  +V
Sbjct  148  VEVQQQKRFIEELFNIV  164



>ref|XP_010543095.1| PREDICTED: uncharacterized protein LOC104816121 [Tarenaya hassleriana]
Length=278

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 74/150 (49%), Gaps = 22/150 (15%)
 Frame = +3

Query  222  LNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIELE  401
            ++E+FHGFL+IGTLG          ++   P       +     T++T+++LKL+   LE
Sbjct  55   VSEIFHGFLAIGTLGSDPN-----VSTPSTPTFTISLENETGKETEVTERELKLLNDNLE  109

Query  402  KFLEAEE-----DAQSSK-------RSSYASIITLTDKTQQDSSSSPTLLLDCPLQKYFF  545
            K L AE      DA S +       RSS  S ITLT KT +   ++ +    CPLQ Y F
Sbjct  110  KILGAEVKEEICDASSGRNSHVSAGRSSQGSTITLTGKTLEIPETNRSGSNVCPLQGYLF  169

Query  546  G----LSESDMAVKNEEEASLSEDLQEVVV  623
            G    +SE+  A K E   SL E  Q+  +
Sbjct  170  GSAIEMSETTTA-KKEHRTSLRELFQKTKI  198



>ref|XP_008389907.1| PREDICTED: uncharacterized protein LOC103452173 isoform X1 [Malus 
domestica]
Length=395

 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 67/243 (28%), Positives = 90/243 (37%), Gaps = 59/243 (24%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNPNTTCTYQKVIKETEEKPLNEV-  233
            ++LLGWMHRK + N N+  K    F   H     SG P+              KP  +  
Sbjct  4    LQLLGWMHRKFRQNSNDPFK---VFVVEHSCGCLSGQPSLDDQQYYPKPNCGTKPFKQAP  60

Query  234  ---------------------------------FHGFLSIGTLGGGSEEAAALFNstdep  314
                                             FHGFL+IGTLG   +    +      P
Sbjct  61   RDQHVRKSFNGLEAARTEEEYYEEESSAEASEYFHGFLAIGTLGSSDQ----VTTEPSTP  116

Query  315  ptptfptsfeetttQITDQDLKLITIELEKFLEAEEDAQ-------------SSKRSSYA  455
                   +  E  T+ T+ +LKLI  ELE+ L A+                 S+ RSS+ 
Sbjct  117  TLGISVENITEKETEATENELKLINDELERELVADPAKDDICNDSSGRNSYVSNGRSSHG  176

Query  456  SIITLTDKTQQDS-SSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVV  620
            S ITL+ K  +   S+       CPLQ Y FG    LSE+    K E   SL E  Q   
Sbjct  177  STITLSGKALEGGESNGINGTAVCPLQGYLFGSAYELSETTSVTKKEHRTSLGELFQRTK  236

Query  621  VVK  629
            + +
Sbjct  237  LAE  239



>emb|CDX69606.1| BnaA10g19550D [Brassica napus]
Length=362

 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 94/205 (46%), Gaps = 32/205 (16%)
 Frame = +3

Query  75   MHRKLKHNCNEAVKNRTSFD-----PSHPTYGFSGNPNTTCTYQ-KVIKETEEKPLNEV-  233
            MH K + N  + +K+ T+ +      +HP+   S   +T  + Q  + +E+    L+E  
Sbjct  1    MHHKSRDNSKQLLKDATTGNGHFPLSAHPSLD-SPRYSTGISKQFNLFQESSFAGLSEAG  59

Query  234  ----FHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIELE  401
                FHGFL+IGTLGG         +    P              ++T+ DLKLI+ ELE
Sbjct  60   NSDFFHGFLAIGTLGG-----ETFLDEPPTPTFGMSSEDPATDNAEVTENDLKLISNELE  114

Query  402  KFLEAEE-------DAQSSKRSSYASIITLTDKTQQDSSSSPTLLLDCPLQKYFFG----  548
            KFLEAE          ++S  ++ AS I   +    +    P   +  PLQ+Y FG    
Sbjct  115  KFLEAEAKEGHNQPSGRNSDTNTIASTIEAAEGVDAEEDDQP---MKFPLQEYLFGSQIE  171

Query  549  LSESDMAVKNEEEASLSEDLQEVVV  623
             SE+ +A K +E ASL E  Q   V
Sbjct  172  SSETKVAGK-KERASLGELFQATEV  195



>ref|XP_010249078.1| PREDICTED: uncharacterized protein LOC104591766 isoform X1 [Nelumbo 
nucifera]
Length=396

 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 67/224 (30%), Positives = 98/224 (44%), Gaps = 54/224 (24%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKN----RTSF----DPS----HPTYGFSGNP---------N  173
            MKLL WMHRK +   NE  K+    R+ +     PS     P Y +   P         N
Sbjct  1    MKLLDWMHRKFRQYNNEPSKDFIIGRSCYCLSGQPSSPDDEPQYYYHTKPGYNGSRSSSN  60

Query  174  TTCTYQKVIKET----EEKPLNE---------VFHGFLSIGTLGGGSEEAAALFNstdep  314
                 +++ +++    E   ++E          F G L+IGT G     +  +       
Sbjct  61   QMSQKERIRRKSFAGSETTVVDEDLEAAAAAERFDGLLTIGTFG-----SDPVLADPTTS  115

Query  315  ptptfptsfeetttQITDQDLKLITIELEKFL--EAEEDA--QSSKRSSYASIITLTDKT  482
                   +  E  T++T+ DLKLI  ELEK L  E +ED    SS RSS+ S    T  T
Sbjct  116  VFTFSVENITEKETEVTESDLKLINEELEKVLVTEVKEDGCNLSSGRSSHVS----TKTT  171

Query  483  QQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSE  602
            + + +S+  +   CPLQ+Y FG    + E+ M  K +   SLSE
Sbjct  172  ENNGNSTMAI---CPLQEYLFGSPIKIPETTMVAKKQHRMSLSE  212



>ref|XP_010679995.1| PREDICTED: uncharacterized protein LOC104895240 [Beta vulgaris 
subsp. vulgaris]
Length=389

 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 65/213 (31%), Positives = 91/213 (43%), Gaps = 58/213 (27%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNPNTTCTY----------------  188
            MKLLGWMHRKL+ +   ++  + S   S  T  F  + N    Y                
Sbjct  1    MKLLGWMHRKLQKDVTGSL--QASVVGSSCTCLFLPSANNQVNYITPSNEAKQKWQQKGH  58

Query  189  -QKVIK--------ETEEKPLNEVFHGFLSIGTLGGG--SEEAAALFNstdepptptfpt  335
             Q  +K        E  EK   ++F GFL+IGTL     SE     F+            
Sbjct  59   CQHHLKEFNPESNEEFNEKESTDIFPGFLTIGTLSMDPISEAPTPKFD------------  106

Query  336  sfeetttQITDQ--------DLKLITIELEKFLEAEEDAQ----SSKRSSYASIITLTDK  479
                   Q+T++        DLKLI  ELE+FL+ E + +    SS+R+S AS ITL+D+
Sbjct  107  ----MPHQVTNKGGIPEMKYDLKLINEELERFLKVEAEKEGTTDSSRRNSQASTITLSDE  162

Query  480  TQQD-SSSSPTLLLDCPLQKYFFGLSESDMAVK  575
              +D +  + T     PLQ Y  G S   +  K
Sbjct  163  VNEDVNDHNSTNKQVYPLQGYLLGSSTELLTTK  195



>emb|CDY58415.1| BnaC09g54600D [Brassica napus]
Length=357

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 69/144 (48%), Gaps = 20/144 (14%)
 Frame = +3

Query  225  NEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIELEK  404
            ++ FHGFL+IGTLGG +       +    P              ++T+ DLKLI+ ELEK
Sbjct  56   SDFFHGFLAIGTLGGET-----FLDEPATPTFGMSSGEPATDNAEVTENDLKLISNELEK  110

Query  405  FLEAEE-------DAQSSKRSSYASIITLTDKTQQDSSSSPTLLLDCPLQKYFFG----L  551
            FLEAE          ++S  ++ AS I   +    +    P   +  PLQ+Y FG     
Sbjct  111  FLEAEAKEGHNQPSGRNSDTNTIASTIEAAEGVDAEEDDQP---MKFPLQEYLFGSQIES  167

Query  552  SESDMAVKNEEEASLSEDLQEVVV  623
            SE+ +A K +E ASL E  Q   V
Sbjct  168  SETKVAGK-KERASLGELFQATEV  190



>gb|AES77964.2| WRKY transcription factor-like protein [Medicago truncatula]
Length=383

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 97/250 (39%), Gaps = 72/250 (29%)
 Frame = +3

Query  57   MKLLGWMHRKLKHN--------------CNEAVKNRTSFDPSH-----PTYGFSGNPNTT  179
            M LLGWMHRK + N              CN  +  + S D        P  G   N  T 
Sbjct  1    MTLLGWMHRKFRQNSSTEPFKDLVIGNSCN-CLSGQPSLDEEQNYHQKPNLGIRFNKQTQ  59

Query  180  CTYQKVIKE-------------------TEEKPLNEVFHGFLSIGTLGGGSEEAAALFNs  302
             T     K                     ++  + ++F GFL+IGTLG     ++ L  S
Sbjct  60   KTQNNFRKSFAGLESTREEHEEEYGRQSQDDDAMFDLFPGFLAIGTLGSDQPISSNL--S  117

Query  303  tdepptptfptsfeetttQITDQDLKLITIELEKFLEAEEDAQ-----------------  431
            T   P      +  E   ++T+ DLKLI  ELEK L AE                     
Sbjct  118  TPSFPISVQTITENENEDEVTENDLKLINDELEKVLGAETKDDVLSYDSSSRNSHVSTGR  177

Query  432  ----SSKRSSYASIITLTDKTQQDSSSSPTLLLDCPLQKYFFG--LSESDMAV----KNE  581
                S+ RSS+ SI+T++ K  + + ++      CPLQ Y FG  +  S+ AV    K E
Sbjct  178  SSHVSTGRSSHVSIVTISGKPIEGTDTNAV----CPLQGYLFGTAVEMSETAVTSVGKKE  233

Query  582  EEASLSEDLQ  611
               SL E  Q
Sbjct  234  HRTSLGELFQ  243



>ref|XP_008808109.1| PREDICTED: uncharacterized protein LOC103720272 [Phoenix dactylifera]
Length=380

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 107/409 (26%), Positives = 152/409 (37%), Gaps = 106/409 (26%)
 Frame = +3

Query  57    MKLLGWMHRKLKHNCNEAVKN------------RTSFDPSHPTYGFSGNPNTTCTYQKVI  200
             MKLLGWMHRK + N  +  K+            R S D  H       NP  + + +   
Sbjct  1     MKLLGWMHRKFRQNSGDVFKDFPGGGTCNCLSGRPSLDEEHHRRRSHFNPFPSRSLRLSA  60

Query  201   KE------------TEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfe  344
              E              +  + E+F G L+IGTLG G+        + +E    T      
Sbjct  61    AEEFVEDSGCGGGGGGDATVEELFGGLLAIGTLGIGAGPIEEEEAAAEEEGAATPAFGKA  120

Query  345   etttQI--------TDQDLKLITIELEKFL----------EAEEDAQSSKRSSYASIITL  470
                  I        T+ DL +++ ELEK L           A  D  SS R S+ S  + 
Sbjct  121   AIVEAIAEKQAEATTETDLMVVSAELEKVLAMEAEKAAAAAAASDRLSSARPSHVSAGSA  180

Query  471   TDKTQQDSSSSPTLLLDCPLQKYFFG----LSESDMAVKNEEEASLSEDLQEVVVVKGND  638
                              CPLQ + FG    ++E+  A    +E   S  L E+ +     
Sbjct  181   A----------------CPLQGFLFGSPIEIAETTPAASGRKERRAS--LGELFMKSRMA  222

Query  639   KKRAGKAQFAKNFmkkmlkslnsnskskTHMH---------------APNESAPPTknkf  773
             ++ +GK + A         + +   +S   MH                P E++  T  KF
Sbjct  223   EEGSGKREEATVAGGAASAAGDGEGRSTAGMHLMKKLKRRGSRVSGGGPGETSAET--KF  280

Query  774   pkvlkmlkkkvHPERYIGEK----------------GAEKDENRVKGSRLRSSSDTTGNI  905
              K+L++  +KVHPE     K                G   D N  +GS +  S  T    
Sbjct  281   QKILQIFHRKVHPENTAAAKKTAGSGNKNGSDCMRRGGGNDCNGSRGSLVTGSKSTC---  337

Query  906   WFRQMISPEEEELIMTTSQSCSGSGRGGAFMENNGHWIKTDADYLVLEL  1052
               R+   P  +     +S + SGS   G    N  HWIKTDADYLVLEL
Sbjct  338   --RKEAIPNFKFCPNASSLALSGSDSNG----NREHWIKTDADYLVLEL  380



>ref|XP_011097397.1| PREDICTED: uncharacterized protein LOC105176330 [Sesamum indicum]
Length=335

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 108/241 (45%), Gaps = 21/241 (9%)
 Frame = +3

Query  357   QITDQDLKLITIELEKFLEAEE---DAQSSKRSSYASIITLT-DKTQQDSSSS--PTLLL  518
             +IT+ DL LI  ELEKFLEAEE   +  +S RSS ASIITL+  K  + ++ S     ++
Sbjct  99    EITENDLNLINYELEKFLEAEETEVEYDTSGRSSQASIITLSYSKPIEGAAGSEGQVHMV  158

Query  519   DCPLQKYFFGLS-----ESDMAVKNEEEASLSEDLQEVVVVKGND----KKRAGKAQFAK  671
              CPLQ Y F  S      +D  V  ++E +  E+L +   +  +D    K   G    A+
Sbjct  159   ACPLQSYLFAASVEVANYTDKKVTYKKERTSLEELFKRNNIVHDDPPMKKSCEGPEHKAR  218

Query  672   NFmkkmlkslnsnskskTHMHAPNESAPPTknkfpkvlkmlkkkvHPERYIGEKGAEKDE  851
                           K ++       +A  TK     + K L K  H + Y  E   ++  
Sbjct  219   TRNHVAHLMKKVVKKFRSSSTNDTSAASGTKAIKENLSKTLVKMFHKKVYPEEMSEKQYV  278

Query  852   NRVKGSRLRSSSDTTGNIWFRQMISPEEEELIMTTSQSCSGSGRGGAFMENNGHWIKTDA  1031
                K  +  S S+ +G+       S  ++    +T+  C      GA  EN GHWIKTD+
Sbjct  279   KLAKAKKKNSGSNKSGD------ESGSKKSKKKSTTLLCWNGICRGASPENGGHWIKTDS  332

Query  1032  D  1034
             D
Sbjct  333   D  333



>ref|XP_010550213.1| PREDICTED: uncharacterized protein LOC104821129 isoform X1 [Tarenaya 
hassleriana]
Length=357

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 94/219 (43%), Gaps = 35/219 (16%)
 Frame = +3

Query  57   MKLLGWMHRKLKHN----CNEAVKNRTSFDPSH-------PTYGFSG---------NPNT  176
            MK LGWM  K + N      + +     F  S         +Y  SG         N   
Sbjct  1    MKFLGWMRHKFRENNKAPWKDVITGNNCFRLSTHSSLADTASYAESGYNTEFMRQLNKFQ  60

Query  177  TCTYQKVIKETEE----KPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfe  344
              ++ +    TEE    + ++++FHGFL+IGTLGG   E A   +    P       +  
Sbjct  61   ESSFPESSDNTEENLEDEMISQLFHGFLAIGTLGG---EPAV--DEPGTPTFGMSLENPI  115

Query  345  etttQITDQDLKLITIELEKFLEAEEDA--QSSKRSSYASIITLTDKTQQDSSSSPTLLL  518
            E   ++T  DL  I+ ELEKF EAE +   Q S R+S A+ I  T K  +  ++   +  
Sbjct  116  EEKAEVTQNDLNFISDELEKFFEAEAEGHDQPSARNSNANTIASTIKPLEGENAKEDIKT  175

Query  519  DC-PLQKYFFGLSESDMAVK---NEEEASLSEDLQEVVV  623
               PLQ Y FG S      K    +E+ASL E  Q   +
Sbjct  176  TIFPLQGYLFGSSIELPKTKIGATKEKASLGELFQRTNI  214



>ref|XP_003621746.1| hypothetical protein MTR_7g022360 [Medicago truncatula]
Length=384

 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 96/248 (39%), Gaps = 72/248 (29%)
 Frame = +3

Query  63   LLGWMHRKLKHN--------------CNEAVKNRTSFDPSH-----PTYGFSGNPNTTCT  185
            LLGWMHRK + N              CN  +  + S D        P  G   N  T  T
Sbjct  4    LLGWMHRKFRQNSSTEPFKDLVIGNSCN-CLSGQPSLDEEQNYHQKPNLGIRFNKQTQKT  62

Query  186  YQKVIKE-------------------TEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstd  308
                 K                     ++  + ++F GFL+IGTLG     ++ L  ST 
Sbjct  63   QNNFRKSFAGLESTREEHEEEYGRQSQDDDAMFDLFPGFLAIGTLGSDQPISSNL--STP  120

Query  309  epptptfptsfeetttQITDQDLKLITIELEKFLEAEEDAQ-------------------  431
              P      +  E   ++T+ DLKLI  ELEK L AE                       
Sbjct  121  SFPISVQTITENENEDEVTENDLKLINDELEKVLGAETKDDVLSYDSSSRNSHVSTGRSS  180

Query  432  --SSKRSSYASIITLTDKTQQDSSSSPTLLLDCPLQKYFFG--LSESDMAV----KNEEE  587
              S+ RSS+ SI+T++ K  + + ++      CPLQ Y FG  +  S+ AV    K E  
Sbjct  181  HVSTGRSSHVSIVTISGKPIEGTDTNAV----CPLQGYLFGTAVEMSETAVTSVGKKEHR  236

Query  588  ASLSEDLQ  611
             SL E  Q
Sbjct  237  TSLGELFQ  244



>ref|XP_003601817.1| hypothetical protein MTR_3g085710 [Medicago truncatula]
Length=407

 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 82/190 (43%), Gaps = 36/190 (19%)
 Frame = +3

Query  60   KLLGWMHRKLKHNCNEAVKN-----RTSFDPSHPTYGFSGNPNTTCTYQK----------  194
            +LLGWMHRKL+ N  E  K+      TS D  +  Y +      +C Y K          
Sbjct  38   QLLGWMHRKLRQNSTEPFKDLVTGQATSVDEENNYYYYLKPKFGSCKYVKQTQKEQFKLR  97

Query  195  -----------VIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsf  341
                       V +E +++  + VF GFL+IGTLG  ++ +           + +     
Sbjct  98   KSFEAVGSGRAVDEEEDKEAWSGVFPGFLAIGTLGLETDPSPL-----TPSFSISVENII  152

Query  342  eetttQITDQDLKLITIELEKFLE-AEEDAQSSKRSSYASIITLTDKTQQDSSSSPTLLL  518
             E   ++T+++LK+I  ELEK L     +  SS R+S+ S        +    S+     
Sbjct  153  TEREAEVTEKELKVINNELEKVLVLTNNNDDSSGRNSHVSTAGRNSHGRISIESNSI---  209

Query  519  DCPLQKYFFG  548
             CPLQ Y FG
Sbjct  210  -CPLQGYLFG  218



>gb|AES78372.2| WRKY transcription factor-like protein, putative [Medicago truncatula]
Length=328

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 63/115 (55%), Gaps = 15/115 (13%)
 Frame = +3

Query  222  LNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIELE  401
            ++E F GFL+IGTLG  +E A   F         +   +       +T+  LKLI+ ELE
Sbjct  60   ISEKFQGFLTIGTLG--AEPATPTF--------ASPLGNIPMKDAAVTETQLKLISYELE  109

Query  402  KFLEAEEDA--QSSKRSSYASIITLTDKTQQDSSSSPTL--LLDCPLQKYFFGLS  554
            KF+EA+E+   +SS R S+ S +TL+ K + D   +  L   + CPLQ+Y  G S
Sbjct  110  KFVEADEECFYESSGRISFRSNVTLSRK-KTDGLETEDLGNKVICPLQEYLLGSS  163



>dbj|BAB08288.1| unnamed protein product [Arabidopsis thaliana]
Length=361

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 66/139 (47%), Gaps = 19/139 (14%)
 Frame = +3

Query  228  EVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIELEKF  407
            + F GFL+IGTLGG       L      P               +T+ DLKLI+ EL+KF
Sbjct  89   DFFDGFLAIGTLGG----ETLLDEQPATPTFGMSFEDPAIDDADVTENDLKLISNELDKF  144

Query  408  LEAEE-------DAQSSKRSSYASIITLTDKTQQDSSSSPTLLLDCPLQKYFFG----LS  554
            LEAE          ++S  ++ AS I   +    +  + P   +  PLQ+YFFG    L 
Sbjct  145  LEAEAKEGHHQPSGRNSDTNTIASTIEAIEGVDDEEDNQP---MKFPLQEYFFGSLIELP  201

Query  555  ESDMAVKNEEEASLSEDLQ  611
            ES +A K ++ ASL E  Q
Sbjct  202  ESKIAGK-KDRASLGELFQ  219



>ref|XP_006338807.1| PREDICTED: uncharacterized protein LOC102585754 [Solanum tuberosum]
Length=258

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 69/168 (41%), Gaps = 47/168 (28%)
 Frame = +3

Query  57   MKLLGWMHRKLKHNCNEAVKNRTSFDPSHPTYGFSGNPNTTCTYQKVIKETEEKPLNEVF  236
            MKLLGWMH  L+   NE         P++     SG  N+   + K +K    +  +E+F
Sbjct  1    MKLLGWMHSILRQKGNEP--------PNNTAIIVSG--NSVSAHDKEVKSNGAE--DEIF  48

Query  237  HGFLSIGTLGGGSEEAAALFNstdepptptfptsfeetttQITDQDLKLITIELEKFLEA  416
             GFL+IGTLG            T                   T+++LK I  ELEKFLE 
Sbjct  49   PGFLAIGTLGNYETTNTDPPTPTFPMHVE-------------TEKELKFINDELEKFLE-  94

Query  417  EEDAQSSKRSSYASIITLTDKTQQDSSSSPT--LLLDCPLQKYFFGLS  554
                               +K  ++ +  P+   + +CPLQKY  G S
Sbjct  95   -------------------EKVNEEFAFEPSERTMEECPLQKYLLGSS  123



>emb|CDP13369.1| unnamed protein product [Coffea canephora]
Length=412

 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 81/214 (38%), Gaps = 61/214 (29%)
 Frame = +3

Query  75   MHRKLKHNCNEAVKN------------RTSFD----PSHPTYGF---------------S  161
            MHRK + N NE  K+            + S D    PS P Y                 S
Sbjct  1    MHRKFRQNSNEPFKDFSIGNSCACLTGQPSLDDVQYPSKPNYCTKPLIRGQRDNQLRKSS  60

Query  162  GNPNTTCTYQKVIKETEEKPLNEVFHGFLSIGTLGGGSEEAAALFNstdepptptfptsf  341
             + +   T    I E     L+E FHGFL+IGTLG     A         P       + 
Sbjct  61   ASTDAARTDGDDIGEETSAALSEFFHGFLAIGTLGTDPVTA-----DPSTPTFSISVENI  115

Query  342  eetttQITDQDLKLITIELEKFLEAEEDAQ-------------------------SSKRS  446
             E  T++T+ +L+LI  ELEK L A+E                            S+ RS
Sbjct  116  MEKETEVTENELRLINDELEKVLGADEICNLSSGRNSHVSTGRNSHVSTGRNSHVSAGRS  175

Query  447  SYASIITLTDKTQQDSSSSPTLLLDCPLQKYFFG  548
            S+ S ITL  K  + + ++    + CPLQ Y  G
Sbjct  176  SHCSAITLGGKPTESTDANGNGTIVCPLQSYLLG  209



>ref|XP_004492060.1| PREDICTED: uncharacterized protein LOC101497033 [Cicer arietinum]
Length=382

 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 98/250 (39%), Gaps = 85/250 (34%)
 Frame = +3

Query  57   MKLLGWMHRKLKHN--------------CNEAVKNRTSFDPSHPTYGFSGNPNTTCTYQK  194
            MKLLGWMHRKL+ N              CN  +  + S D       +   PN    + K
Sbjct  1    MKLLGWMHRKLRQNNSTEPFKDLVIGNSCN-CLSGQPSVDDEQ---NYHQKPNLNIKFTK  56

Query  195  VIKETE---------------------------EKPLNEVFHGFLSIGTLGGGSEEAAA-  290
              ++T+                           +  + ++F GFL+IGTLG   +  ++ 
Sbjct  57   QTQKTQNNLRKSFASLQSTREEEDEDEYDDVESQASMFDLFPGFLAIGTLGSSDQTISST  116

Query  291  --LFNstdepptptfptsfeetttQITDQDLKLITIELEKFLEAEE------------DA  428
              LF         +  T  E     +T+ DLKLI  ELEK L  ++              
Sbjct  117  PTLF-------PISVETITENEDQVVTENDLKLINDELEKVLTKDDLVVGSYDSSRRNSH  169

Query  429  QSSKRSSYASIITLTDKTQQDSSS-------------SPTLLLDCPLQKYFFGLSESDMA  569
             S+ R+S+ SI+T++ K  +++               S T    CPLQ Y FG      A
Sbjct  170  VSTGRNSHVSIVTISGKPIENNEGYQYLTKVEGGKEFSNTESSICPLQGYLFG-----TA  224

Query  570  VKNEEEASLS  599
            V+  E A++S
Sbjct  225  VEYSETAAVS  234



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4625486112216