BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15719_g1_i2 len=1112 path=[1090:0-576 1667:577-1111]

Length=1112
                                                                      Score     E

ref|XP_006338755.1|  PREDICTED: reticulon-like protein B13-like         169   4e-46   
ref|XP_009777026.1|  PREDICTED: reticulon-like protein B13              164   3e-44   
ref|XP_009617575.1|  PREDICTED: reticulon-like protein B13 isofor...    161   2e-43   
ref|XP_009617576.1|  PREDICTED: reticulon-like protein B13 isofor...    160   4e-43   
ref|XP_002270797.1|  PREDICTED: reticulon-like protein B13              155   4e-41   Vitis vinifera
ref|XP_008363135.1|  PREDICTED: reticulon-like protein B13              148   1e-38   
ref|XP_009366426.1|  PREDICTED: reticulon-like protein B13              146   8e-38   
ref|XP_004232057.1|  PREDICTED: reticulon-like protein B13              145   3e-37   
ref|XP_010109887.1|  Reticulon-like protein                             142   2e-36   
ref|XP_004300547.1|  PREDICTED: reticulon-like protein B13-like         142   2e-36   
ref|XP_006425824.1|  hypothetical protein CICLE_v10026468mg             140   9e-36   
ref|XP_010263759.1|  PREDICTED: reticulon-like protein B13              141   1e-35   
ref|XP_007047155.1|  Reticulan like protein B13, putative               141   5e-35   
ref|XP_007203430.1|  hypothetical protein PRUPE_ppa021658mg             134   8e-34   
gb|EYU44361.1|  hypothetical protein MIMGU_mgv1a013149mg                134   2e-33   
gb|KDP31877.1|  hypothetical protein JCGZ_12338                         132   2e-32   
ref|XP_003517278.2|  PREDICTED: LOW QUALITY PROTEIN: reticulon-li...    132   2e-32   
ref|XP_008241555.1|  PREDICTED: reticulon-like protein B13              130   4e-32   
ref|XP_011099219.1|  PREDICTED: reticulon-like protein B13              130   4e-32   
ref|NP_001237302.1|  24 kDa seed maturation protein                     129   9e-32   
gb|ACU18528.1|  unknown                                                 129   1e-31   Glycine max [soybeans]
ref|XP_002310752.2|  reticulon family protein                           128   3e-31   Populus trichocarpa [western balsam poplar]
ref|XP_002522336.1|  conserved hypothetical protein                     126   1e-30   Ricinus communis
gb|KHN42055.1|  Putative disease resistance protein                     130   2e-29   
ref|XP_011039227.1|  PREDICTED: reticulon-like protein B13              122   4e-29   
gb|KDO79339.1|  hypothetical protein CISIN_1g047422mg                   121   5e-29   
ref|XP_010531229.1|  PREDICTED: reticulon-like protein B13              122   6e-29   
emb|CDP11148.1|  unnamed protein product                                121   7e-29   
ref|XP_008340297.1|  PREDICTED: reticulon-like protein B13              113   2e-26   
ref|XP_003611823.1|  seed maturation protein                            112   2e-25   
ref|XP_002878692.1|  reticulon family protein                           112   2e-25   
ref|XP_009117273.1|  PREDICTED: reticulon-like protein B13              111   3e-25   
ref|NP_565555.1|  reticulon-like protein B13                            111   4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004512216.1|  PREDICTED: reticulon-like protein B13-like         109   2e-24   
ref|XP_007156840.1|  hypothetical protein PHAVU_002G021800g             108   3e-24   
emb|CDX76854.1|  BnaC08g34400D                                          107   7e-24   
ref|XP_006295650.1|  hypothetical protein CARUB_v10024763mg             105   3e-23   
ref|XP_006404851.1|  hypothetical protein EUTSA_v10000566mg             104   1e-22   
gb|KHN36199.1|  Reticulon-like protein B13                              103   2e-22   
ref|XP_010472358.1|  PREDICTED: reticulon-like protein B13              102   3e-22   
ref|XP_010429314.1|  PREDICTED: reticulon-like protein B13              101   1e-21   
ref|XP_007047156.1|  Reticulan like protein B13                         101   9e-21   
ref|XP_010030609.1|  PREDICTED: LOW QUALITY PROTEIN: reticulon-li...  97.8    1e-20   
ref|XP_010417108.1|  PREDICTED: reticulon-like protein B13            97.8    2e-20   
ref|XP_003611807.1|  seed maturation protein                          92.8    5e-19   
ref|XP_003611809.1|  seed maturation protein                          92.0    2e-18   
gb|AES94768.2|  reticulon-like protein                                91.7    6e-17   
ref|XP_003611817.1|  seed maturation protein                          88.6    5e-16   
gb|KFK32722.1|  hypothetical protein AALP_AA6G280300                  78.2    5e-14   
emb|CDY41666.1|  BnaC03g62180D                                        80.9    5e-14   
ref|XP_006647139.1|  PREDICTED: reticulon-like protein B2-like        78.6    2e-13   
ref|NP_001046501.1|  Os02g0265900                                     78.2    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006413535.1|  hypothetical protein EUTSA_v10025959mg           77.8    5e-13   
gb|EAY85291.1|  hypothetical protein OsI_06662                        77.0    6e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_003572248.1|  PREDICTED: reticulon-like protein B2             77.0    7e-13   
ref|XP_004969875.1|  PREDICTED: reticulon-like protein B1-like        77.4    7e-13   
gb|AFK41983.1|  unknown                                               76.6    1e-12   
ref|NP_001056102.1|  Os05g0526400                                     76.6    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011047748.1|  PREDICTED: reticulon-like protein B1             76.6    1e-12   
ref|XP_009137263.1|  PREDICTED: reticulon-like protein B1             77.0    1e-12   
emb|CDY57657.1|  BnaC01g15350D                                        77.0    1e-12   
emb|CDY44123.1|  BnaA01g13310D                                        77.0    1e-12   
ref|XP_010509305.1|  PREDICTED: reticulon-like protein B1             76.6    1e-12   
dbj|BAJ98297.1|  predicted protein                                    76.3    1e-12   
ref|NP_001044177.1|  Os01g0736900                                     76.3    2e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ13460.1|  hypothetical protein OsJ_03377                        76.3    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010433883.1|  PREDICTED: reticulon-like protein B1             76.6    2e-12   
ref|XP_010530741.1|  PREDICTED: reticulon-like protein B10 isofor...  75.5    2e-12   
ref|XP_010439152.1|  PREDICTED: reticulon-like protein B1 isoform X1  76.3    2e-12   
ref|NP_194094.1|  VIRB2-interacting protein 1                         76.3    2e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ84486.1|  unknown                                               76.3    2e-12   Medicago truncatula
ref|XP_006284300.1|  hypothetical protein CARUB_v10005469mg           76.3    2e-12   
dbj|BAJ33905.1|  unnamed protein product                              76.3    2e-12   
ref|XP_010530737.1|  PREDICTED: reticulon-like protein B10 isofor...  75.1    2e-12   
ref|XP_006644671.1|  PREDICTED: reticulon-like protein B1-like        75.5    3e-12   
ref|XP_003568063.1|  PREDICTED: reticulon-like protein B1             75.5    3e-12   
ref|XP_010533622.1|  PREDICTED: reticulon-like protein B4             75.5    3e-12   
ref|XP_002869770.1|  VIRB2-interacting protein 1                      75.9    3e-12   
ref|XP_004503660.1|  PREDICTED: reticulon-like protein B2-like        75.5    3e-12   
emb|CDY10954.1|  BnaA03g46130D                                        75.5    4e-12   
ref|XP_009137373.1|  PREDICTED: reticulon-like protein B1             75.1    4e-12   
gb|EAY75742.1|  hypothetical protein OsI_03655                        74.7    5e-12   Oryza sativa Indica Group [Indian rice]
emb|CDY24806.1|  BnaA08g15040D                                        75.1    5e-12   
ref|XP_001754332.1|  predicted protein                                74.3    5e-12   
gb|KFK31901.1|  hypothetical protein AALP_AA6G173800                  74.7    5e-12   
gb|ABB51093.1|  reticulon                                             73.9    6e-12   Hordeum vulgare [barley]
gb|KHN15986.1|  Reticulon-like protein B5                             74.3    7e-12   
gb|EAY98759.1|  hypothetical protein OsI_20691                        73.9    9e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001241367.1|  uncharacterized protein LOC100796111             73.9    1e-11   
dbj|BAJ89699.1|  predicted protein                                    73.9    1e-11   
gb|EMT18983.1|  Reticulon-like protein B1                             73.2    1e-11   
ref|XP_009112901.1|  PREDICTED: reticulon-like protein B3             73.6    1e-11   
ref|XP_010023623.1|  PREDICTED: reticulon-like protein B8 isoform X1  74.3    1e-11   
ref|XP_009109295.1|  PREDICTED: reticulon-like protein B1             73.6    2e-11   
emb|CDP12094.1|  unnamed protein product                              73.2    2e-11   
ref|XP_010055800.1|  PREDICTED: reticulon-like protein B1             73.6    2e-11   
ref|XP_003528823.2|  PREDICTED: reticulon-like protein B1-like        74.3    2e-11   
gb|AFK34557.1|  unknown                                               73.6    2e-11   
emb|CDM81762.1|  unnamed protein product                              73.2    2e-11   
gb|ACU23452.1|  unknown                                               72.8    2e-11   Glycine max [soybeans]
gb|KCW72347.1|  hypothetical protein EUGRSUZ_E00805                   73.2    2e-11   
ref|XP_009341126.1|  PREDICTED: reticulon-like protein B1             72.8    2e-11   
ref|XP_003525365.1|  PREDICTED: reticulon-like protein B2-like is...  72.8    2e-11   
ref|XP_001759351.1|  predicted protein                                72.4    3e-11   
gb|KDO56851.1|  hypothetical protein CISIN_1g023137mg                 72.4    3e-11   
gb|KCW72348.1|  hypothetical protein EUGRSUZ_E00805                   73.2    3e-11   
dbj|BAJ94514.1|  predicted protein                                    72.4    3e-11   
ref|XP_006422079.1|  hypothetical protein CICLE_v10005564mg           72.4    3e-11   
gb|EMS50148.1|  Reticulon-like protein B2                             72.0    3e-11   
ref|XP_010422067.1|  PREDICTED: reticulon-like protein B2             72.8    3e-11   
ref|XP_010547982.1|  PREDICTED: reticulon-like protein B10 isofor...  71.6    3e-11   
gb|EMS62606.1|  Reticulon-like protein B1                             72.0    4e-11   
ref|XP_003592173.1|  Reticulon family protein                         72.0    5e-11   
emb|CDY48222.1|  BnaA07g03850D                                        71.2    5e-11   
gb|EMT25698.1|  Reticulon-like protein B2                             72.0    5e-11   
ref|XP_009104316.1|  PREDICTED: reticulon-like protein B6             72.0    5e-11   
ref|XP_010529625.1|  PREDICTED: reticulon-like protein B1             72.0    5e-11   
ref|XP_009123150.1|  PREDICTED: reticulon-like protein B10            70.9    6e-11   
ref|XP_009603458.1|  PREDICTED: reticulon-like protein B11 isofor...  70.9    6e-11   
ref|XP_010455527.1|  PREDICTED: reticulon-like protein B2             72.0    6e-11   
ref|XP_008437352.1|  PREDICTED: reticulon-like protein B2             71.6    6e-11   
ref|XP_010523772.1|  PREDICTED: reticulon-like protein B5             71.6    6e-11   
ref|XP_009345612.1|  PREDICTED: reticulon-like protein B1             71.6    6e-11   
ref|NP_001149653.1|  LOC100283279                                     71.6    7e-11   Zea mays [maize]
ref|XP_010530740.1|  PREDICTED: reticulon-like protein B10 isofor...  70.9    8e-11   
ref|XP_010558054.1|  PREDICTED: reticulon-like protein B16 isofor...  70.9    8e-11   
ref|XP_006291739.1|  hypothetical protein CARUB_v10017909mg           71.2    8e-11   
ref|XP_009598008.1|  PREDICTED: reticulon-like protein B2             70.5    9e-11   
gb|KDP25363.1|  hypothetical protein JCGZ_20519                       71.2    9e-11   
gb|AFK42059.1|  unknown                                               71.2    9e-11   
gb|ACF87936.1|  unknown                                               70.5    9e-11   Zea mays [maize]
emb|CDY25557.1|  BnaC09g11820D                                        71.2    9e-11   
ref|XP_004229935.1|  PREDICTED: reticulon-like protein B1             71.2    9e-11   
ref|XP_008232963.1|  PREDICTED: reticulon-like protein B6             71.2    9e-11   
ref|XP_010530738.1|  PREDICTED: reticulon-like protein B10 isofor...  70.5    1e-10   
emb|CDY52012.1|  BnaC06g42920D                                        70.9    1e-10   
ref|XP_006654676.1|  PREDICTED: reticulon-like protein B1-like        70.9    1e-10   
ref|XP_010530735.1|  PREDICTED: reticulon-like protein B10 isofor...  70.5    1e-10   
ref|XP_007048924.1|  Reticulon family protein                         70.9    1e-10   
emb|CDX71213.1|  BnaC07g04920D                                        70.1    1e-10   
emb|CDY38194.1|  BnaA09g11950D                                        70.9    1e-10   
ref|XP_004143883.1|  PREDICTED: reticulon-like protein B2-like        70.9    1e-10   
ref|XP_004230738.1|  PREDICTED: reticulon-like protein B11            70.1    1e-10   
ref|XP_010530739.1|  PREDICTED: reticulon-like protein B10 isofor...  70.1    1e-10   
ref|XP_006391670.1|  hypothetical protein EUTSA_v10023649mg           70.9    1e-10   
ref|XP_010544774.1|  PREDICTED: reticulon-like protein B6             70.5    1e-10   
ref|XP_011003673.1|  PREDICTED: reticulon-like protein B1             70.5    1e-10   
gb|EMT06999.1|  Reticulon-like protein B1                             70.5    1e-10   
ref|XP_010023631.1|  PREDICTED: reticulon-like protein B8 isoform X2  71.2    2e-10   
ref|XP_007218268.1|  hypothetical protein PRUPE_ppa008259mg           71.6    2e-10   
ref|XP_010435260.1|  PREDICTED: reticulon-like protein B2             70.5    2e-10   
ref|XP_006374289.1|  hypothetical protein POPTR_0015s05710g           70.5    2e-10   
gb|EMS49910.1|  Reticulon-like protein B3                             71.2    2e-10   
ref|XP_010541290.1|  PREDICTED: reticulon-like protein B1             70.5    2e-10   
emb|CDY08353.1|  BnaC09g12430D                                        70.1    2e-10   
ref|XP_010538815.1|  PREDICTED: reticulon-like protein B1             70.5    2e-10   
ref|XP_002511930.1|  conserved hypothetical protein                   70.1    2e-10   Ricinus communis
gb|KHG29253.1|  Reticulon-like protein B5                             69.7    3e-10   
ref|XP_009603460.1|  PREDICTED: reticulon-like protein B11 isofor...  68.9    3e-10   
ref|XP_006374290.1|  hypothetical protein POPTR_0015s05710g           69.7    3e-10   
ref|XP_002887921.1|  reticulon family protein                         69.7    3e-10   
emb|CDY34396.1|  BnaA09g11380D                                        69.7    3e-10   
gb|KFK40472.1|  hypothetical protein AALP_AA2G000200                  69.7    3e-10   
gb|KDP28552.1|  hypothetical protein JCGZ_14323                       69.7    3e-10   
ref|NP_001130478.1|  Seed maturation protein                          69.7    3e-10   Zea mays [maize]
ref|XP_006288443.1|  hypothetical protein CARUB_v10001704mg           69.7    3e-10   
ref|XP_010054092.1|  PREDICTED: reticulon-like protein B8 isoform X1  69.3    4e-10   
ref|XP_002509881.1|  conserved hypothetical protein                   69.3    4e-10   Ricinus communis
dbj|BAH57206.1|  AT1G64090                                            69.3    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003569752.1|  PREDICTED: reticulon-like protein B1             69.3    4e-10   
ref|XP_007160119.1|  hypothetical protein PHAVU_002G294100g           69.3    4e-10   
ref|XP_002300239.1|  hypothetical protein POPTR_0001s30770g           68.6    4e-10   Populus trichocarpa [western balsam poplar]
gb|AFW77088.1|  hypothetical protein ZEAMMB73_846644                  68.6    5e-10   
ref|XP_009597328.1|  PREDICTED: reticulon-like protein B5             69.3    5e-10   
ref|XP_009134231.1|  PREDICTED: reticulon-like protein B2             69.3    5e-10   
ref|NP_001239711.1|  uncharacterized protein LOC100811024             68.9    5e-10   
ref|XP_008234814.1|  PREDICTED: reticulon-like protein B1             68.9    5e-10   
ref|XP_006302727.1|  hypothetical protein CARUB_v10020840mg           68.9    5e-10   
ref|XP_009112802.1|  PREDICTED: reticulon-like protein B3             68.9    5e-10   
ref|NP_176592.1|  reticulon-like protein B3                           68.9    5e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402470.1|  hypothetical protein EUTSA_v10006190mg           68.9    6e-10   
gb|EPS73616.1|  hypothetical protein M569_01145                       68.9    6e-10   
ref|XP_006650682.1|  PREDICTED: reticulon-like protein B8-like        68.6    6e-10   
gb|AEZ00899.1|  putative 24 kDa seed maturation protein               68.9    6e-10   
ref|XP_007218819.1|  hypothetical protein PRUPE_ppa010065mg           68.9    6e-10   
ref|XP_009626480.1|  PREDICTED: reticulon-like protein B2 isoform X1  68.9    6e-10   
ref|XP_010552913.1|  PREDICTED: reticulon-like protein B16 isofor...  68.2    6e-10   
gb|KCW72350.1|  hypothetical protein EUGRSUZ_E00805                   68.6    6e-10   
emb|CDX99221.1|  BnaC05g33360D                                        67.8    7e-10   
ref|XP_007215866.1|  hypothetical protein PRUPE_ppa010481mg           68.6    7e-10   
gb|KFK38479.1|  hypothetical protein AALP_AA3G118300                  68.2    7e-10   
ref|XP_001783072.1|  predicted protein                                68.2    7e-10   
ref|XP_010558053.1|  PREDICTED: reticulon-like protein B16 isofor...  68.2    7e-10   
ref|XP_006439447.1|  hypothetical protein CICLE_v10021801mg           68.6    8e-10   
ref|NP_001185307.1|  reticulon-like protein B3                        68.6    8e-10   
ref|XP_010916969.1|  PREDICTED: reticulon-like protein B3             69.3    8e-10   
ref|XP_004245560.1|  PREDICTED: reticulon-like protein B4             68.6    8e-10   
ref|XP_010413382.1|  PREDICTED: reticulon-like protein B6             68.2    8e-10   
ref|XP_009765582.1|  PREDICTED: reticulon-like protein B2             68.2    9e-10   
ref|XP_010512508.1|  PREDICTED: reticulon-like protein B6             68.2    9e-10   
ref|NP_191715.2|  reticulon-like protein B6                           68.2    9e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006343915.1|  PREDICTED: reticulon-like protein B1-like        68.6    9e-10   
ref|XP_010469092.1|  PREDICTED: reticulon-like protein B6             68.2    9e-10   
ref|XP_002993037.1|  hypothetical protein SELMODRAFT_136377           67.8    9e-10   
ref|XP_002876621.1|  reticulon family protein                         68.2    9e-10   
ref|XP_010252079.1|  PREDICTED: reticulon-like protein B16 isofor...  67.8    1e-09   
ref|XP_004499535.1|  PREDICTED: reticulon-like protein B8-like is...  68.2    1e-09   
ref|XP_011093062.1|  PREDICTED: reticulon-like protein B1             68.2    1e-09   
ref|XP_006339640.1|  PREDICTED: reticulon-like protein B1-like        68.2    1e-09   
ref|XP_010545343.1|  PREDICTED: reticulon-like protein B3             68.2    1e-09   
ref|XP_004951242.1|  PREDICTED: reticulon-like protein B2-like        67.8    1e-09   
ref|XP_009793558.1|  PREDICTED: reticulon-like protein B4             68.2    1e-09   
ref|NP_001189857.1|  reticulon-like protein B16                       67.0    1e-09   
ref|XP_010252077.1|  PREDICTED: reticulon-like protein B16 isofor...  67.8    1e-09   
ref|XP_001784743.1|  predicted protein                                67.8    1e-09   
ref|XP_009766982.1|  PREDICTED: reticulon-like protein B5             68.2    1e-09   
ref|NP_974276.3|  reticulon-like protein B16                          67.0    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001783075.1|  predicted protein                                67.0    1e-09   
ref|NP_001130268.1|  uncharacterized protein LOC100191362             67.8    1e-09   Zea mays [maize]
ref|XP_008810936.1|  PREDICTED: reticulon-like protein B5             67.8    1e-09   
gb|ACG36034.1|  reticulon                                             67.8    1e-09   Zea mays [maize]
ref|NP_001130603.1|  uncharacterized protein LOC100191702             67.4    1e-09   Zea mays [maize]
ref|XP_004510697.1|  PREDICTED: reticulon-like protein B1-like        67.8    1e-09   
ref|XP_003565315.1|  PREDICTED: reticulon-like protein B4             67.0    1e-09   
ref|XP_002441411.1|  hypothetical protein SORBIDRAFT_09g026210        67.4    2e-09   Sorghum bicolor [broomcorn]
ref|XP_010658515.1|  PREDICTED: reticulon-like protein B2             67.4    2e-09   
ref|XP_006656127.1|  PREDICTED: reticulon-like protein B2-like        67.4    2e-09   
ref|XP_006422934.1|  hypothetical protein CICLE_v10029287mg           66.6    2e-09   
gb|KHG04885.1|  Reticulon-like protein B5                             67.4    2e-09   
gb|EPS69502.1|  hypothetical protein M569_05265                       67.0    2e-09   
ref|XP_004961431.1|  PREDICTED: reticulon-like protein B1-like        67.0    2e-09   
ref|NP_001130091.1|  uncharacterized protein LOC100191184             67.0    2e-09   Zea mays [maize]
ref|NP_974275.1|  reticulon-like protein B16                          66.6    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192861.1|  reticulon-like protein B2                           67.4    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002463790.1|  hypothetical protein SORBIDRAFT_01g006220        66.6    3e-09   Sorghum bicolor [broomcorn]
ref|XP_009415169.1|  PREDICTED: reticulon-like protein B2             67.0    3e-09   
ref|NP_001057713.1|  Os06g0503400                                     67.0    3e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010053196.1|  PREDICTED: reticulon-like protein B1             67.0    3e-09   
gb|KFK37395.1|  hypothetical protein AALP_AA4G251600                  66.6    3e-09   
ref|XP_006476478.1|  PREDICTED: reticulon-like protein B2-like        66.6    3e-09   
gb|EYU32181.1|  hypothetical protein MIMGU_mgv1a012219mg              67.0    3e-09   
gb|KDP22201.1|  hypothetical protein JCGZ_26032                       66.6    3e-09   
ref|XP_002273700.1|  PREDICTED: reticulon-like protein B12 isofor...  65.9    3e-09   Vitis vinifera
ref|XP_010654209.1|  PREDICTED: reticulon-like protein B12 isofor...  65.9    3e-09   
ref|XP_007139767.1|  hypothetical protein PHAVU_008G057300g           66.6    3e-09   
ref|XP_008344578.1|  PREDICTED: reticulon-like protein B1             66.6    3e-09   
ref|XP_008811812.1|  PREDICTED: reticulon-like protein B8             66.2    4e-09   
gb|KHG24129.1|  Reticulon-like protein B3                             66.2    4e-09   
ref|XP_006407490.1|  hypothetical protein EUTSA_v10021461mg           65.9    4e-09   
ref|XP_002275520.1|  PREDICTED: reticulon-like protein B5             66.2    4e-09   Vitis vinifera
ref|XP_004307723.1|  PREDICTED: reticulon-like protein B16-like       65.9    4e-09   
ref|XP_010552962.1|  PREDICTED: reticulon-like protein B8             65.9    4e-09   
ref|XP_011030397.1|  PREDICTED: reticulon-like protein B11            65.5    5e-09   
emb|CDY05135.1|  BnaC03g29330D                                        67.0    5e-09   
ref|XP_010054120.1|  PREDICTED: reticulon-like protein B8 isoform X2  65.9    5e-09   
ref|XP_009388111.1|  PREDICTED: reticulon-like protein B1             66.2    5e-09   
ref|XP_006397801.1|  hypothetical protein EUTSA_v10001599mg           66.2    5e-09   
emb|CDP18758.1|  unnamed protein product                              65.9    5e-09   
ref|XP_010906857.1|  PREDICTED: reticulon-like protein B8 isoform X1  65.9    5e-09   
dbj|BAK05980.1|  predicted protein                                    65.5    5e-09   
ref|XP_008229593.1|  PREDICTED: reticulon-like protein B8             65.9    6e-09   
ref|NP_198975.1|  reticulon-like protein B4                           65.9    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010093192.1|  Reticulon-like protein                           65.9    6e-09   
ref|XP_002870630.1|  VIRB2-interacting protein 3                      65.9    6e-09   
ref|NP_566635.1|  reticulon-like protein B11                          65.1    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008805646.1|  PREDICTED: reticulon-like protein B3             65.9    6e-09   
gb|KCW89791.1|  hypothetical protein EUGRSUZ_A02040                   66.2    7e-09   
ref|XP_010924771.1|  PREDICTED: reticulon-like protein B2             65.5    7e-09   
gb|ACG32549.1|  seed maturation protein                               65.5    7e-09   Zea mays [maize]
ref|XP_002282955.1|  PREDICTED: reticulon-like protein B9             65.1    7e-09   Vitis vinifera
ref|XP_010921131.1|  PREDICTED: reticulon-like protein B16            65.1    8e-09   
ref|XP_004981542.1|  PREDICTED: reticulon-like protein B8-like        66.2    8e-09   
ref|NP_001051461.1|  Os03g0781700                                     65.5    8e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003633964.1|  PREDICTED: reticulon-like protein B1             65.5    8e-09   
ref|XP_002972127.1|  hypothetical protein SELMODRAFT_96839            64.7    9e-09   
ref|XP_009801484.1|  PREDICTED: reticulon-like protein B11            64.7    9e-09   
ref|XP_003519525.1|  PREDICTED: uncharacterized LOC100500122 isof...  65.1    1e-08   
ref|XP_006852959.1|  hypothetical protein AMTR_s00033p00243500        63.9    1e-08   
emb|CDY08567.1|  BnaA05g28030D                                        65.1    1e-08   
ref|XP_009416410.1|  PREDICTED: reticulon-like protein B2             65.1    1e-08   
ref|XP_008375931.1|  PREDICTED: reticulon-like protein B1             65.1    1e-08   
gb|ABC01908.1|  putative 24 kDa seed maturation protein-like protein  65.1    1e-08   
ref|XP_011085435.1|  PREDICTED: reticulon-like protein B8             65.1    1e-08   
ref|XP_009368711.1|  PREDICTED: reticulon-like protein B1             65.1    1e-08   
emb|CBI26976.3|  unnamed protein product                              65.1    1e-08   
emb|CDY42012.1|  BnaC04g00900D                                        64.7    1e-08   
gb|KHN28537.1|  Reticulon-like protein B8                             64.3    2e-08   
ref|XP_010508058.1|  PREDICTED: reticulon-like protein B5             64.7    2e-08   
ref|XP_010252078.1|  PREDICTED: reticulon-like protein B16 isofor...  64.3    2e-08   
ref|XP_009142682.1|  PREDICTED: reticulon-like protein B5             64.7    2e-08   
ref|XP_002874678.1|  VIRB2-interacting protein 2                      64.7    2e-08   
ref|XP_010506615.1|  PREDICTED: reticulon-like protein B5             64.7    2e-08   
ref|XP_004496510.1|  PREDICTED: reticulon-like protein B1-like        64.7    2e-08   
ref|XP_002306759.1|  reticulon family protein                         64.3    2e-08   
gb|ACG26944.1|  seed maturation protein                               64.3    2e-08   
ref|XP_010036176.1|  PREDICTED: reticulon-like protein B8             64.3    2e-08   
ref|XP_010518282.1|  PREDICTED: reticulon-like protein B5             64.7    2e-08   
gb|EAY92056.1|  hypothetical protein OsI_13754                        64.7    2e-08   
ref|XP_010418453.1|  PREDICTED: reticulon-like protein B3             64.3    2e-08   
ref|XP_010430525.1|  PREDICTED: reticulon-like protein B3             64.3    2e-08   
tpg|DAA51729.1|  TPA: seed maturation protein                         64.3    2e-08   
ref|NP_001137021.1|  seed maturation protein isoform 1                64.3    2e-08   
ref|XP_008342327.1|  PREDICTED: reticulon-like protein B8             64.3    2e-08   
ref|XP_006487007.1|  PREDICTED: reticulon-like protein B11-like       63.5    2e-08   
ref|XP_008451843.1|  PREDICTED: reticulon-like protein B8 isoform X2  64.3    2e-08   
gb|AAM65155.1|  unknown                                               63.5    2e-08   
ref|XP_008376662.1|  PREDICTED: reticulon-like protein B1             64.3    2e-08   
ref|NP_001240231.1|  uncharacterized protein LOC100778096             64.3    2e-08   
ref|XP_007143486.1|  hypothetical protein PHAVU_007G075900g           63.9    2e-08   
gb|ABK94480.1|  unknown                                               64.3    2e-08   
ref|XP_006363068.1|  PREDICTED: reticulon-like protein B12-like       63.5    2e-08   
ref|XP_009334492.1|  PREDICTED: reticulon-like protein B2             64.3    2e-08   
ref|XP_009349323.1|  PREDICTED: reticulon-like protein B1             64.3    2e-08   
ref|NP_566065.1|  reticulon-like protein B5                           64.3    2e-08   
ref|XP_010473658.1|  PREDICTED: reticulon-like protein B3 isoform X3  64.3    2e-08   
ref|XP_004234204.1|  PREDICTED: reticulon-like protein B2             64.3    2e-08   
ref|XP_010552912.1|  PREDICTED: reticulon-like protein B16 isofor...  63.5    2e-08   
ref|XP_002320163.1|  reticulon family protein                         63.9    2e-08   
ref|NP_001239653.1|  uncharacterized protein LOC100793862             64.3    2e-08   
gb|KHN40449.1|  Reticulon-like protein B5                             64.3    2e-08   
ref|XP_008451841.1|  PREDICTED: reticulon-like protein B8 isoform X1  64.3    2e-08   
ref|XP_007051689.1|  Reticulon family protein                         63.9    3e-08   
ref|XP_010035177.1|  PREDICTED: reticulon-like protein B1             63.9    3e-08   
ref|XP_004246346.1|  PREDICTED: reticulon-like protein B12            63.2    3e-08   
ref|XP_008377768.1|  PREDICTED: reticulon-like protein B2             63.9    3e-08   
ref|XP_004965478.1|  PREDICTED: reticulon-like protein B2-like        63.5    3e-08   
ref|XP_008343772.1|  PREDICTED: reticulon-like protein B1             63.5    3e-08   
dbj|BAK07483.1|  predicted protein                                    63.5    4e-08   
ref|XP_003532073.1|  PREDICTED: reticulon-like protein B8-like is...  63.5    4e-08   
ref|XP_002883887.1|  reticulon family protein                         62.8    4e-08   
ref|XP_004963616.1|  PREDICTED: reticulon-like protein B9-like        63.2    4e-08   
emb|CDX90792.1|  BnaA03g24720D                                        63.5    4e-08   
ref|NP_001078133.1|  reticulon-like protein B16                       62.8    4e-08   
ref|XP_011094961.1|  PREDICTED: reticulon-like protein B12            62.4    5e-08   
ref|XP_009629277.1|  PREDICTED: reticulon-like protein B11            62.4    5e-08   
gb|EEC80692.1|  hypothetical protein OsI_23118                        65.1    5e-08   
ref|XP_010251601.1|  PREDICTED: reticulon-like protein B2             63.2    5e-08   
gb|KHN45506.1|  Reticulon-like protein B16                            62.4    5e-08   
ref|XP_010105716.1|  Reticulon-like protein                           63.2    5e-08   
gb|KEH33648.1|  reticulon-like protein B2                             62.4    5e-08   
ref|XP_003610409.1|  hypothetical protein MTR_4g131890                60.8    5e-08   
ref|XP_008782644.1|  PREDICTED: reticulon-like protein B16            62.8    6e-08   
gb|KHN29299.1|  Reticulon-like protein B5                             62.8    6e-08   
ref|XP_003543798.1|  PREDICTED: reticulon-like protein B16-like i...  62.0    6e-08   
ref|XP_008655792.1|  PREDICTED: reticulon-like protein B1             63.2    7e-08   
ref|XP_009380544.1|  PREDICTED: reticulon-like protein B2             62.8    7e-08   
ref|XP_010112604.1|  Reticulon-like protein                           62.8    7e-08   
ref|XP_002880222.1|  reticulon family protein                         62.8    7e-08   
gb|KDO56850.1|  hypothetical protein CISIN_1g023137mg                 63.2    7e-08   
gb|EPS59966.1|  hypothetical protein M569_14838                       61.6    7e-08   
ref|XP_010669728.1|  PREDICTED: reticulon-like protein B4             63.2    7e-08   
ref|XP_009376960.1|  PREDICTED: reticulon-like protein B8             62.4    7e-08   
ref|XP_006422078.1|  hypothetical protein CICLE_v10005564mg           63.2    7e-08   
ref|XP_009763462.1|  PREDICTED: reticulon-like protein B1 isoform X2  62.8    8e-08   
gb|KDP21658.1|  hypothetical protein JCGZ_03329                       62.4    8e-08   
ref|XP_001778850.1|  predicted protein                                62.0    8e-08   
gb|EMT22797.1|  Reticulon-like protein B9                             62.0    8e-08   
gb|EPS71452.1|  hypothetical protein M569_03311                       62.4    8e-08   
ref|XP_009338786.1|  PREDICTED: reticulon-like protein B1             62.4    8e-08   
ref|NP_001154603.1|  reticulon-like protein B16                       62.4    9e-08   
ref|XP_009406786.1|  PREDICTED: reticulon-like protein B1 isoform X2  62.4    9e-08   
ref|XP_007135152.1|  hypothetical protein PHAVU_010G105400g           62.4    9e-08   
ref|XP_009603968.1|  PREDICTED: reticulon-like protein B1             62.4    9e-08   
ref|XP_006366650.1|  PREDICTED: putative 24 kDa seed maturation p...  63.5    9e-08   
gb|EMT17810.1|  Reticulon-like protein B8                             62.8    1e-07   
ref|XP_002966548.1|  hypothetical protein SELMODRAFT_86151            61.6    1e-07   
ref|XP_006602275.1|  PREDICTED: reticulon-like protein B8-like is...  62.0    1e-07   
ref|XP_002884415.1|  hypothetical protein ARALYDRAFT_896404           58.9    1e-07   
ref|XP_002438444.1|  hypothetical protein SORBIDRAFT_10g019720        62.4    1e-07   
ref|XP_008354289.1|  PREDICTED: reticulon-like protein B1             62.0    1e-07   
gb|KEH33647.1|  reticulon-like protein B2                             62.0    1e-07   
emb|CDY00975.1|  BnaC05g42250D                                        62.0    1e-07   
ref|XP_010558052.1|  PREDICTED: reticulon-like protein B16 isofor...  61.6    1e-07   
ref|XP_004308034.1|  PREDICTED: reticulon-like protein B1-like        62.4    1e-07   
ref|XP_010676393.1|  PREDICTED: reticulon-like protein B2             62.0    1e-07   
gb|EPS64109.1|  hypothetical protein M569_10676                       62.0    1e-07   
ref|XP_010092876.1|  Reticulon-like protein                           62.0    1e-07   
emb|CDP08746.1|  unnamed protein product                              62.0    1e-07   
ref|XP_007036601.1|  Reticulon family protein, putative isoform 1     61.2    1e-07   
ref|XP_010925814.1|  PREDICTED: reticulon-like protein B2             62.0    1e-07   
ref|XP_004161550.1|  PREDICTED: reticulon-like protein B8-like        61.6    1e-07   
ref|XP_009146795.1|  PREDICTED: reticulon-like protein B16            61.6    1e-07   
ref|XP_006298494.1|  hypothetical protein CARUB_v10014570mg           61.2    1e-07   
gb|EEE65781.1|  hypothetical protein OsJ_21474                        63.5    1e-07   
gb|KDO86331.1|  hypothetical protein CISIN_1g025719mg                 61.6    2e-07   
ref|XP_009416749.1|  PREDICTED: reticulon-like protein B8 isoform X1  61.2    2e-07   
ref|XP_009786417.1|  PREDICTED: reticulon-like protein B12            60.8    2e-07   
ref|XP_009596514.1|  PREDICTED: reticulon-like protein B8             61.2    2e-07   
ref|XP_010915765.1|  PREDICTED: reticulon-like protein B2             61.6    2e-07   
ref|XP_006435911.1|  hypothetical protein CICLE_v10032603mg           61.2    2e-07   
ref|XP_008796064.1|  PREDICTED: reticulon-like protein B2             61.2    2e-07   
gb|ACG31942.1|  seed maturation protein                               61.2    2e-07   
ref|XP_010671578.1|  PREDICTED: reticulon-like protein B4             62.0    2e-07   
ref|XP_009589077.1|  PREDICTED: reticulon-like protein B12            60.5    2e-07   
ref|XP_011032748.1|  PREDICTED: reticulon-like protein B8 isoform X1  61.2    2e-07   
ref|XP_009610462.1|  PREDICTED: reticulon-like protein B9             60.8    2e-07   
gb|KHG28741.1|  Reticulon-like protein B8                             61.2    2e-07   
ref|XP_011032749.1|  PREDICTED: reticulon-like protein B8 isoform X2  61.2    2e-07   
ref|XP_007011337.1|  Reticulon family protein                         60.8    2e-07   
ref|XP_002299504.1|  reticulon family protein                         61.2    2e-07   
ref|XP_004159803.1|  PREDICTED: reticulon-like protein B2-like        61.2    2e-07   
ref|XP_004137740.1|  PREDICTED: reticulon-like protein B12-like       60.5    2e-07   
ref|XP_009406784.1|  PREDICTED: reticulon-like protein B1 isoform X1  61.2    2e-07   
gb|EMT19773.1|  Reticulon-like protein B1                             61.6    2e-07   
ref|XP_007146289.1|  hypothetical protein PHAVU_006G028000g           60.8    2e-07   
ref|XP_011092539.1|  PREDICTED: reticulon-like protein B11            60.5    2e-07   
ref|XP_004247011.1|  PREDICTED: reticulon-like protein B5             60.8    2e-07   
ref|XP_002982389.1|  hypothetical protein SELMODRAFT_421735           60.5    2e-07   
ref|XP_009777726.1|  PREDICTED: reticulon-like protein B8             60.8    2e-07   
emb|CDP19164.1|  unnamed protein product                              60.1    3e-07   
ref|XP_006294850.1|  hypothetical protein CARUB_v10023902mg           60.8    3e-07   
gb|KDP36280.1|  hypothetical protein JCGZ_10290                       60.8    3e-07   
ref|XP_010905366.1|  PREDICTED: reticulon-like protein B12 isofor...  60.1    3e-07   
ref|XP_002521590.1|  conserved hypothetical protein                   60.8    3e-07   
ref|XP_009375555.1|  PREDICTED: reticulon-like protein B1             60.8    3e-07   
gb|KDP45899.1|  hypothetical protein JCGZ_15459                       60.1    3e-07   
ref|XP_008442476.1|  PREDICTED: reticulon-like protein B12            60.1    3e-07   
ref|XP_010228653.1|  PREDICTED: reticulon-like protein B16            60.1    3e-07   
ref|XP_002527867.1|  3-beta-hydroxy-delta5-steroid dehydrogenase,...  60.1    3e-07   
ref|XP_008812882.1|  PREDICTED: reticulon-like protein B12 isofor...  61.2    3e-07   
ref|XP_006603692.1|  PREDICTED: uncharacterized protein LOC100776...  59.7    3e-07   
ref|XP_006360189.1|  PREDICTED: reticulon-like protein B2-like        60.5    3e-07   
ref|XP_010228928.1|  PREDICTED: reticulon-like protein B8             60.5    4e-07   
tpg|DAA52789.1|  TPA: seed maturation protein                         60.8    4e-07   
ref|XP_002304349.2|  hypothetical protein POPTR_0003s09360g           58.2    4e-07   
ref|XP_008338223.1|  PREDICTED: reticulon-like protein B11            59.7    4e-07   
ref|XP_004240710.1|  PREDICTED: reticulon-like protein B6             60.5    4e-07   
ref|XP_010253410.1|  PREDICTED: reticulon-like protein B9             59.7    4e-07   
ref|XP_006444935.1|  hypothetical protein CICLE_v10021860mg           60.5    4e-07   
ref|XP_003565836.1|  PREDICTED: reticulon-like protein B1             60.8    4e-07   
ref|XP_010558051.1|  PREDICTED: reticulon-like protein B16 isofor...  60.1    4e-07   
ref|XP_004489401.1|  PREDICTED: reticulon-like protein B16-like i...  59.3    4e-07   
emb|CDJ26559.1|  unnamed protein product                              60.8    4e-07   
ref|XP_004157344.1|  PREDICTED: LOW QUALITY PROTEIN: reticulon-li...  59.7    4e-07   
ref|XP_010490417.1|  PREDICTED: reticulon-like protein B16            59.7    5e-07   
gb|ABK22748.1|  unknown                                               60.1    5e-07   
ref|XP_009116098.1|  PREDICTED: reticulon-like protein B12            59.3    5e-07   
ref|XP_004489400.1|  PREDICTED: reticulon-like protein B16-like i...  59.3    5e-07   
dbj|BAB32723.1|  unknown protein                                      60.5    5e-07   
ref|XP_008367699.1|  PREDICTED: reticulon-like protein B2             60.1    5e-07   
ref|XP_010905367.1|  PREDICTED: reticulon-like protein B12 isofor...  59.3    5e-07   
ref|XP_010466091.1|  PREDICTED: reticulon-like protein B11            59.3    5e-07   
ref|XP_010464783.1|  PREDICTED: reticulon-like protein B16            59.7    5e-07   
ref|XP_008346381.1|  PREDICTED: reticulon-like protein B11            59.3    5e-07   
ref|XP_006435910.1|  hypothetical protein CICLE_v10032603mg           59.7    5e-07   
ref|XP_004235819.1|  PREDICTED: reticulon-like protein B9             59.7    5e-07   
ref|XP_008812883.1|  PREDICTED: reticulon-like protein B12 isofor...  60.8    6e-07   
ref|XP_006298486.1|  hypothetical protein CARUB_v10014560mg           59.7    6e-07   
ref|NP_566371.1|  reticulon-like protein B8                           59.7    6e-07   
gb|ADE77553.1|  unknown                                               59.7    6e-07   
ref|NP_001241930.1|  uncharacterized protein LOC100787981             59.7    6e-07   
gb|EYU19605.1|  hypothetical protein MIMGU_mgv1a012182mg              60.1    6e-07   
ref|XP_007038874.1|  VIRB2-interacting protein 2                      59.7    7e-07   
ref|NP_850552.1|  reticulon-like protein B8                           60.1    7e-07   
ref|XP_006650052.1|  PREDICTED: reticulon-like protein B16-like       59.3    8e-07   
ref|XP_011084470.1|  PREDICTED: reticulon-like protein B2             59.7    8e-07   
ref|XP_009601019.1|  PREDICTED: reticulon-like protein B8             59.7    8e-07   
ref|XP_010031091.1|  PREDICTED: reticulon-like protein B16            59.3    8e-07   
ref|XP_006341572.1|  PREDICTED: reticulon-like protein B9-like        58.9    8e-07   
ref|XP_003569595.1|  PREDICTED: reticulon-like protein B9             58.9    8e-07   
ref|XP_002285375.1|  PREDICTED: reticulon-like protein B11            58.9    8e-07   
gb|EAY73097.1|  hypothetical protein OsI_00974                        59.7    8e-07   
ref|XP_009783850.1|  PREDICTED: reticulon-like protein B8             59.3    9e-07   
gb|EMT08230.1|  Reticulon-like protein B16                            59.3    9e-07   
ref|XP_010904667.1|  PREDICTED: reticulon-like protein B8             59.3    9e-07   
ref|XP_010271125.1|  PREDICTED: reticulon-like protein B10            58.9    9e-07   
ref|XP_009145784.1|  PREDICTED: reticulon-like protein B11            58.5    9e-07   
emb|CDY46172.1|  BnaA05g20590D                                        58.5    9e-07   
ref|XP_006358652.1|  PREDICTED: reticulon-like protein B1-like        59.3    1e-06   
ref|NP_001058867.1|  Os07g0142000                                     58.9    1e-06   
ref|XP_011037168.1|  PREDICTED: reticulon-like protein B5             59.3    1e-06   
ref|XP_011026963.1|  PREDICTED: reticulon-like protein B2             59.3    1e-06   
ref|NP_001150474.1|  seed maturation protein                          59.3    1e-06   
ref|XP_011079971.1|  PREDICTED: reticulon-like protein B11            58.9    1e-06   
ref|XP_008792381.1|  PREDICTED: reticulon-like protein B2 isoform X2  58.9    1e-06   
ref|XP_004298843.1|  PREDICTED: reticulon-like protein B2-like is...  58.9    1e-06   
ref|XP_006442586.1|  hypothetical protein CICLE_v10022074mg           58.5    1e-06   
ref|XP_006645024.1|  PREDICTED: reticulon-like protein B12-like       58.2    1e-06   
ref|XP_006396933.1|  hypothetical protein EUTSA_v10028886mg           58.9    1e-06   
ref|XP_006645662.1|  PREDICTED: reticulon-like protein B1-like        58.9    1e-06   
ref|XP_008458672.1|  PREDICTED: reticulon-like protein B2             58.9    1e-06   
ref|XP_004240866.1|  PREDICTED: reticulon-like protein B16 isofor...  58.5    1e-06   
ref|XP_009399837.1|  PREDICTED: reticulon-like protein B5             58.5    1e-06   
ref|XP_006477776.1|  PREDICTED: reticulon-like protein B9-like        58.5    1e-06   
gb|KHN11998.1|  Reticulon-like protein B8                             58.5    1e-06   
gb|EYU36885.1|  hypothetical protein MIMGU_mgv1a013116mg              58.5    2e-06   
ref|XP_004248066.1|  PREDICTED: reticulon-like protein B1             58.9    2e-06   
ref|XP_009763461.1|  PREDICTED: reticulon-like protein B6 isoform X1  58.9    2e-06   
ref|XP_008812884.1|  PREDICTED: reticulon-like protein B12 isofor...  57.4    2e-06   
ref|XP_010928379.1|  PREDICTED: reticulon-like protein B11 isofor...  58.2    2e-06   
ref|XP_009395750.1|  PREDICTED: reticulon-like protein B2             58.5    2e-06   
ref|XP_002441477.1|  hypothetical protein SORBIDRAFT_09g027580        58.2    2e-06   
ref|XP_002884821.1|  predicted protein                                58.2    2e-06   
ref|XP_004306726.1|  PREDICTED: reticulon-like protein B5-like        58.5    2e-06   
ref|XP_010487741.1|  PREDICTED: reticulon-like protein B9             58.2    2e-06   
ref|XP_010482050.1|  PREDICTED: reticulon-like protein B8             58.2    2e-06   
emb|CDY36282.1|  BnaA01g31360D                                        57.8    2e-06   
ref|XP_004304044.1|  PREDICTED: reticulon-like protein B11-like i...  57.8    2e-06   
gb|AFK38607.1|  unknown                                               57.4    2e-06   
ref|XP_003563831.1|  PREDICTED: reticulon-like protein B1             58.5    2e-06   



>ref|XP_006338755.1| PREDICTED: reticulon-like protein B13-like [Solanum tuberosum]
Length=244

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 125/176 (71%), Gaps = 1/176 (1%)
 Frame = +3

Query  174  TATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDR  353
            T  I+D++LWKRK  ++ A++ +TA W+ LE+Y  TFIT  SW+AMFV+A  F+WGNI  
Sbjct  44   TDIIRDVILWKRKSYSVVALLAATAIWLGLEVYGLTFITLFSWIAMFVIAFTFLWGNIHM  103

Query  354  LLGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvl  533
            LLGK+P  D SRMYIS +S V     FR  V  S+ F   +  +REW+V A  +A+L +L
Sbjct  104  LLGKDP-LDMSRMYISDESVVDAGTKFRESVENSLRFLFSVSTKREWFVFAGTLASLGLL  162

Query  534  sviasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
            SV+AS+LDLLTLLYIG +VGLTVPV+Y KYE KI + GQR++V+   Y S V+++ 
Sbjct  163  SVVASYLDLLTLLYIGIVVGLTVPVVYVKYEDKIKDLGQRVRVRCHIYNSAVMERC  218



>ref|XP_009777026.1| PREDICTED: reticulon-like protein B13 [Nicotiana sylvestris]
Length=242

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 133/203 (66%), Gaps = 5/203 (2%)
 Frame = +3

Query  174  TATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDR  353
            T  + D++LW+RK L++  ++ +TA W+ALE+Y   F+T  SW++M  +A  F WGNI R
Sbjct  45   TDLVSDVILWRRKNLSVLTLLAATAIWLALEVYELKFVTLFSWMSMLAIAFLFFWGNIHR  104

Query  354  LLGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvl  533
            LLGKE   D S MYIS++SA       R CV + +     + AE+EW+V A  VA+L ++
Sbjct  105  LLGKE-QVDMSAMYISEESAKAMGTKIRECVEKCMRLIFSVSAEKEWFVFAGTVASLGLI  163

Query  534  sviasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELK  713
            SV+AS+ DLLTLLY G + GLT P +Y KYE KI E GQ+++V+Y+R Y+ V+ K  E+K
Sbjct  164  SVVASYFDLLTLLYFGVMGGLTGPFVYVKYEHKIKEWGQKVRVRYQRCYATVVLKLQEMK  223

Query  714  TMMLQKTGDLKNKVSKHKEKKRE  782
                 K  ++KN++ + K KK E
Sbjct  224  ----NKLQEMKNRMQEKKRKKME  242



>ref|XP_009617575.1| PREDICTED: reticulon-like protein B13 isoform X1 [Nicotiana tomentosiformis]
Length=231

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 127/186 (68%), Gaps = 1/186 (1%)
 Frame = +3

Query  174  TATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDR  353
            T  ++D++LWKRK L++  ++ +TA W+ALE+Y   F+T  SW++M  VA    WGNI R
Sbjct  41   TDIVRDVILWKRKNLSVLTLLAATAIWLALEVYELKFVTLFSWMSMLAVAFLLFWGNIHR  100

Query  354  LLGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvl  533
            LLGKEP  D S MYIS++SA +     +  V +S+     + AE+EW V A  VA+L ++
Sbjct  101  LLGKEP-VDMSAMYISEKSAREMGAKIQEYVEKSLRLVFSVSAEKEWLVFAGTVASLGLI  159

Query  534  sviasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELK  713
            SV+AS+ DLLTLLY G +VGLT P +Y KYE KI E GQ+++V+Y+R Y+ V+QK  E+K
Sbjct  160  SVVASYFDLLTLLYFGVVVGLTGPFVYVKYEHKIKEWGQKVRVRYQRCYATVVQKLQEMK  219

Query  714  TMMLQK  731
              M +K
Sbjct  220  NKMQEK  225



>ref|XP_009617576.1| PREDICTED: reticulon-like protein B13 isoform X2 [Nicotiana tomentosiformis]
Length=229

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 126/183 (69%), Gaps = 1/183 (1%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            ++D++LWKRK L++  ++ +TA W+ALE+Y   F+T  SW++M  VA    WGNI RLLG
Sbjct  42   VRDVILWKRKNLSVLTLLAATAIWLALEVYELKFVTLFSWMSMLAVAFLLFWGNIHRLLG  101

Query  363  KEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvi  542
            KEP  D S MYIS++SA +     +  V +S+     + AE+EW V A  VA+L ++SV+
Sbjct  102  KEP-VDMSAMYISEKSAREMGAKIQEYVEKSLRLVFSVSAEKEWLVFAGTVASLGLISVV  160

Query  543  asHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMM  722
            AS+ DLLTLLY G +VGLT P +Y KYE KI E GQ+++V+Y+R Y+ V+QK  E+K  M
Sbjct  161  ASYFDLLTLLYFGVVVGLTGPFVYVKYEHKIKEWGQKVRVRYQRCYATVVQKLQEMKNKM  220

Query  723  LQK  731
             +K
Sbjct  221  QEK  223



>ref|XP_002270797.1| PREDICTED: reticulon-like protein B13 [Vitis vinifera]
 emb|CBI18559.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 119/171 (70%), Gaps = 1/171 (1%)
 Frame = +3

Query  186  KDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGK  365
            +DILLW+RK++++    ISTATWV +E+Y+F  IT   WV M VV + FIWGN+ RLLGK
Sbjct  16   RDILLWRRKKMSVMVFFISTATWVLMEVYQFNSITIVCWVGMAVVTSLFIWGNMCRLLGK  75

Query  366  EPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvia  545
            EP +  S + I++QS  +   +FR  + ++V +  R+GAE EWYV A  V  LW+LS++ 
Sbjct  76   EPPS-LSGLEITEQSTTEMTILFRESIEEAVRWMFRVGAESEWYVFAGVVTGLWILSIVG  134

Query  546  sHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
            S +DLLTL YIG ++ +T+PVIY KYE KI   G+R+KV +R+   +V +K
Sbjct  135  SCMDLLTLAYIGIMMSVTIPVIYIKYEDKIKRYGERVKVHWRKLVEIVDEK  185



>ref|XP_008363135.1| PREDICTED: reticulon-like protein B13 [Malus domestica]
Length=208

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 122/173 (71%), Gaps = 1/173 (1%)
 Frame = +3

Query  180  TIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLL  359
            T++DILLW++K+ +   ++ +TATW+ L++Y+F F+T  S+VAMF V + F+ GN+ RLL
Sbjct  17   TVRDILLWRKKKQSFLVLLTATATWILLDVYQFNFLTVISYVAMFJVTSLFLSGNLLRLL  76

Query  360  GKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsv  539
            GKEP  D SR+ I+++ A++  +  R  V + + +  ++ AEREW+V    V+ LW+LS 
Sbjct  77   GKEP-XDLSRVGITEKXALEMGNTIRAWVEEGIRWMFQVAAEREWFVFVGTVSGLWLLSR  135

Query  540  iasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
            +A  +DLLTLLYIG ++G+TVP +Y KYE KI  S ++LK Q +RYY  + +K
Sbjct  136  VARCVDLLTLLYIGIVMGMTVPAMYVKYEDKIGRSEEKLKAQLKRYYDTLDEK  188



>ref|XP_009366426.1| PREDICTED: reticulon-like protein B13 [Pyrus x bretschneideri]
Length=219

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 120/173 (69%), Gaps = 1/173 (1%)
 Frame = +3

Query  180  TIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLL  359
            T++DILLW++K+ +   ++ +TA W+ L++Y+F F+T  S+VAMF+V + F+ GN+ RLL
Sbjct  17   TVRDILLWRKKKQSFLVLLTATAAWILLDVYQFNFLTVISYVAMFIVTSLFLSGNLLRLL  76

Query  360  GKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsv  539
            GKEP  D SR+ I+++SA+   +  R  V + + +   + AEREW+V    V+ LW+LS 
Sbjct  77   GKEP-PDLSRVGITEKSALDMGNTVRAWVEEGIRWMFLVAAEREWFVFVGTVSGLWLLSG  135

Query  540  iasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
            +A  +DLLTLLYIG ++G+T P +Y KYE KI  S ++LK Q +RYY  + +K
Sbjct  136  VARCVDLLTLLYIGTVMGMTAPAMYVKYEDKIERSEEKLKAQLKRYYDTLDEK  188



>ref|XP_004232057.1| PREDICTED: reticulon-like protein B13 [Solanum lycopersicum]
Length=245

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 123/175 (70%), Gaps = 1/175 (1%)
 Frame = +3

Query  174  TATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDR  353
            T  ++D++LWKRK   +AA++ +TA W+ALE+Y  TFIT  SW+AMF++ + F+WGNI  
Sbjct  44   TDILRDVILWKRKSFTVAALLAATAIWLALEVYGLTFITLFSWIAMFLIVSTFLWGNIHM  103

Query  354  LLGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvl  533
            LLGKEP  D SRMYIS +S V+    FR  V  S+ F   +  +REW+V A  VA+L +L
Sbjct  104  LLGKEP-LDMSRMYISDESVVEAGIKFRESVENSLRFLFNVSTKREWFVFAGTVASLGLL  162

Query  534  sviasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
            SV+ S+LDLLTLLYIG ++GLTVPV+Y KYE +I + GQR +V+   Y S   ++
Sbjct  163  SVVGSYLDLLTLLYIGIVMGLTVPVVYVKYEDRIKDLGQRARVRCHIYNSAATER  217



>ref|XP_010109887.1| Reticulon-like protein [Morus notabilis]
 gb|EXC24856.1| Reticulon-like protein [Morus notabilis]
Length=212

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 114/166 (69%), Gaps = 1/166 (1%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            ++DI LW++K+ ++  +V+STAT V LE+Y+F F+T  SW+AMF+V + F+WGN+ RLLG
Sbjct  15   MRDIFLWRKKKQSLLVLVVSTATCVLLEVYQFNFLTVVSWLAMFIVVSLFLWGNLVRLLG  74

Query  363  KEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvi  542
            KEP  +   + I+++S +K A   R    + + +  R+GA+R+ +  A  V  LW+ S +
Sbjct  75   KEP-PNLLGLEITEESTIKLAMALRTWTEEGIRWMFRVGAQRDLFSFALTVGGLWLFSQV  133

Query  543  asHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYY  680
            A++ DLLTLLY G ++G+T+P +Y KYE KI    +R+K Q +RYY
Sbjct  134  ANYFDLLTLLYTGIIMGMTIPPVYVKYEDKIKRCNERVKKQLKRYY  179



>ref|XP_004300547.1| PREDICTED: reticulon-like protein B13-like [Fragaria vesca subsp. 
vesca]
Length=211

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 130/205 (63%), Gaps = 14/205 (7%)
 Frame = +3

Query  180  TIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLL  359
            +++DI LWK+K+ ++  + I+TATWV L++Y F F+T  SW AMFVV + F+W N+ R  
Sbjct  17   SVRDIFLWKKKKQSVLLLSIATATWVLLKVYLFNFLTVISWAAMFVVTSLFLWANMLRFF  76

Query  360  GKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsv  539
             KEP      + +++++A++TA+  R  + + + +   + AEREW+V A   A LW+LS 
Sbjct  77   NKEPPNLYGMLEVTEETALRTANSIRAWIEEGIRWMFWVAAEREWFVFAGTAAGLWLLSR  136

Query  540  iasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTM  719
            +  ++DLLT LY G ++G+T+PVIY +Y++ +  S + +K Q RRY+ MV +K  +    
Sbjct  137  VGGYVDLLTFLYTGVVMGMTIPVIYVRYKENLKRSEEWVKAQARRYHDMVDEKVVK----  192

Query  720  MLQKTGDLKNKVS----KHKEKKRE  782
                  ++KNKV+     +K+KK E
Sbjct  193  ------NIKNKVTVTNENYKDKKVE  211



>ref|XP_006425824.1| hypothetical protein CICLE_v10026468mg [Citrus clementina]
 ref|XP_006466742.1| PREDICTED: reticulon-like protein B13-like [Citrus sinensis]
 gb|ESR39064.1| hypothetical protein CICLE_v10026468mg [Citrus clementina]
Length=214

 Score =   140 bits (354),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 117/171 (68%), Gaps = 1/171 (1%)
 Frame = +3

Query  186  KDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGK  365
            +D+ LW+RK L+   +++STA WV LE+Y+F F+T ASW+AM +V+  F+ G+I RLLGK
Sbjct  22   RDVFLWRRKNLSFTLLLVSTAIWVLLEVYQFNFLTVASWLAMSIVSFTFLSGSIMRLLGK  81

Query  366  EPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvia  545
            EP    S + IS++SA++ A+ FR  V +   +   +  E++W+V A AVA L VLS +A
Sbjct  82   EP-PKLSGLEISEKSALEVANSFRGVVEEFTRWMFHVSVEKQWFVFAQAVAGLLVLSYVA  140

Query  546  sHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
            +  DLLTLLY G ++G+TVPVIY KY  KI   G+  KV+ RR+Y  V +K
Sbjct  141  TFSDLLTLLYTGIVMGMTVPVIYEKYGDKIKRCGETAKVKSRRFYEEVDEK  191



>ref|XP_010263759.1| PREDICTED: reticulon-like protein B13 [Nelumbo nucifera]
Length=252

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/231 (40%), Positives = 134/231 (58%), Gaps = 41/231 (18%)
 Frame = +3

Query  177  ATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRL  356
              IKD  LW+RK+L+++ +  +TATWV LE+Y+F F+T ASW+ + +VA+ F+WGN+ R+
Sbjct  34   GVIKDTFLWRRKKLSLSVLATATATWVLLEVYQFNFLTVASWLGISIVASMFLWGNLLRI  93

Query  357  L-GKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvl  533
            L  KEP  D S + +S+Q A + A+ FR  + + V +  R+GAER+WYV  A V+ LWVL
Sbjct  94   LRKKEP--DMSGLEVSEQWATEAANTFRGWMEEGVRWVFRVGAERQWYVSVAVVSGLWVL  151

Query  534  sviasHLDLLTLLYIGE----------------------------LVGLTVPVIYNKYEQ  629
            S++ S  D LTLLYIG                             + G+T PVIY +YE 
Sbjct  152  SLLGSLADFLTLLYIGMSTDYNYKTEPLSLSLSPAKFFVSGFTGIVAGMTAPVIYVRYEY  211

Query  630  KINESGQRLKVQYRRYYSMVLQKSSELKTMMLQKTGDLKNKVSKHKEKKRE  782
            KI E G++  VQ R+ Y MV  K       + +K   +K+ V + KEKK E
Sbjct  212  KIKECGEKAMVQGRKLYDMVDDK-------VFRK---MKHNVFQSKEKKVE  252



>ref|XP_007047155.1| Reticulan like protein B13, putative [Theobroma cacao]
 gb|EOX91312.1| Reticulan like protein B13, putative [Theobroma cacao]
Length=326

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 116/171 (68%), Gaps = 3/171 (2%)
 Frame = +3

Query  186  KDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGK  365
            +DI+LW+RK+L+   +++STATWV LE+Y+  FIT ASW+AMF+VA+ F+WGN+ RLLGK
Sbjct  139  RDIILWRRKKLSATVLLVSTATWVLLEVYQLNFITVASWLAMFIVASLFLWGNVLRLLGK  198

Query  366  EPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvia  545
            EP  + S + +S+++A++  +  R  + + + +   +  E +W V A  V  L +LS + 
Sbjct  199  EP-PNLSDLELSKETALEIENTCRTFIEEVIGWMFHVTVEGDWLVFARTVVGLLLLSYVG  257

Query  546  sHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
            S  DLLTLLYIG    +TVP+IY KY  +I   G+R+K Q+RR Y M  +K
Sbjct  258  S--DLLTLLYIGIKTAMTVPLIYVKYGDQIKRCGERVKDQFRRLYEMFDEK  306



>ref|XP_007203430.1| hypothetical protein PRUPE_ppa021658mg [Prunus persica]
 gb|EMJ04629.1| hypothetical protein PRUPE_ppa021658mg [Prunus persica]
Length=195

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 132/201 (66%), Gaps = 11/201 (5%)
 Frame = +3

Query  180  TIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLL  359
            T+ DI+LW++KR ++  ++ +TATWV L++++F F+T  S++AMF+VA+ F+ GN+ RLL
Sbjct  4    TLSDIILWRKKRQSLLTLLTATATWVLLQVHQFNFLTLISYLAMFIVASLFLSGNLLRLL  63

Query  360  GKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsv  539
            GK P  D SR+  S++SA +  +  R  V + + +   + AEREW+V    V+ L ++S 
Sbjct  64   GKAP-PDLSRVGTSEKSASEMGNTIRAWVEEGIRWMFWVAAEREWFVFVGTVSGLLLVSR  122

Query  540  iasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTM  719
            +A+ +DLLTLLYIG + G+TVP +Y KY+ KI    ++LK Q + YY MV +K  +    
Sbjct  123  VATSIDLLTLLYIGIVTGMTVPAMYVKYQDKIEWGEEKLKAQLKSYYDMVDEKVVK----  178

Query  720  MLQKTGDLKNKVSKHKEKKRE  782
                   ++NKV+  +EK+++
Sbjct  179  ------KIQNKVTVREEKEKK  193



>gb|EYU44361.1| hypothetical protein MIMGU_mgv1a013149mg [Erythranthe guttata]
Length=229

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 122/195 (63%), Gaps = 5/195 (3%)
 Frame = +3

Query  186  KDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGK  365
            KD++ W+RK+LN+ A++ +T+ W A++IY++ FIT  S++A+      F WGNI RLL +
Sbjct  38   KDLVTWRRKQLNLFALLAATSAWTAMQIYKYNFITLVSYIAIAAAVCLFFWGNIHRLLKR  97

Query  366  EPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvia  545
            E A D S + IS+++A+  A+  RR   + V    R+  + EW+V   AVA+L++LS++A
Sbjct  98   E-APDLSELEISEEAAIGCANSLRRKCEEGVRLMFRVSVDSEWFVFVGAVASLYLLSLLA  156

Query  546  sHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMML  725
               DLLTL ++G + GLT+PVIY K E +I   G+ + ++ RR+YSM   K      MM 
Sbjct  157  KQFDLLTLFFMGVVGGLTLPVIYVKNEGRIRGFGEVVGIKSRRFYSMAEDKFQ----MMK  212

Query  726  QKTGDLKNKVSKHKE  770
             K    + KV K K+
Sbjct  213  NKIAAGRGKVIKEKK  227



>gb|KDP31877.1| hypothetical protein JCGZ_12338 [Jatropha curcas]
Length=216

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 115/170 (68%), Gaps = 1/170 (1%)
 Frame = +3

Query  180  TIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLL  359
            T++DI LW+RK+L++  ++++T TWV  +IY F FIT ASW+AM ++++ FI+GN+ RL 
Sbjct  14   TVRDIFLWRRKKLSLLILLVATGTWVLFDIYEFNFITVASWIAMVIISSLFIYGNLVRLF  73

Query  360  GKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsv  539
             KE   + S + +S+ + V+TA   +  + + + +   L  ER+  V    VA LW+LS 
Sbjct  74   RKEE-PNLSGLQVSEGTVVETAKSVKEMIEKGINWMFCLSVERDVLVFVRVVALLWLLSY  132

Query  540  iasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMV  689
            + S  D LTLLYIG +VG++VP+IY K E++I + G+ +++Q +R+Y MV
Sbjct  133  VGSFFDFLTLLYIGTVVGMSVPLIYVKNEERIKKCGEWIRMQGKRFYEMV  182



>ref|XP_003517278.2| PREDICTED: LOW QUALITY PROTEIN: reticulon-like protein B13-like 
[Glycine max]
Length=228

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 129/195 (66%), Gaps = 11/195 (6%)
 Frame = +3

Query  186  KDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGK  365
            KD++LW+RK++NI+ +V +T  WV +E++ F F+   SWVA+ V+A+ F++ N+ RLLGK
Sbjct  43   KDVVLWRRKKINISVLVXATVAWVLMEVFEFNFLAVVSWVAILVLASIFLYANMLRLLGK  102

Query  366  EPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvia  545
            EP  +  R+ +++++  + A   R  + +++ +   +GAE+EW V   AVAAL +LS I 
Sbjct  103  EP-PNLLRLEVTEETTTRIAKTVRAWIKEAIRWLFLVGAEKEWPVFVGAVAALLLLSYIG  161

Query  546  sHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMML  725
            S +DLLTL+Y+G LVG+ VP+ Y K E KI      L+ +++RYY ++ +K+       +
Sbjct  162  SCMDLLTLVYMGTLVGMAVPLTYVKNEDKIKRFVGWLREKHKRYYQIIDEKT-------I  214

Query  726  QKTGDLKNKVSKHKE  770
            QK   +K++++K K+
Sbjct  215  QK---IKSRIAKEKK  226



>ref|XP_008241555.1| PREDICTED: reticulon-like protein B13 [Prunus mume]
Length=195

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 132/201 (66%), Gaps = 11/201 (5%)
 Frame = +3

Query  180  TIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLL  359
            T+ DI+LW++KR ++  ++ +T TWV L++Y+F F+T  S++AMF+VA+ F+ GN+ RLL
Sbjct  4    TLSDIILWRKKRQSLLTLLTATTTWVLLQVYQFNFLTLISYLAMFIVASLFLSGNLLRLL  63

Query  360  GKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsv  539
            GK P  D SR+ IS++SA +  +  +  V + + +   + AEREW+V    V+ L ++S 
Sbjct  64   GKGP-PDLSRVGISEKSASEMGNTIQVWVEEGIRWMFWVAAEREWFVFVGTVSGLLLVSR  122

Query  540  iasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTM  719
            +A+ +DLLTLLYIG + G+TVP +Y KY+ KI    ++LK Q +RYY  V +K  +    
Sbjct  123  VATSVDLLTLLYIGTVTGMTVPAMYVKYQDKIKRGEEKLKAQLKRYYDTVDEKVVK----  178

Query  720  MLQKTGDLKNKVSKHKEKKRE  782
                   L+NKV+  +EK+++
Sbjct  179  ------KLQNKVTVREEKEKK  193



>ref|XP_011099219.1| PREDICTED: reticulon-like protein B13 [Sesamum indicum]
Length=212

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 125/199 (63%), Gaps = 12/199 (6%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            + D++LW+RK+LN+  +  +TA W A+E+Y+F FIT  SW+AM ++   F WG I RLL 
Sbjct  24   VSDVILWRRKQLNVIILAAATAAWTAMEVYQFNFITLLSWLAMALLLCLFFWGTIHRLLK  83

Query  363  KEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvi  542
            KE A D S + IS+++A +TA   R+   + +     + AEREW+V A  VA L+ ++ +
Sbjct  84   KE-APDLSELEISEETATETAKSLRQRAEEGIRLMFHVSAEREWFVFAGVVACLYAVAEL  142

Query  543  asHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMM  722
            A   D LTL YIG + G+T+PVIY K E++I E G++++V+    Y+ V +K        
Sbjct  143  ARRFDFLTLCYIGVVGGMTIPVIYFKNEERIREMGEKMRVKSGSTYAGVEEK--------  194

Query  723  LQKTGDLKNKVSKHKEKKR  779
            LQK   ++NK+   K++K+
Sbjct  195  LQK---MRNKIGGRKKQKK  210



>ref|NP_001237302.1| 24 kDa seed maturation protein [Glycine max]
 gb|AAD01540.1| 24 kDa seed maturation protein [Glycine max]
Length=212

 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 116/173 (67%), Gaps = 1/173 (1%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            +KD++LW+RK++NI+ +V +TA WV +E++ F F+T  SWVA+  +A+ F++ N+ RLLG
Sbjct  26   VKDVVLWRRKKINISVLVAATAAWVLMEVFEFNFLTLISWVAILGLASIFLYANMLRLLG  85

Query  363  KEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvi  542
            KEP  +   + +S+++  + A   R  + + + +   +GAE+EW V   AVA L  LS +
Sbjct  86   KEP-PNLLGLEVSEKTTTRIAHTVRAWIEEGIRWLFLVGAEKEWPVFVGAVAGLLSLSYL  144

Query  543  asHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
             S +DLLTL+Y+G LVG+ VP+ Y K E KI    + L+ +++RYY ++ +K+
Sbjct  145  GSCMDLLTLVYMGTLVGMAVPLTYVKNEDKIKRFVEWLREKHKRYYQIIDEKT  197



>gb|ACU18528.1| unknown [Glycine max]
Length=212

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 116/173 (67%), Gaps = 1/173 (1%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            +KD++LW+RK++NI+ +V +TA WV +E++ F F+T  SWVA+  +A+ F++ N+ RLLG
Sbjct  26   VKDVVLWRRKKINISVLVAATAAWVLMEVFEFNFLTLISWVAILGLASIFLYANMLRLLG  85

Query  363  KEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvi  542
            KEP  +   + +S+++  + A   R  + + + +   +GAE+EW V   AVA L  LS +
Sbjct  86   KEP-PNLLGLEVSEKTTTRIAHTVRAWIEEGIRWLFLVGAEKEWPVFVGAVAGLLSLSYL  144

Query  543  asHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
             S +DLLTL+Y+G LVG+ VP+ Y K E KI    + L+ +++RYY ++ +K+
Sbjct  145  GSCMDLLTLVYMGTLVGMAVPLTYVKNEDKIKRFVEWLREKHKRYYQIIDEKT  197



>ref|XP_002310752.2| reticulon family protein [Populus trichocarpa]
 gb|EEE91202.2| reticulon family protein [Populus trichocarpa]
Length=203

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 127/199 (64%), Gaps = 11/199 (6%)
 Frame = +3

Query  180  TIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLL  359
            T++D+ LW+RK+L++  +++STATWV+L++Y+F  IT ASW AMF V + F++GNI R L
Sbjct  14   TVRDVFLWRRKKLSLLVLLVSTATWVSLDVYQFNLITVASWAAMFAVTSLFLYGNIARFL  73

Query  360  GKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsv  539
             KE   D S + IS+Q+A++ A   R+ + + V +   + AERE ++ A  VAAL +LS 
Sbjct  74   RKEE-PDLSGLEISEQTAIEAARSVRQSIEEGVRWMCHVSAERELFLFARVVAALCLLSY  132

Query  540  iasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTM  719
            + S  D L+LLYI  +VG+TVPVIY K E KI    + +++Q RR   MV +K       
Sbjct  133  VGSFWDSLSLLYIDIVVGMTVPVIYVKNEDKIKRYEEWMRMQARRLCDMVDEKV------  186

Query  720  MLQKTGDLKNKVSKHKEKK  776
                   +KN+V K KEK+
Sbjct  187  ----VKRMKNRVLKVKEKR  201



>ref|XP_002522336.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40020.1| conserved hypothetical protein [Ricinus communis]
Length=206

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 115/172 (67%), Gaps = 1/172 (1%)
 Frame = +3

Query  174  TATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDR  353
            T T+KDI+LW+RK+L++  ++++T TWV L++Y F FIT ASW+AM +V + F++GN+ R
Sbjct  12   TDTVKDIVLWRRKKLSLLVLLVATVTWVLLDVYEFNFITVASWLAMLIVTSLFLYGNLVR  71

Query  354  LLGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvl  533
            L  KE     S   IS+++  +TA   R  + + + +   + AE EW++ A  V  LW+L
Sbjct  72   LFRKEE-PKISNWKISEETTTETAKSVRGMIEEGIRWMFHVSAESEWFIFARVVTVLWLL  130

Query  534  sviasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMV  689
            S + S  D LTLLY+G ++G++VPVIY K E+KI    + +K++ RR+Y M+
Sbjct  131  SYVGSFFDFLTLLYVGTVMGMSVPVIYVKNEEKIKRCEEWMKMKARRFYEMM  182



>gb|KHN42055.1| Putative disease resistance protein [Glycine soja]
Length=737

 Score =   130 bits (326),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 116/176 (66%), Gaps = 1/176 (1%)
 Frame = +3

Query  174  TATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDR  353
               +KD++LW+RK++NI+ +V +TA WV +E++ F F+T  SWVA+  +A+ F++ N+ R
Sbjct  23   NGIVKDVVLWRRKKINISVLVAATAAWVLMEVFEFNFLTLISWVAILGLASIFLYANMLR  82

Query  354  LLGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvl  533
            LLGKEP  +   + +S+++  + A   R  + + + +   +GAE+EW V   AVA L  L
Sbjct  83   LLGKEP-PNLLGLEVSEKTTTRIAHTVRAWIEEGIRWLFLVGAEKEWPVFVGAVAGLLSL  141

Query  534  sviasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
            S + S +DLLTL+Y+G LVG+ VP+ Y K E KI    + L+ +++RYY ++ +K+
Sbjct  142  SYLGSCMDLLTLVYMGTLVGMAVPLTYVKNEDKIKRFVEWLREKHKRYYQIIDEKT  197



>ref|XP_011039227.1| PREDICTED: reticulon-like protein B13 [Populus euphratica]
Length=203

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 127/200 (64%), Gaps = 13/200 (7%)
 Frame = +3

Query  180  TIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLL  359
            T++D+ LW+RK+L++  +++STA+WV L++Y+F  IT ASW AMF V + F++GNI R L
Sbjct  14   TVRDVFLWRRKKLSLLVLLVSTASWVLLDVYQFNLITVASWAAMFAVTSLFLYGNIARFL  73

Query  360  -GKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvls  536
              KEP  D S + IS+Q+A++ A   R+ + + V +   + AERE ++ A  VAALW LS
Sbjct  74   RKKEP--DLSGLEISEQTAIEAARSVRQSIEEGVRWMCHVSAERELFLFARVVAALWFLS  131

Query  537  viasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKT  716
             + S  D L+LLYI  +VG+TVPVIY K E KI    + +++Q RR   +V +K      
Sbjct  132  YVGSFWDSLSLLYIDIVVGMTVPVIYLKNEDKIKRFEEWMRMQARRLCDLVDEKV-----  186

Query  717  MMLQKTGDLKNKVSKHKEKK  776
                    +KN+V+K KE K
Sbjct  187  -----VRRMKNRVAKVKENK  201



>gb|KDO79339.1| hypothetical protein CISIN_1g047422mg [Citrus sinensis]
Length=171

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = +3

Query  186  KDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGK  365
            +D+ LW+RK L+   +++STA WV LE+Y+F F+T ASW+AM +V+  F+ G+I RLLGK
Sbjct  24   RDVFLWRRKNLSFTLLLVSTAIWVLLEVYQFNFLTVASWLAMSIVSFTFLSGSIMRLLGK  83

Query  366  EPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvia  545
            EP    S + IS++SA++ A+ FR  V +   +   +  E+EW+V A AVA L VLS +A
Sbjct  84   EP-PKLSGLEISEKSALEVANSFRGVVEEFTRWMFHVSVEKEWFVFAQAVAGLLVLSYVA  142

Query  546  sHLDLLTLLYIGELVGLTVPVIYNKYEQK  632
            +  DLLTLLY G ++G+TVPVIY K   K
Sbjct  143  TFSDLLTLLYTGIVMGMTVPVIYEKMGIK  171



>ref|XP_010531229.1| PREDICTED: reticulon-like protein B13 [Tarenaya hassleriana]
Length=207

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 110/174 (63%), Gaps = 3/174 (2%)
 Frame = +3

Query  180  TIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLL  359
            T++DI+LW+RK+L  + +++ TATWV L +Y F  +T  SW A+  VA  F+WGN+ RLL
Sbjct  16   TVEDIILWRRKKLAFSILIVETATWVLLNVYGFNSMTIVSWAAIAAVALLFLWGNLLRLL  75

Query  360  GK-EPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvls  536
             K EP  + SR+ +S+  A +TA   R    +++ +   + +EREW+V A  V  LW+LS
Sbjct  76   HKGEP--ELSRLRVSEDFAAETASTCRELGEEAIRWMFSVSSEREWFVFARTVLGLWILS  133

Query  537  viasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
             + + LD  T L+IG ++GLTVPV + K + +I +   RLK + R  YS+  +K
Sbjct  134  RVGNLLDFQTFLFIGSVMGLTVPVFWEKQKGRIKKISDRLKEKTREAYSVAREK  187



>emb|CDP11148.1| unnamed protein product [Coffea canephora]
Length=192

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 105/164 (64%), Gaps = 1/164 (1%)
 Frame = +3

Query  174  TATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDR  353
             A I D+L W+   L+I  ++++TATWV L++Y +  +   S +AM +V   F+WGNI R
Sbjct  22   AALIMDLLFWRSMYLSILVLLVATATWVTLQLYHYYMVDVVSRMAMLLVTLIFVWGNIHR  81

Query  354  LLGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvl  533
            LL  E A D S M IS+  A   A   R C+++ + +  R+G EREW V  A V AL +L
Sbjct  82   LLKNE-APDFSGMEISEARAEGMARGIRECIDEGIRWLFRVGVEREWSVFGATVFALGLL  140

Query  534  sviasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQ  665
            S IASH DLLT++Y+G ++G+TVP IY K+E+KI E  + + +Q
Sbjct  141  SWIASHFDLLTIVYMGVVLGMTVPAIYVKHEEKIIELWKAIYLQ  184



>ref|XP_008340297.1| PREDICTED: reticulon-like protein B13 [Malus domestica]
Length=157

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 102/150 (68%), Gaps = 11/150 (7%)
 Frame = +3

Query  180  TIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLL  359
            T++DILLW++K+ +   ++ +TATW+ L++Y+F F+T  S+VAMF+V + F+ GN+ RLL
Sbjct  17   TVRDILLWRKKKQSFLVLLTATATWILLDVYQFNFLTVISYVAMFIVTSLFLSGNLLRLL  76

Query  360  GKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsv  539
            GKEP +D SR+ I+++SA++  +  R  V + + +  ++ AEREW+V    V+ LW+LS 
Sbjct  77   GKEP-SDLSRVGITEKSALEMGNTIRAWVEEGIRWMFQVAAEREWFVFVGTVSGLWLLSR  135

Query  540  iasHLDLLTLLYIGELVGLTVPVIYNKYEQ  629
            +A  +DLLTLLYIG           N YE+
Sbjct  136  VARCVDLLTLLYIGN----------NSYEE  155



>ref|XP_003611823.1| seed maturation protein [Medicago truncatula]
 gb|AES94781.1| reticulon-like protein [Medicago truncatula]
Length=224

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 119/201 (59%), Gaps = 10/201 (5%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            + DI+LW+RK+L+   ++++T++W+ LE+ +F F+T  SW+A+FVV + F++ N+    G
Sbjct  33   MNDIVLWRRKKLSAIVLIVATSSWMLLEVCQFNFLTLISWLAIFVVTSIFLYSNMLTFFG  92

Query  363  KEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvi  542
            KEP  +  R+ + +++A + A   R  + +S+ +   +  + +W V    +  L  +S +
Sbjct  93   KEP-PNLLRLELKEETATRMAKTVRAWIEKSIRWLFVVSIKEDWPVFVGVMVRLLAISYV  151

Query  543  asHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS-SELKTM  719
             + +D LT +YIG L G+T+P+ Y K E KI    + L+ +Y++ Y ++ +K+ ++ K+ 
Sbjct  152  GTCMDFLTFIYIGILTGMTLPITYMKNEDKIKRCMEWLREKYKKSYEIIDEKAINKFKSR  211

Query  720  MLQKTGDLKNKVSKHKEKKRE  782
            +L           K KEKK E
Sbjct  212  ILND--------EKQKEKKIE  224



>ref|XP_002878692.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54951.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 123/201 (61%), Gaps = 14/201 (7%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            ++DI+LW+RK+L  + + +ST+TW+ L  Y FT IT  SW+ + VV+  F+WG++ RLL 
Sbjct  16   VEDIILWRRKKLAFSILSVSTSTWILLNFYGFTTITIISWIGIAVVSMVFLWGSLLRLLS  75

Query  363  K-EPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsv  539
            K EP  + S + +S++  V+T    R  + ++V +  R+GAE EW+V+A  V   WVLS 
Sbjct  76   KVEP--ELSGLEVSEEFVVETVRSCRMLMEETVRWMFRVGAESEWFVLARTVLGFWVLSR  133

Query  540  iasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTM  719
            I + LD  T L+IG ++GLTVP +++KY  +I +    LK + +  Y+   +K      +
Sbjct  134  IGNLLDFHTCLFIGLVMGLTVPKLWDKYGDQIQKQLGSLKDKSKGAYNTTHEK------I  187

Query  720  MLQKTGDLKNKVSKHKEKKRE  782
            +L     +KNK+   +E+K +
Sbjct  188  LL-----MKNKLQHGREEKEK  203



>ref|XP_009117273.1| PREDICTED: reticulon-like protein B13 [Brassica rapa]
 emb|CDY46067.1| BnaA09g41910D [Brassica napus]
Length=208

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 112/188 (60%), Gaps = 3/188 (2%)
 Frame = +3

Query  180  TIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLL  359
            T++DI LW+RK+L  + +++STATWV + IY F+ IT  SW AM +V+  F+WG++ RLL
Sbjct  17   TLEDIYLWRRKKLAFSVLLVSTATWVLINIYGFSSITIVSWAAMAIVSMVFLWGSLLRLL  76

Query  360  GK-EPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvls  536
             K EP  D S + +S +   + A   R+ + + V +   +GAE EW+V A  +   W+LS
Sbjct  77   SKVEP--DLSGLEVSDEFVAEMARSCRKLMEEMVGWMFTVGAESEWFVFAKTILGFWILS  134

Query  537  viasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKT  716
             I + LD  T L+IG ++GLTVP ++ K+  ++ +  + LK +    Y    +K  ++K 
Sbjct  135  RIGNLLDFHTFLFIGLVIGLTVPKLWEKHGDRLQKLSRNLKDRSNEAYDNSREKILKMKN  194

Query  717  MMLQKTGD  740
             +   T D
Sbjct  195  KLQHGTED  202



>ref|NP_565555.1| reticulon-like protein B13 [Arabidopsis thaliana]
 sp|O64837.1|RTNLM_ARATH RecName: Full=Reticulon-like protein B13; Short=AtRTNLB13 [Arabidopsis 
thaliana]
 gb|AAC17096.1| putative seed maturation protein [Arabidopsis thaliana]
 gb|AAM14868.1| putative seed maturation protein [Arabidopsis thaliana]
 gb|AEC07475.1| reticulon-like protein B13 [Arabidopsis thaliana]
Length=206

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 116/194 (60%), Gaps = 6/194 (3%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            ++DI LW+RK+L  + +++ST+TW+ L  Y FT IT  SW+ + VV+  F+WG++ RLL 
Sbjct  16   VEDIYLWRRKKLAFSTLLVSTSTWILLSFYGFTTITIVSWIGIAVVSMIFLWGSLLRLLS  75

Query  363  K-EPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsv  539
            K EP  + S + +S++  V+T    R  + + V +  R+GAE EW+V A  V   W+LS 
Sbjct  76   KVEP--ELSGLEVSEEFVVETVRSCRMLMEEMVRWMFRVGAESEWFVFARTVLGFWILSR  133

Query  540  iasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTM  719
            I + LD  T L+IG ++GLTVP ++ +Y  +I +    LK + +  Y+   +K  E+K  
Sbjct  134  IGNLLDFHTCLFIGLVMGLTVPKLWEEYGDQIQKHLGSLKDKSKGAYNTTHEKILEMKNK  193

Query  720  MLQKTGDLKNKVSK  761
            +   T   + KV K
Sbjct  194  LHHGT---EEKVKK  204



>ref|XP_004512216.1| PREDICTED: reticulon-like protein B13-like [Cicer arietinum]
Length=213

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 109/169 (64%), Gaps = 1/169 (1%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            +KDI+LW+RK+L+ + +V +TATWV +E+Y+F F+T  SW  +FVV++ F++ N+ RLL 
Sbjct  21   MKDIVLWRRKKLSTSILVAATATWVLMELYQFNFLTLISWFIIFVVSSIFLYANMLRLLS  80

Query  363  KEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvi  542
            KEP  +  R+ + +++ ++ A   R  + +S+ + + +  + +  V    VA+L  LS +
Sbjct  81   KEP-QNWLRVELKEETTLRMAKKVRAWIEESIRWLIMVSTKEDLPVFVGVVASLLTLSYV  139

Query  543  asHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMV  689
             + +D LT +YIG L G+T+P+ Y K E +I    + L+ +Y+R Y ++
Sbjct  140  GACMDFLTFIYIGILGGMTLPITYMKNEDRIKRCREWLREKYKRCYEII  188



>ref|XP_007156840.1| hypothetical protein PHAVU_002G021800g [Phaseolus vulgaris]
 gb|ESW28834.1| hypothetical protein PHAVU_002G021800g [Phaseolus vulgaris]
Length=212

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 113/175 (65%), Gaps = 1/175 (1%)
 Frame = +3

Query  177  ATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRL  356
              +KD++ W+RK+LN   IV +TA WV +E++ F F+   SWVA+ VVA+ F++ N+ RL
Sbjct  24   GVVKDVVFWRRKKLNAVVIVAATAAWVLMEVFEFNFLAVISWVAILVVASTFLYANMLRL  83

Query  357  LGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvls  536
            LGKEP  + S + +++++  + A   R  + +++ + L +   +EW V    VA LW LS
Sbjct  84   LGKEP-PNLSWLELTEETTRRIASKVRAWIQETIRWLLLVSVRKEWPVFVGVVAGLWSLS  142

Query  537  viasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
             I   +DLLT++YIG LVG+ +P+ Y K E+KI   G+ L+ +Y+R Y ++ +K+
Sbjct  143  YIGRCMDLLTVVYIGVLVGMAIPLTYVKNEEKIKRFGEWLREKYKRCYEIIDEKT  197



>emb|CDX76854.1| BnaC08g34400D [Brassica napus]
Length=207

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 112/187 (60%), Gaps = 2/187 (1%)
 Frame = +3

Query  180  TIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLL  359
            T++DI LW+RK+L  + +++STATWV + IY F+ IT  SW AM +V+  F+WG++ RL 
Sbjct  17   TLEDIYLWRRKKLAFSVLLVSTATWVLINIYGFSSITIVSWAAMAIVSMVFLWGSLLRLS  76

Query  360  GKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsv  539
              EP  D S + +S +   +TA   R+ + + V +   +G E EW+V A  +  +W+LS 
Sbjct  77   KVEP--DLSGLEVSDEFVAETARSCRKLMEEIVRWMFTVGVESEWFVFAKTILGVWILSR  134

Query  540  iasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTM  719
            I + LD  T L+IG ++GLT+P ++ K+  ++ +  + LK +    Y+   +K  ++K  
Sbjct  135  IGNLLDFHTFLFIGLVIGLTLPKLWEKHGDRLQKLSRNLKDRSNEAYNNSREKILKMKKK  194

Query  720  MLQKTGD  740
            +   T +
Sbjct  195  LQHGTEE  201



>ref|XP_006295650.1| hypothetical protein CARUB_v10024763mg [Capsella rubella]
 gb|EOA28548.1| hypothetical protein CARUB_v10024763mg [Capsella rubella]
Length=206

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 109/187 (58%), Gaps = 3/187 (2%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            ++D+ LW+RK+L  + + +STATWV L  Y F  IT  SW+ + VV+  F+WG++ RLL 
Sbjct  16   VEDVYLWRRKKLAFSILSVSTATWVLLNFYGFNSITIVSWIGIAVVSMVFLWGSLLRLLS  75

Query  363  K-EPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsv  539
            K EP  + S + +S++   +T    R  + ++V +  R+GAE EW+V A  +  LW+LS 
Sbjct  76   KVEP--ELSGLEVSEEFVAETVRSCRMLMEETVRWMFRVGAESEWFVFARTILGLWILSR  133

Query  540  iasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTM  719
            I S LD  T L+ G ++GLTVP +  KY  +IN+    +K + +  Y    +K   +K  
Sbjct  134  IGSLLDFHTFLFTGLVMGLTVPKLLEKYGDQINKQLANVKERSKGAYDTTHKKILMMKNK  193

Query  720  MLQKTGD  740
            +   T +
Sbjct  194  LQHGTAE  200



>ref|XP_006404851.1| hypothetical protein EUTSA_v10000566mg [Eutrema salsugineum]
 gb|ESQ46304.1| hypothetical protein EUTSA_v10000566mg [Eutrema salsugineum]
Length=206

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 103/173 (60%), Gaps = 3/173 (2%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            ++DI LW++K+L  + + +ST TWV L IY F  IT  SW A+ +V+  F+WG++ RLL 
Sbjct  16   VEDIYLWRKKKLAFSVLSVSTVTWVLLSIYGFNSITIVSWTAIAIVSMVFLWGSLLRLLS  75

Query  363  K-EPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsv  539
            K EP  + S + +S++   +T    R+ + + V +  R+GAE EW+V A  V   W+LS 
Sbjct  76   KVEP--ELSGLEVSEEFVAETVRSCRKLMEEMVRWMFRVGAESEWFVFARTVLGFWILSR  133

Query  540  iasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
            I + LD  T L+IG +VGLTVP ++ K   +I +    LK + +  Y    +K
Sbjct  134  IGNLLDFHTFLFIGLVVGLTVPKLWEKNSDRIQKLLANLKERSKGAYDHTQEK  186



>gb|KHN36199.1| Reticulon-like protein B13 [Glycine soja]
Length=183

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 112/176 (64%), Gaps = 12/176 (7%)
 Frame = +3

Query  243  TATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKEPAADTSRMYISQQSAVKT  422
            T  WV +E++ F F+   SWVA+ V+A+ F++ N+ RLLGKEP  +  R+ +++++  + 
Sbjct  18   TLAWVLMEVFEFNFLAVVSWVAILVLASIFLYANMLRLLGKEP-PNLLRLEVTEETT-RI  75

Query  423  ADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsviasHLDLLTLLYIGELVGLTV  602
            A   R  + +++ +   +GAE+EW V   AVAAL +LS I S +DLLTL+Y+G LVG+ V
Sbjct  76   AKTVRAWIKEAIRWLFLVGAEKEWPVFVGAVAALLLLSYIGSCMDLLTLVYMGTLVGMAV  135

Query  603  PVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQKTGDLKNKVSKHKE  770
            P+ Y K E KI      L+ +++RYY ++ +K+       +QK   +K++++K K+
Sbjct  136  PLTYVKNEDKIKRFVGWLREKHKRYYQIIDEKT-------IQK---IKSRIAKEKK  181



>ref|XP_010472358.1| PREDICTED: reticulon-like protein B13 [Camelina sativa]
Length=206

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 107/187 (57%), Gaps = 3/187 (2%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            ++DI LW+RK+L  + + +ST+TW+ L  Y F  IT  SW+ + VV+  F+WG++ RLL 
Sbjct  16   VEDIYLWRRKKLAFSILTVSTSTWILLNFYGFNSITIVSWIGIAVVSMVFLWGSLLRLLS  75

Query  363  K-EPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsv  539
            K EP  + S + +S++   +T    R  + + V +  R+GAE EW+V A  V   W+LS 
Sbjct  76   KVEP--ELSGLEVSEEFVTETVRSCRVLMEEIVRWMFRVGAESEWFVFARTVLGFWILSR  133

Query  540  iasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTM  719
            I   LD  T L+IG ++GLTVP ++ KY  +I +    +K + +  Y    +K   +K  
Sbjct  134  IGKLLDFHTCLFIGLVMGLTVPKLWEKYGVQIQKQLGDVKERSKGVYGTTHEKILMMKNK  193

Query  720  MLQKTGD  740
            +   T D
Sbjct  194  LEHSTYD  200



>ref|XP_010429314.1| PREDICTED: reticulon-like protein B13 [Camelina sativa]
Length=206

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 108/187 (58%), Gaps = 3/187 (2%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            ++DI LW+RK+L  + + +ST+TW+ L  Y F  IT  SW+ + VV+  F+WG++ RLL 
Sbjct  16   VEDIYLWRRKKLAFSILSVSTSTWILLNFYGFNSITIVSWIGIAVVSMVFLWGSLLRLLS  75

Query  363  K-EPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsv  539
            K EP  + S + +S++   +T    R  + + V +  R+GAE EW++ A  V   W+LS 
Sbjct  76   KVEP--ELSGLEVSEEFVTETVRSCRMLMEEIVRWMFRVGAESEWFIFARTVLGFWILSR  133

Query  540  iasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTM  719
            I   L+  T L+IG ++GLTVP ++ KY  +I++    +K + +  Y    +K   +K  
Sbjct  134  IGKLLEFQTCLFIGLVMGLTVPKLWEKYGVQIHKQLGDVKERSKGVYDTTHEKILMMKNK  193

Query  720  MLQKTGD  740
            +   T D
Sbjct  194  LQHGTYD  200



>ref|XP_007047156.1| Reticulan like protein B13 [Theobroma cacao]
 gb|EOX91313.1| Reticulan like protein B13 [Theobroma cacao]
Length=387

 Score =   101 bits (252),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 98/172 (57%), Gaps = 2/172 (1%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            + DI LWKRK+L+   +  STATW+  ++Y++ FIT ASWVA+F V + FIW N++R L 
Sbjct  189  VNDIALWKRKKLSGTLLFSSTATWLLQQVYQYNFITIASWVAIFFVTSLFIWRNVNRFLD  248

Query  363  KEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLR-LGAEREWYvvaaavaalwvlsv  539
            +E A  +    I ++ A++ A+  R   +Q + +       E EW+V    VA L + S 
Sbjct  249  REEATKSRLENIREKVAMEVANACRELTDQIIGWIFHATDVEGEWFVFPQTVALLLIFSC  308

Query  540  iasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQ  695
            + S  DL TL   G ++G TVP I  K+  K+   G  +++Q  R   MVL+
Sbjct  309  VGSFFDLPTLCK-GVMMGTTVPPIVAKHGDKMKTFGNMVRMQSGRVCEMVLE  359



>ref|XP_010030609.1| PREDICTED: LOW QUALITY PROTEIN: reticulon-like protein B13 [Eucalyptus 
grandis]
Length=188

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 100/172 (58%), Gaps = 23/172 (13%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            +KD  LW+RK+L++  +V++T TWVA+E+Y  T   +                     L 
Sbjct  19   VKDTFLWRRKKLSLMVLVMATTTWVAMEVYHSTSPLS---------------------LP  57

Query  363  KEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvi  542
            +EP  +  RM IS+Q+A++ A+  R    + + +  R+GAER+W+  A  VA LW LS I
Sbjct  58   EEP--ELRRMEISEQTAMEMANSARAWAEEGIRWMFRVGAERDWFTFAGVVAGLWALSKI  115

Query  543  asHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + DLLTL+Y+  ++G+TVP +Y ++E K+ + G+++K + R +Y    +K
Sbjct  116  GGYFDLLTLVYLAVVLGMTVPALYVRHEDKVAQLGEKVKARSRSFYERADEK  167



>ref|XP_010417108.1| PREDICTED: reticulon-like protein B13 [Camelina sativa]
Length=206

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 106/187 (57%), Gaps = 3/187 (2%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            ++DI LW+RK+L  + + +ST+TW+ L  Y    IT  SW+ + VV+  F+WG++ RLL 
Sbjct  16   VEDIYLWRRKKLAFSILTVSTSTWILLNFYGLNSITIVSWIGIAVVSMVFLWGSLLRLLS  75

Query  363  K-EPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsv  539
            K EP  + S + +S++   +T    R  + +   +  R+GAE EW+V A  V   W+LS 
Sbjct  76   KVEP--ELSGLEVSEEFVTETVRSCRMLMEEIDRWMFRVGAESEWFVFARTVLGFWILSR  133

Query  540  iasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTM  719
            I   LD  T L+IG ++GLTVP ++ KY  +I++    +K + +  Y    +K   +K  
Sbjct  134  IGKLLDFHTCLFIGLVMGLTVPKLWEKYGVQIHKQLGDVKERSKGVYGTTHEKILMMKNK  193

Query  720  MLQKTGD  740
            +   T D
Sbjct  194  LQYGTYD  200



>ref|XP_003611807.1| seed maturation protein [Medicago truncatula]
 gb|AES94765.1| reticulon-like protein [Medicago truncatula]
Length=160

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 91/139 (65%), Gaps = 1/139 (1%)
 Frame = +3

Query  192  ILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKEP  371
            ++LW+RK+L    ++ +T TWV++E+Y+F F+T  SW+ +FVV + F++ N+  L GKEP
Sbjct  18   LVLWRRKKLGTIVLIAATTTWVSMEVYQFNFLTLISWLTIFVVTSIFLYSNMLTLFGKEP  77

Query  372  AADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsviasH  551
              +  R+ + +++A + A   R  + +S+ +   +  +++W V    +AAL+V+S + + 
Sbjct  78   -PNLLRLELKEETATRMAKTVRAWIEKSIRWLFVVSIKKDWPVFVGVMAALFVISYVGTC  136

Query  552  LDLLTLLYIGELVGLTVPV  608
            +D LT +YIG + G+T+PV
Sbjct  137  MDFLTFIYIGIVAGMTLPV  155



>ref|XP_003611809.1| seed maturation protein [Medicago truncatula]
Length=202

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 89/139 (64%), Gaps = 1/139 (1%)
 Frame = +3

Query  192  ILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKEP  371
            ++LW+RK+L    ++ +TATWV++E+Y+F F+T  SW+ +FVV + F++ N+    GKEP
Sbjct  60   LVLWRRKKLGTIVLIAATATWVSMEVYQFKFLTLISWITIFVVTSIFLYSNMLTFFGKEP  119

Query  372  AADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsviasH  551
              +  R+ + +++ V+ A   R  + + + +   +  +++W V    +A L+V+S + + 
Sbjct  120  -PNLLRLELKEETTVRMAKTVRAWIEKLIRWLFVVSIKKDWPVFVGVMATLFVISYVGTC  178

Query  552  LDLLTLLYIGELVGLTVPV  608
            +D LT +YIG + GLT+PV
Sbjct  179  MDFLTFIYIGMVAGLTLPV  197



>gb|AES94768.2| reticulon-like protein [Medicago truncatula]
Length=486

 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 89/139 (64%), Gaps = 1/139 (1%)
 Frame = +3

Query  192  ILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKEP  371
            ++LW+RK+L    ++ +TATWV++E+Y+F F+T  SW+ +FVV + F++ N+    GKEP
Sbjct  344  LVLWRRKKLGTIVLIAATATWVSMEVYQFKFLTLISWITIFVVTSIFLYSNMLTFFGKEP  403

Query  372  AADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsviasH  551
              +  R+ + +++ V+ A   R  + + + +   +  +++W V    +A L+V+S + + 
Sbjct  404  -PNLLRLELKEETTVRMAKTVRAWIEKLIRWLFVVSIKKDWPVFVGVMATLFVISYVGTC  462

Query  552  LDLLTLLYIGELVGLTVPV  608
            +D LT +YIG + GLT+PV
Sbjct  463  MDFLTFIYIGMVAGLTLPV  481



>ref|XP_003611817.1| seed maturation protein [Medicago truncatula]
 gb|AES94775.1| plant broad-spectrum mildew resistance protein RPW8 [Medicago 
truncatula]
Length=434

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 92/147 (63%), Gaps = 1/147 (1%)
 Frame = +3

Query  195  LLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKEPA  374
            +LW+RK+L+   ++++T++W+ LE+ +F F+T  SW+A+FVV + F++ N+  L GKEP 
Sbjct  284  ILWRRKKLSTIVLIVATSSWMLLEVCQFNFLTLISWLAIFVVTSIFLYSNMLTLFGKEP-  342

Query  375  ADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsviasHL  554
             +  R+ + +++ V+ A   R    +S+ +   +  + +W V    +A L+V+S + S +
Sbjct  343  PNLLRLELKKETTVRMAKTVRAWTEKSIRWLFVVSIKEDWPVFVGVMATLFVISYVGSCM  402

Query  555  DLLTLLYIGELVGLTVPVIYNKYEQKI  635
            D LT ++IG L  +T+P+   K E KI
Sbjct  403  DFLTFIFIGILASMTLPITSMKNEDKI  429



>gb|KFK32722.1| hypothetical protein AALP_AA6G280300 [Arabis alpina]
Length=122

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 62/92 (67%), Gaps = 3/92 (3%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            ++DI LW+RK+L  + + +STATWV L IY F +IT  SW+AM +++  F+WGN+ RLL 
Sbjct  16   VEDIYLWRRKKLAFSILSVSTATWVLLNIYGFNYITIVSWIAMAMISTVFLWGNLLRLLS  75

Query  363  K-EPAADTSRMYISQQSAVKTADVFRRCVNQS  455
            K EP  D S + +S++  V+T    ++ + ++
Sbjct  76   KVEP--DLSGLEVSEEFVVETVRSSQKLMEET  105



>emb|CDY41666.1| BnaC03g62180D [Brassica napus]
Length=276

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 104/190 (55%), Gaps = 10/190 (5%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   +  +TA WV  E+  +  +T    V + V+A  F+W N+ R + K 
Sbjct  92   DIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNVTRFIHKS  151

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P     +++I ++  ++ A   R  +N+       + + R+     +A+A LWVLS++  
Sbjct  152  P-PKIPQVHIPEEPVLQLASGLRIEINRGFSSLREIASGRDLKKFISAIAGLWVLSILGG  210

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVP++Y+KYE K++  G++  ++ ++ Y+++ +K       +L 
Sbjct  211  WFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEK-------VLS  263

Query  729  KT--GDLKNK  752
            K   G LKNK
Sbjct  264  KIPLGPLKNK  273



>ref|XP_006647139.1| PREDICTED: reticulon-like protein B2-like [Oryza brachyantha]
Length=232

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 87/170 (51%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLWK K+ + A I  +T  WV  E+  + F+T  S V + V+A  F+W      + K 
Sbjct  48   DVLLWKDKKTSAAVIGGATVLWVLFEVVDYHFLTLISHVLIGVLAILFLWSKATIFIKKS  107

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  D   + IS+  AV      R  +NQ++     +    +       +  LW+LS I S
Sbjct  108  P-PDIPEVKISEDLAVNVVLALRTDINQALHLLREIALGHDLMKFLGVIVGLWILSEIGS  166

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              D LTL Y+  L+  TVP++Y+KY+ K++    +  V+  R YS++ +K
Sbjct  167  LCDFLTLFYVAVLMLHTVPILYHKYQDKVDHFAGKAHVELSRQYSVLDEK  216



>ref|NP_001046501.1| Os02g0265900 [Oryza sativa Japonica Group]
 dbj|BAD27895.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF08415.1| Os02g0265900 [Oryza sativa Japonica Group]
 gb|EAZ22509.1| hypothetical protein OsJ_06173 [Oryza sativa Japonica Group]
 dbj|BAG96495.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87213.1| unnamed protein product [Oryza sativa Japonica Group]
Length=230

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 89/170 (52%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLWK K+++ A I  +T  WV  E+  + F+T  S V + V+A  F+W      + K 
Sbjct  46   DVLLWKDKKISAAVIGGATVLWVLFEVVDYHFLTLISHVLIGVLAILFLWSKATIFIKKS  105

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + IS+  AV  A   R  +NQ++     +    +       + ALW+LS I S
Sbjct  106  P-PNIPEVKISEDLAVNVALALRTDINQALHLLREISLGHDLMKFLGVIVALWILSEIGS  164

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              D LTL Y+  L+  TVP++Y+KY+ K++    +  V+  R YS++  K
Sbjct  165  LCDFLTLFYVAVLMLHTVPILYHKYQDKVDHFAGKAHVELSRQYSVLDAK  214



>ref|XP_006413535.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54988.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=275

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 101/190 (53%), Gaps = 10/190 (5%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   +  +TA WV  E+  +  +T    V + V+A  F+W N    + K 
Sbjct  91   DIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKS  150

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + R+     +AVA LWVLSV+  
Sbjct  151  P-PKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLSAVAGLWVLSVLGG  209

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVP++Y+KYE K++  G++  ++ ++ Y+++ +K       +L 
Sbjct  210  WFNFLTLAYIALVLLFTVPIVYDKYEDKVDPLGEKAMIEIKKQYAVLDEK-------VLS  262

Query  729  KT--GDLKNK  752
            K   G LKNK
Sbjct  263  KIPLGPLKNK  272



>gb|EAY85291.1| hypothetical protein OsI_06662 [Oryza sativa Indica Group]
Length=230

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 88/170 (52%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLWK K+++ A I  +T  WV  E+  + F+T  S V + V+A  F+W      + K 
Sbjct  46   DVLLWKDKKISAAVIGGATVLWVLFEVVDYHFLTLISHVLIGVLAILFLWSKATIFIKKS  105

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + IS+  AV  A   R  +NQ++     +    +       + ALW+LS I S
Sbjct  106  P-PNIPEVKISEDLAVNVALALRTDINQALHLLREISLGHDLMKFLGVIVALWILSEIGS  164

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              D LTL Y+  L+  TVP+ Y+KY+ K++    +  V+  R YS++  K
Sbjct  165  LCDFLTLFYVAVLMLHTVPIFYHKYQDKVDHFAGKAHVELSRQYSVLDAK  214



>ref|XP_003572248.1| PREDICTED: reticulon-like protein B2 [Brachypodium distachyon]
Length=235

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 85/165 (52%), Gaps = 1/165 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+L+WK K+++ A I  +T  WV  E+  + F+   S V +  +A  F+W      + K 
Sbjct  51   DVLMWKDKKMSAAVIGGATVIWVLFEVVEYNFLPLVSHVLIGTLAIVFLWSKATIFIKKS  110

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  D   + IS+  AV      R  +NQ++     +    +       + ALWVLS I S
Sbjct  111  P-PDIPEVQISEDLAVNIVQALRTDINQALGLLREIALGHDLMKFLGLMVALWVLSEIGS  169

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYS  683
              D LTL+Y+  L+  TVP++Y+KY+ K+++   +  V+ R+ Y 
Sbjct  170  LCDFLTLVYVAALMLHTVPILYHKYQDKVDDFAGKAHVELRKLYE  214



>ref|XP_004969875.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=257

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 89/171 (52%), Gaps = 1/171 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LW+ K+++   +  +TA W+  E+  +  +T      +  +A  F+W N    + K 
Sbjct  74   DLVLWRNKKISGGVLASATAIWLLFEVMEYHLLTLVCHCLILSLAILFLWSNASTFINKS  133

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + IS+  AV  A   R  +N+       +G  R+       +A  W+LSV+ S
Sbjct  134  PP-NIPEVKISEDVAVNVALSLRYEINRGFATLREIGHGRDLKKFLIVIAGFWLLSVLGS  192

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
              + LTL YI  +V  TVPV+Y KYE K++  G++  ++ ++YY++  +K 
Sbjct  193  CCNFLTLFYIVFVVLYTVPVLYEKYEDKVDAFGEKAMIELKKYYAIFDEKC  243



>gb|AFK41983.1| unknown [Medicago truncatula]
Length=237

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 95/170 (56%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   + ++TA WV  E+  +  +T  S +A+  +A  F+W N    + K 
Sbjct  53   DVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHLAILALAVLFLWSNASTFINKS  112

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P     +++I ++  ++ A   R  +N++      + + R+     + +A LWVLS++ S
Sbjct  113  P-PKIPQVHIPEEPVLQIASAIRIEINRAFAILRDIASGRDLKQFLSVIAGLWVLSIVGS  171

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL YI  ++  TVPV+Y KYE +++  G++   ++++ Y++  +K
Sbjct  172  WTNFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKALHEFKKQYAVFDEK  221



>ref|NP_001056102.1| Os05g0526400 [Oryza sativa Japonica Group]
 gb|AAU44062.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18016.1| Os05g0526400 [Oryza sativa Japonica Group]
 dbj|BAG96540.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00639.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64429.1| hypothetical protein OsJ_19273 [Oryza sativa Japonica Group]
Length=251

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 93/188 (49%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K++++  +  +TA W+  E+  +  +T      +  +A  F+W N    + K 
Sbjct  68   DLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWSNASTFINKS  127

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I +  AV  A   R  +N+       +G   +       V  LWVLSV+ S
Sbjct  128  P-PNIPEVKIPEDLAVNVARSLRFEINRGFATLREIGQGHDLKKFLIVVVGLWVLSVLGS  186

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  +V  TVPV+Y KYE +I+  G++  ++ ++YY++  +     K +   
Sbjct  187  CCNFLTLFYIVFMVLYTVPVLYEKYEDQIDAFGEKAMIELKKYYAIFDE-----KCLSKI  241

Query  729  KTGDLKNK  752
              G LKNK
Sbjct  242  PKGPLKNK  249



>ref|XP_011047748.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=254

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 92/170 (54%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +TA WV  E+  +  IT   ++++F +A  F+W N    L K 
Sbjct  70   DVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCYLSIFSLAVLFLWSNASNFLNKS  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + + ++   + A   R  +N+ V     + + R+     A +A L VLS++ S
Sbjct  130  P-PKIPEVLLPEKCVREVASGLRIEINRGVAVLHDIASGRDLKKFLAVIAGLLVLSLVGS  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTLLYI  ++  TVPV+Y KYE +++   ++  +Q ++ Y+++ +K
Sbjct  189  CCNFLTLLYISFVLLHTVPVLYEKYEDQVDGCSEKSWIQIKKQYALLDEK  238



>ref|XP_009137263.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=276

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 98/188 (52%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   +  +TA WV  E+  +  +T    V + V+A  F+W N    + K 
Sbjct  92   DIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKS  151

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+ +     + + R+      A+  LWVLS++  
Sbjct  152  P-PKIPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDLKKFLCAIFGLWVLSIMGG  210

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVP++Y+KYE K++  G++  ++ ++ Y+++ +K      M   
Sbjct  211  WFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPM---  267

Query  729  KTGDLKNK  752
              G LKNK
Sbjct  268  --GPLKNK  273



>emb|CDY57657.1| BnaC01g15350D [Brassica napus]
Length=275

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 98/188 (52%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   +  +TA WV  E+  +  +T    V + V+A  F+W N    + K 
Sbjct  91   DIFMWKDKKISGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKS  150

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+ +     + + R+      A+  LWVLS++  
Sbjct  151  PPK-IPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDLKKFLCAIVGLWVLSIMGG  209

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVP++Y+KYE K++  G++  ++ ++ Y+++ +K      M   
Sbjct  210  WFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPM---  266

Query  729  KTGDLKNK  752
              G LKNK
Sbjct  267  --GPLKNK  272



>emb|CDY44123.1| BnaA01g13310D [Brassica napus]
Length=276

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 98/188 (52%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   +  +TA WV  E+  +  +T    V + V+A  F+W N    + K 
Sbjct  92   DIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKS  151

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+ +     + + R+      A+  LWVLS++  
Sbjct  152  P-PKIPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDLKKFLCAIFGLWVLSIMGG  210

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVP++Y+KYE K++  G++  ++ ++ Y+++ +K      M   
Sbjct  211  WFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPM---  267

Query  729  KTGDLKNK  752
              G LKNK
Sbjct  268  --GPLKNK  273



>ref|XP_010509305.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=275

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 98/190 (52%), Gaps = 10/190 (5%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   +  +TA WV  E+  +  +T    V + V+A  F+W N    + K 
Sbjct  91   DIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLICHVMIVVLAVLFLWSNATMFINKS  150

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + RE      A+  LW+LS++  
Sbjct  151  P-PKIPEIHIPEEPILQLASGLRIEINRGFSSLREIASGRELKKFLIAIFGLWILSILGG  209

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVP+ Y+KYE K++  G++  ++ ++ Y+++ +K       +L 
Sbjct  210  CFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEK-------VLS  262

Query  729  KT--GDLKNK  752
            K   G LKNK
Sbjct  263  KIPLGPLKNK  272



>dbj|BAJ98297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97542.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 99/189 (52%), Gaps = 8/189 (4%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LW+ K+++   +  +TA W+  E+  +  +T      +  +A  F+W N+   + K 
Sbjct  72   DLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLATLFLWSNVCIFIHKS  131

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLR-LGAEREWYvvaaavaalwvlsvia  545
            P  +   + I +   V  A   R  +N+ + FTLR +G  R+       +  LWVLSV+ 
Sbjct  132  PP-NIPEVKIPEDLTVNIALSLRHEINRGL-FTLREIGHGRDLKKFLIVIGGLWVLSVLG  189

Query  546  sHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMML  725
            S  + LTL YI  +V  TVPV+Y KY+ K++  G++  ++ ++YY++      E K +  
Sbjct  190  SCCNFLTLSYIVFVVLYTVPVLYEKYDDKVDAFGEKAMIELKKYYAIF-----EEKVLSK  244

Query  726  QKTGDLKNK  752
               G LKNK
Sbjct  245  IPKGALKNK  253



>ref|NP_001044177.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAB89453.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF06091.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAG89426.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00393.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 95/188 (51%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LW+ K+++   +  +TA W+  EI  +  +T      +  +A  F+W N    + K 
Sbjct  70   DLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNASTFIHKS  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I +   V  A   R  +N+       +G  R+       +A LW+LSV+ S
Sbjct  130  PP-NIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWILSVLGS  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  +   TVPV+Y KYE K++  G++ ++++++YY++      E K +   
Sbjct  189  SCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAEIEFKKYYALF-----EEKCLSKI  243

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  244  PKGPLKDK  251



>gb|EAZ13460.1| hypothetical protein OsJ_03377 [Oryza sativa Japonica Group]
Length=253

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 95/188 (51%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LW+ K+++   +  +TA W+  EI  +  +T      +  +A  F+W N    + K 
Sbjct  70   DLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNASTFIHKS  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I +   V  A   R  +N+       +G  R+       +A LW+LSV+ S
Sbjct  130  PP-NIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWILSVLGS  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  +   TVPV+Y KYE K++  G++ ++++++YY++      E K +   
Sbjct  189  SCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAEIEFKKYYALF-----EEKCLSKI  243

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  244  PKGPLKDK  251



>ref|XP_010433883.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=276

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 98/190 (52%), Gaps = 10/190 (5%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   +  +TA WV  E+  +  +T    V + V+A  F+W N    + K 
Sbjct  92   DIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLICHVMIVVLAVLFLWSNATMFINKS  151

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + RE      A+  LW+LS++  
Sbjct  152  P-PKIPEVHIPEEPILQLASGLRIEINRGFSTLREIASGRELKKFLIAIFGLWILSILGG  210

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVP+ Y+KYE K++  G++  ++ ++ Y+++ +K       +L 
Sbjct  211  CFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEK-------VLS  263

Query  729  KT--GDLKNK  752
            K   G LKNK
Sbjct  264  KIPLGPLKNK  273



>ref|XP_010530741.1| PREDICTED: reticulon-like protein B10 isoform X6 [Tarenaya hassleriana]
Length=209

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 92/178 (52%), Gaps = 5/178 (3%)
 Frame = +3

Query  177  ATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRL  356
             ++ D+LLW+++R  +  +  ST  W   E   ++F++  + V +  V   F+W     L
Sbjct  21   GSVADLLLWRKRRGPVLLLGSSTLLWFLFEKAGYSFLSFVANVQLLFVVILFLWAKSASL  80

Query  357  LGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvls  536
            L + P      + IS+ SA+K AD  R  +N+ +     +   R    +      LW LS
Sbjct  81   LDR-PMPPLPNLEISEASALKVADALRVWLNRVLSVARDIAVGRNVKRLFQVSFVLWSLS  139

Query  537  viasHLDLLTLLYIGELVGLTVPVIYNKYEQKINES---GQR-LKVQYRRYYSMVLQK  698
            ++ +  + LTLLY+G ++ L++PV+Y KY+  I++     QR L+ Q RR    +LQK
Sbjct  140  LLGNFFNFLTLLYLGVILSLSIPVLYEKYQDNIDDKLSVTQRVLQTQCRRIDESILQK  197



>ref|XP_010439152.1| PREDICTED: reticulon-like protein B1 isoform X1 [Camelina sativa]
Length=276

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 98/190 (52%), Gaps = 10/190 (5%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   +  +TA WV  E+  +  +T    V + V+A  F+W N    + K 
Sbjct  92   DIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLICHVMIVVLAVLFLWSNATMFINKS  151

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + RE      A+  LW+LS++  
Sbjct  152  P-PKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRELKKFLIAIFGLWILSILGG  210

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVP+ Y+KYE K++  G++  ++ ++ Y+++ +K       +L 
Sbjct  211  CFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEK-------VLS  263

Query  729  KT--GDLKNK  752
            K   G LKNK
Sbjct  264  KIPLGPLKNK  273



>ref|NP_194094.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
 sp|Q9SUR3.1|RTNLA_ARATH RecName: Full=Reticulon-like protein B1; Short=AtRTNLB1; AltName: 
Full=VirB2-interacting protein 1 [Arabidopsis thaliana]
 emb|CAA23029.1| putative protein [Arabidopsis thaliana]
 emb|CAB79318.1| putative protein [Arabidopsis thaliana]
 gb|AAK91338.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AAM65433.1| unknown [Arabidopsis thaliana]
 gb|AAM91465.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AEE84787.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
Length=275

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 99/190 (52%), Gaps = 10/190 (5%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   +  +TA WV  E+  +  +T    V + V+A  F+W N    + K 
Sbjct  91   DIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKS  150

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + R+      A+A LWVLS++  
Sbjct  151  P-PKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLIAIAGLWVLSILGG  209

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVP+ Y+KYE K++  G++  ++ ++ Y+++ +K       +L 
Sbjct  210  CFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIELKKQYAVLDEK-------VLS  262

Query  729  KT--GDLKNK  752
            K   G LKNK
Sbjct  263  KIPLGPLKNK  272



>gb|ACJ84486.1| unknown [Medicago truncatula]
 gb|AFK36476.1| unknown [Medicago truncatula]
 gb|KEH21160.1| seed maturation protein [Medicago truncatula]
Length=260

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 95/170 (56%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   + ++TA WV  E+  +  +T  S +A+  +A  F+W N    + K 
Sbjct  76   DVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHLAILALAVLFLWSNASTFINKS  135

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P     +++I ++  ++ A   R  +N++      + + R+     + +A LWVLS++ S
Sbjct  136  PPK-IPQVHIPEEPVLQIASAIRIEINRAFAILRDIASGRDLKQFLSVIAGLWVLSIVGS  194

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL YI  ++  TVPV+Y KYE +++  G++   ++++ Y++  +K
Sbjct  195  WTNFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKALHEFKKQYAVFDEK  244



>ref|XP_006284300.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
 gb|ACC91263.1| reticulon family protein [Capsella rubella]
 gb|EOA17198.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
Length=274

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 99/190 (52%), Gaps = 10/190 (5%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   +  +TA WV  E+  +  +T    V + V+A  F+W N    + K 
Sbjct  90   DIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKS  149

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + R+      A+A LWVLS++  
Sbjct  150  P-PKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLIAIAGLWVLSILGG  208

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVP+ Y+KYE K++  G++  ++ ++ Y+++ +K       +L 
Sbjct  209  CFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEK-------VLS  261

Query  729  KT--GDLKNK  752
            K   G LKNK
Sbjct  262  KIPLGPLKNK  271



>dbj|BAJ33905.1| unnamed protein product [Thellungiella halophila]
Length=275

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 101/190 (53%), Gaps = 10/190 (5%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            +I +WK K+++   +  +TA WV  E+  +  +T    V + V+A  F+W N    + K 
Sbjct  91   EIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKS  150

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + R+     +AVA LWVLSV+  
Sbjct  151  P-PKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLSAVAGLWVLSVLGG  209

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVP++Y+KYE K++  G++  ++ ++ Y+++ +K       +L 
Sbjct  210  WFNFLTLAYIALVLLFTVPIVYDKYEDKVDPLGEKAMIEIKKQYAVLDEK-------VLS  262

Query  729  KT--GDLKNK  752
            K   G LKNK
Sbjct  263  KIPLGPLKNK  272



>ref|XP_010530737.1| PREDICTED: reticulon-like protein B10 isoform X2 [Tarenaya hassleriana]
Length=219

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 92/178 (52%), Gaps = 5/178 (3%)
 Frame = +3

Query  177  ATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRL  356
            + + D+LLW+++R  +  +  ST  W   E   ++F++  + V +  V   F+W     L
Sbjct  31   SPVADLLLWRKRRGPVLLLGSSTLLWFLFEKAGYSFLSFVANVQLLFVVILFLWAKSASL  90

Query  357  LGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvls  536
            L + P      + IS+ SA+K AD  R  +N+ +     +   R    +      LW LS
Sbjct  91   LDR-PMPPLPNLEISEASALKVADALRVWLNRVLSVARDIAVGRNVKRLFQVSFVLWSLS  149

Query  537  viasHLDLLTLLYIGELVGLTVPVIYNKYEQKINES---GQR-LKVQYRRYYSMVLQK  698
            ++ +  + LTLLY+G ++ L++PV+Y KY+  I++     QR L+ Q RR    +LQK
Sbjct  150  LLGNFFNFLTLLYLGVILSLSIPVLYEKYQDNIDDKLSVTQRVLQTQCRRIDESILQK  207



>ref|XP_006644671.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=253

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 94/188 (50%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LW+ K+++   +  +TA W+  E+  +  +T      +  +A  F+W N    + K 
Sbjct  70   DLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLAVLFLWSNASTFINKS  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I +   V  A   R  +N+       +G  RE       +A LW+LSV+ S
Sbjct  130  PP-NIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRELKKFLIVIAGLWILSVLGS  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  +   TVPV+Y KYE K++  G++ +++ ++YY++      E K +   
Sbjct  189  SCNFLTLFYIVFVALYTVPVLYEKYEDKVDALGEKAEIELKKYYALF-----EEKCLSKI  243

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  244  PKGPLKDK  251



>ref|XP_003568063.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=244

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 85/171 (50%), Gaps = 1/171 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +TA W+  E+  +  +T      +  +   F+W N    + K 
Sbjct  61   DLFLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLLCHCFILTLGILFLWSNASAFINKS  120

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I +  AV  A   R  +N+       +G  R+       +A LW LS + S
Sbjct  121  PP-NIPEVRIPEDLAVNVARSLRYEINRGFASLRDIGQGRDLKKFLIVIAGLWTLSALGS  179

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
              + LTL YI  +V  TVPV+Y KYE KI+  G++  ++ ++YY++  +K 
Sbjct  180  SCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAYGEKAMIELKKYYAIFDEKC  230



>ref|XP_010533622.1| PREDICTED: reticulon-like protein B4 [Tarenaya hassleriana]
Length=259

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 92/170 (54%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++  A+ ++TA WV  E+  +  +T     ++F +A  F+W N    + K 
Sbjct  72   DIFLWRNKKVSGGALGVATAAWVLFELLEYHLLTLVCHSSIFALAVLFLWSNASTFIHKT  131

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  VN+       + + R+       ++ LWVLS++ S
Sbjct  132  P-PRIPHVHIPEEPVIQLASGLRFEVNRGFTALRDIASGRDLKKFLVVISGLWVLSILGS  190

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + +TL YI  ++  TVPV+Y KYE +++  G++   + ++ Y+++ +K
Sbjct  191  CCNFVTLFYIATVLLFTVPVLYEKYEDQVDAFGEKAMKEIKKQYAVLDEK  240



>ref|XP_002869770.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46029.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=272

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 99/190 (52%), Gaps = 10/190 (5%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   +  +TA WV  E+  +  +T    V + V+A  F+W N    + K 
Sbjct  88   DIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKS  147

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + R+      A+A LWVLS++  
Sbjct  148  P-PKIPEVHIPEEPILQLASGLRIEINRGFSTLREIASGRDLKKFLIAIAGLWVLSILGG  206

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVP+ Y+KYE K++  G++  ++ ++ Y+++ +K       +L 
Sbjct  207  CFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEK-------VLS  259

Query  729  KT--GDLKNK  752
            K   G LKNK
Sbjct  260  KIPLGPLKNK  269



>ref|XP_004503660.1| PREDICTED: reticulon-like protein B2-like [Cicer arietinum]
Length=255

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/188 (26%), Positives = 100/188 (53%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   + ++TA+W+  E+  +  +T    +A+  +A  F+W N    + K 
Sbjct  71   DVFLWRNKKISATVLGVATASWILFELLEYHLLTLVCHLAILALAVLFLWSNASTFINKA  130

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P     +++I ++  ++ A   R  +N+       + + ++     + +A LWVLS++ S
Sbjct  131  P-PKIPQVHIPEEPVLQIAAALRIEINRVFAVLRDIASGKDLKKFLSVIAGLWVLSIVGS  189

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVPV+Y KYE +++  G++   ++++ Y++      + K +   
Sbjct  190  WANFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKALAEFKKQYAVF-----DAKVLSKI  244

Query  729  KTGDLKNK  752
              G LKNK
Sbjct  245  PKGALKNK  252



>emb|CDY10954.1| BnaA03g46130D [Brassica napus]
Length=270

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 99/190 (52%), Gaps = 10/190 (5%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   +  +TA WV  E+  +  +T    V + V+A  F+W N    + K 
Sbjct  86   DIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKS  145

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + R+      A+A LWV+S++  
Sbjct  146  P-PKIPEVHIPEEPILQLASGLRVEINRGFSSLREIASGRDLKKFLTAIAGLWVMSILGG  204

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVP+ Y+KYE K++  G++  ++ ++ Y+++ +K       +L 
Sbjct  205  WFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIEIKKQYAVLDEK-------VLS  257

Query  729  KT--GDLKNK  752
            K   G LKNK
Sbjct  258  KIPLGPLKNK  267



>ref|XP_009137373.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=268

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 99/190 (52%), Gaps = 10/190 (5%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   +  +TA WV  E+  +  +T    V + V+A  F+W N    + K 
Sbjct  84   DIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKS  143

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + R+     AA+A LW +S++  
Sbjct  144  P-PKIPEVHIPEEPILQLASGLRVEINRGFSSLREIASGRDLKKFLAAIAGLWFVSILGG  202

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVP+ Y+KYE K++  G++  ++ ++ Y+++ +K       +L 
Sbjct  203  WFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIEIKKQYAVLDEK-------VLS  255

Query  729  KT--GDLKNK  752
            K   G LKNK
Sbjct  256  KIPLGPLKNK  265



>gb|EAY75742.1| hypothetical protein OsI_03655 [Oryza sativa Indica Group]
Length=253

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 94/188 (50%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LW+ K+++   +  +TA W+  EI  +  +T      +  +A  F+W N    + K 
Sbjct  70   DLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNASTFIHKS  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I +   V  A   R  +N+       +G  R+       +A LW+LSV+ S
Sbjct  130  PP-NIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWILSVLGS  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  +   TVPV+Y KYE KI+  G++ +++ ++YY++      E K +   
Sbjct  189  SCNFLTLFYIVFVALYTVPVLYEKYEDKIDAFGEKAEIELKKYYALF-----EEKCLSKI  243

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  244  PKGPLKDK  251



>emb|CDY24806.1| BnaA08g15040D [Brassica napus]
Length=274

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 101/190 (53%), Gaps = 10/190 (5%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   +  +TA WV  E+  +  +T    V + V+A  F+W N    + K 
Sbjct  90   DIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFIHKS  149

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + R+     +A+A LWVLS++  
Sbjct  150  P-PKIPEVHIPEEPVLQLASGLRIEINRGFYSLREIASGRDLKKFISAIAGLWVLSILGG  208

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVP++Y+KYE K++  G++  ++ ++ Y+++ +K       +L 
Sbjct  209  WFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEK-------VLS  261

Query  729  KT--GDLKNK  752
            K   G LKNK
Sbjct  262  KIPLGPLKNK  271



>ref|XP_001754332.1| predicted protein [Physcomitrella patens]
 gb|EDQ80782.1| predicted protein [Physcomitrella patens]
Length=220

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 90/174 (52%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LWK +  ++A +V ST  W  LE   +T +T  S + MF +A  F+W N+  LL + 
Sbjct  36   DVFLWKDRNTSVAVLVGSTLLWCLLEKSGYTLLTLLSNIFMFSLAILFVWANVSSLLNRA  95

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
                     +S    ++TA   R  +N+++ F+  +    ++ +    V  LWV+S +AS
Sbjct  96   -GPPVPEFSLSDDFVMRTASCVRDELNKALRFSRNVALGNDFKLFFKVVTLLWVVSTVAS  154

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              +LLTL++IG ++   VP +Y+KYE  I+           V +++    VLQK
Sbjct  155  WFNLLTLIWIGVILLHVVPFVYDKYEDIIDHHASNAFHAANVHFKKLDDAVLQK  208



>gb|KFK31901.1| hypothetical protein AALP_AA6G173800 [Arabis alpina]
Length=259

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 97/188 (52%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK+K+++      +T  WV  E+  +  +T  S V + ++A  F+W N    + K 
Sbjct  75   DIFMWKKKKMSGGVFGGATVAWVLFELMEYHLLTLLSHVMILLLAVLFLWSNATMFIHKS  134

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P     +++I ++  ++ A   R  +N+       + + R+     + +A LWVLS++  
Sbjct  135  PPK-IPQLHIPEEPLLQLASGLRIEINRGFSSLHEIASGRDLKKFLSVIAGLWVLSILGG  193

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
                LTL YI  ++  TVP++Y+KYE K++  G++  ++ ++ Y++      + K +   
Sbjct  194  CCSFLTLAYIALVLLFTVPLLYDKYEDKVDPYGEKAMLELKKQYAVF-----DAKVLSKI  248

Query  729  KTGDLKNK  752
              G LKNK
Sbjct  249  PMGPLKNK  256



>gb|ABB51093.1| reticulon [Hordeum vulgare]
Length=204

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 85/170 (50%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLWK K+     I  +T  WV  E+  +  +T  S V + V+A  F+W      + K 
Sbjct  21   DVLLWKNKKTTAVVIGGTTVIWVLFEVLDYHLLTLLSHVMIGVLAILFVWSKAMTFIKKS  80

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  D   + I +  AV  +   R  VN+S+     +    +       +A LWVLS + S
Sbjct  81   P-PDIPVVEIPEDLAVNVSRALRNDVNRSLHLFREIAMGHDLKKFLGVIAGLWVLSEVGS  139

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              D LTL+YI  L+  TVP++Y+KY+ K++    +   +  ++Y ++ QK
Sbjct  140  CCDFLTLIYIAVLMIHTVPILYDKYQDKVDHFAGKAHTEACKHYEVLDQK  189



>gb|KHN15986.1| Reticulon-like protein B5, partial [Glycine soja]
Length=242

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/170 (25%), Positives = 92/170 (54%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+++ + + ++TA W+  E+  +  +T    +++ V+A  F+W N    + K 
Sbjct  58   DVLLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTFIHKA  117

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +++ ++   + A      +N+       +G+ R+       +   W++S++ S
Sbjct  118  PPC-IPTVHLPEEPIRQFASALTIEINRGFAALHAIGSGRDLKTFLIIIVGTWIISIVGS  176

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL YI  ++  TVPVIY+KYE KI+   ++  +++++ Y++  +K
Sbjct  177  WCNFLTLFYIVFVLLHTVPVIYDKYEDKIDPLAEKALIEFKKQYAVFDEK  226



>gb|EAY98759.1| hypothetical protein OsI_20691 [Oryza sativa Indica Group]
Length=251

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 88/171 (51%), Gaps = 1/171 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K++++  +  +TA W+  E+  +  +T      +  +A  F+W N    + K 
Sbjct  68   DLFLWRNKKISVGVLTGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWSNASTFINKS  127

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I +  AV  A   R  +N+       +G   +       VA LWVLSV+ S
Sbjct  128  P-PNIPEVKIPEDLAVNVARSVRFEINRGFATLREIGLGHDLKKFLIVVAGLWVLSVLGS  186

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
              + LTL YI  +V  TVPV+Y KYE +I+  G++  ++ ++YY++  +K 
Sbjct  187  CCNFLTLFYIVFMVLYTVPVLYEKYEDQIDAFGEKAVIELKKYYAIFDEKC  237



>ref|NP_001241367.1| uncharacterized protein LOC100796111 [Glycine max]
 gb|ACU22605.1| unknown [Glycine max]
Length=256

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/170 (25%), Positives = 92/170 (54%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+++ + + ++TA W+  E+  +  +T    +++ V+A  F+W N    + K 
Sbjct  72   DVLLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTFIHKA  131

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +++ ++   + A      +N+       +G+ R+       +   W++S++ S
Sbjct  132  PPC-IPTVHLPEEPIRQFASALTIEINRGFAALHAIGSGRDLKTFLIIIVGTWIISIVGS  190

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL YI  ++  TVPVIY+KYE KI+   ++  +++++ Y++  +K
Sbjct  191  WCNFLTLFYIVFVLLHTVPVIYDKYEDKIDPLAEKALIEFKKQYAVFDEK  240



>dbj|BAJ89699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 87/171 (51%), Gaps = 1/171 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+++   +  +TA W+  E+  +  +T      +  +   F+W N    + K 
Sbjct  73   DLLLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAFVNKC  132

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I +  AV  A   R  +N+       +G  R+       VA LW+LS + S
Sbjct  133  PP-NIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDLKKFLIVVAGLWILSALGS  191

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
              + LTL YI  +V  TVPV+Y KYE KI+  G++  V+ ++YY++  +K 
Sbjct  192  SCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKC  242



>gb|EMT18983.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=225

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 86/171 (50%), Gaps = 1/171 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +TA W+  E+  +  +T      +  +   F+W N    + K 
Sbjct  41   DLFLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAFVNKC  100

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I +  AV  A   R  +N+       +G  R+       VA LW+LS + S
Sbjct  101  PP-NIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDLKKFLIVVAGLWILSFLGS  159

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
              + LTL YI  +V  TVPV+Y KYE KI+  G++  V+ ++YY++  +K 
Sbjct  160  CCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKC  210



>ref|XP_009112901.1| PREDICTED: reticulon-like protein B3 [Brassica rapa]
Length=251

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 91/170 (54%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +T +W+  E+ ++  +T    V++  +A  F+W +    + K+
Sbjct  64   DIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWSSATTFIHKK  123

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++ A++ A   R  +N+       +   RE       VA LWVLS + S
Sbjct  124  P-PHIPEVHIPEEVALQLASGLRIEINRGFTILRNIALGRELKKFLMVVAGLWVLSKVGS  182

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL+YI  ++  TVPV Y KYE K++  G++   + ++ Y+++ +K
Sbjct  183  SCNFLTLIYIATVLLFTVPVFYEKYEDKVDHFGEKAMKEIKKQYAVLDEK  232



>ref|XP_010023623.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 ref|XP_010023624.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 ref|XP_010023625.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 ref|XP_010023626.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 ref|XP_010023628.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 ref|XP_010023629.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 ref|XP_010023630.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
Length=298

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/166 (27%), Positives = 81/166 (49%), Gaps = 4/166 (2%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+++   +  +TA WV LE   + F+T   +  +  + A F+W N+  LL   
Sbjct  64   DVLLWRNKKISAGVLAGATAIWVLLEWLDYHFLTLVCFALILGMLALFLWSNVSGLLSSR  123

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEF--TLRLGAEREWYvvaaavaalwvlsvi  542
             A+   R+ +     V         VNQ+++F   + LG   + +++         +   
Sbjct  124  SASKPPRLVVPNDVFVDIGKSVGAEVNQALKFLQDVALGGNLKQFLMVVGSLWAAAIIGG  183

Query  543  asHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYY  680
                + +T+LYIG   G T+PV+Y +YE ++N  G ++  Q +  Y
Sbjct  184  L--CNFITVLYIGFAAGHTLPVLYERYEDQVNSFGDQVLDQLQHLY  227



>ref|XP_009109295.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=269

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 100/190 (53%), Gaps = 14/190 (7%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++  A    TA WV  E+  +  +T    V + V+A  F+W N    + K 
Sbjct  89   DIFMWKDKKMSGGA----TAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFIHKS  144

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + R+     +AVA LWVLS++  
Sbjct  145  PP-KIPEVHIPEEPVLQLASGLRIEINRGFHSLREIASGRDLKKFISAVAGLWVLSILGG  203

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVP++Y+KYE K++  G++  ++ ++ Y+++ +K       +L 
Sbjct  204  WFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEK-------VLS  256

Query  729  KT--GDLKNK  752
            K   G LKNK
Sbjct  257  KIPLGPLKNK  266



>emb|CDP12094.1| unnamed protein product [Coffea canephora]
Length=252

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 89/174 (51%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ +W+ K+++   + ++TA WV  EI  +  +T      + V+A  F+W N    + K 
Sbjct  68   DVFMWRNKQISAGVLGVATAIWVLFEILEYHLLTLVCHGLIIVLAVLFLWSNASTFINKS  127

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + + ++  ++ A   R  +NQ+      + + R      + +A LW+ S++ S
Sbjct  128  PPR-IPEVSVPEKPVLQFASDARVAINQTFALLRDVASGRNLKKFLSVIAGLWIFSILGS  186

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              D LTLLYI  ++  TVPVIY+KYE +++   ++    LK QY  +   VL K
Sbjct  187  CCDFLTLLYISAVLLHTVPVIYDKYEDQVDSFAEKALAELKKQYAVFDKKVLSK  240



>ref|XP_010055800.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW72349.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=262

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 88/170 (52%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++  A+ ++TA W+  E+  +  +T    V +  +A  F+W N    + K 
Sbjct  78   DVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNATTFIHKM  137

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + I ++  ++ A V    +NQ +     + + R+       VA  WV S++ S
Sbjct  138  P-PHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLVVAVFWVFSIVGS  196

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL YI  ++  TVPV+Y KYE K++   ++  ++ ++ Y++  +K
Sbjct  197  CCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDEK  246



>ref|XP_003528823.2| PREDICTED: reticulon-like protein B1-like [Glycine max]
Length=314

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/170 (25%), Positives = 92/170 (54%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+++   + ++TA W+  E+  +  +T    +++ ++A  F+W N    + K 
Sbjct  130  DVLLWRNKKISAGVLGVATAIWIFFELLEYHLLTLVCHISILLLAVLFLWSNAHTFIHKA  189

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A      +N+       +G+ R+       +   W++S++ S
Sbjct  190  P-PRIPVVHIPEEPILQFASALTIEINRGFAALRAIGSGRDLKTFLIVIVGTWIISIVGS  248

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL YI  ++  TVPV+Y+KYE KI+   ++  V++++ Y++  +K
Sbjct  249  WCNFLTLFYIAFVLLHTVPVLYDKYEDKIDPLAEKALVEFKKQYAVFDEK  298



>gb|AFK34557.1| unknown [Medicago truncatula]
 gb|KEH18780.1| seed maturation protein [Medicago truncatula]
Length=267

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 98/190 (52%), Gaps = 2/190 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LWK K+L+   +  +TA WV  E+  + F+T    +++ V+A  F+W N    + K 
Sbjct  80   DVFLWKNKKLSAGTLATATAIWVFFELLEYHFLTLICHISILVLALLFLWSNAHTFVHKT  139

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +++ ++  ++ A   R  +N+       +G  ++       +  LW+LS++ S
Sbjct  140  P-PHIPIVHLPEEPFLQIASALRIEINRGFSALRDIGTGKDVKKFLIVIFGLWILSIVGS  198

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVP +Y+KYE KI+   ++  ++ ++ Y++  +K    K +   
Sbjct  199  WSNFLTLFYITFVLLFTVPFVYDKYEDKIDPLAEKAFIEIKKQYAVFDEKVLS-KVLSKI  257

Query  729  KTGDLKNKVS  758
              G LK K++
Sbjct  258  PKGVLKGKLA  267



>emb|CDM81762.1| unnamed protein product [Triticum aestivum]
Length=253

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 98/189 (52%), Gaps = 8/189 (4%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LW+ K+++   +  +TA W+  EI  +  +T      +  +A  F++ N+   + K 
Sbjct  70   DLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVGHCLILSLATLFLYSNVCIFVHKS  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLR-LGAEREWYvvaaavaalwvlsvia  545
            P  +   + I +   V  A   R  +N+   FTLR +G  R+       +  LWVLSV+ 
Sbjct  130  PP-NIPEVKIPEDMTVNIALSLRHEINRGF-FTLREIGHGRDLKKFLIVIGGLWVLSVLG  187

Query  546  sHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMML  725
            S  + LTL YI  +V  TVPV+Y KY+ K++  G++  ++ ++YY++      E K +  
Sbjct  188  SCCNFLTLSYIVFVVLYTVPVLYEKYDDKVDAFGEKAMIELKKYYAIF-----EEKVLSK  242

Query  726  QKTGDLKNK  752
               G LKNK
Sbjct  243  IPKGALKNK  251



>gb|ACU23452.1| unknown [Glycine max]
Length=253

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 95/188 (51%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++ + + ++TA WV  E+  +  +T      +  +A  F+W N    + K 
Sbjct  69   DVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILALAGLFLWSNASTFINKS  128

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P     +++I ++  +K A   R  +N++      + + R+     + +A LWV S++  
Sbjct  129  P-PKIPQVHIPEEPVLKFASALRIEINRAFAVLRDIASGRDLKKFLSVIAGLWVFSILGC  187

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVPV+Y KYE  ++  G++   + ++ Y++      + K +   
Sbjct  188  WANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGEKAIAEIKKQYAVF-----DAKVLSKI  242

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  243  PRGPLKDK  250



>gb|KCW72347.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=265

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 88/170 (52%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++  A+ ++TA W+  E+  +  +T    V +  +A  F+W N    + K 
Sbjct  78   DVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNATTFIHKM  137

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + I ++  ++ A V    +NQ +     + + R+       VA  WV S++ S
Sbjct  138  P-PHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLVVAVFWVFSIVGS  196

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL YI  ++  TVPV+Y KYE K++   ++  ++ ++ Y++  +K
Sbjct  197  CCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDEK  246



>ref|XP_009341126.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 89/166 (54%), Gaps = 1/166 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   ++ +TA WV  E+  +  +T   ++ +  +A  F+W N    + K 
Sbjct  78   DVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICALAILFLWSNAHAFIHKT  137

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P     ++++ ++  ++ A   R  +N        + + R+     A +A LWVLSV+  
Sbjct  138  P-PHIPKVHLPEEPFLQVASELRVQINCGFALLHDIASGRDLKKFLAVIAGLWVLSVVGK  196

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSM  686
              + LTL YI  ++  TVPVIY KYE KI+   ++  +++++ Y++
Sbjct  197  WCNFLTLFYICFVLLHTVPVIYEKYEDKIDPLAEKATIEFKKQYAV  242



>ref|XP_003525365.1| PREDICTED: reticulon-like protein B2-like isoform 1 [Glycine 
max]
 gb|KHM99936.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 95/188 (51%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++ + + ++TA WV  E+  +  +T      +  +A  F+W N    + K 
Sbjct  70   DVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILALAGLFLWSNASTFINKS  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P     +++I ++  +K A   R  +N++      + + R+     + +A LWV S++  
Sbjct  130  P-PKIPQVHIPEEPVLKFASALRIEINRAFAVLRDIASGRDLKKFLSVIAGLWVFSILGC  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVPV+Y KYE  ++  G++   + ++ Y++      + K +   
Sbjct  189  WANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGEKAIAEIKKQYAVF-----DAKVLSKI  243

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  244  PRGPLKDK  251



>ref|XP_001759351.1| predicted protein [Physcomitrella patens]
 gb|EDQ75653.1| predicted protein [Physcomitrella patens]
Length=240

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 97/183 (53%), Gaps = 5/183 (3%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            + D  LW+ + L+   +  ST  W+ LE   +TF+T    + +FVV   F+W N+  L+ 
Sbjct  55   VADSALWRDRYLSGGTLGGSTLLWILLEKSGYTFLTLVCNILLFVVVILFVWSNVATLIN  114

Query  363  KEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvi  542
            + P      + +S+   + TA++ R  VN+++     +   +++ +    VA+L+V+S++
Sbjct  115  R-PGPPVPELSLSENFVMNTANLIRIEVNKALHIARTVALGKDFKLFLLVVASLYVVSIV  173

Query  543  asHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQKSSEL  710
             S  +LLT ++IG +    VP I++KYE  I+   Q+      VQYR+    +L+K    
Sbjct  174  GSWFNLLTCVWIGIVWFHVVPFIFDKYEDVIDHHAQKASEAASVQYRKLDDAILRKIPRA  233

Query  711  KTM  719
             +M
Sbjct  234  PSM  236



>gb|KDO56851.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=255

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 99/188 (53%), Gaps = 2/188 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +TA WV  E+  +  IT    +++  +A  F+W N    + K 
Sbjct  69   DIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKS  128

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + + ++  ++ A   R  +N+++     + + R+       +A LW+LS++ +
Sbjct  129  P-PEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSIVGN  187

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + +TL YI  ++  TVPVIY KYE KI+  G++  ++ ++ Y++  +K  + K +   
Sbjct  188  WCNFVTLFYIVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEKVLK-KVLSRI  246

Query  729  KTGDLKNK  752
              G LK K
Sbjct  247  PKGALKKK  254



>gb|KCW72348.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=296

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 88/170 (52%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++  A+ ++TA W+  E+  +  +T    V +  +A  F+W N    + K 
Sbjct  78   DVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNATTFIHKM  137

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + I ++  ++ A V    +NQ +     + + R+       VA  WV S++ S
Sbjct  138  P-PHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLVVAVFWVFSIVGS  196

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL YI  ++  TVPV+Y KYE K++   ++  ++ ++ Y++  +K
Sbjct  197  CCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDEK  246



>dbj|BAJ94514.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95784.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=260

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 85/170 (50%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLWK K+     I  +T  WV  E+  +  +T  S V + V+A  F+W      + K 
Sbjct  77   DVLLWKDKKTTAVVIGGTTVIWVLFEVLDYHLLTLLSHVMIGVLAILFVWSKAMTFIKKS  136

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  D   + I +  AV  +   R  VN+S+     +    +       +A LWVLS + S
Sbjct  137  P-PDIPVVEIPEDLAVNVSRALRNDVNRSLHLFREIAMGHDLKKFLGVIAGLWVLSEVGS  195

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              D LTL+YI  L+  TVP++Y+KY+ K++    +   +  ++Y ++ QK
Sbjct  196  CCDFLTLIYIAVLMIHTVPILYDKYQDKVDHFAGKAHTEACKHYEVLDQK  245



>ref|XP_006422079.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 ref|XP_006490603.1| PREDICTED: reticulon-like protein B3-like [Citrus sinensis]
 gb|ESR35319.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=255

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 99/188 (53%), Gaps = 2/188 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +TA WV  E+  +  IT    +++  +A  F+W N    + K 
Sbjct  69   DIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINKS  128

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + + ++  ++ A   R  +N+++     + + R+       +A LW+LS++ +
Sbjct  129  P-PEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSIVGN  187

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + +TL YI  ++  TVPVIY KYE KI+  G++  ++ ++ Y++  +K  + K +   
Sbjct  188  WCNFVTLFYIVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEKVLK-KVLSRI  246

Query  729  KTGDLKNK  752
              G LK K
Sbjct  247  PKGALKKK  254



>gb|EMS50148.1| Reticulon-like protein B2 [Triticum urartu]
Length=235

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 85/170 (50%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLWK K+     I  +T  WV  E+  +  +T  S V + V+A  F+W      + K 
Sbjct  52   DVLLWKDKKTTAVVIGGTTVIWVLFEVLDYHLLTLLSHVMIGVLAILFVWSKAMTFIKKS  111

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  D   + I +  AV  +   R  VN+S+     +    +       +A LWVLS + S
Sbjct  112  P-PDIPVVEIPEDLAVNVSRALRSDVNRSLHLLREIAMGHDLKKFLGVIAGLWVLSEVGS  170

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              D LTL+YI  L+  TVP++Y+KY+ K++    +   +  ++Y ++ QK
Sbjct  171  CCDFLTLIYIAVLMIHTVPILYDKYQDKVDHFAGKAHTEACKHYEVLDQK  220



>ref|XP_010422067.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=265

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 93/188 (49%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   I  +T  WV  E+  +  +T    V +  +A  F+W N    + K 
Sbjct  81   DIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKS  140

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + R+     +A+  LWVLS++  
Sbjct  141  P-PKIPEVHIPEEPLLQLASGLRIEINRGFSSLHEIASGRDIKKFLSAIFGLWVLSILGG  199

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
                LTL YI  ++  TVP+IY+KYE KI+  G++   + ++ Y++      + K +   
Sbjct  200  CCSFLTLAYIALVLLFTVPLIYDKYEDKIDPYGEKAMAELKKQYAVF-----DAKVLSKI  254

Query  729  KTGDLKNK  752
              G LKNK
Sbjct  255  PRGPLKNK  262



>ref|XP_010547982.1| PREDICTED: reticulon-like protein B10 isoform X1 [Tarenaya hassleriana]
Length=208

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 92/178 (52%), Gaps = 5/178 (3%)
 Frame = +3

Query  177  ATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRL  356
             ++ D+LLW+ +R  +  +  +T  W   E   + F++  + V +  V   F+W     L
Sbjct  19   GSVADLLLWRNRRGAVLLLGSATLFWFLFEKAGYNFLSFVANVQLLFVVILFLWAKSASL  78

Query  357  LGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvls  536
            L + P      + IS+ SA+K +D  +  +N+++     +   R    +      LW++S
Sbjct  79   LNR-PMPPLPSLEISEASALKVSDALQVWLNRALSVAHDIAVGRNVKSLFQVSFVLWMVS  137

Query  537  viasHLDLLTLLYIGELVGLTVPVIYNKYEQKINE----SGQRLKVQYRRYYSMVLQK  698
            ++    + LTLLY+G ++ L+VPV+Y +Y+  I++    + + L+ QYR+    +LQK
Sbjct  138  LLGYFFNFLTLLYLGAILSLSVPVLYERYQDNIDDKLSVTHRVLQTQYRKIDETLLQK  195



>gb|EMS62606.1| Reticulon-like protein B1 [Triticum urartu]
Length=248

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 86/171 (50%), Gaps = 1/171 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +TA W+  E+  +  +T      +  +   F+W N    + K 
Sbjct  64   DLFLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAFVNKC  123

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I +  AV  A   R  +N+       +G  R+       VA LW+LS + S
Sbjct  124  PP-NIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDLKKFLIVVAGLWILSFLGS  182

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
              + LTL YI  +V  TVPV+Y KYE KI+  G++  V+ ++YY++  +K 
Sbjct  183  CCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKC  233



>ref|XP_003592173.1| Reticulon family protein [Medicago truncatula]
 gb|AES62424.1| seed maturation protein [Medicago truncatula]
Length=250

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 85/170 (50%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DILLW+ K+    A+   TA WV  E+ ++  IT    + +  +AA F+W N    + K 
Sbjct  69   DILLWRNKKCTAIALGAGTALWVFFELMQYNLITLVCHLMILALAALFLWSNASVFIHKS  128

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + I Q+   + A V R  +NQ       +G  R+       +A LW +SVI S
Sbjct  129  P-LQIPHVVIPQECVFEAASVLRIEINQVFAILREIGTGRDIKKFLTVIAGLWFISVIGS  187

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL YI  +   T+P++Y K E +++   ++  ++ ++ Y+++  K
Sbjct  188  CFNFLTLFYIFYVSLFTLPLVYEKNEDQVDALAEKAMIEIKKQYAVLDAK  237



>emb|CDY48222.1| BnaA07g03850D [Brassica napus]
Length=203

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 96/191 (50%), Gaps = 10/191 (5%)
 Frame = +3

Query  174  TATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDR  353
             A++ D+++WK KR  I  +  +T  W+  E   ++F    + + + VV   F+W     
Sbjct  13   NASVADLVMWKNKRGGILLLGSATLFWILFEKCGYSFFPFVANIQLLVVIILFLWAK-SA  71

Query  354  LLGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvl  533
            +L   P  +   + I++ S +  AD  R  +N  +     +   R    +      LW +
Sbjct  72   ILFNRPMPELPNLEITEASLLMIADPLRLLINTLLSIARDIYVNRNAKQLFRVSVVLWTI  131

Query  534  sviasHLDLLTLLYIGELVGLTVPVIYNKYEQKINE----SGQRLKVQYRRYYSMVLQK-  698
            S++ S L+  T+LY+G ++G+ +P++Y +Y+  I+E    + + ++ QYR+    +LQK 
Sbjct  132  SLVGSFLNFFTILYLGIVLGMLIPILYERYQHHIDEKLSVTHRMIQTQYRKIDERLLQKL  191

Query  699  ----SSELKTM  719
                +S++K M
Sbjct  192  IAKPTSKIKKM  202



>gb|EMT25698.1| Reticulon-like protein B2 [Aegilops tauschii]
Length=258

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 85/170 (50%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLWK K+     I  +T  WV  E+  +  +T  S V + V+A  F+W      + K 
Sbjct  75   DVLLWKDKKTTAVVIGGTTVIWVLFEVLDYHLLTLLSHVMIGVLAILFVWSKAMTFIKKS  134

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  D   + I +  A+  +   R  VN+S+     +    +       +A LWVLS + S
Sbjct  135  P-PDIPVVEIPEDLALNVSRALRNDVNRSLHLLREIAMGHDLKKFLGVIAGLWVLSEVGS  193

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              D LTL+YI  L+  TVP++Y+KY+ K++    +   +  ++Y ++ QK
Sbjct  194  CCDFLTLIYIAVLMIHTVPILYDKYQDKVDHFAGKAHTEACKHYQVLDQK  243



>ref|XP_009104316.1| PREDICTED: reticulon-like protein B6 [Brassica rapa]
 emb|CDY53913.1| BnaA07g38210D [Brassica napus]
Length=254

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 87/164 (53%), Gaps = 1/164 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+L+ A + ++TA WV  E+  + F++    + +F +AA F+W N    + K 
Sbjct  71   DVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFSLAAMFLWSNAHAFMKKS  130

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + + ++  +  A   R  +NQ+      +   R+       V  LW++SV+ +
Sbjct  131  P-PKIPEIQVKEEHFLLIASALRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGN  189

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYY  680
              + LTL+YI  +V  TVP++Y K+E K++   ++   + +++Y
Sbjct  190  WFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHY  233



>ref|XP_010529625.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 93/170 (55%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +W+ K+++ + +   TA WV  E+  +  +T    V + V+A  F+W N    + K 
Sbjct  83   DIFMWRNKKMSASVLGGITAVWVLFELAEYHLLTLLCHVLIAVIAVLFLWSNASMFIHKS  142

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N++      + + R+     +A+A LWVLS++  
Sbjct  143  P-PKIPEVHIPEEPILQLASGLRIEINRAFTCLRDIASGRDLKKFLSAIAGLWVLSILGG  201

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL YI  ++  T+PV+Y KYE K++  G++  V+ ++ Y+++ +K
Sbjct  202  CCNFLTLSYIAMVMLFTIPVLYEKYEDKVDAYGEKAMVEIKKQYAVLDEK  251



>ref|XP_009123150.1| PREDICTED: reticulon-like protein B10 [Brassica rapa]
Length=203

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 95/191 (50%), Gaps = 10/191 (5%)
 Frame = +3

Query  174  TATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDR  353
             A++ D+++WK KR  I  +  +T  W+  E   ++F    + + + VV   F+W     
Sbjct  13   NASVADLVMWKNKRGGILLLGSATLFWILFEKCGYSFFPFVANIQLLVVVILFLWAK-SA  71

Query  354  LLGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvl  533
            +L   P  +     I++ S +  AD  R  +N  +     +   R    +      LW +
Sbjct  72   ILFNRPMPELPNFEITEASLLMVADPLRLLINTLLSIARDIYVNRNAKQLFRVSVVLWTI  131

Query  534  sviasHLDLLTLLYIGELVGLTVPVIYNKYEQKINE----SGQRLKVQYRRYYSMVLQK-  698
            S++ S L+  T+LY+G ++G+ +P++Y +Y+  I+E    + + ++ QYR+    +LQK 
Sbjct  132  SLVGSFLNFFTILYLGIVLGMLIPILYERYQHHIDEKLSVTHRMIQTQYRKIDERLLQKL  191

Query  699  ----SSELKTM  719
                +S++K M
Sbjct  192  IAKPTSKIKKM  202



>ref|XP_009603458.1| PREDICTED: reticulon-like protein B11 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009603459.1| PREDICTED: reticulon-like protein B11 isoform X1 [Nicotiana tomentosiformis]
Length=204

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 92/180 (51%), Gaps = 9/180 (5%)
 Frame = +3

Query  177  ATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRL  356
             T+ D+LLW+R+  ++  +V ST  W   E   +  ++  + V + +V   F WG    L
Sbjct  16   GTVADVLLWRRQCASVTLLVSSTVLWFLFERAGYNLLSFIANVMLLLVVILFFWGKSASL  75

Query  357  LGKE--PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwv  530
            L +   P  D   M + ++  VK AD+ R  VN  +     +       +       LW+
Sbjct  76   LNRSLPPIPD---MEVPEEFVVKAADMMRVWVNHILLTAHDIAISGNLKLFGWVALGLWL  132

Query  531  lsviasHLDLLTLLYIGELVGLTVPVIYNKYEQKINE---SGQR-LKVQYRRYYSMVLQK  698
            +S + S   LLTLLYIG L  L+VP++Y KY+ +I++   + Q+ ++ QYR+    VL+K
Sbjct  133  ISYVGSFFTLLTLLYIGTLFSLSVPLLYEKYQNQIDDKLITAQKVIQKQYRKIDENVLRK  192



>ref|XP_010455527.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=268

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 92/188 (49%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   I  +T  WV  E+  +  +T    V +  +A  F+W N    + K 
Sbjct  84   DIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKS  143

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I +   ++ A   R  +N+       + + R+     +A+  LWVLS++  
Sbjct  144  P-PKIPEIHIPEDPLLQLASGLRIEINRGFSSLHEIASGRDIKKFLSAIFGLWVLSILGG  202

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
                LTL YI  ++  TVP+IY+KYE KI+  G++   + ++ Y++      + K +   
Sbjct  203  CCSFLTLAYIALVLLFTVPLIYDKYEDKIDPYGEKAMAELKKQYAVF-----DAKVLSKI  257

Query  729  KTGDLKNK  752
              G LKNK
Sbjct  258  PRGPLKNK  265



>ref|XP_008437352.1| PREDICTED: reticulon-like protein B2 [Cucumis melo]
Length=257

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 95/188 (51%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+L+   +  +T  W+  E+  + F+T    + M  +A  F+W N    + K 
Sbjct  73   DIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNASFFINKS  132

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
                  +++I +   ++ A   R  +N+++     + + R+      A+A LWVLS++ S
Sbjct  133  -LPHIPQVHIPEDPVIEIASALRVEINRAIAVLRDIASGRDLKSFLYAIAGLWVLSILGS  191

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTLLYIG +V  TVPV Y KY+ K++   ++   + ++ Y +      + K +   
Sbjct  192  WFNFLTLLYIGVIVLFTVPVFYEKYDDKVDAFAEKAMAEIKKQYVVF-----DAKVLSKI  246

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  247  PRGPLKDK  254



>ref|XP_010523772.1| PREDICTED: reticulon-like protein B5 [Tarenaya hassleriana]
Length=253

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 92/174 (53%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+L+ A +  +TA WV  E+  +  ++    +++  +A  F+W N    + K 
Sbjct  70   DVLLWRDKKLSAAVLGTTTAVWVLFELVEYHLLSFVCHISILTLAVLFLWSNAHSFINKS  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++++++  +  A   R  VN +      +   ++   +   VA LWV+S++ S
Sbjct  130  P-PQIPEIHVAEEPFLLIASAIRNEVNHAFTVLRNIALGKDLKKLLKVVAGLWVISIVGS  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYS----MVLQK  698
               LLTL+YI  +V  TVPV+Y K E K++   ++  ++ ++ YS    MVL K
Sbjct  189  WCHLLTLIYICVVVLHTVPVLYEKNEDKVDPMAEKAFIELKKQYSVLDEMVLSK  242



>ref|XP_009345612.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009345624.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/166 (27%), Positives = 89/166 (54%), Gaps = 1/166 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   ++ +TA WV  E+  +  +T   ++ +  +A  F+W N    + K 
Sbjct  78   DVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICALAILFLWSNAHAFIHKT  137

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P     ++++ ++  ++ A   R  +N        + + R+     A +A LWVLSV+  
Sbjct  138  P-PHIPKVHLPEEPFLQVASELRVQINCGFALLHDIASGRDLKKFLAVIAGLWVLSVVGK  196

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSM  686
              + LTL YI  ++  TVPVIY +YE KI+   ++  +++++ Y++
Sbjct  197  WCNFLTLFYICFVLLHTVPVIYERYEDKIDPLAEKATIEFKKQYAV  242



>ref|NP_001149653.1| LOC100283279 [Zea mays]
 gb|ACG36248.1| seed maturation protein [Zea mays]
 gb|ACN31840.1| unknown [Zea mays]
 tpg|DAA57749.1| TPA: Seed maturation protein isoform 1 [Zea mays]
 tpg|DAA57750.1| TPA: Seed maturation protein isoform 2 [Zea mays]
Length=257

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 87/171 (51%), Gaps = 1/171 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LW+ ++++   +  +TA W+  E+  +  +T      +  +A  F+W N    + K 
Sbjct  74   DLILWRNRKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLAILFLWSNASTFINKS  133

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I +  AV  A   R  +N+       +G  R+       +A LW+LSV+ S
Sbjct  134  PP-NIPEVKIPEDVAVNVALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWLLSVLGS  192

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
              + LTL YI  +   TVPV+Y KYE K++  G++   + ++YY++  +K 
Sbjct  193  CCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAMTELKKYYAIFDEKC  243



>ref|XP_010530740.1| PREDICTED: reticulon-like protein B10 isoform X5 [Tarenaya hassleriana]
Length=210

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 92/179 (51%), Gaps = 6/179 (3%)
 Frame = +3

Query  177  ATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRL  356
             ++ D+LLW+++R  +  +  ST  W   E   ++F++  + V +  V   F+W     L
Sbjct  21   GSVADLLLWRKRRGPVLLLGSSTLLWFLFEKAGYSFLSFVANVQLLFVVILFLWAKSASL  80

Query  357  LGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvls  536
            L + P      + IS+ SA+K AD  R  +N+ +     +   R    +      LW LS
Sbjct  81   LDR-PMPPLPNLEISEASALKVADALRVWLNRVLSVARDIAVGRNVKRLFQVSFVLWSLS  139

Query  537  viasHLDLLTLLYI-GELVGLTVPVIYNKYEQKINES---GQR-LKVQYRRYYSMVLQK  698
            ++ +  + LTLLY+ G ++ L++PV+Y KY+  I++     QR L+ Q RR    +LQK
Sbjct  140  LLGNFFNFLTLLYLAGVILSLSIPVLYEKYQDNIDDKLSVTQRVLQTQCRRIDESILQK  198



>ref|XP_010558054.1| PREDICTED: reticulon-like protein B16 isoform X5 [Tarenaya hassleriana]
Length=226

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 91/167 (54%), Gaps = 1/167 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW++  L++  IV+ST  W+  E+     ++  S V + +V   FI   I     K+
Sbjct  43   DLLLWRKGHLSLGVIVLSTVAWLIFELSGLPVLSVCSDVLLILVIVSFIHSRIAAFRNKQ  102

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P +    + +S++     A  FR  +N S+     +    ++ +    V  LW+LSV+ S
Sbjct  103  PKS-LPELVLSEEMVNSAAASFRVKLNNSLLMAHNITVGNDFKLFFKVVILLWLLSVVGS  161

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMV  689
            ++   TL YIG +V +TVPV+Y++Y++++++    +  ++ R+Y +V
Sbjct  162  YISFFTLAYIGTIVSVTVPVMYSRYQKEVDKCCGMIHRKFSRHYKVV  208



>ref|XP_006291739.1| hypothetical protein CARUB_v10017909mg [Capsella rubella]
 gb|EOA24637.1| hypothetical protein CARUB_v10017909mg [Capsella rubella]
Length=249

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 86/164 (52%), Gaps = 1/164 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+L+ A + ++TA WV  E+  + F++    + +F +A  F+  N    + K 
Sbjct  66   DVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFALAVLFLLSNAHAFMNKT  125

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  +  A   R  +NQ+      +   R+       V  LWV+SV+ +
Sbjct  126  P-PKIPEIHIKEEHFILIASALRNELNQAFVILRSIALGRDLKKFLMVVVGLWVISVVGN  184

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYY  680
              + LTLLYI  +V  TVP++Y K+E K++   ++   + +++Y
Sbjct  185  WFNFLTLLYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHY  228



>ref|XP_009598008.1| PREDICTED: reticulon-like protein B2, partial [Nicotiana tomentosiformis]
Length=197

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 89/174 (51%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +TA WV  E+  + F+T      +  +A  F+W N    + K 
Sbjct  13   DVFLWRNKKISAGFLGGATAIWVLFEVVEYHFLTLLCHCLIVALAGLFLWSNASAFIHKS  72

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
             A     ++I ++  ++ A   R  +N++      + A R+  +    +  LW+LSV+ S
Sbjct  73   -APHIPEVHIPEKPVLEFATGLRNEINRAFAVLREIAAGRDLKMFLMVIGGLWILSVLGS  131

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              D L+L YI  +V  TVPV+Y KYE +I+   ++    LK QY  + + VL K
Sbjct  132  CCDFLSLFYIIVVVLHTVPVLYEKYEDQIDSFAEKAFHELKKQYAVFDAKVLSK  185



>gb|KDP25363.1| hypothetical protein JCGZ_20519 [Jatropha curcas]
Length=257

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 95/188 (51%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +TA WV  E+  +  +T      +  +A  F+W N    + K 
Sbjct  73   DIFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHGLILSLAVLFLWSNASTFINKS  132

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +YI ++  ++ AD  R  +N        + + R+     + +A LWVLS++ S
Sbjct  133  PPR-IPEVYIPEEPVLQVADALRSEINWGFAVLRDIASGRDLKKFLSVIAGLWVLSIVGS  191

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
             ++ LTL YI  ++  TVPV Y KYE K++   ++  ++ ++ Y+++     + K +   
Sbjct  192  WVNFLTLFYIVFVLLYTVPVFYEKYEDKVDSLAEKALIELKKQYAVL-----DAKVLSKI  246

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  247  PRGPLKDK  254



>gb|AFK42059.1| unknown [Lotus japonicus]
Length=258

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 90/174 (52%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLWK K+++  A+ ++TA W+  E+  +  +T    + +  +   F+W N   LL K 
Sbjct  71   DVLLWKNKKVSAGALGVATAVWLFFELLEYHLLTLVCHILILSITLLFLWSNAHTLLHKA  130

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P       ++ ++  ++ A   R  +N        +G  ++      A+  LW+LS++ S
Sbjct  131  P-PRIPVFHLPEEPFLEIASALRIEINHGFAALRDIGTGKDVKKFLIAIVGLWILSIVGS  189

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKIN----ESGQRLKVQYRRYYSMVLQK  698
              + LTL YI  ++ LT+P +Y+KYE KI+    ++   +K QY  + + VL K
Sbjct  190  WCNFLTLFYINFVLLLTIPFLYDKYEDKIDPLAEKAAHEIKKQYVVFDAKVLSK  243



>gb|ACF87936.1| unknown [Zea mays]
Length=208

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/171 (26%), Positives = 86/171 (50%), Gaps = 1/171 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LW+ K+++   +  +TA W+  E+  +  +T      +  +A  F+W N    + K 
Sbjct  26   DLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLIVSLAILFLWSNASSFINKS  85

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I +  +V  A   R  +N+       +G   +       +A LW+ SV+ S
Sbjct  86   PP-NIPEVKIPEDVSVNVALTLRYEINRGFATLREIGHGHDLKKFLIVIAGLWLFSVLGS  144

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
              + LTL YI  +   T+PV+Y KYE K++  G++  ++ ++YY++  +K 
Sbjct  145  CCNFLTLFYIVFVALYTIPVLYEKYEDKVDAFGEKAMIELKKYYAIFDEKC  195



>emb|CDY25557.1| BnaC09g11820D [Brassica napus]
Length=251

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 90/170 (53%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +T +W+  E+ ++  +T    +++  +A  F+W +    + K 
Sbjct  64   DIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHISILALAVLFLWSSATTFIHKT  123

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I +   ++ A   R  +N+       +   R+       VA LWVLS + S
Sbjct  124  PP-HIPEVHIPEDVVLQLASGLRNEINRGFTLLRNIALGRDLKKFLMVVAGLWVLSKVGS  182

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL+YI  ++  TVPV+Y KYE K+++ G++   + ++ Y+++ +K
Sbjct  183  SCNFLTLIYIATVLLFTVPVLYEKYEDKVDDFGEKAMKEIKKQYAVLDEK  232



>ref|XP_004229935.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 91/170 (54%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   I  +TA WV  E+  +  +T    + +  +A  F+W N    + K+
Sbjct  79   DVFLWRNKKISATVIGGATAIWVLFELLEYHLLTLICHILIITLAVLFLWSNATTFINKK  138

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +++ +   ++ A   R  +N++++    + + RE     A +A LW+LS++ S
Sbjct  139  P-PHIPEVHLPEGPILQVASALRIEINRALDLLREIASGRELKKFLAVIAGLWILSIVGS  197

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL YI  ++  TVPVIY KYE K++   ++   + ++ Y++  +K
Sbjct  198  WCNFLTLFYISFVLLHTVPVIYEKYEDKVDPLAEKAMHEIKKQYAVFDEK  247



>ref|XP_008232963.1| PREDICTED: reticulon-like protein B6 [Prunus mume]
Length=257

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/166 (27%), Positives = 88/166 (53%), Gaps = 1/166 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +TA WV  E+  +  +T    + +  +A  F+W N    + K 
Sbjct  75   DVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAVLFLWSNAHSFIHKT  134

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +++ ++  ++ A   R  +N +      + + RE       +A LWVLS++ +
Sbjct  135  P-PRIPEVHLPEEPFLQVASELRLQINWAFAVLHDIASGRELKKFLIVIAGLWVLSIVGT  193

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSM  686
              + LTL YI  ++  TVPVIY KYE KI+   ++  ++++++Y++
Sbjct  194  WCNFLTLFYISFVLLHTVPVIYEKYEDKIDPFAEKATIEFKKHYAV  239



>ref|XP_010530738.1| PREDICTED: reticulon-like protein B10 isoform X3 [Tarenaya hassleriana]
Length=219

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 92/179 (51%), Gaps = 6/179 (3%)
 Frame = +3

Query  177  ATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRL  356
            + + D+LLW+++R  +  +  ST  W   E   ++F++  + V +  V   F+W     L
Sbjct  31   SPVADLLLWRKRRGPVLLLGSSTLLWFLFEKAGYSFLSFVANVQLLFVVILFLWAKSASL  90

Query  357  LGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvls  536
            L + P      + IS+ SA+K AD  R  +N+ +     +   R    +      LW LS
Sbjct  91   LDR-PMPPLPNLEISEASALKVADALRVWLNRVLSVARDIAVGRNVKRLFQVSFVLWSLS  149

Query  537  viasHLDLLTLLYI-GELVGLTVPVIYNKYEQKINES---GQR-LKVQYRRYYSMVLQK  698
            ++ +  + LTLLY+ G ++ L++PV+Y KY+  I++     QR L+ Q RR    +LQK
Sbjct  150  LLGNFFNFLTLLYLAGVILSLSIPVLYEKYQDNIDDKLSVTQRVLQTQCRRIDESILQK  208



>emb|CDY52012.1| BnaC06g42920D [Brassica napus]
Length=254

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 87/164 (53%), Gaps = 1/164 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+L+ A + ++TA WV  E+  +  ++    + +F +AA F+W N    + K 
Sbjct  71   DVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLVCHILIFSLAAMFLWSNAHAFMKKS  130

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +++ ++  +  A   R  +NQ+      +   R+       V  LW++SV+ +
Sbjct  131  P-PKIPEVHVKEEHFLLIASALRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGN  189

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYY  680
              + LTL+YI  +V  TVP++Y K+E K++   ++   + +++Y
Sbjct  190  WFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHY  233



>ref|XP_006654676.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=247

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 86/171 (50%), Gaps = 1/171 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K++++  +  +TA W+  E+  +  +T      +  +A  F+W N    + K 
Sbjct  64   DLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCVILTLAILFLWSNASTFINKS  123

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I +  AV  A   R  +N+       +G   +       VA LW+LSV+ S
Sbjct  124  P-PNIPEVRIPEDLAVNVARSLRFEINRGFATLREIGQGHDLKKFLIVVAGLWILSVLGS  182

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
              + LTL YI  +   TVPV+Y KY+ KI+  G++  ++ ++Y ++  +K 
Sbjct  183  CCNFLTLFYIVFMALYTVPVLYEKYDDKIDAFGEKAMIELKKYCAIFDEKC  233



>ref|XP_010530735.1| PREDICTED: reticulon-like protein B10 isoform X1 [Tarenaya hassleriana]
Length=220

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 92/179 (51%), Gaps = 6/179 (3%)
 Frame = +3

Query  177  ATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRL  356
            + + D+LLW+++R  +  +  ST  W   E   ++F++  + V +  V   F+W     L
Sbjct  31   SPVADLLLWRKRRGPVLLLGSSTLLWFLFEKAGYSFLSFVANVQLLFVVILFLWAKSASL  90

Query  357  LGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvls  536
            L + P      + IS+ SA+K AD  R  +N+ +     +   R    +      LW LS
Sbjct  91   LDR-PMPPLPNLEISEASALKVADALRVWLNRVLSVARDIAVGRNVKRLFQVSFVLWSLS  149

Query  537  viasHLDLLTLLYI-GELVGLTVPVIYNKYEQKINES---GQR-LKVQYRRYYSMVLQK  698
            ++ +  + LTLLY+ G ++ L++PV+Y KY+  I++     QR L+ Q RR    +LQK
Sbjct  150  LLGNFFNFLTLLYLAGVILSLSIPVLYEKYQDNIDDKLSVTQRVLQTQCRRIDESILQK  208



>ref|XP_007048924.1| Reticulon family protein [Theobroma cacao]
 gb|EOX93081.1| Reticulon family protein [Theobroma cacao]
Length=248

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 94/192 (49%), Gaps = 8/192 (4%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+++ + +  +TA WV  E   + F+T   +  +  + A F+W N   LL + 
Sbjct  64   DVLLWRNKKISASVLAGATAIWVLFEWLNYHFLTLLCFAVVLGMLAQFVWSNASGLLNRS  123

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P ++  R+++ ++  V         VN+ + F   +            V +LWV +VI S
Sbjct  124  P-SEVPRLFLPEELFVGIGRSLGGEVNRGLHFLQDVACGGNLKQFLVVVLSLWVAAVIGS  182

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LT+LYIG +   T+PV+Y +Y+++I+        Q+R  Y        +L   +L 
Sbjct  183  WCNFLTVLYIGFIAAHTLPVLYERYDEQIDSFVYNFLDQFRNQY-------KKLDAGVLS  235

Query  729  KTGDLKNKVSKH  764
            K    K K+ KH
Sbjct  236  KIPKGKFKLKKH  247



>emb|CDX71213.1| BnaC07g04920D [Brassica napus]
Length=203

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/191 (25%), Positives = 96/191 (50%), Gaps = 10/191 (5%)
 Frame = +3

Query  174  TATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDR  353
             A++ D+++WK KR  I  +  +T  W+  E   ++F    + + + VV   F+W     
Sbjct  13   NASVADLVMWKNKRGGILLLGSATLFWILFEKCGYSFFPFVANIQLLVVVILFLWAK-SA  71

Query  354  LLGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvl  533
            +L   P  +   + I++ S +  AD  R  +N  +     +   R    +      LW +
Sbjct  72   ILFNRPMPELPNLEITEASLLMVADPLRLLINTLLSIARDIYVNRNAKQLFRVSVVLWTI  131

Query  534  sviasHLDLLTLLYIGELVGLTVPVIYNKYEQKINE----SGQRLKVQYRRYYSMVLQK-  698
            S++ S L+  T+LY+G ++G+ +P++Y +Y+  I+E    + + ++ Q+R+    +LQK 
Sbjct  132  SLVGSFLNFFTILYLGIVLGMLIPILYERYQDHIDEKLSVTHRMIQTQFRKIDERLLQKL  191

Query  699  ----SSELKTM  719
                +S++K M
Sbjct  192  IAKPTSKIKKM  202



>emb|CDY38194.1| BnaA09g11950D [Brassica napus]
Length=250

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 91/170 (54%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +T +W+  E+ ++  +T    V++  +A  F+W +    + K+
Sbjct  64   DIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWSSATTFIHKK  123

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       +   R+       VA LWVLS + S
Sbjct  124  P-PHIPEVHIPEEVVLQLASGLRIEINRGFTILRNIALGRDLKKFLMVVAGLWVLSKVGS  182

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL+YI  ++  T+PV+Y KYE K++  G++   + ++ Y+++ +K
Sbjct  183  SCNFLTLIYIATVLLFTIPVLYEKYEDKVDHFGEKAMKEIKKQYAVLDEK  232



>ref|XP_004143883.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 ref|XP_004170740.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 gb|KGN50045.1| hypothetical protein Csa_5G151610 [Cucumis sativus]
Length=257

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 95/188 (51%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+L+   +  +T  W+  E+  + F+T    + M  +A  F+W N    + K 
Sbjct  73   DIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNASFFINKS  132

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
                  +++I +   V+ A   R  +N+++     + + R+      A+A LWVLS++ S
Sbjct  133  -LPHIPQVHIPEGPVVEIASALRVEINRAIAVLREIASGRDLKSFLYAIAGLWVLSIVGS  191

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTLLYIG +V  TVP+ Y KY+ K++   ++   + ++ Y +      + K +   
Sbjct  192  WFNFLTLLYIGVIVLFTVPLFYEKYDDKVDAFAEKAMAEIKKQYVVF-----DAKVLSKI  246

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  247  PRGPLKDK  254



>ref|XP_004230738.1| PREDICTED: reticulon-like protein B11 [Solanum lycopersicum]
 ref|XP_006346364.1| PREDICTED: reticulon-like protein B11-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006346365.1| PREDICTED: reticulon-like protein B11-like isoform X2 [Solanum 
tuberosum]
Length=204

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 93/181 (51%), Gaps = 5/181 (3%)
 Frame = +3

Query  177  ATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRL  356
             ++ D+LLW+R   ++  +V STA W+  E   +  ++  + V + +V   F W     L
Sbjct  16   GSVADVLLWRRWCASVTLLVSSTALWILFERAGYNVLSFVANVMLLLVVILFFWAKSASL  75

Query  357  LGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvls  536
            L + P      + + ++S VK AD+ R  +N  +     +       +       LW++S
Sbjct  76   LNR-PLPPIPDLEVHEESVVKAADMMRVWINHVLMIAHDIAIGGNLKLFVKVSLVLWLIS  134

Query  537  viasHLDLLTLLYIGELVGLTVPVIYNKYEQKINE----SGQRLKVQYRRYYSMVLQKSS  704
             + S  +LLT +Y+G L  L+VP++Y+KY+ +I++    + + ++ QY++    VL+K S
Sbjct  135  YVGSFFNLLTFIYMGILFSLSVPLLYDKYQNQIDDKLIIAQKVIQTQYKKIDDNVLRKIS  194

Query  705  E  707
             
Sbjct  195  R  195



>ref|XP_010530739.1| PREDICTED: reticulon-like protein B10 isoform X4 [Tarenaya hassleriana]
Length=213

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 92/180 (51%), Gaps = 6/180 (3%)
 Frame = +3

Query  174  TATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDR  353
             + + D+LLW+++R  +  +  ST  W   E   ++F++  + V +  V   F+W     
Sbjct  23   VSPVADLLLWRKRRGPVLLLGSSTLLWFLFEKAGYSFLSFVANVQLLFVVILFLWAKSAS  82

Query  354  LLGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvl  533
            LL + P      + IS+ SA+K AD  R  +N+ +     +   R    +      LW L
Sbjct  83   LLDR-PMPPLPNLEISEASALKVADALRVWLNRVLSVARDIAVGRNVKRLFQVSFVLWSL  141

Query  534  sviasHLDLLTLLYI-GELVGLTVPVIYNKYEQKINES---GQR-LKVQYRRYYSMVLQK  698
            S++ +  + LTLLY+ G ++ L++PV+Y KY+  I++     QR L+ Q RR    +LQK
Sbjct  142  SLLGNFFNFLTLLYLAGVILSLSIPVLYEKYQDNIDDKLSVTQRVLQTQCRRIDESILQK  201



>ref|XP_006391670.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
 gb|ESQ28956.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
Length=256

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 91/170 (54%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   + ++T +WV  E+  +  +T    + +  +A  F+W +    + K 
Sbjct  69   DIFLWRNKKVSGGVLGVATISWVLFELLEYNLLTLFGHITILALACLFLWSSAITFIHKT  128

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + R+       +A LW+LS++ S
Sbjct  129  PP-HIPEIHIPEEVVLQLASGLRIEINRGFTTLRDIASGRDLKKFLLVIAGLWLLSIVGS  187

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL+YI  ++  TVPV+Y KYE K+++ G++   + ++ Y++  +K
Sbjct  188  SCNFLTLIYIATILLFTVPVLYEKYEDKVDDFGEKAMKEIKKQYAVFDEK  237



>ref|XP_010544774.1| PREDICTED: reticulon-like protein B6 [Tarenaya hassleriana]
Length=253

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 89/170 (52%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+L+ A +  +TA WV  E+  +  ++    + +  ++  F+W N    + K 
Sbjct  70   DVLLWRDKKLSAAVLGTATAIWVLFELVEYHLLSLVCHILILALSVLFLWSNAHSFINKS  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +++ ++  +  A   R  VNQ+      +   R+       VA LWV+SV+ S
Sbjct  130  P-PQIPEIHLHEEHFLLVASALRNEVNQAFTVLRDIALGRDLKKFLMVVAGLWVISVVGS  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
                LTL+YI  ++  TVPV+Y K+E K++   ++  V+ ++ Y ++ +K
Sbjct  189  WCHFLTLIYICFVLLHTVPVLYEKHEDKVDPMAEKAFVELKKQYGVLDEK  238



>ref|XP_011003673.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=251

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 92/170 (54%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+  +++   +  +T  WV  E+  +  IT   ++++F +A  F+W N    L K 
Sbjct  67   DVFLWRNTKISAGVLGGATTVWVLFELLGYHLITLVCYLSIFFLAVLFLWSNTSDFLNK-  125

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + + +Q   + A   R  +N+       + + R+   V A +A LWVLS+I S
Sbjct  126  PPPKIPEVVLPEQCVREVASALRIEINRGFAVLHDIASGRDLKKVLAVIAGLWVLSLIGS  185

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
             +++LTLLYI  ++  TVPV+Y KYE +++   ++  ++ ++ Y++  +K
Sbjct  186  CINILTLLYISFVLLHTVPVLYEKYEDQVDAYSEKTWIEIKKQYAVFDEK  235



>gb|EMT06999.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=248

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 91/171 (53%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LW+ K+++   +  +TA W+  E+  +  +T      +  +A  F++ N+   + K 
Sbjct  69   DLVLWRNKKVSGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLATLFLYSNVCIFIHKS  128

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLR-LGAEREWYvvaaavaalwvlsvia  545
            P  +   + I +   V  A   R  +N+   FTLR +G  R+          LW+LSV+ 
Sbjct  129  PP-NIPEVKIPEDMTVNIALSLRHEINRGF-FTLREIGHGRDLKKFLIVTGGLWLLSVLG  186

Query  546  sHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
            S  + LTL YI  +V  TVPV+Y KY+ K++  G++  ++ ++YY++  +K
Sbjct  187  SCCNFLTLSYIVFVVLYTVPVLYEKYDDKVDAFGEKAMIELKKYYAIFEEK  237



>ref|XP_010023631.1| PREDICTED: reticulon-like protein B8 isoform X2 [Eucalyptus grandis]
 gb|KCW59927.1| hypothetical protein EUGRSUZ_H02651 [Eucalyptus grandis]
 gb|KCW59928.1| hypothetical protein EUGRSUZ_H02651 [Eucalyptus grandis]
Length=297

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/166 (27%), Positives = 82/166 (49%), Gaps = 5/166 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+++   +  +TA WV LE   + F+T   +  +  + A F+W N+  LL + 
Sbjct  64   DVLLWRNKKISAGVLAGATAIWVLLEWLDYHFLTLVCFALILGMLALFLWSNVSGLLSRS  123

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEF--TLRLGAEREWYvvaaavaalwvlsvi  542
             A+   R+ +     V         VNQ+++F   + LG   + +++         +   
Sbjct  124  -ASKPPRLVVPNDVFVDIGKSVGAEVNQALKFLQDVALGGNLKQFLMVVGSLWAAAIIGG  182

Query  543  asHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYY  680
                + +T+LYIG   G T+PV+Y +YE ++N  G ++  Q +  Y
Sbjct  183  L--CNFITVLYIGFAAGHTLPVLYERYEDQVNSFGDQVLDQLQHLY  226



>ref|XP_007218268.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19467.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=339

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/166 (27%), Positives = 88/166 (53%), Gaps = 1/166 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +TA WV  E+  +  +T    + +  +A  F+W N    + K 
Sbjct  157  DVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAVLFLWSNAHSFIHKT  216

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +++ ++  ++ A   R  +N +      + + RE       +A LWVLS++ +
Sbjct  217  PPR-IPEVHLPEEPFLQVASELRLQINWAFAVLHDIASGRELKKFLIVIAGLWVLSIVGT  275

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSM  686
              + LTL YI  ++  TVPVIY KYE KI+   ++  ++++++Y++
Sbjct  276  WCNFLTLFYISFVLLHTVPVIYEKYEDKIDPFAEKATIEFKKHYAV  321



>ref|XP_010435260.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=273

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 92/188 (49%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   I  +T  WV  E+  +  +     V +  +A  F+W N    + K 
Sbjct  89   DIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLAVLCHVMIVALAVLFLWSNATMFIHKS  148

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + R+     +A+  LWVLS++  
Sbjct  149  P-PKIPEVHIPEEPLLQLASGLRIEINRGFSSLHEIASGRDIKKFLSAIFGLWVLSILGG  207

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
                LTL YI  ++  TVP++Y+KYE KI+  G++   + ++ Y++      + K +   
Sbjct  208  CCSFLTLAYIALVLLFTVPLVYDKYEDKIDPYGEKAMAELKKQYAVF-----DAKVLSKI  262

Query  729  KTGDLKNK  752
              G LKNK
Sbjct  263  PRGPLKNK  270



>ref|XP_006374289.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52086.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=254

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 90/170 (53%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +TA WV  E+  +  IT    +++F +A  F+W N    L K 
Sbjct  70   DVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFLWSNASNFLNKS  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + + ++   + A   R  +N+       + + R+     A +A L VLS++ S
Sbjct  130  P-PKIPEVLLPEKWVREVASGLRIEINRGFAVLHDIASGRDLKKFLAVIAGLLVLSLVGS  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTLLYI  ++  TVPV+Y KYE +++ + ++   Q ++ Y+++ +K
Sbjct  189  CCNFLTLLYISFVLLHTVPVLYEKYEDQVDGNSEKAWTQIKKQYAVLDEK  238



>gb|EMS49910.1| Reticulon-like protein B3 [Triticum urartu]
Length=327

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 97/184 (53%), Gaps = 3/184 (2%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LW+ K+++   +  +TA W+  E+  +  +T      +  +A  F++ N+   + K 
Sbjct  69   DLVLWRNKKVSGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLATLFLYSNVCIFIHKS  128

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLR-LGAEREWYvvaaavaalwvlsvia  545
            P  +   + I +   V  A   R  +N+   FTLR  G  R+       +  LW+LSV+ 
Sbjct  129  PP-NIPEVKIPEDMTVNIALSLRHEINRGF-FTLRETGHGRDLKKFLIVIGGLWLLSVLG  186

Query  546  sHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMML  725
            S+ + LTL YI  +V  TVPV+Y KY+ K++  G++  ++ ++YY++  +K  + K   L
Sbjct  187  SYCNFLTLSYIVFVVLYTVPVLYEKYDDKVDAFGEKAMIELKKYYAIFEEKGLKSKKRWL  246

Query  726  QKTG  737
             + G
Sbjct  247  VRGG  250



>ref|XP_010541290.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 94/170 (55%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +W+ K+++   +   TA WV  E+ ++  +T    + + V+A  F+W N    + K 
Sbjct  83   DIFMWRNKKMSGGVLGGITAVWVLFELMQYHLLTLFCHILIVVLAVLFLWSNASIFINKS  142

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N++      + + R+     +A+A LWVLSVI S
Sbjct  143  P-PKIPEVHIPEEHILQLASGLRIEINRAFTCLRDIASGRDLKKFLSAIAGLWVLSVIGS  201

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL YI  ++  TVPV+Y KYE K++  G++  V+ ++ Y+++ +K
Sbjct  202  WCNFLTLSYIAMVMLFTVPVMYEKYEDKVDAFGEKAMVEIKKQYAVLDEK  251



>emb|CDY08353.1| BnaC09g12430D [Brassica napus]
Length=250

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/170 (25%), Positives = 92/170 (54%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +T +W+  E++++  +T    +++  +A  F+W +    + K+
Sbjct  64   DIFLWRNKKVSGGVLGAATLSWILFELFQYNLLTLFGHISILALAVLFLWSSASTFIHKK  123

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       +   R+       +A LWVLS + S
Sbjct  124  P-PRIPEVHIPEEVVLQLASGLRIEINRGFTLLRHIALGRDLKKFLMVIAGLWVLSKVGS  182

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL+Y   ++  TVPV+Y KYE K+++ G++   + ++ Y+++ +K
Sbjct  183  SCNFLTLVYSATVLLFTVPVLYEKYEDKVDDFGEKAMKEIKKQYAVLDEK  232



>ref|XP_010538815.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 94/170 (55%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +W+ K+++ + +   TA WV  E+  +  ++  S V + V+A  FIW N    + K 
Sbjct  83   DIFMWRDKKMSASVLGGITAVWVLFELMEYHLLSLLSHVLIVVLAVLFIWSNASMFINKS  142

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N++      + + R+      A+A LWVLS++  
Sbjct  143  P-PKIPEVHIPEEPILQLASGLRIEINRAFTCLRDIASGRDLKKFLTAIAGLWVLSIVGG  201

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL YIG ++  T+PV+Y K+E K++  G++  V+ ++ Y+++ +K
Sbjct  202  CCNFLTLSYIGMVMLFTIPVLYEKHEDKVDAYGEKAMVEMKKQYAVLDEK  251



>ref|XP_002511930.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50599.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 85/166 (51%), Gaps = 1/166 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++ + +  +TA W+  E+  +  +T    +++  +A  F+W N    + K 
Sbjct  70   DVFLWRNKKISASVLGTATAIWILFELIEYHLLTLVCHISILTLAILFLWSNAHTFINKT  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P     +++I ++  ++ A      +N        + + ++       +AA W LS++  
Sbjct  130  P-PRIPQVHIPEEPVLQVASALTMEINHGFAVLRSIASGKDLKKFLVVIAAFWALSIVGC  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSM  686
              + LTL YI  ++  TVPV+Y KYE K++   ++  ++ ++ Y+M
Sbjct  189  WCNFLTLFYITFVLLHTVPVLYEKYEDKVDPFAEKAMIEIKKQYAM  234



>gb|KHG29253.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=251

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 97/188 (52%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +TA WV  E+  +  +T    +++  +A  F+W N+   + K 
Sbjct  68   DVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILCLAVLFLWSNVHTFIHKT  127

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P     ++++ ++  ++ A      +NQ+++    + + R        VAA WVLSV+ S
Sbjct  128  P-PRIPQVHLPEEPFLQIASALTIELNQALKLLRDIASGRNLKKFLVVVAAFWVLSVVGS  186

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL Y   ++  TVPV+Y KYE K++   ++  ++ ++ Y++      + K +   
Sbjct  187  WCNFLTLFYTSFVLLHTVPVLYEKYEDKVDPFAEKAVIEIKKQYAVF-----DAKVLGKI  241

Query  729  KTGDLKNK  752
             TG LK K
Sbjct  242  PTGPLKTK  249



>ref|XP_009603460.1| PREDICTED: reticulon-like protein B11 isoform X2 [Nicotiana tomentosiformis]
Length=182

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 85/180 (47%), Gaps = 31/180 (17%)
 Frame = +3

Query  177  ATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRL  356
             T+ D+LLW+R+  ++  +V ST  W   E   +  ++  + V + +V   F WG    L
Sbjct  16   GTVADVLLWRRQCASVTLLVSSTVLWFLFERAGYNLLSFIANVMLLLVVILFFWGKSASL  75

Query  357  LGKE--PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwv  530
            L +   P  D   M + ++  VK AD+ R  V   +     +G+                
Sbjct  76   LNRSLPPIPD---MEVPEEFVVKAADMMRVWVALGLWLISYVGS----------------  116

Query  531  lsviasHLDLLTLLYIGELVGLTVPVIYNKYEQKINE---SGQR-LKVQYRRYYSMVLQK  698
                     LLTLLYIG L  L+VP++Y KY+ +I++   + Q+ ++ QYR+    VL+K
Sbjct  117  ------FFTLLTLLYIGTLFSLSVPLLYEKYQNQIDDKLITAQKVIQKQYRKIDENVLRK  170



>ref|XP_006374290.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52087.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=263

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 90/170 (53%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +TA WV  E+  +  IT    +++F +A  F+W N    L K 
Sbjct  79   DVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFLWSNASNFLNKS  138

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + + ++   + A   R  +N+       + + R+     A +A L VLS++ S
Sbjct  139  P-PKIPEVLLPEKWVREVASGLRIEINRGFAVLHDIASGRDLKKFLAVIAGLLVLSLVGS  197

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTLLYI  ++  TVPV+Y KYE +++ + ++   Q ++ Y+++ +K
Sbjct  198  CCNFLTLLYISFVLLHTVPVLYEKYEDQVDGNSEKAWTQIKKQYAVLDEK  247



>ref|XP_002887921.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64180.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=254

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 90/174 (52%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +T +W+  E+  +  +T    +++  +A  F+W +    + K 
Sbjct  67   DIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSATTFIHKS  126

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + R+       +A LWVLS + S
Sbjct  127  P-PHIPEVHIPEEVVLELASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKLGS  185

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              + LTL+YI  ++  T+PV+Y KYE K+++ G++    +K QY  +   VL K
Sbjct  186  SCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSK  239



>emb|CDY34396.1| BnaA09g11380D [Brassica napus]
Length=251

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 89/170 (52%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +T +W+  E+ ++  +T    V++  +A  F+W +    + K 
Sbjct  64   DIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWSSATTFIHKT  123

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       +   R+       VA LWVLS + S
Sbjct  124  P-PHIPEVHIPEEVVLQLASGLRIEINRGFTILRNIALGRDLKKFLMVVAGLWVLSKVGS  182

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL+YI  ++  TVPV Y KYE K++  G++   + ++ Y+++ +K
Sbjct  183  SCNFLTLIYIATVLLFTVPVFYEKYEDKVDHFGEKAMKEIKKQYAVLDEK  232



>gb|KFK40472.1| hypothetical protein AALP_AA2G000200 [Arabis alpina]
Length=254

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 90/170 (53%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +T +W+  E+  +  +T    V++  +A  F+W +    + K 
Sbjct  67   DIFLWRNKKVSGGVLGAATISWILFELLEYNLLTLFGHVSILALAVLFLWSSATTFIHKT  126

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       +   R+       VA LWVLS++ S
Sbjct  127  PP-HIPEIHIPEKIVLELASGLRIEINRGFTVLRHIALGRDLKKFLMVVAGLWVLSILGS  185

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
                LTL+YI  ++  TVPV+Y KYE K+++ G++   + ++ Y+++ +K
Sbjct  186  SCTFLTLVYIATVILFTVPVLYEKYEDKVDDFGEKAMKEIKKQYAVLDEK  235



>gb|KDP28552.1| hypothetical protein JCGZ_14323 [Jatropha curcas]
Length=254

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 91/166 (55%), Gaps = 1/166 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+++ + + ++TA WV  E+  +  +T A  + +  +A  F+W N    + K 
Sbjct  71   DVLLWRNKKISASVLGVATAIWVLFELIEYHLLTLACHILILSLAVLFLWSNAHTFINKT  130

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P     ++++ ++  +  A      +N+ +     + + ++       +AALWV+S++ S
Sbjct  131  P-PRIPQIHLPEEPFLLVASALTLEINRGLAVLRDIASGKDLKKFLIVIAALWVVSIVGS  189

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSM  686
              + LTL YI  ++  TVPV+Y KYE K++   ++  ++ ++ Y++
Sbjct  190  WCNFLTLFYISFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAV  235



>ref|NP_001130478.1| Seed maturation protein [Zea mays]
 ref|XP_008654247.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 ref|XP_008654248.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 gb|ACF78704.1| unknown [Zea mays]
 gb|ACF84299.1| unknown [Zea mays]
 gb|ACG48055.1| seed maturation protein [Zea mays]
 gb|ACR34851.1| unknown [Zea mays]
 gb|AFW85129.1| Seed maturation protein [Zea mays]
Length=253

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/171 (26%), Positives = 86/171 (50%), Gaps = 1/171 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LW+ K+++   +  +TA W+  E+  +  +T      +  +A  F+W N    + K 
Sbjct  71   DLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLIVSLAILFLWSNASSFINKS  130

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I +  +V  A   R  +N+       +G   +       +A LW+ SV+ S
Sbjct  131  PP-NIPEVKIPEDVSVNVALTLRYEINRGFATLREIGHGHDLKKFLIVIAGLWLFSVLGS  189

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
              + LTL YI  +   T+PV+Y KYE K++  G++  ++ ++YY++  +K 
Sbjct  190  CCNFLTLFYIVFVALYTIPVLYEKYEDKVDAFGEKAMIELKKYYAIFDEKC  240



>ref|XP_006288443.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
 gb|EOA21341.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
Length=271

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 95/188 (51%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   I  +T  WV  E+  +  +T    V +  +A  F+W N    + K 
Sbjct  87   DIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKS  146

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + R+     +A+A LWVLS++  
Sbjct  147  P-PKIPEVHIPEEPLLQLASGLRIEINRGFSSLREIASGRDLKKFLSAIAGLWVLSILGG  205

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
                LTL YI  ++  TVP++Y+KYE K++  G++   + ++ Y+++     + K +   
Sbjct  206  CCSFLTLSYIALVLLFTVPLLYDKYEDKVDSYGEKAMAELKKQYAVL-----DAKVLSKI  260

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  261  PRGPLKDK  268



>ref|XP_010054092.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 ref|XP_010054101.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 ref|XP_010054110.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 gb|KCW89792.1| hypothetical protein EUGRSUZ_A02040 [Eucalyptus grandis]
Length=249

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 83/164 (51%), Gaps = 0/164 (0%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+++   +  +TA WV LE   + F+T   +  +  + A F+W N+  LL   
Sbjct  64   DVLLWRNKKISGGVLAGATAIWVLLEWLDYHFLTLVCFALILGMLAQFLWSNVSGLLSSR  123

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
             A+   R+ +     V         VN++++F   +            V +LW  ++I S
Sbjct  124  SASKPPRLVVPNDVFVDIGKSVGAEVNEALKFLQDVALGGNLKQFLIVVGSLWAAAIIGS  183

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYY  680
              + +T+LYIG +   T+PV+Y +YE +++  G ++  Q + +Y
Sbjct  184  WCNFITVLYIGFVAAHTLPVLYERYEDQVDSFGDQVLDQLQHHY  227



>ref|XP_002509881.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51268.1| conserved hypothetical protein [Ricinus communis]
Length=260

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 93/188 (49%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +TA WV  E+  +  +T      +  +A  F+W N    + K 
Sbjct  76   DIFLWRNKKVSAGVLGFATAVWVLFELIEYHLLTLICHGFILALAILFLWSNASTFINKS  135

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N +      + + R+     + +A LWVLS++ S
Sbjct  136  P-PHIPEVHIPEEPVLQVAAALRMEINYAFAILRDIASGRDLKKFLSVIAGLWVLSIVGS  194

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVPV Y KYE K++   ++  ++ ++ Y++      + K +   
Sbjct  195  WCNFLTLFYIAFVLLHTVPVFYEKYEDKVDAFAEKAAIEIKKQYAVF-----DAKVLSKI  249

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  250  PRGPLKDK  257



>dbj|BAH57206.1| AT1G64090 [Arabidopsis thaliana]
Length=240

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 89/174 (51%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +T +W+  E+  +  +T    +++  +A  F+W +    + K 
Sbjct  51   DIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSASTFIHKS  110

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I +   ++ A   R  +N+       + + R+       +A LWVLS + S
Sbjct  111  P-LHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGS  169

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              + LTL+YI  ++  T+PV+Y KYE K+++ G++    +K QY  +   VL K
Sbjct  170  SCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSK  223



>ref|XP_003569752.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=257

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 93/188 (49%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LW+ K+ +   +  +T+ W+  E+  +  +       +  +A  F+W N    + K 
Sbjct  74   DLVLWRNKKTSGVVLAGATSIWLLFEVMEYHLLNLVCHCLILSLATLFLWSNACTFINKS  133

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I +   V  A   R  +N+       +G  R+       +A+LWVLSV+ +
Sbjct  134  PP-NIPEVKIPEDLTVNIALSLRYEINRGFSTLRDIGHGRDLKKFLIVIASLWVLSVLGN  192

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  +V  TVPV+Y KYE K++  G++  ++ ++YY++      E K +   
Sbjct  193  CCNFLTLSYIVFVVLYTVPVLYEKYEDKVDAFGEKAMIELKKYYAIF-----EEKCLSKI  247

Query  729  KTGDLKNK  752
              G LKNK
Sbjct  248  PKGHLKNK  255



>ref|XP_007160119.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
 gb|ESW32113.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
Length=254

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/188 (24%), Positives = 95/188 (51%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++ + + ++T  W+  E+  +  +T      +  +A  F+W N    + K 
Sbjct  70   DVFLWRNKKISASTLGVATVIWILFELLEYHLLTLVCHFVILALAGLFLWSNASTFINKR  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P     +++I +   ++ A   R  +N++      + + R+     + +A LWV S++ S
Sbjct  130  P-PKIPQVHIPEDPILQFASALRIEINRAFSVLRDIASGRDLKKFLSVIAGLWVFSILGS  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVPV+Y KYE +++  G++   + ++ Y++      + K +   
Sbjct  189  WANFLTLFYIAFVLLHTVPVLYEKYEDQVDSFGEKAIAEIKKQYAVF-----DAKVLSKI  243

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  244  PKGPLKDK  251



>ref|XP_002300239.1| hypothetical protein POPTR_0001s30770g [Populus trichocarpa]
 gb|EEE85044.1| hypothetical protein POPTR_0001s30770g [Populus trichocarpa]
Length=207

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 88/178 (49%), Gaps = 5/178 (3%)
 Frame = +3

Query  177  ATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRL  356
              + D+LLWKR   ++  +V +T  W+  E   +  ++  + V   +V   F W     L
Sbjct  19   GPVADVLLWKRWYASVGVLVSATTLWILFEKAGYNLLSFVANVLFLLVVILFFWAKSASL  78

Query  357  LGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvls  536
            L + P      + I ++   K A +     N ++     +  E+ + V    V+   V S
Sbjct  79   LNR-PFPPLPNLEIPEEIVAKAAGIIHVYANYALSIAREIVIEKNFKVFLQVVSGFCVAS  137

Query  537  viasHLDLLTLLYIGELVGLTVPVIYNKYEQKINE----SGQRLKVQYRRYYSMVLQK  698
             I S  + LTL+YIG L+ L+VP++Y+KY+  I+E    + + ++ QY++ +  +L+K
Sbjct  138  YIGSLCNFLTLVYIGVLLSLSVPLVYDKYQHHIDEKICLAHKIIQEQYKKIHDAILKK  195



>gb|AFW77088.1| hypothetical protein ZEAMMB73_846644 [Zea mays]
Length=223

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 82/170 (48%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLWK K+ +   I  +T  WV  E+  +  +T  S V + V+A  F+W      + K 
Sbjct  39   DVLLWKDKKTSAVVIGGATVIWVLFEVLDYHLLTLISHVLIGVLATLFLWSKATTFIKKS  98

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  D   + +S+   V  +   R  +N+++     +    +       +  LWVLS + S
Sbjct  99   P-PDIPVVQVSEDLVVNVSRALRNDINRALHLFREIAMGHDLKKFLGVIVGLWVLSGVGS  157

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              D LTL YI  L+  TVP++Y+KY+ K++    R   +  + Y ++  K
Sbjct  158  SCDFLTLTYIAVLMLHTVPILYDKYQDKVDHVAGRAHTEALKQYKVLDAK  207



>ref|XP_009597328.1| PREDICTED: reticulon-like protein B5 [Nicotiana tomentosiformis]
Length=268

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/174 (28%), Positives = 90/174 (52%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++ + +  +TA WV  E+  +  +T    + +  +A  F+W N    + K+
Sbjct  84   DVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHILIISLAVLFLWSNATTFINKK  143

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +++ Q   ++ A   R  +N+++     + + RE       VA LW++S++ S
Sbjct  144  P-PHIPEIHLPQDPFLQVASALRIEINRALALLREIASGRELKKFLGVVAGLWIISIVGS  202

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              + LTL YI  ++  TVPV+Y KYE K++   ++    +K QY  +   VL K
Sbjct  203  WCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLAEKAMHEIKKQYAVFDKKVLSK  256



>ref|XP_009134231.1| PREDICTED: reticulon-like protein B2 [Brassica rapa]
Length=267

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 93/188 (49%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++   +  +T  WV  E+  +  +T    V +  +A  F+W N    + K 
Sbjct  83   DIFMWKNKKMSGGVLGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKS  142

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I +   ++ A   R  +N+       + + R+     +A+  LW+LS++  
Sbjct  143  P-PKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGRDLKKFLSALFGLWILSILGG  201

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
                LTL YI  ++  TVP++Y+KYE K++  G++   + ++ Y+++     + K +   
Sbjct  202  CCSFLTLAYIALVLLFTVPLVYDKYEDKVDSYGEKAMAELKKQYAVL-----DAKVLSKI  256

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  257  PRGPLKDK  264



>ref|NP_001239711.1| uncharacterized protein LOC100811024 [Glycine max]
 gb|ACU21063.1| unknown [Glycine max]
 gb|KHN16777.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 95/188 (51%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++ + + ++TA WV  E+  +  +T      +  +A  F+W N    + K 
Sbjct  70   DVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILGLAVLFLWSNASTFINKS  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P     +++I ++  ++ A   R  +N++      + + R+     + +A LWV S++ S
Sbjct  130  P-PKIPQVHIPEKPVLEFASALRVEINRAFALLRDIASGRDLKKFLSVIAGLWVFSILGS  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVPV+Y KYE  ++  G +   + ++ Y++      + K +   
Sbjct  189  WANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGGKAIAEIKKQYAVF-----DAKVLSKI  243

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  244  PRGPLKDK  251



>ref|XP_008234814.1| PREDICTED: reticulon-like protein B1 [Prunus mume]
Length=259

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 98/188 (52%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+++ + +  +T  WV  E+  +  IT    + +  +A FF+W N    + K 
Sbjct  75   DVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSNASTFINKS  134

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P     ++ +S+++ +  A   R  +N++      + + R+  +    +A LW++S++  
Sbjct  135  P-PQIPKVQLSERTVLDLASALRIELNRAFHILRDIASGRDLKMFLGVIAVLWIVSLVGK  193

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  T+PVIY KY+ +I+   ++  +++++ Y++      + K +   
Sbjct  194  WFNFLTLFYITFVLLHTLPVIYEKYDVQIDAFSEKALIEFKKQYAVF-----DAKVLSKI  248

Query  729  KTGDLKNK  752
              G LK K
Sbjct  249  PKGPLKEK  256



>ref|XP_006302727.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
 gb|EOA35625.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
Length=253

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 90/174 (52%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +T +W+  E+  +  +T    +++  +A  F+W +    + K 
Sbjct  65   DIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSATTFIHKT  124

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + R+       +A LWVLS + S
Sbjct  125  P-PHIPEVHIPEEVVLQLASGLRIEINRGFTALRDIASGRDLKKFLLVIAGLWVLSKVGS  183

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              + LTL+YI  ++  T+PV+Y KYE K+++ G++    +K QY  +   VL K
Sbjct  184  SCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSK  237



>ref|XP_009112802.1| PREDICTED: reticulon-like protein B3 [Brassica rapa]
Length=250

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 90/170 (53%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +T +W+  E+ ++  +T    V++  +A  F W +    + K+
Sbjct  64   DIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFSWPSATTFIHKK  123

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       +   R+       VA LWVLS + S
Sbjct  124  PP-HIPEVHIPEEVVLQLASGLRIEINRGFTILRNIALGRDLKKFLMVVAGLWVLSKVGS  182

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL+YI  ++  T+PV+Y KYE K++  G++   + ++ Y+++ +K
Sbjct  183  SCNFLTLIYIATVLLFTIPVLYEKYEDKVDHFGEKAMKEIKKQYAVLDEK  232



>ref|NP_176592.1| reticulon-like protein B3 [Arabidopsis thaliana]
 sp|Q9SH59.1|RTNLC_ARATH RecName: Full=Reticulon-like protein B3; Short=AtRTNLB3 [Arabidopsis 
thaliana]
 gb|AAF24576.1|AC007764_18 F22C12.15 [Arabidopsis thaliana]
 gb|AAL36421.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51418.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99051.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34190.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=255

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 89/174 (51%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +T +W+  E+  +  +T    +++  +A  F+W +    + K 
Sbjct  66   DIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSASTFIHKS  125

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I +   ++ A   R  +N+       + + R+       +A LWVLS + S
Sbjct  126  P-LHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGS  184

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              + LTL+YI  ++  T+PV+Y KYE K+++ G++    +K QY  +   VL K
Sbjct  185  SCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSK  238



>ref|XP_006402470.1| hypothetical protein EUTSA_v10006190mg [Eutrema salsugineum]
 gb|ESQ43923.1| hypothetical protein EUTSA_v10006190mg [Eutrema salsugineum]
Length=253

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 86/164 (52%), Gaps = 1/164 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+L+ A + ++TA WV  E+  + F++    + +F +A  F+  N    + K 
Sbjct  70   DVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFALAVLFLLSNAHAFMKKS  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  +  A   R  +NQ+      +   R+       V  LW++SV+ +
Sbjct  130  P-PKIPEIHIKEEHFLLIASALRNELNQAFVILRSIALGRDLKKFLMVVFGLWIISVVGN  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYY  680
              + LTL+YI  +V  TVP++Y K+E K++   ++   + +++Y
Sbjct  189  WFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHY  232



>gb|EPS73616.1| hypothetical protein M569_01145, partial [Genlisea aurea]
Length=256

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 93/170 (55%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K++    + ++TA WV  E+  +  +T    + +  +A  F+W N    + K 
Sbjct  75   DVFLWRDKKVTAGILGVATAIWVLFELIEYHLLTLVCHILILTLALLFLWSNTSAFINKS  134

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + I ++ A+  A   R  +N +      + + ++     A +A LWVL+++ S
Sbjct  135  P-PKIPEIVIPEKVALGIASAIRTEINTASAELRDIASGKDLKKFLAVIAGLWVLAILGS  193

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
            H++ LTL YI  +V  TVPV Y KYE +++E G++++ ++++ Y+++  K
Sbjct  194  HVNFLTLFYICFVVLHTVPVAYEKYEDEVDEFGEKVEREFKKQYAVLDAK  243



>ref|XP_006650682.1| PREDICTED: reticulon-like protein B8-like [Oryza brachyantha]
Length=247

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 87/174 (50%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+++ + + ++TA WV  E   + F+T  S+  +  +   F+W N    L   
Sbjct  63   DVLLWRNKKISSSVLALATAIWVFFEWLDYHFLTIVSFALVLGMVVQFVWSNFSSALSGS  122

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P +   R+ + ++  V TA      VN+ + F   +  ER       A+  LW  + I  
Sbjct  123  P-SKVPRVELPEELFVNTAVAIGTQVNKFLSFLQDVSCERNLKHFVLAIVGLWAAAAIGG  181

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              + LT++YIG +   T+PV+Y KYE ++++        L+ QY++    VL K
Sbjct  182  WCNFLTVIYIGFVCAHTLPVLYEKYEDQVDDFLYNILGLLRDQYQKLDQGVLSK  235



>gb|AEZ00899.1| putative 24 kDa seed maturation protein [Elaeis guineensis]
Length=253

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 85/171 (50%), Gaps = 1/171 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +TA WV  E+  +  ++      +  +A  F+W N    + K 
Sbjct  69   DIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLWSNATTFINKS  128

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + I +  AV  A   R  +N++      + + R+       +A LWVLS+I S
Sbjct  129  P-PHIPEVSIPEDVAVSVALSLRYDINRAFAVLRDIASGRDLKKFLLVIAGLWVLSIIGS  187

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
              + LTL YI  +   TVPV+Y KYE K++  G++   + +++Y+ V  K 
Sbjct  188  CCNFLTLFYIVFVTLHTVPVLYEKYEDKVDSFGEKAMAEIKKHYATVHAKC  238



>ref|XP_007218819.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
 gb|EMJ20018.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
Length=265

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/188 (26%), Positives = 97/188 (52%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+++ + +  +T  WV  E+  +  IT    + +  +A FF+W N    + K 
Sbjct  81   DVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSNASTFINKS  140

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P     ++ +S+++ +  A   R  +N++      + + R+       +A LW+LSV+  
Sbjct  141  P-PQIPKVQLSERTVLDLASALRIELNRAFHILRDIASGRDLKTFLGVIAILWILSVVGK  199

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  T+PVIY KY+ +I+   ++  +++++ Y++      + K +   
Sbjct  200  WFNFLTLFYITFVLLHTLPVIYEKYDVQIDAFSEKALIEFKKQYAVF-----DAKVLSKI  254

Query  729  KTGDLKNK  752
              G LK K
Sbjct  255  PKGPLKEK  262



>ref|XP_009626480.1| PREDICTED: reticulon-like protein B2 isoform X1 [Nicotiana tomentosiformis]
Length=254

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/188 (26%), Positives = 94/188 (50%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K++    +  +TA WV  E+  +  +T    + +  +A  F+W N    + K 
Sbjct  70   DIFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSNASTFINKS  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + + +   +  A   R  +N+++E    + + +E     A +A LWVLS++ +
Sbjct  130  P-PQIPEVILPEDIVLGVASALRIEINRALEILRDIASGKELKKFLAVIAGLWVLSILGN  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVPV+Y KYE +++   ++ + + ++ Y++       +K +   
Sbjct  189  CWNFLTLFYICFVLLHTVPVLYEKYEDQVDAFAEKAEAEIKKQYAVF-----NVKVLSKI  243

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  244  PRGPLKDK  251



>ref|XP_010552913.1| PREDICTED: reticulon-like protein B16 isoform X2 [Tarenaya hassleriana]
Length=226

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 88/167 (53%), Gaps = 1/167 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+R+  ++  I++ST  W   E+ R  F++  S V + +V   FI   +     K+
Sbjct  43   DLLLWRRRHHSLGVIIVSTVAWFIFELSRLPFLSVWSDVLLILVIVSFIHSRVAAFRNKQ  102

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P +    + +S++    +A  FR  +N  +     +    ++ +    V  LW+LS + S
Sbjct  103  PKS-LPELVLSEEMVNSSAASFRAKLNNFLLLAHDITVGNDFKLFFKVVICLWLLSSVGS  161

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMV  689
            ++   TL+YIG ++ +TVP +Y+K++  I++    +  Q+  +Y +V
Sbjct  162  YVSFFTLVYIGTILSVTVPALYSKFKNHIDKCCGMIHRQFSHHYKLV  208



>gb|KCW72350.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=232

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/155 (28%), Positives = 79/155 (51%), Gaps = 1/155 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++  A+ ++TA W+  E+  +  +T    V +  +A  F+W N    + K 
Sbjct  78   DVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNATTFIHKM  137

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + I ++  ++ A V    +NQ +     + + R+       VA  WV S++ S
Sbjct  138  P-PHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLVVAVFWVFSIVGS  196

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR  653
              + LTL YI  ++  TVPV+Y KYE K++   ++
Sbjct  197  CCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEK  231



>emb|CDX99221.1| BnaC05g33360D [Brassica napus]
Length=203

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 78/153 (51%), Gaps = 1/153 (1%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            + D+LLW+ +   +  +V ST  W   E   +  ++  S V + +VA  F+W     LL 
Sbjct  24   VADLLLWRNRTGAVIVLVSSTVFWFLFERAGYNLLSFVSNVVLLLVAILFLWAKSASLLN  83

Query  363  KEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvi  542
            + P      M I ++ AVK AD  R  +N+ +     +   R    +      LW +S +
Sbjct  84   R-PLPPVPNMEIPEELAVKAADDIRVWINRVLSIASDITIARNPIRLLQVSLVLWAISYV  142

Query  543  asHLDLLTLLYIGELVGLTVPVIYNKYEQKINE  641
             + ++ LTL+YIG L+ L+VP++Y KY+  I++
Sbjct  143  GTFINSLTLVYIGILLSLSVPLVYEKYQDHIDD  175



>ref|XP_007215866.1| hypothetical protein PRUPE_ppa010481mg [Prunus persica]
 gb|EMJ17065.1| hypothetical protein PRUPE_ppa010481mg [Prunus persica]
Length=248

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 92/174 (53%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+++ + +  +T TWV  E   + F+T   +  + ++ A F+W N   ++ + 
Sbjct  64   DVLLWRNKKISASVLTGATVTWVLFEWLNYHFLTLVGFALVLLMLAQFLWSNFSGIISRS  123

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P ++  R+ +  Q  V  A      +N+++EF   +            VA+LWV +VI S
Sbjct  124  P-SEVPRLVVPDQLFVNIAISIGHEINRALEFIQDVALGGNLKQFLMVVASLWVAAVIGS  182

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESG----QRLKVQYRRYYSMVLQK  698
              + LT+LYIG +   T+PV+Y +YE +++        +L+  YR+  + VL +
Sbjct  183  WCNFLTVLYIGFVAAHTLPVLYERYEDQVDNFAYQVLGQLQHNYRKLDTGVLSR  236



>gb|KFK38479.1| hypothetical protein AALP_AA3G118300 [Arabis alpina]
Length=226

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/167 (26%), Positives = 89/167 (53%), Gaps = 1/167 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+R+ L++  IV+ST  W+  E+    F++ +S V + ++   F+   I     ++
Sbjct  43   DLLLWRRRHLSLWVIVLSTVAWLIFELSGLPFLSVSSDVLLILIIISFVHARISAFRNRQ  102

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P +    + +S++     A  FR  +N  +     +    ++ +    V  LW+LS + S
Sbjct  103  PDS-LPELVLSEEMVNSAAASFRIKLNHLLVMAHDVTVGNDFRLFFKVVICLWLLSAVGS  161

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMV  689
            ++   TL+YIG ++ +T+P +Y+KY+ K+++    +  Q   +Y +V
Sbjct  162  YISFCTLVYIGTILSVTIPALYSKYQSKVDKCCGSIHKQLSHHYKLV  208



>ref|XP_001783072.1| predicted protein [Physcomitrella patens]
 gb|EDQ52141.1| predicted protein [Physcomitrella patens]
Length=239

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 88/174 (51%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D  LW+ K L+   +  ST  W  +E   +T  T    + M +    F+W N+  LL K 
Sbjct  57   DSALWRDKYLSAGTLGGSTLIWFLVEKSGYTITTLICNILMLITVVLFVWSNVAALL-KR  115

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + +S+   + TA VFR  VN+++     +   +++ +    +A L+V+S + S
Sbjct  116  PGPPVPELSLSEDFVLSTASVFRNEVNKALSAARTVALGKDFKLFFIVIAFLYVVSTVTS  175

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              + LT ++IG ++   VP I++KYE  I+   ++      VQY++  + VLQK
Sbjct  176  WFNFLTCIWIGIVLLHVVPFIFDKYEDVIDHHARKAADTASVQYKKIDNAVLQK  229



>ref|XP_010558053.1| PREDICTED: reticulon-like protein B16 isoform X4 [Tarenaya hassleriana]
Length=227

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 87/167 (52%), Gaps = 0/167 (0%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW++  L++  IV+ST  W+  E+     ++  S V + +V   FI   I       
Sbjct  43   DLLLWRKGHLSLGVIVLSTVAWLIFELSGLPVLSVCSDVLLILVIVSFIHSRIAAFRNNR  102

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
                   + +S++     A  FR  +N S+     +    ++ +    V  LW+LSV+ S
Sbjct  103  QPKSLPELVLSEEMVNSAAASFRVKLNNSLLMAHNITVGNDFKLFFKVVILLWLLSVVGS  162

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMV  689
            ++   TL YIG +V +TVPV+Y++Y++++++    +  ++ R+Y +V
Sbjct  163  YISFFTLAYIGTIVSVTVPVMYSRYQKEVDKCCGMIHRKFSRHYKVV  209



>ref|XP_006439447.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
 gb|ESR52687.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
Length=256

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 48/174 (28%), Positives = 89/174 (51%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +TA WV  E+  +  +T      +  +A  F+W N    + K 
Sbjct  73   DVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLIVALAVLFLWSNASTFINKS  132

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +YI ++  ++ A   R  +N++      + + R+     + +A LWV+S++ S
Sbjct  133  P-PRIPEVYIPEEPVLQLASALRFEINRAFPLLREIASGRDLKKFLSVIAGLWVVSIVGS  191

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              + LTL YI  ++  TVPVIY KYE +++   ++    +K QY  + + VL K
Sbjct  192  WCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSK  245



>ref|NP_001185307.1| reticulon-like protein B3 [Arabidopsis thaliana]
 gb|AEE34191.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=271

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 89/174 (51%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +T +W+  E+  +  +T    +++  +A  F+W +    + K 
Sbjct  82   DIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSASTFIHKS  141

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I +   ++ A   R  +N+       + + R+       +A LWVLS + S
Sbjct  142  P-LHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGS  200

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              + LTL+YI  ++  T+PV+Y KYE K+++ G++    +K QY  +   VL K
Sbjct  201  SCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSK  254



>ref|XP_010916969.1| PREDICTED: reticulon-like protein B3 [Elaeis guineensis]
Length=310

 Score = 69.3 bits (168),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 85/171 (50%), Gaps = 1/171 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +TA WV  E+  +  ++      +  +A  F+W N    + K 
Sbjct  69   DIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLWSNATTFINKS  128

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + I +  AV  A   R  +N++      + + R+       +A LWVLS+I S
Sbjct  129  P-PHIPEVSIPEDVAVSVALSLRYDINRAFAVLRDIASGRDLKKFLLVIAGLWVLSIIGS  187

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
              + LTL YI  +   TVPV+Y KYE K++  G++   + +++Y+ V  K 
Sbjct  188  CCNFLTLFYIVFVTLHTVPVLYEKYEDKVDSFGEKAMAEIKKHYATVHAKC  238



>ref|XP_004245560.1| PREDICTED: reticulon-like protein B4 [Solanum lycopersicum]
Length=270

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 93/188 (49%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +TA WV  E+  +  +T      M  +A  F+W N    + K 
Sbjct  86   DVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLCHGLMIALAGLFLWSNASTFIHKS  145

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
             A     ++I ++  ++ A   R  +N+++     + + R+  +    +  LW+ S++  
Sbjct  146  -APHIPEVHIPEKPVLEFASALRNEINRALAVLREIASGRDLKMFLLVIGGLWLASILGG  204

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              D LTL YI  +V  TVPV+Y KYE +++   ++   + ++ Y+++     + K +   
Sbjct  205  CCDFLTLFYIIVVVLHTVPVLYEKYEDQVDAFAEKALHELKKQYAVL-----DAKVLSKI  259

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  260  PRGPLKDK  267



>ref|XP_010413382.1| PREDICTED: reticulon-like protein B6 [Camelina sativa]
Length=241

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 92/171 (54%), Gaps = 3/171 (2%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+L+ A + ++TA WV  E+  + F++    + +F +AA F+  N    + K 
Sbjct  58   DVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFALAALFLLSNAHAFMNKT  117

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLR-LGAEREWYvvaaavaalwvlsvia  545
            P      + + ++  +  A   R  +NQ+   TLR +   R+       V  LWV+SV+ 
Sbjct  118  P-PKIPEINVKEEHFLLIASALRNELNQAF-VTLRSIALGRDLKKFLMVVVGLWVISVVG  175

Query  546  sHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
            +  + LTL+YI  +V  TVP++Y K+E K++   ++   + +++Y +  +K
Sbjct  176  NWFNFLTLIYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHYMVFDEK  226



>ref|XP_009765582.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=254

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 94/188 (50%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K++    +  +TA WV  E+  +  +T    + +  +A  F+W N    + K 
Sbjct  70   DVFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSNASTFINKS  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + + +   +  A   R  +N+++E    + + +E     A +A LWVLS++ +
Sbjct  130  P-PQIPEVILPEDIVLGVASALRIEINRALEILRDIASGKELKKFLAVIAGLWVLSILGN  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVPV+Y KYE +++   ++ + + ++ Y++       +K +   
Sbjct  189  CWNFLTLFYICFVLLHTVPVLYEKYEDQVDAFAEKAEAEIKKQYAVF-----NVKVLSKI  243

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  244  PRGPLKDK  251



>ref|XP_010512508.1| PREDICTED: reticulon-like protein B6 [Camelina sativa]
Length=249

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 89/165 (54%), Gaps = 3/165 (2%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+L+ A + ++TA WV  E+  + F++    + +F +AA F+  N    + K 
Sbjct  66   DVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFALAALFLLSNAHAFMNKT  125

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLR-LGAEREWYvvaaavaalwvlsvia  545
            P      + + ++  +  A   R  +NQ+   TLR +   R+       V  LWV+SV+ 
Sbjct  126  P-PKIPEISVKEEHFLLIASALRNELNQAF-VTLRSIALGRDLKKFLMVVVGLWVISVVG  183

Query  546  sHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYY  680
            +  + LTL+YI  +V  TVP++Y K+E K++   ++   + +++Y
Sbjct  184  NWFNFLTLIYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHY  228



>ref|NP_191715.2| reticulon-like protein B6 [Arabidopsis thaliana]
 sp|Q6DBN4.1|RTNLF_ARATH RecName: Full=Reticulon-like protein B6; Short=AtRTNLB6 [Arabidopsis 
thaliana]
 gb|AAT70439.1| At3g61560 [Arabidopsis thaliana]
 gb|AAV85700.1| At3g61560 [Arabidopsis thaliana]
 gb|AEE80222.1| reticulon-like protein B6 [Arabidopsis thaliana]
Length=253

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/164 (26%), Positives = 86/164 (52%), Gaps = 1/164 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+L+ + + ++TA WV  E+  + F++    + +F +AA F+  N    + K 
Sbjct  70   DVFLWRDKKLSASVLGVATAIWVLFELVEYHFLSLVCHILIFALAALFLLSNAHAFMNKT  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  +      R  +NQ+      +   R+       V  LW++SV+ +
Sbjct  130  P-PKIPEIHIKEEHFLMIVSALRNELNQAFVILRSIALGRDLKKFLMVVFGLWIISVVGN  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYY  680
              + LTL+YI  +V  TVP++Y K+E K++   ++   + +++Y
Sbjct  189  WFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHY  232



>ref|XP_006343915.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=270

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (49%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +TA WV  E+  +  +T      M  +A  F+W N    + K 
Sbjct  86   DVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLCHGLMVALAGLFLWSNASTFIHKS  145

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
             A     ++I ++  +  A   R  +N+++     + + R+       +  LW+ S++  
Sbjct  146  -APHIPEVHIPEKPVLAFASALRNEINRALAVLREIASGRDLKTFLLVIGGLWLASILGG  204

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              D LTL YI  +V  TVPV+Y KYE +++   ++    LK QY  + + VL K
Sbjct  205  CCDFLTLFYIIVVVLHTVPVLYEKYEDQVDAFAEKALHELKKQYAVFDAKVLSK  258



>ref|XP_010469092.1| PREDICTED: reticulon-like protein B6 [Camelina sativa]
Length=249

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 89/165 (54%), Gaps = 3/165 (2%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+L+ A + ++TA WV  E+  + F++    + +F +AA F+  N    + K 
Sbjct  66   DVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFALAALFLLSNAHAFMNKT  125

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLR-LGAEREWYvvaaavaalwvlsvia  545
            P      + + ++  +  A   R  +NQ+   TLR +   R+       V  LWV+SV+ 
Sbjct  126  P-PKIPEISVKEEHFLLIASALRNELNQAF-VTLRSIALGRDLKKFLMVVVGLWVISVVG  183

Query  546  sHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYY  680
            +  + LTL+YI  +V  TVP++Y K+E K++   ++   + +++Y
Sbjct  184  NWFNFLTLIYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHY  228



>ref|XP_002993037.1| hypothetical protein SELMODRAFT_136377 [Selaginella moellendorffii]
 gb|EFJ05876.1| hypothetical protein SELMODRAFT_136377 [Selaginella moellendorffii]
Length=215

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 86/164 (52%), Gaps = 1/164 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LWK+KR +I  +  ST  W   E   +T I+  + + +F++ A F W N+  L+ + 
Sbjct  36   DVVLWKQKRKSIGILGGSTLVWFIFEWSGYTLISLVANIVLFLLIALFAWANLAALVNR-  94

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + +S + + K A    + VN  + +   L   +++ ++      LWVL  +  
Sbjct  95   PLPPVPEVQLSDEKSNKIAKRVAKEVNGVLNYARSLSTGKDFPMLLKTCLMLWVLGNVGQ  154

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYY  680
               LLTL+Y+G +  LT+P+ Y ++E +I++  Q++  + R  Y
Sbjct  155  WFSLLTLIYLGVIGTLTLPLAYERHEDQIDQFIQKIVQKARNQY  198



>ref|XP_002876621.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52880.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=254

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/164 (26%), Positives = 85/164 (52%), Gaps = 1/164 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+L+ + + ++TA WV  E+  + F++    + +F + A F+  N    + K 
Sbjct  71   DVFLWRDKKLSASVLGVATAIWVLFELVEYHFLSLVCHILIFALGALFLLSNAHAFMNKT  130

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  +      R  +NQ+      +   R+       V  LW++SV+ +
Sbjct  131  P-PKIPEIHIKEEHFLMIVSALRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGN  189

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYY  680
              + LTLLYI  +V  TVP++Y K+E K++   ++   + +++Y
Sbjct  190  WFNFLTLLYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHY  233



>ref|XP_010252079.1| PREDICTED: reticulon-like protein B16 isoform X3 [Nelumbo nucifera]
Length=238

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/167 (26%), Positives = 86/167 (51%), Gaps = 0/167 (0%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LWKR+ ++   I++ST  W+  E    +F++  S + + ++   F+  N   L  K 
Sbjct  54   DVILWKRRHVSFGVIIVSTVAWLLFEQSGLSFLSICSDIFLILIVIQFLRANFAVLRNKR  113

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
                   + +S++     A  FR  +N  +     +   +++ +    V  LW+LSVI  
Sbjct  114  QLQPLPELVLSEEMVNNAAASFRVKINNVLLMAHDITLGKDFRLFFKVVVCLWLLSVIGG  173

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMV  689
                 TL+YIG ++ +TVPV+YN+YE  +++    +  ++ ++Y +V
Sbjct  174  FFSFFTLVYIGTIISITVPVLYNRYEDHVDKYAGVVHQKFSKHYRVV  220



>ref|XP_004499535.1| PREDICTED: reticulon-like protein B8-like isoform X1 [Cicer arietinum]
 ref|XP_004499536.1| PREDICTED: reticulon-like protein B8-like isoform X2 [Cicer arietinum]
Length=245

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 99/198 (50%), Gaps = 18/198 (9%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LW+ K+++ + +  +T  WV  E   + F+T   +  + V+ A F+W N   LL   
Sbjct  61   DVMLWRNKKISASFLTGATIVWVLFEWLNYHFLTLLCFALVLVMLAQFLWSNASGLLNST  120

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P +   R+ I Q+  V    +    VN+ + F   +  E    +    VA+LWV SVI S
Sbjct  121  P-SKVPRLVIPQEYFVNIGTIIGNEVNRGLRFLQDISCEGNLKLFLIVVASLWVGSVIGS  179

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINE-----SGQRLKVQYRRYYSMVLQKSSELK  713
              + LT++YIG +   T+PV Y KYE +++       GQ ++  YR+  + VL K  +  
Sbjct  180  WCNFLTVIYIGIVAAHTLPVFYEKYEDEVDNFVFQVLGQ-VQNNYRKLDAGVLSKIPK--  236

Query  714  TMMLQKTGDLKNKVSKHK  767
                   G+LK K  KH+
Sbjct  237  -------GNLKGK--KHE  245



>ref|XP_011093062.1| PREDICTED: reticulon-like protein B1 [Sesamum indicum]
Length=257

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/166 (27%), Positives = 84/166 (51%), Gaps = 1/166 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +  +TA WV  E+  +  +T    V++  ++  F+W N    + K 
Sbjct  74   DIFLWRNKKISATVLGGATAVWVLFELLEYHLLTLVCHVSILALSLLFLWSNATTFINKR  133

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + + +   ++ A V R  +N+       + + R+       V  LW LS++ S
Sbjct  134  P-PHIPEVRLPEDPFLEVASVLRTEINRGFAVLREIASGRDLKKFLMVVVGLWALSIVGS  192

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSM  686
              + LTL YI  ++  TVPV+Y KY+ KI+   ++  +Q ++ Y++
Sbjct  193  FCNFLTLFYIVFILLHTVPVLYEKYDDKIDAFAEKAMIQIKKQYAV  238



>ref|XP_006339640.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=265

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 92/174 (53%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +TA WV  E+  +  +T    + +  +A  F+W N    + K+
Sbjct  81   DVFLWRNKKISGTVLGGATAIWVLFELLEYHLLTLICHILIITLAVLFLWSNATTFINKK  140

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +++ +   ++ A   R  +N++++    + + RE     A +A LW+LS++ S
Sbjct  141  P-PHIPEVHLPEGPILQVASALRIEINRALDLLREIASGRELKKFLAVIAGLWILSIVGS  199

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              + LTL YI  ++  T+PV+Y KYE K++   ++    +K QY  + + VL K
Sbjct  200  WCNFLTLFYISFVLLHTIPVLYEKYEDKVDPLAEKAMHEIKKQYAVFDAKVLSK  253



>ref|XP_010545343.1| PREDICTED: reticulon-like protein B3 [Tarenaya hassleriana]
Length=259

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 89/170 (52%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI+LW+ K+++   +  +TA WV  E+  +  ++     ++  +A  F+W N    + K 
Sbjct  72   DIVLWRNKKVSGGVLGAATAAWVLFELLEYHLLSLVCHSSILALAVLFLWSNASTFIHKT  131

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+       + + R+       +A LWVLS++ S
Sbjct  132  P-PRIPEVHIPEEHVLQLASGLRTEINRGFAALRDIASGRDLKKFLMVIAGLWVLSILGS  190

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + +TL YI  ++  T+PV+Y KYE K++  G++   + ++ Y ++ +K
Sbjct  191  CCNFVTLFYIATVLLFTIPVLYEKYEDKVDAFGEKAMKEIKKQYEVLDEK  240



>ref|XP_004951242.1| PREDICTED: reticulon-like protein B2-like [Setaria italica]
Length=240

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 86/170 (51%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLWK  + + A +  +T  W+  E+  +  +T AS V +  +   F+W N    + K 
Sbjct  56   DVLLWKDTKTSAAVVGGATILWLLFEVVEYHLLTLASHVMIATLTILFLWSNATVFIKKS  115

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  D   + IS++ AV  A   R  +N+++     L    +       + ALW++S I  
Sbjct  116  P-PDVPEVQISEELAVNIALALRADINKALVLLRELALGHDLMKFLGVIVALWIVSEIGE  174

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              DLL L+YI  L+  TVP++Y+KY+ ++++   +   +  + Y ++  K
Sbjct  175  LCDLLRLMYIVVLILHTVPILYHKYQDQVDDFAAKAHAELCKQYKVLDAK  224



>ref|XP_009793558.1| PREDICTED: reticulon-like protein B4 [Nicotiana sylvestris]
Length=268

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 88/174 (51%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +TA WV  E+  + F+T      +  +A  F+W N    + K 
Sbjct  84   DVFLWRNKKISAGFLGGATAIWVLFEVVEYHFLTLLCHGLIVALAGLFLWSNASAFIHKS  143

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
             A     ++I ++  ++ A   R  +N++      + A R+       +  LW+LSV+ S
Sbjct  144  -APHIPEVHIPEKPVLEFATGLRNEINRAFAVLREIAAGRDLKTFLMVIGGLWILSVLGS  202

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              D L+L YI  +V  TVPV+Y KYE +I+   ++    LK QY  + + VL K
Sbjct  203  CCDFLSLFYIIVVVLHTVPVLYEKYEDQIDSFAEKALHELKKQYAVFDAKVLSK  256



>ref|NP_001189857.1| reticulon-like protein B16 [Arabidopsis thaliana]
 gb|AEE74976.1| reticulon-like protein B16 [Arabidopsis thaliana]
Length=194

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 88/167 (53%), Gaps = 1/167 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+R+ L++  I+IST  W+  E     F++ +S V + V+   F+   +     ++
Sbjct  11   DLLLWRRRHLSLGVIIISTVAWLIFEFSGLPFLSVSSDVLLIVIMISFVHARVSAFRNRQ  70

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
              +    + +S++     A  FR  +N  +     +    ++ +    V  LW+LS I S
Sbjct  71   LHS-LPELVLSEEMVNSAAASFRIKLNHLLVMAHDVTVGNDFRLFFKVVICLWLLSAIGS  129

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMV  689
            ++ L TLLYIG ++ +T+P +Y+KY+ K+++    +  +   +Y +V
Sbjct  130  YISLCTLLYIGTILSVTIPALYSKYQSKVDKCCGTIHRRLSHHYKIV  176



>ref|XP_010252077.1| PREDICTED: reticulon-like protein B16 isoform X1 [Nelumbo nucifera]
Length=240

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/167 (26%), Positives = 86/167 (51%), Gaps = 0/167 (0%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LWKR+ ++   I++ST  W+  E    +F++  S + + ++   F+  N   L  K 
Sbjct  56   DVILWKRRHVSFGVIIVSTVAWLLFEQSGLSFLSICSDIFLILIVIQFLRANFAVLRNKR  115

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
                   + +S++     A  FR  +N  +     +   +++ +    V  LW+LSVI  
Sbjct  116  QLQPLPELVLSEEMVNNAAASFRVKINNVLLMAHDITLGKDFRLFFKVVVCLWLLSVIGG  175

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMV  689
                 TL+YIG ++ +TVPV+YN+YE  +++    +  ++ ++Y +V
Sbjct  176  FFSFFTLVYIGTIISITVPVLYNRYEDHVDKYAGVVHQKFSKHYRVV  222



>ref|XP_001784743.1| predicted protein [Physcomitrella patens]
 gb|EDQ50432.1| predicted protein [Physcomitrella patens]
Length=240

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 95/181 (52%), Gaps = 5/181 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D  LW+ K L+   +  STA W  LE   +TF+T    + M V+   F+W +I  LL + 
Sbjct  57   DSALWRDKYLSGGTLFGSTAIWYLLEKSGYTFVTLTCNILMCVIVLLFVWSSIAALLHRA  116

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
                   + +S+   + TA++ R  VN+++     +   +++ +    VA+L+V+S++ S
Sbjct  117  -GPPVPELSLSESFVMNTANLIRIEVNKALHIARTVALGKDFKLFLLVVASLYVVSIVGS  175

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQKSSELKT  716
              +LLT ++IG +    VP I++KYE  I+   Q+      VQYR+    +L+K   + +
Sbjct  176  WFNLLTCVWIGIVWFHVVPFIFDKYEDVIDHHAQKASEAASVQYRKLDDAILRKIPRVPS  235

Query  717  M  719
            M
Sbjct  236  M  236



>ref|XP_009766982.1| PREDICTED: reticulon-like protein B5 [Nicotiana sylvestris]
Length=266

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 90/170 (53%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++ + +  +TA WV  E+  +  +T    + +  +A  F+W N    + K+
Sbjct  82   DVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHILIISLAVLFLWSNATTFINKK  141

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +++ Q   ++ A   R  +N+++     + + RE       VA LW+LS++ S
Sbjct  142  P-PHIPEIHLPQDPFLQVASALRIEINRALALLREIASGRELKKFLGVVAGLWILSIVGS  200

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL YI  ++  TVPV+Y KYE K++   ++   + ++ Y++  +K
Sbjct  201  WCNFLTLFYILFVLLHTVPVLYEKYEDKVDPLAEKAMHEIKKQYAVFDEK  250



>ref|NP_974276.3| reticulon-like protein B16 [Arabidopsis thaliana]
 dbj|BAE99701.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE74973.1| reticulon-like protein B16 [Arabidopsis thaliana]
Length=193

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 88/167 (53%), Gaps = 1/167 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+R+ L++  I+IST  W+  E     F++ +S V + V+   F+   +     ++
Sbjct  10   DLLLWRRRHLSLGVIIISTVAWLIFEFSGLPFLSVSSDVLLIVIMISFVHARVSAFRNRQ  69

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
              +    + +S++     A  FR  +N  +     +    ++ +    V  LW+LS I S
Sbjct  70   LHS-LPELVLSEEMVNSAAASFRIKLNHLLVMAHDVTVGNDFRLFFKVVICLWLLSAIGS  128

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMV  689
            ++ L TLLYIG ++ +T+P +Y+KY+ K+++    +  +   +Y +V
Sbjct  129  YISLCTLLYIGTILSVTIPALYSKYQSKVDKCCGTIHRRLSHHYKIV  175



>ref|XP_001783075.1| predicted protein [Physcomitrella patens]
 gb|EDQ52144.1| predicted protein [Physcomitrella patens]
Length=218

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 90/174 (52%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D  LW+ K L+   +  ST  W  LE   +T +T    + +FV+   F+W N+  LL + 
Sbjct  36   DSALWRDKYLSAGTLGGSTLIWFLLEKSGYTLVTLLCNILLFVIVILFLWSNVASLLHR-  94

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + + +   + TA+V R  VN+++     +   +++ +    +A L+V+S + S
Sbjct  95   PGPPVPELTLPEDLVLSTANVVRIEVNKALSVARTVALGKDFKLFFIVIAFLYVVSTVTS  154

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              + LT ++IG ++   VP I++KYE  I+   ++      VQY++  + VLQK
Sbjct  155  WFNFLTCIWIGIVLLHVVPFIFDKYEDVIDHHARKAADTASVQYKKIDNAVLQK  208



>ref|NP_001130268.1| uncharacterized protein LOC100191362 [Zea mays]
 gb|ACF78438.1| unknown [Zea mays]
 gb|ACG39160.1| seed maturation protein [Zea mays]
 gb|ACL53798.1| unknown [Zea mays]
 gb|AFW78797.1| seed maturation protein [Zea mays]
Length=254

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 86/171 (50%), Gaps = 1/171 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ KR++   +  +TA W+  E+  +  +T      +  +A  F+W N    + K 
Sbjct  70   DLFLWRNKRISGGVLAGATAFWLLFEVMDYHLLTLLCHCLILTLAILFLWSNATTFINKS  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I    AV  A   R  +N+       +G   +       +A LW+LSV+ S
Sbjct  130  PP-NIPEVKIPDDLAVNVARSLRYEINRGFATLREIGQGHDLKKFLIVIAGLWILSVLGS  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
              + LTL YI  +V  TVPV+Y K+E K++  G++  V+ +RYY++  +K 
Sbjct  189  CCNFLTLSYIVFMVLYTVPVLYEKHEDKVDAFGEKAMVELKRYYAIFDEKC  239



>ref|XP_008810936.1| PREDICTED: reticulon-like protein B5 [Phoenix dactylifera]
Length=253

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 83/165 (50%), Gaps = 1/165 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   + ++TA WV  E+  +  +T      +  +A  F+W N    + K 
Sbjct  69   DIFLWRNKKISAGVLGVATAIWVLFELMEYHLLTLVCHCLILSLAILFLWSNASTFINKS  128

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
             +     + I +  AV  A   R  +N+       + + RE       +A LWVLS+I +
Sbjct  129  -SPHIPEVSIPEDVAVDVALSLRYEINRGFAVLRDIASGRELKKFLMVIAGLWVLSIIGT  187

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYS  683
              + LTL YI  +   TVPV+Y KYE K++   +++  + +++Y+
Sbjct  188  CCNFLTLFYIVFVTLHTVPVLYEKYEDKVDPFAEKVMAEIKKHYA  232



>gb|ACG36034.1| reticulon [Zea mays]
 gb|AFW77086.1| reticulon [Zea mays]
Length=256

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 82/170 (48%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLWK K+ +   I  +T  WV  E+  +  +T  S V + V+A  F+W      + K 
Sbjct  72   DVLLWKDKKTSAVVIGGATVIWVLFEVLDYHLLTLISHVLIGVLATLFLWSKATTFIKKS  131

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  D   + +S+   V  +   R  +N+++     +    +       +  LWVLS + S
Sbjct  132  P-PDIPVVQVSEDLVVNVSRALRNDINRALHLFREIAMGHDLKKFLGVIVGLWVLSGVGS  190

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              D LTL YI  L+  TVP++Y+KY+ K++    R   +  + Y ++  K
Sbjct  191  SCDFLTLTYIAVLMLHTVPILYDKYQDKVDHVAGRAHTEALKQYKVLDAK  240



>ref|NP_001130603.1| uncharacterized protein LOC100191702 [Zea mays]
 gb|ACF78889.1| unknown [Zea mays]
 gb|ACF84893.1| unknown [Zea mays]
 gb|ACG36852.1| reticulon [Zea mays]
 gb|AFW70989.1| hypothetical protein ZEAMMB73_119334 [Zea mays]
Length=230

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 84/170 (49%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLWK K+ + A +  +T  WV  EI  +  +T  S V +  +   F+W N    + K 
Sbjct  46   DVLLWKDKKTSAAVVGGATVLWVLFEIVEYHLLTLVSHVLIAALTILFLWSNATVFIKKS  105

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  D   + IS+  AV  A   R  +N+++     +            V ALW+LS I  
Sbjct  106  P-PDVPEVQISEDLAVNIALALRADINKALALLREIALGHNLMKFLGVVVALWILSEIGE  164

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              DLL L+YI  L+  TVP++Y+KY+ +++    +   +  + Y+++  K
Sbjct  165  LCDLLRLMYIVVLILHTVPILYHKYQDQVDNFAAKAHRELCKQYAVLDAK  214



>ref|XP_004510697.1| PREDICTED: reticulon-like protein B1-like [Cicer arietinum]
Length=255

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 93/170 (55%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LWK K+++  A+  +TA WV  E+  + F+T  S + + ++A  F+W N    + K 
Sbjct  72   DVFLWKNKKVSAGALGAATAFWVFFELLEYHFLTLVSHILILLLALLFLWSNAHTFIHKT  131

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +++ ++  ++ A   R  +N+       +G+ R+       + +LW+LS++ S
Sbjct  132  P-PHIPVVHLPEEPFLQIASALRIEINRGFSALHNIGSGRDLKKFLIVIVSLWILSIVGS  190

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL YI  ++  TVP +YNKYE KI+   ++  ++ ++ Y++  +K
Sbjct  191  WCNFLTLFYISFVLLHTVPFLYNKYEDKIDPLAEKAFIEIKKQYAVFDEK  240



>ref|XP_003565315.1| PREDICTED: reticulon-like protein B4 [Brachypodium distachyon]
Length=216

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 89/174 (51%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI+LW+RK ++ + +  +TA WV  E+  F F+T A + AM  +  FFIW N    L   
Sbjct  34   DIILWRRKEVSASILGAATAAWVLFEVAEFHFLTLACYAAMIAMLTFFIWTNASGFL-NL  92

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P        +S+++A +      R +   V     +   ++  +    VA+L++ SVIAS
Sbjct  93   PVPRIPETLLSERTARQVILGLHRRLTWFVYRLYDIACGKDIKMFILTVASLYIGSVIAS  152

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
                LTLLY+  + G+TVP +Y +YE +++    R    L+  +    S VL+K
Sbjct  153  CFSSLTLLYLVVVFGMTVPALYERYESEVDHLAARAVHDLRSHFAEMDSGVLRK  206



>ref|XP_002441411.1| hypothetical protein SORBIDRAFT_09g026210 [Sorghum bicolor]
 gb|EES19841.1| hypothetical protein SORBIDRAFT_09g026210 [Sorghum bicolor]
Length=255

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 87/171 (51%), Gaps = 1/171 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ KR++   +  +TA W+  E+  +  +T      +  +A  F+W N    + K 
Sbjct  71   DLFLWRNKRISGGVLAGATAIWLLFEVMDYHLLTLLCHCLILTLAILFLWSNATTFINKS  130

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I +  AV  A   R  +N+       +G   +       +A LW+LSV+ S
Sbjct  131  PP-NIPEVKIPEDLAVNVARSLRYEINRGFATLREIGQGHDLKKFLIVIAGLWILSVLGS  189

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
              + LTL YI  +V  TVPV+Y K+E K++  G++  V+ ++YY++  +K 
Sbjct  190  CCNFLTLSYIVFMVLYTVPVLYEKHEDKVDAFGEKAMVELKKYYAIFDEKC  240



>ref|XP_010658515.1| PREDICTED: reticulon-like protein B2 [Vitis vinifera]
 emb|CBI34409.3| unnamed protein product [Vitis vinifera]
Length=252

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 94/188 (50%), Gaps = 6/188 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D++LW+ K+++   +  +TA W+  E+  +  +T     ++  +A  F+W N    + K 
Sbjct  68   DVVLWRNKKISAGVLGGATAVWILFELLEYHLLTLVCHCSILALAILFLWSNATTFINKA  127

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I +   ++ A   R  +N+       + + ++     + +A LWV+S++ S
Sbjct  128  P-PHIPEVHIPEDPVLQFASALRIEINRGFTLLRNVASGKDLKKFLSVIAGLWVVSIVGS  186

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  TVPV+Y KYE  ++   ++  V+ +R Y++      + K +   
Sbjct  187  WCNFLTLFYIVFVLLHTVPVLYEKYEDPVDSFAEKAMVEIKRQYAVF-----DAKVLSRI  241

Query  729  KTGDLKNK  752
              G LK+K
Sbjct  242  PRGPLKDK  249



>ref|XP_006656127.1| PREDICTED: reticulon-like protein B2-like [Oryza brachyantha]
Length=262

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 84/170 (49%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLWK K+ +   I  +T  W+  E+  +  +T  S V +  +A  F+W      + K 
Sbjct  78   DVLLWKDKKTSAVVIGGATVIWILFEVLDYHLLTLLSHVMIGALAILFLWSKATTFIKKS  137

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  D   + I +  AV  +   R  +N+++     +    +       + ALWVLS + S
Sbjct  138  P-PDIPVVQIPEDVAVNVSRALRNDINRALHLFREIALGHDLKKFLGVIVALWVLSEVGS  196

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              D LTL+Y+  L+  TVP++Y+KY+ K++    R   +  ++Y ++  K
Sbjct  197  CCDFLTLIYVAVLMLHTVPILYDKYQDKVDHFAGRAHSEACKHYEVLDAK  246



>ref|XP_006422934.1| hypothetical protein CICLE_v10029287mg [Citrus clementina]
 ref|XP_006422935.1| hypothetical protein CICLE_v10029287mg [Citrus clementina]
 gb|ESR36174.1| hypothetical protein CICLE_v10029287mg [Citrus clementina]
 gb|ESR36175.1| hypothetical protein CICLE_v10029287mg [Citrus clementina]
 gb|KDO59810.1| hypothetical protein CISIN_1g0285691mg [Citrus sinensis]
 gb|KDO59811.1| hypothetical protein CISIN_1g0285691mg [Citrus sinensis]
 gb|KDO59812.1| hypothetical protein CISIN_1g0285691mg [Citrus sinensis]
 gb|KDO59813.1| hypothetical protein CISIN_1g0285691mg [Citrus sinensis]
 gb|KDO59814.1| hypothetical protein CISIN_1g0285691mg [Citrus sinensis]
Length=207

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 91/178 (51%), Gaps = 5/178 (3%)
 Frame = +3

Query  177  ATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRL  356
             ++ D+LLW+++   +  +  ST  W   E   + F++  S V + +VA  F WG    L
Sbjct  19   GSVADVLLWRKRCGGVVLLGSSTILWFLFERAGYNFLSFVSNVLLLLVAILFFWGKSASL  78

Query  357  LGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvls  536
            L   P      + IS QS VK AD  +  VN ++     +   R           LWV+S
Sbjct  79   L-NRPLPPLPDLEISDQSVVKAADEIQVWVNHALSIARDIAMGRNLSRFLQVAFLLWVVS  137

Query  537  viasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESG---QR-LKVQYRRYYSMVLQK  698
             + S  + LTL+YIG L+ L+VPV+Y K++  I+E     QR +++QYR+    +L+K
Sbjct  138  YVGSVFNFLTLVYIGVLLSLSVPVLYEKFQDHIDEKLCKIQRVIQMQYRKIDESLLKK  195



>gb|KHG04885.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=255

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 87/166 (52%), Gaps = 1/166 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +TA WV  E+  +  +T    +++  +A  F+W N    + K 
Sbjct  72   DVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHISILCLALLFLWSNAHTFIHKS  131

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +++ ++  ++ A      +NQ ++    + + R        +AA WVLS++ S
Sbjct  132  P-PRIPEIHLPEEPFLQVASALAIELNQGLKLLRDIASGRNLKEFLMVIAAFWVLSIVGS  190

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSM  686
              + LTL YI  ++  TVPV+Y KYE K++   ++  ++ ++ Y++
Sbjct  191  WCNFLTLFYICFVLLHTVPVLYEKYEDKVDPFAEKAAIEVKKQYAV  236



>gb|EPS69502.1| hypothetical protein M569_05265, partial [Genlisea aurea]
Length=238

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/168 (28%), Positives = 88/168 (52%), Gaps = 1/168 (1%)
 Frame = +3

Query  177  ATIKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRL  356
              + D+LLWK K +++  +V +TA WV  +++ + F+T  S   +  +   F+W N    
Sbjct  52   GKVADLLLWKNKNVSVGVLVGATALWVLFDVFEYHFLTLVSHALIVGLVILFLWTNGSAF  111

Query  357  LGKEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvls  536
            + K P      + I ++  ++ A   R  +N+++     + + ++       +  LWVLS
Sbjct  112  VRKSPPR-IPEVIIPEKLVLEFASDLRIEINRALSAFRDIASGKDLKAFLLVIVVLWVLS  170

Query  537  viasHLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYY  680
            VI S LD L LLY+  +  LT+P+ Y+KYE +I+    +  V+ ++ Y
Sbjct  171  VIGSVLDFLALLYLITVALLTLPLFYDKYEDEIDSFAHKAGVEIKKRY  218



>ref|XP_004961431.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=252

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 87/171 (51%), Gaps = 1/171 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ KR++   +  +TA W+  E+  +  +T      +  +A  F+W N    + K 
Sbjct  68   DLFLWRNKRISGGVLAGATAIWLLFEVMDYHLLTLLCHCLILTLAILFLWSNATTFINKS  127

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + I +  AV  A   R  +N+       +G   +       VA LW+LSV+ S
Sbjct  128  PP-NIPEVKIPEDLAVNVARSLRYEINRGFATLRGIGQGHDLKKFLIVVAGLWILSVLGS  186

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKS  701
              + LTL YI  +V  TVPV+Y K+E K++  G++  V+ ++YY++  +K 
Sbjct  187  CCNFLTLSYIVFMVLYTVPVLYEKHEDKVDAFGEKTMVELKKYYAIFDEKC  237



>ref|NP_001130091.1| uncharacterized protein LOC100191184 [Zea mays]
 gb|ACF78218.1| unknown [Zea mays]
Length=256

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 82/170 (48%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLWK K+ +   I  +T  WV  E+  +  +T  S V + V+A  F+W      + K 
Sbjct  72   DVLLWKDKKTSAVVIGGATVIWVLFEVLDYHLLTLISRVLIGVLATLFLWSKATTFIKKS  131

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  D   + +S+   V  +   R  +N+++     +    +       +  LWVLS + S
Sbjct  132  P-PDIPVVQVSEDLVVNVSRALRNDINRALHLFREIAMGHDLKKFLGVIVGLWVLSGVGS  190

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              D LTL YI  L+  TVP++Y+KY+ K++    R   +  + Y ++  K
Sbjct  191  SCDFLTLTYIAVLMLHTVPILYDKYQDKVDHVAGRAHTEALKQYKVLDAK  240



>ref|NP_974275.1| reticulon-like protein B16 [Arabidopsis thaliana]
 sp|Q8GYH6.1|RTNLP_ARATH RecName: Full=Reticulon-like protein B16; Short=AtRTNLB16 [Arabidopsis 
thaliana]
 dbj|BAC42275.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50641.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74972.1| reticulon-like protein B16 [Arabidopsis thaliana]
Length=226

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 88/167 (53%), Gaps = 1/167 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+R+ L++  I+IST  W+  E     F++ +S V + V+   F+   +     ++
Sbjct  43   DLLLWRRRHLSLGVIIISTVAWLIFEFSGLPFLSVSSDVLLIVIMISFVHARVSAFRNRQ  102

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
              +    + +S++     A  FR  +N  +     +    ++ +    V  LW+LS I S
Sbjct  103  LHS-LPELVLSEEMVNSAAASFRIKLNHLLVMAHDVTVGNDFRLFFKVVICLWLLSAIGS  161

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMV  689
            ++ L TLLYIG ++ +T+P +Y+KY+ K+++    +  +   +Y +V
Sbjct  162  YISLCTLLYIGTILSVTIPALYSKYQSKVDKCCGTIHRRLSHHYKIV  208



>ref|NP_192861.1| reticulon-like protein B2 [Arabidopsis thaliana]
 sp|Q9SUT9.1|RTNLB_ARATH RecName: Full=Reticulon-like protein B2; Short=AtRTNLB2; AltName: 
Full=VirB2-interacting protein 2 [Arabidopsis thaliana]
 emb|CAB51406.1| putative protein [Arabidopsis thaliana]
 emb|CAB81223.1| putative protein [Arabidopsis thaliana]
 gb|AAK59408.1| unknown protein [Arabidopsis thaliana]
 gb|AAK82535.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAL14401.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAM64366.1| unknown [Arabidopsis thaliana]
 gb|AAN86201.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82986.1| reticulon-like protein B2 [Arabidopsis thaliana]
Length=271

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 87/170 (51%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI +WK K+++      +T  WV  E+  +  +T    V +  +A  F+W N    + K 
Sbjct  87   DIFMWKDKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKS  146

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      ++I ++  ++ A   R  +N+ +     + + R+     +A+A LWVLS++  
Sbjct  147  P-PKIPEVHIPEEPLLQLASGLRIEINRGISSLREIASGRDIKKFLSAIAGLWVLSILGG  205

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
                LTL YI  ++  TVP+ Y+KYE K++  G++   + ++ Y+++  K
Sbjct  206  CYSFLTLAYIALVLLFTVPLFYDKYEDKVDSYGEKAMAELKKQYAVLDAK  255



>ref|XP_002463790.1| hypothetical protein SORBIDRAFT_01g006220 [Sorghum bicolor]
 gb|EER90788.1| hypothetical protein SORBIDRAFT_01g006220 [Sorghum bicolor]
Length=247

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 90/174 (52%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+++ + + ++TA WV  E   + F+T  S+  +  +   FIW N   +L   
Sbjct  63   DVLLWRNKKISSSVLALATAIWVFFEWLDYHFLTIVSFALVLGMVVQFIWSNFSNMLSGS  122

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P +   R+ + ++  V  A      VN+ + F   +  ER       A+A LW  +VI S
Sbjct  123  P-SQVPRVELPEELFVNIAIAIGAQVNKFMCFLQDVSCERNLKHFVVAIAGLWAAAVIGS  181

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              + LT++YIG +   T+PV+Y KYE ++++        L+ QY++    VL K
Sbjct  182  WCNFLTVIYIGFVCVHTLPVLYEKYEDQVDDFLYNLLGLLRDQYQKLDQGVLSK  235



>ref|XP_009415169.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 85/170 (50%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LWK K+ +   +  +TA WV  E+  +  +T      +  +A  F+W N    + K 
Sbjct  67   DVFLWKNKKASAIVLGGATAIWVLFELMEYHLLTLVCHCLILSLAILFLWSNATTFINKS  126

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + I +  +V  A   R  +N+       + A R+     A +  LWVLSVI +
Sbjct  127  P-PHIPEVIIPEDLSVNIALSLRYEINRGFAVLREIAAGRDVKKFLAVIVGLWVLSVIGN  185

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTL YI  +   TVP +Y+KYE +++   ++  V+++++Y+++  K
Sbjct  186  CCNFLTLFYIAFVTLHTVPFLYDKYEDQVDSFAEKATVEFKKHYAVIHAK  235



>ref|NP_001057713.1| Os06g0503400 [Oryza sativa Japonica Group]
 dbj|BAD45275.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF19627.1| Os06g0503400 [Oryza sativa Japonica Group]
 dbj|BAG93532.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 84/170 (49%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLWK K+ +   I  +T  W+  E+  +  +T  S V +  +A  F+W      + K 
Sbjct  82   DVLLWKDKKTSAVVIGGATVIWILFEVLDYHLLTLLSHVMIGALAILFLWSKATTFIKKS  141

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  D   + I +  AV  +   R  +N+++     +    +       + ALWVLS + S
Sbjct  142  P-PDIPVVQIPEDVAVNVSRALRSDINRALHLFREIALGHDLKKFLGVIVALWVLSEVGS  200

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              D LTL+Y+  L+  TVP++Y+KY+ K++    R   +  ++Y ++  K
Sbjct  201  CCDFLTLIYVAVLMLHTVPILYDKYQDKVDHFAGRAHSEACKHYEVLDAK  250



>ref|XP_010053196.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW77460.1| hypothetical protein EUGRSUZ_D01798 [Eucalyptus grandis]
Length=256

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/174 (28%), Positives = 87/174 (50%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++  A+ + T  W   E+  +  +T A+   +  +A  F+W N    + K 
Sbjct  71   DVFLWRNKKVSAGALGVVTVIWALFELAEYHLLTLAAHCLILTLAVLFLWSNAHAFIHKS  130

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + I ++  ++ A   R  +NQ+      + + ++       +A LW+LS+  +
Sbjct  131  P-PRIPEVSIPEEPVLQFASALRLEINQAFAVLRDIASGKDLKKFLLVIAGLWLLSIAGN  189

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              + LTL YI  ++  TVPV+Y K+E KI+   +R    LK QY  + + VL K
Sbjct  190  WCNFLTLFYIVFVLLHTVPVLYEKFEDKIDPFAERAMGELKKQYAVFDAKVLSK  243



>gb|KFK37395.1| hypothetical protein AALP_AA4G251600 [Arabis alpina]
Length=249

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 85/164 (52%), Gaps = 1/164 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+L+ A + ++TA WV  E+  +  ++    +++  +   F+W N    + K 
Sbjct  66   DVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFIKKS  125

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +++ +++ +  A   R  VNQ+      +   R+       +  LW++SV+ +
Sbjct  126  P-PQIPEIHVPEEAFLVIASSLRNEVNQAFVILRSIALGRDLKKFLMVIVGLWIISVVGN  184

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYY  680
              + LTL+YI  +V  TVP++Y K+E K++   ++   + ++ Y
Sbjct  185  WFNFLTLVYICFVVLHTVPMMYEKHEDKVDPFAEKAMKELQKQY  228



>ref|XP_006476478.1| PREDICTED: reticulon-like protein B2-like [Citrus sinensis]
 gb|KDO76366.1| hypothetical protein CISIN_1g039009mg [Citrus sinensis]
Length=256

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 89/174 (51%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +TA WV  ++  +  +T      +  +A  F+W N    + K 
Sbjct  73   DVFLWRNKKISAGVLGGATAIWVLFQLLEYHLLTLVCHCLIVALAVLFLWSNASTFINKS  132

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +YI ++  ++ A   R  +N++      + + R+     + +A LWV+S++ S
Sbjct  133  P-PRIPEVYIPEEPVLQLASALRFEINRAFTLLREIASGRDLKKFLSVIAGLWVVSIVGS  191

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              + LTL YI  ++  TVPVIY KYE +++   ++    +K QY  + + VL K
Sbjct  192  WCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSK  245



>gb|EYU32181.1| hypothetical protein MIMGU_mgv1a012219mg [Erythranthe guttata]
Length=258

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/166 (27%), Positives = 85/166 (51%), Gaps = 1/166 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++   +   TA WV  E+  +  +T    + +F ++  F+W N+   + K 
Sbjct  75   DIFLWRDKKISGGVLGGVTAVWVLFELLEYHLLTLVCHIVIFTLSMLFLWSNVTIFINKR  134

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + +S++  V  A   R  +N++      + + R+       VA LW  S++ S
Sbjct  135  PPP-IPVVSLSEEPFVGVALALRNEINRTCAVLREIASGRDLKKFLVVVAVLWFFSIVGS  193

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSM  686
              + LTL Y+  ++  TVPV+Y KY +KI+   ++  V+ ++ Y++
Sbjct  194  CCNFLTLFYLVFVLLHTVPVLYEKYNEKIDAFTEKATVEIKKQYAV  239



>gb|KDP22201.1| hypothetical protein JCGZ_26032 [Jatropha curcas]
Length=248

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 93/170 (55%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+++ + +  +T  WV  E+  +  IT    +++  +A  F+W N    + K 
Sbjct  64   DVLLWRNKQVSASVLGGATVVWVLFELLEYHLITLVCHISILTLAILFLWSNASTFVNKS  123

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +  ++ + ++  ++ A   R  +N+++     + A R+       +A+LWVLS+I S
Sbjct  124  P-PEIPQIVLPEKYVLEIASALRIEINRALAVLHDIAAGRDVKTFLTVIASLWVLSIIGS  182

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + LTLLYI  ++  TVP+ Y KYE +I+   ++  ++ ++ Y +  +K
Sbjct  183  WFNFLTLLYIVFVLLHTVPLAYEKYEDQIDPIAEKAWIEIKKQYVVFDEK  232



>ref|XP_002273700.1| PREDICTED: reticulon-like protein B12 isoform X1 [Vitis vinifera]
 emb|CBI30438.3| unnamed protein product [Vitis vinifera]
Length=209

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/152 (28%), Positives = 82/152 (54%), Gaps = 1/152 (1%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            + D++LW++K L +  ++++ A WV  E+  +T ++  S V + +V+  F+W     +L 
Sbjct  23   VADVMLWRQKNLTVGILLVTLAAWVVFELSGYTLLSLVSSVFLLLVSILFLWAKSAAILN  82

Query  363  KEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvi  542
            + PA     +Y+S++   + A   R   N  ++ +  +   ++  +     A LW++SV+
Sbjct  83   R-PAPPLPNLYLSEEIVNEVAAFIRTRTNTLLQVSQDIALGKDSRMFFKVAAYLWLISVV  141

Query  543  asHLDLLTLLYIGELVGLTVPVIYNKYEQKIN  638
                D LTL YI  ++ LTVP +Y +YE  I+
Sbjct  142  GGLTDFLTLGYISLVIVLTVPALYERYEDYID  173



>ref|XP_010654209.1| PREDICTED: reticulon-like protein B12 isoform X2 [Vitis vinifera]
Length=190

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/152 (28%), Positives = 82/152 (54%), Gaps = 1/152 (1%)
 Frame = +3

Query  183  IKDILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLG  362
            + D++LW++K L +  ++++ A WV  E+  +T ++  S V + +V+  F+W     +L 
Sbjct  4    VADVMLWRQKNLTVGILLVTLAAWVVFELSGYTLLSLVSSVFLLLVSILFLWAKSAAILN  63

Query  363  KEPAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvi  542
            + PA     +Y+S++   + A   R   N  ++ +  +   ++  +     A LW++SV+
Sbjct  64   R-PAPPLPNLYLSEEIVNEVAAFIRTRTNTLLQVSQDIALGKDSRMFFKVAAYLWLISVV  122

Query  543  asHLDLLTLLYIGELVGLTVPVIYNKYEQKIN  638
                D LTL YI  ++ LTVP +Y +YE  I+
Sbjct  123  GGLTDFLTLGYISLVIVLTVPALYERYEDYID  154



>ref|XP_007139767.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
 gb|ESW11761.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
Length=256

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/190 (26%), Positives = 99/190 (52%), Gaps = 6/190 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+++   +  +TA WV  E+  + F+T    + + ++A  F+W N    + K 
Sbjct  73   DVLLWRNKKISAGVLGGATAVWVLFELLEYHFLTLVCHILILLLAVLFLWSNAHTFIHKS  132

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      +++ ++  ++ A V R  +N+       +G+ R+       +A +W+LS++ +
Sbjct  133  P-PRIPDVHLPEEPILQVASVLRIEINRGFAVLHSIGSGRDLKKFLMVIAGVWILSIVGN  191

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQKSSELKTMMLQ  728
              + LTL YI  ++  T PV+Y KYE KI+   ++  ++ ++ Y++      + K +   
Sbjct  192  WCNFLTLFYITFILLHTTPVLYEKYEDKIDPLAEKAVIEIKKQYAVF-----DAKVLSKI  246

Query  729  KTGDLKNKVS  758
              G LK K+S
Sbjct  247  PVGLLKAKLS  256



>ref|XP_008344578.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=260

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 85/165 (52%), Gaps = 1/165 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++   +  +T  WV  E+ ++  +T    + +  +A  F+W N    + K 
Sbjct  78   DVFLWRNKKVSAGVLSGATVIWVLFELLQYHLLTLVGHILIGALAILFLWSNAHAFIHKT  137

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + + ++  ++ A   R  +N +      + + R+     A +A LWVLSV+  
Sbjct  138  P-PRIPEVRLPEEPFLQVASELRVQINCAFALLHDIASGRDLKKFLAVIAGLWVLSVVGK  196

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYS  683
              + LTL YI  +V  TVPVIY KYE KI+   +R  +++++ Y+
Sbjct  197  WCNFLTLFYICFVVLHTVPVIYEKYEDKIDPLAERATIEFKKQYA  241



>ref|XP_008811812.1| PREDICTED: reticulon-like protein B8 [Phoenix dactylifera]
 ref|XP_008811814.1| PREDICTED: reticulon-like protein B8 [Phoenix dactylifera]
Length=242

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 92/180 (51%), Gaps = 7/180 (4%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+ K+++ + +  +TATWV  E  ++  +T   +  +  +   F+W N   +L + 
Sbjct  64   DVLLWRNKKISSSVLTGATATWVLFEWLQYNILTILCFALVIGMLIQFLWSNASDMLSRS  123

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P +   R+ + ++  +  A      +NQ + F   +   R        V +LW  +VI S
Sbjct  124  P-SQVPRLVLPEELFINIAVCIGAQINQFLGFIQDVACGRNLRQSLVVVVSLWAAAVIGS  182

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINE-----SGQRLKVQYRRYYSMVLQKSSELK  713
              + LT+LYIG +   T+PV+Y KYE ++++      GQ L+ +YR+  + V  K +  K
Sbjct  183  WCNFLTVLYIGFVCAHTLPVLYEKYEDQVDDFVYNLIGQ-LQNRYRKVDASVFSKMANGK  241



>gb|KHG24129.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=250

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 89/174 (51%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            DI LW+ K+++  A+ ++T  W+  E+  +  +T    + +  +A  F+W N    + K 
Sbjct  66   DIFLWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALAVLFLWSNAATFINKS  125

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P      + I +   ++ A   R  +N++      + + RE     + +A LWVLS++ S
Sbjct  126  P-PRIPEVQIPKDPVMEFAQALRFEINRAFAVLRDIASGRELKKFLSVIAGLWVLSIVGS  184

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQR----LKVQYRRYYSMVLQK  698
              + LTL YI  ++  TVPV+Y KYE K++   ++    +K QY  + + VL K
Sbjct  185  WCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLSK  238



>ref|XP_006407490.1| hypothetical protein EUTSA_v10021461mg [Eutrema salsugineum]
 gb|ESQ48943.1| hypothetical protein EUTSA_v10021461mg [Eutrema salsugineum]
Length=226

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 88/167 (53%), Gaps = 1/167 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+LLW+R+ L++  IV+ST  W+  E+    F++ +S V +  +   F+   +     ++
Sbjct  43   DLLLWRRRNLSLGVIVLSTVAWLIFELSGLPFLSVSSDVLLIGIIISFVHARVSAFRNRQ  102

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
             A     + +S++     A  FR  +NQ +     +    ++ +    V  LW+LS I S
Sbjct  103  -ANSLPELVLSEEMVNSAAASFRIKLNQLLVMAHDVTVGNDFRLFFKVVICLWILSAIGS  161

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMV  689
            ++   TL+YIG ++ +T+P +Y+KY+ K+++    +  Q   +Y +V
Sbjct  162  YISFCTLVYIGTILSVTIPALYSKYQSKVDKCCGLIHRQLSHHYKLV  208



>ref|XP_002275520.1| PREDICTED: reticulon-like protein B5 [Vitis vinifera]
 emb|CBI22609.3| unnamed protein product [Vitis vinifera]
Length=254

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 88/170 (52%), Gaps = 1/170 (1%)
 Frame = +3

Query  189  DILLWKRKRLNIAAIVISTATWVALEIYRFTFITAASWVAMFVVAAFFIWGNIDRLLGKE  368
            D+ LW+ K+++ + +  +TA WV  E+  +  +     + M  +A+ F+W N   ++ K 
Sbjct  70   DVFLWRNKKISASVLGCATAIWVLFEMLEYQLLPLLCHILMLSLASLFLWSNASIVIKKS  129

Query  369  PAADTSRMYISQQSAVKTADVFRRCVNQSVEFTLRLGAEREWYvvaaavaalwvlsvias  548
            P  +   + + +++ ++        +N+ +     + + R      A  A LWVLS +  
Sbjct  130  P-PNIPEVGVPEKAVMEITSALLYAINRGLTSLHNIASGRHLKQFLAVTAGLWVLSAVGR  188

Query  549  HLDLLTLLYIGELVGLTVPVIYNKYEQKINESGQRLKVQYRRYYSMVLQK  698
              + +TL Y+  ++  TVPVIY KYE +++ S +++K + +  Y ++ +K
Sbjct  189  WCNFITLFYLLFVLLHTVPVIYEKYEDEVDSSAEKVKTEIKNQYRVLCEK  238



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2653716996480