BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15697_g1_i1 len=1004 path=[1:0-890 892:891-1003]

Length=1004
                                                                      Score     E

emb|CDP15954.1|  unnamed protein product                                200   2e-58   
ref|XP_009794562.1|  PREDICTED: uncharacterized protein LOC104241317    180   5e-51   
ref|XP_009586598.1|  PREDICTED: uncharacterized protein LOC104084453    176   1e-49   
ref|XP_010246440.1|  PREDICTED: uncharacterized protein LOC104589726    172   5e-48   
ref|XP_007044083.1|  Uncharacterized protein TCM_008922                 172   2e-47   
gb|AES66960.2|  DUF1685 family protein                                  170   3e-47   
gb|ACU23192.1|  unknown                                                 169   6e-47   Glycine max [soybeans]
ref|XP_004487581.1|  PREDICTED: uncharacterized protein LOC101503885    169   2e-46   
ref|NP_001241326.1|  uncharacterized protein LOC100807366               167   8e-46   
ref|XP_010274414.1|  PREDICTED: uncharacterized protein LOC104609737    166   1e-45   
gb|KEH38854.1|  DUF1685 family protein                                  167   1e-45   
ref|XP_003596709.1|  hypothetical protein MTR_2g083910                  167   2e-45   
ref|XP_010999777.1|  PREDICTED: uncharacterized protein LOC105107522    166   2e-45   
ref|XP_003546042.1|  PREDICTED: uncharacterized protein LOC100782674    165   3e-45   
ref|XP_008225325.1|  PREDICTED: uncharacterized protein LOC103324979    164   7e-45   
ref|XP_002269394.1|  PREDICTED: uncharacterized protein LOC100266883    164   7e-45   Vitis vinifera
ref|XP_002305058.2|  hypothetical protein POPTR_0004s05860g             162   4e-44   Populus trichocarpa [western balsam poplar]
ref|XP_007149725.1|  hypothetical protein PHAVU_005G093900g             160   4e-43   
ref|XP_008371722.1|  PREDICTED: uncharacterized protein LOC103435110    158   2e-42   
ref|XP_002316812.1|  hypothetical protein POPTR_0011s07010g             155   2e-41   Populus trichocarpa [western balsam poplar]
ref|XP_007213349.1|  hypothetical protein PRUPE_ppa1027161mg            155   2e-41   
ref|XP_003527334.1|  PREDICTED: uncharacterized protein LOC100800312    155   2e-41   
ref|NP_001241436.1|  uncharacterized protein LOC100811994               155   3e-41   
gb|KEH36642.1|  DUF1685 family protein                                  157   9e-41   
ref|XP_002522240.1|  conserved hypothetical protein                     155   9e-41   Ricinus communis
gb|KDP21126.1|  hypothetical protein JCGZ_21597                         152   2e-40   
ref|XP_006446825.1|  hypothetical protein CICLE_v10016386mg             153   2e-40   
ref|XP_007159478.1|  hypothetical protein PHAVU_002G240700g             152   4e-40   
ref|XP_003543003.1|  PREDICTED: uncharacterized protein LOC100781024    152   4e-40   
gb|AET04282.2|  DUF1685 family protein                                  151   7e-40   
ref|XP_003629806.1|  hypothetical protein MTR_8g086820                  151   8e-40   
ref|XP_003531264.1|  PREDICTED: uncharacterized protein LOC100814411    151   8e-40   
gb|KDO63416.1|  hypothetical protein CISIN_1g041944mg                   151   9e-40   
ref|XP_006467617.1|  PREDICTED: uncharacterized protein LOC102628675    150   2e-39   
ref|XP_007132824.1|  hypothetical protein PHAVU_011G127600g             149   4e-39   
ref|XP_003524968.1|  PREDICTED: uncharacterized protein LOC100792716    149   5e-39   
gb|KHN36708.1|  hypothetical protein glysoja_001439                     149   5e-39   
gb|KHN48012.1|  hypothetical protein glysoja_015482                     149   6e-39   
ref|XP_009352733.1|  PREDICTED: uncharacterized protein LOC103944066    148   6e-39   
ref|XP_007025324.1|  Uncharacterized protein TCM_029658                 149   8e-39   
gb|KHN06416.1|  hypothetical protein glysoja_010760                     148   1e-38   
gb|ACU23694.1|  unknown                                                 148   1e-38   Glycine max [soybeans]
ref|XP_006449540.1|  hypothetical protein CICLE_v10016436mg             148   2e-38   
ref|XP_007216770.1|  hypothetical protein PRUPE_ppa024447mg             148   2e-38   
ref|XP_011039395.1|  PREDICTED: uncharacterized protein LOC105135974    147   3e-38   
ref|XP_002277345.1|  PREDICTED: uncharacterized protein LOC100260838    145   1e-37   Vitis vinifera
ref|XP_009593785.1|  PREDICTED: uncharacterized protein LOC104090403    145   2e-37   
ref|XP_004485927.1|  PREDICTED: uncharacterized protein LOC101512973    144   5e-37   
ref|XP_010100736.1|  hypothetical protein L484_005803                   144   6e-37   
ref|XP_011083310.1|  PREDICTED: uncharacterized protein LOC105165845    142   3e-36   
ref|XP_009353410.1|  PREDICTED: uncharacterized protein LOC103944673    141   3e-36   
gb|AFK43794.1|  unknown                                                 142   4e-36   
ref|XP_011082982.1|  PREDICTED: uncharacterized protein LOC105165613    140   8e-36   
ref|XP_008366054.1|  PREDICTED: uncharacterized protein LOC103429701    141   9e-36   
emb|CDO96846.1|  unnamed protein product                                139   3e-35   
gb|AFK40408.1|  unknown                                                 137   3e-35   
ref|XP_004504284.1|  PREDICTED: uncharacterized protein LOC101494080    139   4e-35   
ref|XP_008228946.1|  PREDICTED: uncharacterized protein LOC103328331    139   4e-35   
ref|XP_002277325.1|  PREDICTED: uncharacterized protein LOC100266042    138   6e-35   Vitis vinifera
ref|XP_011101455.1|  PREDICTED: uncharacterized protein LOC105179506    134   2e-33   
ref|XP_008455295.1|  PREDICTED: uncharacterized protein LOC103495495    133   3e-33   
ref|XP_009365283.1|  PREDICTED: uncharacterized protein LOC103955136    134   3e-33   
emb|CBI22018.3|  unnamed protein product                                130   4e-33   
ref|XP_009766224.1|  PREDICTED: uncharacterized protein LOC104217628    131   2e-32   
ref|XP_006348891.1|  PREDICTED: uncharacterized protein LOC102578884    131   2e-32   
emb|CDP15956.1|  unnamed protein product                                131   2e-32   
ref|XP_010314075.1|  PREDICTED: uncharacterized protein LOC104644911    129   5e-32   
ref|XP_009591668.1|  PREDICTED: uncharacterized protein LOC104088654    129   1e-31   
ref|XP_004243270.1|  PREDICTED: uncharacterized protein LOC101267910    129   2e-31   
gb|KGN61130.1|  hypothetical protein Csa_2G058630                       127   3e-31   
ref|XP_009790979.1|  PREDICTED: uncharacterized protein LOC104238348    127   3e-31   
ref|XP_009804439.1|  PREDICTED: uncharacterized protein LOC104249662    127   4e-31   
gb|AFK41310.1|  unknown                                                 127   5e-31   
ref|XP_003607621.1|  hypothetical protein MTR_4g080340                  127   5e-31   
ref|XP_008381194.1|  PREDICTED: uncharacterized protein LOC103444064    128   5e-31   
ref|XP_008460386.1|  PREDICTED: uncharacterized protein LOC103499218    127   5e-31   
ref|XP_010317344.1|  PREDICTED: uncharacterized protein LOC104646047    126   1e-30   
ref|XP_004136833.1|  PREDICTED: uncharacterized protein LOC101209175    125   2e-30   
gb|EYU30763.1|  hypothetical protein MIMGU_mgv1a025120mg                123   4e-30   
ref|XP_009591632.1|  PREDICTED: uncharacterized protein LOC104088627    124   8e-30   
ref|XP_011098377.1|  PREDICTED: uncharacterized protein LOC105177052    123   1e-29   
gb|KCW47364.1|  hypothetical protein EUGRSUZ_K01150                     122   2e-29   
ref|XP_010686232.1|  PREDICTED: uncharacterized protein LOC104900508    124   2e-29   
ref|XP_010040033.1|  PREDICTED: uncharacterized protein LOC104428796    123   3e-29   
ref|XP_010040036.1|  PREDICTED: uncharacterized protein LOC104428799    120   2e-28   
ref|XP_010059035.1|  PREDICTED: uncharacterized protein LOC104446943    120   3e-28   
emb|CBI30714.3|  unnamed protein product                                118   3e-28   
ref|XP_004303200.1|  PREDICTED: uncharacterized protein LOC101313135    120   3e-28   
ref|XP_010038705.1|  PREDICTED: uncharacterized protein LOC104427291    117   3e-28   
ref|XP_008439724.1|  PREDICTED: uncharacterized protein LOC103484438    117   3e-27   
ref|XP_003629798.1|  hypothetical protein MTR_8g086670                  112   7e-27   
ref|XP_010317343.1|  PREDICTED: uncharacterized protein LOC104646046    115   8e-27   
ref|XP_006294801.1|  hypothetical protein CARUB_v10023852mg             116   1e-26   
gb|KGN49319.1|  hypothetical protein Csa_6G519700                       114   2e-26   
ref|XP_010524072.1|  PREDICTED: uncharacterized protein LOC104802264    115   4e-26   
ref|XP_010040035.1|  PREDICTED: uncharacterized protein LOC104428798    114   7e-26   
gb|KCW45543.1|  hypothetical protein EUGRSUZ_L00732                     111   4e-25   
gb|ACU17606.1|  unknown                                                 111   4e-25   Glycine max [soybeans]
ref|XP_006411544.1|  hypothetical protein EUTSA_v10017132mg             110   2e-24   
ref|XP_007148013.1|  hypothetical protein PHAVU_006G173300g             108   2e-24   
ref|XP_010102120.1|  hypothetical protein L484_021354                   109   3e-24   
ref|XP_002881871.1|  hypothetical protein ARALYDRAFT_483373             108   7e-24   
ref|XP_008366658.1|  PREDICTED: uncharacterized protein LOC103430300    103   8e-24   
gb|KGN65040.1|  hypothetical protein Csa_1G181530                       105   2e-23   
gb|KGN65608.1|  hypothetical protein Csa_1G470240                       107   2e-23   
gb|KCW74140.1|  hypothetical protein EUGRSUZ_E02771                     106   3e-23   
ref|XP_009115260.1|  PREDICTED: uncharacterized protein LOC103840505    103   3e-23   
ref|XP_009142082.1|  PREDICTED: uncharacterized protein LOC103865964    105   5e-23   
ref|XP_010517817.1|  PREDICTED: uncharacterized protein LOC104793203    106   5e-23   
emb|CDY50782.1|  BnaA09g54110D                                          102   8e-23   
ref|XP_010059032.1|  PREDICTED: uncharacterized protein LOC104446940    107   1e-22   
ref|XP_010040852.1|  PREDICTED: uncharacterized protein LOC104429715    104   2e-22   
gb|KCW74145.1|  hypothetical protein EUGRSUZ_E02780                     103   3e-22   
ref|XP_006850606.1|  hypothetical protein AMTR_s00034p00131640          102   5e-22   
gb|KFK37122.1|  hypothetical protein AALP_AA4G215600                    102   6e-22   
gb|EYU28109.1|  hypothetical protein MIMGU_mgv1a022012mg                100   6e-22   
ref|XP_006303781.1|  hypothetical protein CARUB_v10012027mg             100   7e-22   
ref|XP_004155514.1|  PREDICTED: uncharacterized protein LOC101232662    101   8e-22   
emb|CDY14852.1|  BnaC04g48490D                                          102   1e-21   
ref|XP_010059038.1|  PREDICTED: uncharacterized protein LOC104446946    102   1e-21   
gb|EYU37337.1|  hypothetical protein MIMGU_mgv11b016324mg               101   1e-21   
ref|XP_006830214.1|  hypothetical protein AMTR_s00130p00028330          102   2e-21   
ref|NP_181804.1|  uncharacterized protein                               101   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010925601.1|  PREDICTED: putative WAS protein family homol...    100   3e-21   
emb|CDX99803.1|  BnaC05g22250D                                        97.8    4e-21   
ref|XP_010059037.1|  PREDICTED: uncharacterized protein LOC104446945  98.2    6e-21   
ref|XP_006303202.1|  hypothetical protein CARUB_v10011127mg           92.4    3e-19   
emb|CDP06723.1|  unnamed protein product                              95.1    4e-19   
ref|XP_004249495.1|  PREDICTED: uncharacterized protein LOC101249595  93.6    4e-19   
gb|KHN02356.1|  hypothetical protein glysoja_002380                   94.4    5e-19   
ref|XP_003553543.1|  PREDICTED: uncharacterized protein LOC100786645  94.4    5e-19   
ref|XP_002519556.1|  conserved hypothetical protein                   92.4    7e-19   Ricinus communis
ref|XP_008790021.1|  PREDICTED: uncharacterized protein LOC103707351  93.6    1e-18   
ref|XP_008239371.1|  PREDICTED: uncharacterized protein LOC103337975  94.0    1e-18   
gb|AFW86969.1|  hypothetical protein ZEAMMB73_882946                  90.9    2e-18   
ref|XP_006577012.1|  PREDICTED: uncharacterized protein LOC102667501  92.0    3e-18   
ref|XP_010915479.1|  PREDICTED: programmed cell death protein 7-like  92.4    3e-18   
ref|XP_009358150.1|  PREDICTED: uncharacterized protein LOC103948809  92.0    5e-18   
ref|XP_008659691.1|  PREDICTED: uncharacterized protein LOC103638600  91.3    5e-18   
ref|XP_010046753.1|  PREDICTED: uncharacterized protein LOC104435755  90.9    9e-18   
gb|KHG19373.1|  rna exonuclease 3                                     90.5    2e-17   
gb|KDP29097.1|  hypothetical protein JCGZ_16486                       90.1    2e-17   
ref|XP_008369743.1|  PREDICTED: uncharacterized protein LOC103433275  89.7    3e-17   
ref|XP_006381475.1|  hypothetical protein POPTR_0006s13180g           89.4    3e-17   
ref|XP_007162732.1|  hypothetical protein PHAVU_001G175800g           89.0    4e-17   
ref|XP_007027287.1|  Uncharacterized protein TCM_022118               89.4    4e-17   
ref|XP_011048575.1|  PREDICTED: uncharacterized protein LOC105142...  88.6    6e-17   
ref|XP_011048574.1|  PREDICTED: uncharacterized protein LOC105142...  88.6    6e-17   
gb|KCW75609.1|  hypothetical protein EUGRSUZ_E04347                   87.4    1e-16   
ref|XP_004294142.1|  PREDICTED: uncharacterized protein LOC101306310  87.4    2e-16   
ref|NP_001057835.1|  Os06g0550800                                     87.0    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003563777.1|  PREDICTED: uncharacterized protein LOC100825390  86.3    2e-16   
gb|KCW74146.1|  hypothetical protein EUGRSUZ_E02782                   85.9    3e-16   
ref|XP_010107564.1|  hypothetical protein L484_024420                 85.5    5e-16   
gb|KCW45545.1|  hypothetical protein EUGRSUZ_L00734                   84.7    7e-16   
ref|XP_008226466.1|  PREDICTED: uncharacterized protein LOC103326040  85.5    1e-15   
ref|XP_006591846.1|  PREDICTED: uncharacterized protein LOC100527...  85.5    1e-15   
gb|KDO35922.1|  hypothetical protein CISIN_1g025682mg                 84.3    1e-15   
ref|XP_006480639.1|  PREDICTED: uncharacterized protein LOC102612278  84.3    1e-15   
ref|XP_010253606.1|  PREDICTED: uncharacterized protein LOC104594811  84.3    2e-15   
ref|XP_007021600.1|  Serine/arginine repetitive matrix protein 2,...  84.7    2e-15   
ref|XP_007149427.1|  hypothetical protein PHAVU_005G069500g           84.3    3e-15   
ref|XP_009339321.1|  PREDICTED: uncharacterized protein LOC103931537  84.3    4e-15   
ref|XP_007213579.1|  hypothetical protein PRUPE_ppa014990mg           84.0    5e-15   
ref|XP_009784159.1|  PREDICTED: uncharacterized protein LOC104232609  82.4    6e-15   
gb|KHG27555.1|  hypothetical protein F383_14062                       82.4    8e-15   
ref|XP_004517128.1|  PREDICTED: uncharacterized protein LOC101512525  83.2    8e-15   
dbj|BAK07204.1|  predicted protein                                    82.0    9e-15   
emb|CBI20241.3|  unnamed protein product                              80.9    1e-14   
ref|XP_004493960.1|  PREDICTED: uncharacterized protein LOC101490574  81.6    1e-14   
ref|XP_010675463.1|  PREDICTED: uncharacterized protein LOC104891465  82.4    2e-14   
ref|XP_004965581.1|  PREDICTED: serine/arginine repetitive matrix...  81.3    2e-14   
ref|XP_008363621.1|  PREDICTED: uncharacterized protein LOC103427337  82.0    2e-14   
ref|XP_003541833.1|  PREDICTED: uncharacterized protein LOC100803315  82.0    3e-14   
ref|XP_010279224.1|  PREDICTED: uncharacterized protein LOC104613196  80.5    4e-14   
ref|XP_010098450.1|  hypothetical protein L484_012165                 81.6    4e-14   
ref|XP_007205680.1|  hypothetical protein PRUPE_ppa009620mg           80.5    4e-14   
gb|KCW74143.1|  hypothetical protein EUGRSUZ_E02775                   79.0    7e-14   
ref|XP_011077361.1|  PREDICTED: uncharacterized protein LOC105161392  79.0    1e-13   
ref|XP_010040037.1|  PREDICTED: uncharacterized protein LOC104428800  78.6    1e-13   
emb|CBI32707.3|  unnamed protein product                              79.0    1e-13   
emb|CAN63558.1|  hypothetical protein VITISV_034122                   80.9    1e-13   Vitis vinifera
ref|XP_002285236.1|  PREDICTED: uncharacterized protein LOC100257151  80.9    1e-13   Vitis vinifera
ref|XP_010059036.1|  PREDICTED: uncharacterized protein LOC104446944  76.3    1e-13   
ref|XP_009601138.1|  PREDICTED: uncharacterized protein LOC104096...  79.0    2e-13   
ref|XP_010916029.1|  PREDICTED: uncharacterized protein LOC105040...  78.6    2e-13   
ref|XP_010653545.1|  PREDICTED: uncharacterized protein LOC100854914  78.2    2e-13   
ref|XP_009601139.1|  PREDICTED: uncharacterized protein LOC104096...  78.6    2e-13   
ref|XP_010916028.1|  PREDICTED: uncharacterized protein LOC105040...  78.2    2e-13   
ref|XP_008442668.1|  PREDICTED: late secretory pathway protein AV...  77.4    4e-13   
gb|KEH38674.1|  hypothetical protein MTR_2g078620                     77.8    8e-13   
gb|KCW74141.1|  hypothetical protein EUGRSUZ_E02773                   75.9    9e-13   
ref|XP_004137815.1|  PREDICTED: uncharacterized protein LOC101215662  75.9    1e-12   
ref|XP_004165143.1|  PREDICTED: uncharacterized LOC101215662          75.9    2e-12   
ref|XP_008783125.1|  PREDICTED: uncharacterized protein LOC103702463  75.5    2e-12   
ref|XP_007212450.1|  hypothetical protein PRUPE_ppa017283mg           73.9    3e-12   
ref|XP_010059033.1|  PREDICTED: uncharacterized protein LOC104446941  73.9    5e-12   
ref|XP_009385553.1|  PREDICTED: uncharacterized protein LOC103972892  73.9    5e-12   
ref|XP_006451767.1|  hypothetical protein CICLE_v10010201mg           75.5    5e-12   
ref|XP_009404523.1|  PREDICTED: forkhead box protein G1-like          73.9    8e-12   
ref|XP_009341291.1|  PREDICTED: uncharacterized protein LOC103933323  74.7    9e-12   
ref|XP_010696407.1|  PREDICTED: uncharacterized protein LOC104908935  73.9    1e-11   
ref|XP_009390733.1|  PREDICTED: uncharacterized protein LOC103977053  73.6    2e-11   
ref|XP_002523267.1|  conserved hypothetical protein                   73.9    2e-11   Ricinus communis
ref|XP_011082714.1|  PREDICTED: uncharacterized protein LOC105165412  73.6    2e-11   
ref|XP_010264742.1|  PREDICTED: uncharacterized protein LOC104602661  71.2    7e-11   
ref|XP_004159879.1|  PREDICTED: uncharacterized protein LOC101225687  72.4    1e-10   
gb|KGN57636.1|  hypothetical protein Csa_3G236040                     72.4    1e-10   
gb|EYU30762.1|  hypothetical protein MIMGU_mgv1a022590mg              68.9    1e-10   
ref|XP_002457038.1|  hypothetical protein SORBIDRAFT_03g000320        70.9    3e-10   Sorghum bicolor [broomcorn]
ref|XP_010541165.1|  PREDICTED: uncharacterized protein LOC104814689  67.8    4e-10   
gb|AFK41563.1|  unknown                                               67.0    1e-09   
ref|XP_010059034.1|  PREDICTED: uncharacterized protein LOC104446942  65.9    1e-09   
gb|KCW74142.1|  hypothetical protein EUGRSUZ_E02774                   66.2    1e-09   
gb|EPS61787.1|  hypothetical protein M569_13011                       64.3    2e-09   
ref|XP_010062846.1|  PREDICTED: uncharacterized protein LOC104450110  67.8    3e-09   
ref|XP_004967336.1|  PREDICTED: uncharacterized protein LOC101777454  67.8    3e-09   
ref|XP_006643978.1|  PREDICTED: uncharacterized protein LOC102712021  67.0    5e-09   
ref|XP_004146273.1|  PREDICTED: uncharacterized protein LOC101208087  65.5    2e-08   
ref|NP_001042550.1|  Os01g0241000                                     62.8    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008445628.1|  PREDICTED: uncharacterized protein LOC103488589  58.5    2e-07   
ref|XP_009390133.1|  PREDICTED: uncharacterized protein LOC103976591  60.1    2e-07   
ref|XP_008446725.1|  PREDICTED: uncharacterized protein LOC103489359  60.1    2e-07   
gb|AFG65733.1|  hypothetical protein 0_3683_01                        58.5    4e-07   
gb|ABK22856.1|  unknown                                               57.4    1e-06   Picea sitchensis
gb|EYU26356.1|  hypothetical protein MIMGU_mgv1a010685mg              58.9    2e-06   
ref|XP_010230679.1|  PREDICTED: uncharacterized protein LOC100823668  58.9    2e-06   
gb|ABK23726.1|  unknown                                               56.6    2e-06   Picea sitchensis
ref|XP_004304411.1|  PREDICTED: uncharacterized protein LOC101305283  58.2    3e-06   
ref|XP_002893555.1|  predicted protein                                55.8    5e-06   
ref|XP_001753980.1|  predicted protein                                58.2    5e-06   
emb|CDM85321.1|  unnamed protein product                              55.5    5e-06   
ref|XP_009780657.1|  PREDICTED: uncharacterized protein LOC104229676  56.6    9e-06   
emb|CDY47701.1|  BnaA10g03900D                                        54.3    2e-05   
ref|XP_003564844.1|  PREDICTED: uncharacterized protein LOC100842634  53.9    2e-05   
ref|XP_006443074.1|  hypothetical protein CICLE_v10022453mg           54.3    2e-05   
dbj|BAK00756.1|  predicted protein                                    53.5    2e-05   
ref|XP_006428825.1|  hypothetical protein CICLE_v10013612mg           53.9    3e-05   
ref|XP_009119110.1|  PREDICTED: uncharacterized protein LOC103844090  53.1    3e-05   
emb|CDM85320.1|  unnamed protein product                              52.0    7e-05   
emb|CDY10158.1|  BnaC05g04010D                                        52.0    7e-05   
ref|XP_008790647.1|  PREDICTED: uncharacterized protein LOC103707781  51.6    1e-04   
gb|KDP45851.1|  hypothetical protein JCGZ_15295                       53.1    1e-04   
emb|CDM85319.1|  unnamed protein product                              50.8    2e-04   
ref|XP_001752059.1|  predicted protein                                53.1    2e-04   
ref|XP_009609883.1|  PREDICTED: uncharacterized protein LOC104103669  52.4    2e-04   
ref|XP_002862293.1|  hypothetical protein ARALYDRAFT_497529           51.2    3e-04   
ref|XP_009402693.1|  PREDICTED: uncharacterized protein LOC103986406  50.4    3e-04   
ref|XP_006295428.1|  hypothetical protein CARUB_v10024525mg           51.2    3e-04   
ref|XP_002984723.1|  hypothetical protein SELMODRAFT_423830           52.4    3e-04   
gb|KFK37170.1|  hypothetical protein AALP_AA4G222800                  50.4    3e-04   
ref|NP_001067693.2|  Os11g0282300                                     50.1    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008385930.1|  PREDICTED: uncharacterized protein LOC103448445  49.7    3e-04   
emb|CDY10005.1|  BnaC08g44460D                                        49.7    4e-04   
ref|XP_006663361.1|  PREDICTED: uncharacterized protein LOC102718501  50.4    4e-04   
emb|CDX83487.1|  BnaA03g20190D                                        49.3    4e-04   
ref|XP_006397499.1|  hypothetical protein EUTSA_v10001651mg           50.1    4e-04   
ref|XP_002879335.1|  hypothetical protein ARALYDRAFT_482083           50.4    5e-04   
gb|AFW56686.1|  hypothetical protein ZEAMMB73_673152                  50.1    6e-04   
ref|XP_009142190.1|  PREDICTED: uncharacterized protein LOC103866068  49.7    6e-04   
emb|CDY19080.1|  BnaA04g18200D                                        49.7    6e-04   
ref|XP_002978809.1|  hypothetical protein SELMODRAFT_443974           51.2    6e-04   
gb|ADE77004.1|  unknown                                               49.3    6e-04   
emb|CDY15396.1|  BnaC04g42270D                                        50.1    6e-04   
ref|XP_010525931.1|  PREDICTED: uncharacterized protein LOC104803633  50.4    7e-04   
emb|CDY06184.1|  BnaA09g50190D                                        48.9    8e-04   
ref|NP_850169.1|  uncharacterized protein                             49.7    8e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010907669.1|  PREDICTED: uncharacterized protein LOC105034285  49.3    0.001   



>emb|CDP15954.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 153/232 (66%), Gaps = 6/232 (3%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLD-DEYKKESKTMMGVLSLKVRSQSD  303
            +AAEEILKLFDS WF+  I T K C +   +KP+ D +E++ E   +  +++L+VRS SD
Sbjct  1    MAAEEILKLFDSYWFEHGIFTSKHCLASSTSKPIHDQEEHELEKSKLASIVNLQVRSLSD  60

Query  304  NLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVARKKL  483
            + +S+ T FSP + S KS I  P L  + +    +  +  +   +K+     ++ + ++ 
Sbjct  61   HCVSYDTGFSPNAASSKSAISTPTLPKILSGVEVSDFSERIEEQEKIETTTTKKFSNRRR  120

Query  484  GGHRSLS---ELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSR--DEVMTNESS  648
                      ELE EELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG +  +E++ ++ +
Sbjct  121  RSRGISRSLSELEYEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGKQGSNELVHDKYA  180

Query  649  VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            V RPYLSEAW +++QRK+ K  ++ RFP + NE NMKD LK WAQTVAS VR
Sbjct  181  VSRPYLSEAWGVLNQRKVNKLPVRRRFPDVDNEINMKDQLKAWAQTVASTVR  232



>ref|XP_009794562.1| PREDICTED: uncharacterized protein LOC104241317 [Nicotiana sylvestris]
Length=218

 Score =   180 bits (456),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 143/239 (60%), Gaps = 33/239 (14%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEILT--RKQCPSVHETKPVLDD--EYKKESKTMMGVLSLKVR  291
            M A EEILKLFD+CWF+ EI      Q  +   TK V ++  E ++ +  +MG      R
Sbjct  1    MAAEEEILKLFDTCWFEQEIFKSLEIQISANVTTKEVQENTHEIQESANILMG------R  54

Query  292  SQSDNLLSF-GTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRV  468
            SQSD  LS   TSFSP  +S  S II                   +    KV + K+RR+
Sbjct  55   SQSDYCLSLDNTSFSPLGNSPTSVII---------------THNRVQEPIKVSDKKRRRI  99

Query  469  ARKK---LGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTN  639
             R+    +   RS S+LE+EELKGFMDLGF F+EEDK+S L +I+PGL++WG R E +  
Sbjct  100  KREVKEIIRIRRSSSDLELEELKGFMDLGFEFSEEDKNSRLVTIVPGLEKWGKRAEEIIE  159

Query  640  ESSVQ----RPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
             S  +    RPYLSE W I+++RKM KKLLKWR P ++NE NMKDNL+ WAQTVAS  R
Sbjct  160  NSKKRDVNSRPYLSEVWEILEKRKMTKKLLKWRVPAMNNEINMKDNLRVWAQTVASTFR  218



>ref|XP_009586598.1| PREDICTED: uncharacterized protein LOC104084453 [Nicotiana tomentosiformis]
Length=214

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/237 (47%), Positives = 143/237 (60%), Gaps = 33/237 (14%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDD--EYKKESKTMMGVLSLKVRSQ  297
            M A EEIL+LFD+CWF+ +I    +  +   TK V ++  E ++ +  +MG      RSQ
Sbjct  1    MAAEEEILRLFDTCWFEQKIF---RFSANVTTKEVQENTHEIQESANLLMG------RSQ  51

Query  298  SDNLLSF-GTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVAR  474
            SD  LS   TSFSP  +S  S II      +Q               K   + K+RR+ R
Sbjct  52   SDYCLSLDNTSFSPLGNSPTSVIITH--NRIQEP------------IKGSDKQKRRRIKR  97

Query  475  KKLGG---HRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNES  645
              + G    RS S+LE+EELKGFMDLGF F+EEDK+S L +IIPGL++WG R E +   S
Sbjct  98   GVVKGIRIRRSSSDLELEELKGFMDLGFEFSEEDKNSRLVTIIPGLEKWGKRAEEIVENS  157

Query  646  SVQ----RPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
              +    RPYLSEAW I+++ KM KKLLKWRFP L NE NMKDNL+ WAQTVAS  R
Sbjct  158  KKRDVNSRPYLSEAWEILEKGKMSKKLLKWRFPALHNEINMKDNLRVWAQTVASTFR  214



>ref|XP_010246440.1| PREDICTED: uncharacterized protein LOC104589726 [Nelumbo nucifera]
Length=229

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 143/232 (62%), Gaps = 13/232 (6%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDD--EYKKESKTM--MGVLSLKVRSQS  300
            AEE+L LFDS WF  +ILT+K  PS   + PV+D   E +KE+  +      +L VR  S
Sbjct  3    AEEVLSLFDSYWFDHQILTKK-PPS---SPPVIDPVPEIQKEAPELEISHPPTLHVRYSS  58

Query  301  DNLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVARK-  477
            D L S   SF   + S  S +  P+LE + +   A   A  +   ++  +  K+   R+ 
Sbjct  59   DQL-SSKASFKSETLSPNSVLPTPKLETILSGKDATEVAEEITRHEEAEKPTKKATGRRR  117

Query  478  KLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG---SRDEVMTNESS  648
            K G  +SLSELE EELKGFMDLGF+F+E DK SSL SIIPGLQR G   S +E   +ES+
Sbjct  118  KRGSSKSLSELEFEELKGFMDLGFIFSEADKDSSLVSIIPGLQRMGKKGSDEEQTIDEST  177

Query  649  VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            + RPYLSEAW+++D+RK    L  WR P   NE +MKD+L+FWA TVAS VR
Sbjct  178  IPRPYLSEAWAVLDRRKERNPLTNWRIPSARNEIDMKDHLRFWAHTVASTVR  229



>ref|XP_007044083.1| Uncharacterized protein TCM_008922 [Theobroma cacao]
 gb|EOX99914.1| Uncharacterized protein TCM_008922 [Theobroma cacao]
Length=268

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 136/237 (57%), Gaps = 13/237 (5%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSDN  306
            +AAEE+LKLFD  WF+  I + K      ET     +  ++    +  + +L VRS SD 
Sbjct  34   MAAEEVLKLFDVYWFEQPIFSEKPVSRSQETSQDHKERVEERELKLPRISTLHVRSMSDL  93

Query  307  LLSFGTSFSPPSDSLKSGIIKPELE------DLQaaataaaaataLLITKKVCEIKKRRV  468
             L+   SFS  S S  S +  P L+      D+                 K   +++R  
Sbjct  94   ALNATVSFSSGSLSPNSVLTTPRLQTILSGKDVNEDNADVKKEKMEEAAAKPILVERRSK  153

Query  469  ARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG-----SRDEVM  633
             R K G  RSLSELE EEL+GFMDLGFVF+EEDK SSL SIIPGLQ+ G     SR+E +
Sbjct  154  TRTK-GSSRSLSELEFEELQGFMDLGFVFSEEDKDSSLVSIIPGLQKLGKKTEESREENI  212

Query  634  TNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
              ++ V RPYLSEAW + D+RK+   L+ WR P + NE +MKD+L+FWA TVAS VR
Sbjct  213  -GQTVVSRPYLSEAWEVWDRRKVKNPLMNWRIPTMGNEVDMKDHLRFWAHTVASTVR  268



>gb|AES66960.2| DUF1685 family protein [Medicago truncatula]
Length=233

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 138/245 (56%), Gaps = 31/245 (13%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPS--VHETKPVLDD--------EYKKESKTMMGVL  276
            +AAE +LKLFD  WF+  I T  + PS  +H T  +LDD        E       ++ + 
Sbjct  1    MAAEHVLKLFDINWFETSIFTNNKKPSSPLHSTT-LLDDSTSMSQVEELHFLDTKLLRIP  59

Query  277  SLKVRSQSDNLL-----SFGTSFSP----PSDSLKSGIIKPELEDLQaaataaaaataLL  429
            +L+VRS SD  L     SF  S SP     S  LK  I   E+E+               
Sbjct  60   TLQVRSFSDENLGTKIGSFSDSLSPNSVLTSQKLKPIISGKEVEEFTLEKEVTD------  113

Query  430  ITKKVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQR  609
             TKKV     R   RK     RSLSELE +ELKGFMDLGFVF+EEDK S L S+IPGL  
Sbjct  114  -TKKVSHRTHRTRLRKGRKTARSLSELEFKELKGFMDLGFVFSEEDKDSGLVSLIPGL--  170

Query  610  WGSRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTV  789
              S+++   +ES + RPYLSEAW ++ Q+K++  LL WR P L NE +MKDNLKFWA TV
Sbjct  171  --SKNQHNVDESVISRPYLSEAWGVIKQKKVVNPLLNWRVPTLGNEIDMKDNLKFWAHTV  228

Query  790  ASAVR  804
            AS VR
Sbjct  229  ASIVR  233



>gb|ACU23192.1| unknown [Glycine max]
Length=226

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 141/234 (60%), Gaps = 15/234 (6%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEIL----TRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVR  291
            M+ AEE+LKL+DSCWF  + L    T    PS HE      D   +E   ++ + S   R
Sbjct  1    MMDAEEVLKLYDSCWFGHQNLKEHTTSSPTPSPHENS---SDHQIREEPMLLRIQSSHSR  57

Query  292  SQSDNLLSFGTSFSPPSDSLK-SGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRV  468
            S SD L S  T F    DSL    +  P+L+ +  +      + A  +  ++  + K R 
Sbjct  58   SMSDQLSSM-TCFK--DDSLSPDSVFSPKLQTI-LSGKDVTDSEAAQVQHQLVLLPKNRE  113

Query  469  ARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTN--E  642
             RKK    +SLS+LE EELKGFMDLGFVF+EEDK SSLASIIPGLQR G  DE   +   
Sbjct  114  RRKKRSS-KSLSDLEFEELKGFMDLGFVFSEEDKDSSLASIIPGLQRLGKSDEEEEDFEG  172

Query  643  SSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            SSVQRPYL EAW I ++RK    L+ W+ P L+NE ++KD+L++WAQTVAS VR
Sbjct  173  SSVQRPYLFEAWKIQERRKKENPLMNWKIPALNNEIDIKDSLRWWAQTVASTVR  226



>ref|XP_004487581.1| PREDICTED: uncharacterized protein LOC101503885 [Cicer arietinum]
Length=252

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/254 (43%), Positives = 139/254 (55%), Gaps = 30/254 (12%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQC--PSVHETKPVLDDEYKKESKTM---------MGV  273
            ++AE++LK +D  WF+  I T K+   PS+H T  VLD      SK M         + +
Sbjct  1    MSAEQVLKSYDISWFETSIFTNKKTSSPSIHSTTLVLDS--TSNSKVMEVLFSDTKLLRI  58

Query  274  LSLKVRSQSDNLLS-----FGTSFSPPS----DSLKSGIIKPELED--LQaaataaaaat  420
             +L VRS SD  LS     F  S SP S      LK+ +    +ED  ++          
Sbjct  59   PTLHVRSFSDENLSSKIGAFSDSLSPNSVLTHQKLKTILSGKVVEDFTIENTHAKEDEEK  118

Query  421  aLLITKKVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPG  600
                TKKV    ++   RK     RSLSELE +ELKGFMDLGFVF EEDK S L S+IPG
Sbjct  119  EAFDTKKVSHHTQKTKLRKGKSTSRSLSELEFKELKGFMDLGFVFAEEDKDSRLVSLIPG  178

Query  601  LQRWGSRDEVMT------NESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKD  762
            LQ+ G  D  +       +E+ + RPYLSEAW +++Q K    LL WR P L NE +MKD
Sbjct  179  LQQLGKDDSSLNKKEHKIDENVICRPYLSEAWGLIEQTKEFNPLLNWRVPILGNEIDMKD  238

Query  763  NLKFWAQTVASAVR  804
            NLKFWA TVAS VR
Sbjct  239  NLKFWAHTVASIVR  252



>ref|NP_001241326.1| uncharacterized protein LOC100807366 [Glycine max]
 gb|ACU20145.1| unknown [Glycine max]
 gb|KHN27955.1| hypothetical protein glysoja_007687 [Glycine soja]
Length=248

 Score =   167 bits (423),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 103/246 (42%), Positives = 137/246 (56%), Gaps = 22/246 (9%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKE----SKTMMGVLSLKVRSQS  300
            AE++L+L D+ WF+  I T K  P  H       + + KE       ++   +L+VRS S
Sbjct  3    AEQVLRLLDANWFETTIFTNKTSPPFHSAVDSASESHVKEVFPLDSKLLRAPTLQVRSLS  62

Query  301  DNLLSFG----TSFSPPSDSLKSGIIKP-----ELEDL---QaaataaaaataLLITKKV  444
            D  LS      + F  P+  L    ++P     E+ED    +           +   KK+
Sbjct  63   DQNLSSSVGVFSDFPSPNSVLTPQRLRPILSGKEVEDFPLAKGNGNHENEEEEVATKKKL  122

Query  445  CEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRD  624
                +RR   +K    RSLS+LE +ELKGFMDLGFVF+EEDK S L S+IPGLQR G  D
Sbjct  123  SHAHRRRRRFRKGKATRSLSDLEFKELKGFMDLGFVFSEEDKDSRLVSLIPGLQRLGKED  182

Query  625  ------EVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQT  786
                  E   +E+ V RPYLSEAW ++DQRK++  LL WR P + NE +MKDNL+FWA T
Sbjct  183  ASRGNSEQNIDETVVCRPYLSEAWGVLDQRKVVNPLLNWRVPVVGNEIDMKDNLRFWAHT  242

Query  787  VASAVR  804
            VAS VR
Sbjct  243  VASIVR  248



>ref|XP_010274414.1| PREDICTED: uncharacterized protein LOC104609737 [Nelumbo nucifera]
Length=232

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 142/232 (61%), Gaps = 10/232 (4%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSDNLL  312
            AEE+L+L+D  WF  +ILT+K   S     PV + + +          +L VRS+SD L 
Sbjct  3    AEEVLQLYDHYWFNHQILTKKPPSSPPVADPVPEIKTETPEPESSRPPALHVRSRSDEL-  61

Query  313  SFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKK------RRVAR  474
            S  T F     S  S +  P+LE + +      A       +KV EI+K       R  R
Sbjct  62   SSKTGFRLEIHSPNSVLPTPKLETILSGKEVTEAREETRKQEKV-EIEKPSKKATGRRRR  120

Query  475  KKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRD--EVMTNESS  648
            KK G  +SLS+LE EELKGFMDLGFVF+EEDK SSL SIIPGLQR G +D  E   +ES+
Sbjct  121  KKKGSSKSLSDLEFEELKGFMDLGFVFSEEDKDSSLVSIIPGLQRLGKKDVEEEAIDEST  180

Query  649  VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            + RPYLSEAW ++DQRK    L+ WR PPL +ET+MKD+L+FWA TVAS VR
Sbjct  181  IPRPYLSEAWGVLDQRKERNPLMNWRIPPLGSETDMKDHLRFWAHTVASTVR  232



>gb|KEH38854.1| DUF1685 family protein [Medicago truncatula]
Length=261

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 112/250 (45%), Positives = 139/250 (56%), Gaps = 35/250 (14%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPS--VHETKPVLDD--------EYKKESKTMMGVL  276
            +AAE +LKLFD  WF+  I T  + PS  +H T  +LDD        E       ++ + 
Sbjct  1    MAAEHVLKLFDINWFETSIFTNNKKPSSPLHSTT-LLDDSTSMSQVEELHFLDTKLLRIP  59

Query  277  SLKVRSQSDNLL-----SFGTSFSP----PSDSLKSGIIKPELEDLQaaataaaaataLL  429
            +L+VRS SD  L     SF  S SP     S  LK  I   E+E+               
Sbjct  60   TLQVRSFSDENLGTKIGSFSDSLSPNSVLTSQKLKPIISGKEVEEFTLEKEVTD------  113

Query  430  ITKKVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQR  609
             TKKV     R   RK     RSLSELE +ELKGFMDLGFVF+EEDK S L S+IPGL  
Sbjct  114  -TKKVSHRTHRTRLRKGRKTARSLSELEFKELKGFMDLGFVFSEEDKDSGLVSLIPGL--  170

Query  610  WGSRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTV  789
              S+++   +ES + RPYLSEAW ++ Q+K++  LL WR P L NE +MKDNLKFWA TV
Sbjct  171  --SKNQHNVDESVISRPYLSEAWGVIKQKKVVNPLLNWRVPTLGNEIDMKDNLKFWAHTV  228

Query  790  ASAVR*CFLL  819
            AS     FLL
Sbjct  229  AS----IFLL  234



>ref|XP_003596709.1| hypothetical protein MTR_2g083910 [Medicago truncatula]
Length=278

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 109/244 (45%), Positives = 137/244 (56%), Gaps = 31/244 (13%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPS--VHETKPVLDD--------EYKKESKTMMGVL  276
            +AAE +LKLFD  WF+  I T  + PS  +H T  +LDD        E       ++ + 
Sbjct  1    MAAEHVLKLFDINWFETSIFTNNKKPSSPLHSTT-LLDDSTSMSQVEELHFLDTKLLRIP  59

Query  277  SLKVRSQSDNLL-----SFGTSFSP----PSDSLKSGIIKPELEDLQaaataaaaataLL  429
            +L+VRS SD  L     SF  S SP     S  LK  I   E+E+               
Sbjct  60   TLQVRSFSDENLGTKIGSFSDSLSPNSVLTSQKLKPIISGKEVEEFTLEKEVTD------  113

Query  430  ITKKVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQR  609
             TKKV     R   RK     RSLSELE +ELKGFMDLGFVF+EEDK S L S+IPGL  
Sbjct  114  -TKKVSHRTHRTRLRKGRKTARSLSELEFKELKGFMDLGFVFSEEDKDSGLVSLIPGL--  170

Query  610  WGSRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTV  789
              S+++   +ES + RPYLSEAW ++ Q+K++  LL WR P L NE +MKDNLKFWA TV
Sbjct  171  --SKNQHNVDESVISRPYLSEAWGVIKQKKVVNPLLNWRVPTLGNEIDMKDNLKFWAHTV  228

Query  790  ASAV  801
            AS +
Sbjct  229  ASII  232



>ref|XP_010999777.1| PREDICTED: uncharacterized protein LOC105107522 [Populus euphratica]
Length=235

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/237 (43%), Positives = 145/237 (61%), Gaps = 17/237 (7%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPSVH----ETKPVLDDEYKKESKTMMGVLSLKVRSQS  300
            A E+++LFDSCWF+ EI  +KQ  S      ET P  +++ K     +  V ++  RS S
Sbjct  3    ATEVIELFDSCWFEMEIF-KKQPSSAKSSSVETNPHQENQEKAPKPEISRVPTIIKRSMS  61

Query  301  DNLLS---FGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITK-KVCEIKKRRV  468
            ++L S   F + FS   DS+   +  P+L  + +         +    +  + E  K++V
Sbjct  62   EDLCSKTSFASGFSFSPDSV---LRSPKLHTILSGKEVTEEEYSTPTERVYILESPKKKV  118

Query  469  ARKKLG---GHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRD--EVM  633
            +R +       +SLSELE EELKGFMDLGFVF+EEDK S+LASIIPGL R G +D  E +
Sbjct  119  SRGRKAKKVTSKSLSELEYEELKGFMDLGFVFSEEDKDSNLASIIPGLHRLGKKDEEEAI  178

Query  634  TNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
             +E +V RPYLSEAW ++++++  + L+ WR P L NE +MKDNL++WA TVAS VR
Sbjct  179  LDEPTVCRPYLSEAWEVLEKKRKEEPLMNWRVPALGNEIDMKDNLRWWAHTVASTVR  235



>ref|XP_003546042.1| PREDICTED: uncharacterized protein LOC100782674 [Glycine max]
 gb|KHN28636.1| hypothetical protein glysoja_040504 [Glycine soja]
Length=226

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 142/234 (61%), Gaps = 15/234 (6%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEIL----TRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVR  291
            M+ AEE+LKL+DSCWF  + L    T    PS HE      D   +E   ++ + S   R
Sbjct  1    MMDAEEVLKLYDSCWFGHQNLKEHTTSSPTPSPHENS---SDHQIREEPMLLRIQSSHSR  57

Query  292  SQSDNLLSFGTSFSPPSDSLK-SGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRV  468
            S SD L S  T F    DSL    +  P+L+ +  +      + A  +  ++  + K R 
Sbjct  58   SMSDQLSSM-TCFK--DDSLSPDSVFSPKLQTI-LSGKDVTDSEAAQVQHQLVLLPKNRE  113

Query  469  ARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG--SRDEVMTNE  642
             RKK    +SLS+LE EELKGFMDLGFVF+EEDK SSLASIIPGLQR G    +E  +  
Sbjct  114  RRKKRSS-KSLSDLEFEELKGFMDLGFVFSEEDKDSSLASIIPGLQRLGKSDEEEEDSEG  172

Query  643  SSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            SSVQRPYLSEAW I ++RK    L+ W+ P L+NE ++KD+L++WAQTVAS VR
Sbjct  173  SSVQRPYLSEAWKIQERRKKENPLMNWKIPALNNEIDIKDSLRWWAQTVASTVR  226



>ref|XP_008225325.1| PREDICTED: uncharacterized protein LOC103324979 [Prunus mume]
Length=234

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 147/236 (62%), Gaps = 12/236 (5%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRK---QCPSVHETKPVLDDEYKKESKTMMGVLSL-KVRS  294
            + A+E+++L+DS WFQ  I  ++     PS  E  PVL+ E +     ++ + +L   RS
Sbjct  1    MEADEVMELYDSYWFQLGIFEKQPNSSNPSRIEADPVLEIEEEPSKPELLRIPTLLHTRS  60

Query  295  QSDNLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKK---RR  465
             SD L S  +  S  S S  S + +P+L  + +   A    T   I + V E  K   RR
Sbjct  61   MSDELSSKTSFNSSSSLSPDSVLHRPKLSTILSGKEATEVETP--IQRHVEESPKKITRR  118

Query  466  VARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDK-SSSLASIIPGLQRWGSRD--EVMT  636
               KK G  +SL++L+ EELKGFMDLGFVF+EEDK  S+LASIIPGLQR G +D  + + 
Sbjct  119  RRNKKKGESKSLTDLQFEELKGFMDLGFVFSEEDKEDSNLASIIPGLQRLGKKDGQDEVF  178

Query  637  NESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            +ES++ RPYLSEAW + DQRK  K L+ WRFP L NE +MKDNL++WA TVAS VR
Sbjct  179  DESAIPRPYLSEAWKVRDQRKREKPLMNWRFPALGNEIDMKDNLRWWAHTVASTVR  234



>ref|XP_002269394.1| PREDICTED: uncharacterized protein LOC100266883 [Vitis vinifera]
Length=230

 Score =   164 bits (415),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 144/232 (62%), Gaps = 12/232 (5%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKE-SKTMMGVLSLK-VRSQSDN  306
            AEE+LKLFDSCWF  EI   K+ PS   +K   D + ++E SK ++     + +RS SD 
Sbjct  3    AEEVLKLFDSCWFNLEIF--KEQPSSSSSKSNTDQQIQEEPSKPVLSRSQTRHIRSISDQ  60

Query  307  LLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVAR---K  477
            L S  TSF+P S S  + I+ P+L+ + +         +          K+  +AR   +
Sbjct  61   LSS-ATSFNPGSFSPDT-ILVPKLQPIFSGREIREEENSTETRAGKASPKRATLARGRRR  118

Query  478  KLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRD---EVMTNESS  648
            K G  +SLS+LE +ELKGF+DLGFVF+E  K SSL SIIPGL R G +D   E   +ES+
Sbjct  119  KKGMSKSLSDLEFDELKGFIDLGFVFSEGAKDSSLVSIIPGLHRLGKKDGEEEKTVDESA  178

Query  649  VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            V RPYLSEAW ++D+RK    L+ WR P LS+E +MKDNL+ WA TVAS+VR
Sbjct  179  VPRPYLSEAWEVLDRRKKENPLMNWRVPALSSEIDMKDNLRSWAHTVASSVR  230



>ref|XP_002305058.2| hypothetical protein POPTR_0004s05860g [Populus trichocarpa]
 gb|ABK93152.1| unknown [Populus trichocarpa]
 gb|EEE85569.2| hypothetical protein POPTR_0004s05860g [Populus trichocarpa]
Length=235

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 101/240 (42%), Positives = 146/240 (61%), Gaps = 23/240 (10%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPSVH-----ETKPVLDDEYKKESKTMMGVLSLKVRSQ  297
            A E+++ FDSCWF+ EI   K+ PS+      E  P  +++ K     +  V ++  RS 
Sbjct  3    ATEVIEFFDSCWFEMEIF--KKQPSLAKSSSVEKNPHQENQEKAPKPEISRVPTIITRSM  60

Query  298  SDNL-----LSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITK-KVCEIKK  459
            S++L     LS G S SP  DS+   +  P+L  + +         +    +  + E  K
Sbjct  61   SEDLCSKTSLSSGFSLSP--DSV---LRAPKLHAILSGKEVKEEEYSTPTERVYILESPK  115

Query  460  RRVARKKLG---GHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDE-  627
            ++V+R + G     +SLSELE EEL+GFMDLGFVF+EEDK S+LASIIPGL R G +DE 
Sbjct  116  KKVSRGRKGKKVTSKSLSELEYEELRGFMDLGFVFSEEDKDSNLASIIPGLHRLGKKDEE  175

Query  628  -VMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
              + +E +V RPYLSEAW ++++++  + L+ WR P L NE +MKDNL++WA TVAS VR
Sbjct  176  EAILDEPTVCRPYLSEAWEVLEKKRKEEPLMNWRIPALGNEIDMKDNLRWWAHTVASTVR  235



>ref|XP_007149725.1| hypothetical protein PHAVU_005G093900g [Phaseolus vulgaris]
 gb|ESW21719.1| hypothetical protein PHAVU_005G093900g [Phaseolus vulgaris]
Length=247

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 105/245 (43%), Positives = 140/245 (57%), Gaps = 21/245 (9%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKT----MMGVLSLKVRSQS  300
            AE++L+L D+ WFQ  I T K   S H T         KE  T    ++ V +L+VRS S
Sbjct  3    AEQVLRLLDTFWFQTTIFTNKTSSSFHATVDSTSQSLVKEVLTFDSKLLRVPTLQVRSLS  62

Query  301  DNLL--SFG--TSFSPPSDSLKSGIIKP-----ELEDLQaaataaaaataLLITKK--VC  447
            D  L  S G  + F  P+  L    + P     E+ D              ++T K  + 
Sbjct  63   DQNLGSSIGLFSDFPSPNSVLTPQKLMPILSGKEVGDFPLEKGHGKHEDEQVVTTKRVIH  122

Query  448  EIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRD-  624
              ++RR + +K    RSLS+LE +ELKGFMDLGFVF+E+DK S L S+IPGLQR G  D 
Sbjct  123  SDRRRRRSFRKEKASRSLSDLEFKELKGFMDLGFVFSEKDKDSRLVSLIPGLQRLGREDA  182

Query  625  -EVMT----NESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTV  789
             EV +    +E+ + RPYLSEAW ++DQ+K +  LL WR P + NE +MKDNL+FWA TV
Sbjct  183  GEVSSQHDIDETVICRPYLSEAWGVLDQKKAVNPLLNWRVPVVGNEIDMKDNLRFWAHTV  242

Query  790  ASAVR  804
            AS VR
Sbjct  243  ASIVR  247



>ref|XP_008371722.1| PREDICTED: uncharacterized protein LOC103435110 [Malus domestica]
Length=229

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/243 (42%), Positives = 142/243 (58%), Gaps = 37/243 (15%)
 Frame = +1

Query  145  LKLFDSCWFQGEILTRKQC---PSVHETKP---VLDDEYKKESKTMMGVLSLKVRSQSDN  306
            ++L+DS WF+ +I+ ++     PS  E  P   + ++  K      + + +   RS SD 
Sbjct  1    MELYDSFWFELQIINKQPISPIPSRIEENPDHEIEENPXKPSKPEFLRIPTXHTRSMSDE  60

Query  307  LLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIK--KRRVA---  471
            L S  T+F+  S S  S + +P L             + +L  K+  EI+  K+R A   
Sbjct  61   LSS-KTTFNLSSLSPDSVLHRPNL-------------STVLSGKEAGEIENPKQRCAEEE  106

Query  472  ---------RKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRD  624
                     RKK    +SL++L+ EELKGFMDLGFVF+EEDK S+L SIIPGLQR G +D
Sbjct  107  TPKKVEGRRRKKKSESKSLTDLQFEELKGFMDLGFVFSEEDKDSNLVSIIPGLQRLGKKD  166

Query  625  EVMT---NESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVAS  795
            +      +ES++ RPYLSEAW + ++RK  K L+ WRFP L NE +MKDNLK+WA TVAS
Sbjct  167  DSRYESFDESAISRPYLSEAWEVREKRKREKPLMNWRFPALENEIDMKDNLKWWAHTVAS  226

Query  796  AVR  804
            AVR
Sbjct  227  AVR  229



>ref|XP_002316812.1| hypothetical protein POPTR_0011s07010g [Populus trichocarpa]
 gb|EEE97424.1| hypothetical protein POPTR_0011s07010g [Populus trichocarpa]
Length=234

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 138/236 (58%), Gaps = 18/236 (8%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQC---PSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSD  303
            A E ++LFDS WF+ EI  ++      S  E  P  +++ K     +  + +   RS S+
Sbjct  3    ATEAIELFDSYWFEMEIFKKQPILPKSSSLEANPDHENQEKALKPEISRLPATITRSMSE  62

Query  304  NL-----LSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITK-KVCEIKKRR  465
            +L      SFG SF   SDS+   +  P+L  + +         +    K  V E  K++
Sbjct  63   DLCSNTTFSFGFSFC--SDSV---LHAPKLHTIFSGKDFTEEEYSTPTEKVYVLESHKKK  117

Query  466  VARK--KLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSR--DEVM  633
            V R+  K    +SLSELE EELKGF DLGFVF+EEDK S+LASIIPGLQR G +  DE +
Sbjct  118  VTRRRGKKVASKSLSELEYEELKGFTDLGFVFSEEDKDSNLASIIPGLQRLGKQHEDETV  177

Query  634  TNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAV  801
             +E +V RPYLSEAW + +QR   + L+ W  P LSNE +MKDNL++WA TVASA 
Sbjct  178  LDEPTVSRPYLSEAWEVQEQRMKEEPLMNWAIPALSNEIDMKDNLRWWAHTVASAA  233



>ref|XP_007213349.1| hypothetical protein PRUPE_ppa1027161mg [Prunus persica]
 gb|EMJ14548.1| hypothetical protein PRUPE_ppa1027161mg [Prunus persica]
Length=226

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 149/235 (63%), Gaps = 18/235 (8%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSL-KVRSQSD  303
            + A+E+++L+DS WFQ  I   KQ  S +    +L+ E +     ++ + +L   R+ SD
Sbjct  1    MEADEVMELYDSYWFQLGIF-EKQPNSAN----LLEIEEEPSKPELLRIPTLLHTRAMSD  55

Query  304  NL---LSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataL--LITKKVCEIKKRRV  468
             L    SF  SF P  DS+   + +P+L  + +   A    T +   + +   +I +RR 
Sbjct  56   ELSSKTSFNFSFCPSPDSV---LHRPKLSTILSGKEATEVETPIQRHVEESPKKITRRRR  112

Query  469  ARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDK-SSSLASIIPGLQRWG--SRDEVMTN  639
             +KK G  +SL++L+ EELKGFMDLGFVF+EEDK  S+LASIIPGLQR G   +DEV  +
Sbjct  113  KKKKKGESKSLTDLQFEELKGFMDLGFVFSEEDKEDSNLASIIPGLQRLGKDGQDEVF-D  171

Query  640  ESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            ES++ RPYLSEAW + DQRK  K L+ WRFP L NE +MKDNL++WA TVAS VR
Sbjct  172  ESAIPRPYLSEAWKVRDQRKREKPLMNWRFPALGNEIDMKDNLRWWAHTVASTVR  226



>ref|XP_003527334.1| PREDICTED: uncharacterized protein LOC100800312 [Glycine max]
 gb|KHN33937.1| hypothetical protein glysoja_036744 [Glycine soja]
Length=243

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 139/244 (57%), Gaps = 19/244 (8%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSV--HETKPVLDDEYKKESKTMMGVLS--LKVRS  294
            +AAE +L+L DS WF+  IL+ K   +   H+   V+++    +   ++ V +  L+VRS
Sbjct  1    MAAEHVLRLLDSFWFEASILSNKTLSNSISHDHNKVVEEVLPLDDAKLLLVPTPTLEVRS  60

Query  295  QSDNLLSFGTSF-----SPPSDSLKSGIIK--PELEDLQaaataaaaataLLITKKVCEI  453
             SD  L   T         P+  L    ++  P   +++  ++       + I +K    
Sbjct  61   YSDQNLDSTTCLLCDYSQSPNSVLTPQRLRTIPSEREIREFSSGNHGKEGMSIKRKQKSF  120

Query  454  KKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRD--E  627
               R ARK +   RSLSELE +ELKGFMDLGFVF+EEDK S LAS+IPGLQR G  +  E
Sbjct  121  GHGRRARK-VRTSRSLSELEFKELKGFMDLGFVFSEEDKDSKLASLIPGLQRLGREEDEE  179

Query  628  VMTNESSV-----QRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVA  792
               ++ SV      +PYLSEAW ++DQR+M   LL WR P   NE +MKDNL+FWA TVA
Sbjct  180  GQGDDQSVVSDNNNKPYLSEAWDVLDQREMGNPLLNWRVPARGNEIDMKDNLRFWAHTVA  239

Query  793  SAVR  804
            S VR
Sbjct  240  SIVR  243



>ref|NP_001241436.1| uncharacterized protein LOC100811994 [Glycine max]
 gb|ACU17998.1| unknown [Glycine max]
 gb|KHN34248.1| hypothetical protein glysoja_035883 [Glycine soja]
Length=241

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 139/245 (57%), Gaps = 23/245 (9%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPS---VHETKPVLDDEYKKESKTMM-GVLSLKVRS  294
            +AAE +L+L DS WF+  IL+ K  P+    H  K V +     ++K ++    +L+VRS
Sbjct  1    MAAEHVLRLLDSFWFEASILSSKIPPTNPISHNHKVVEEVLPLDDAKLLLVPTPTLEVRS  60

Query  295  QSDNLLSFGT----SFSPPSDS------LKSGIIKPELEDLQaaataaaaataLLITKKV  444
             SD  L   T     +SP  +S      L++   + E+ +  +        +     K  
Sbjct  61   YSDQNLDSTTCVLCDYSPSPNSVLTPQRLRTIPSEREIREFSSGNHGKEGMSNKRKQKGF  120

Query  445  CEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRD  624
               ++ R  R      RSLSELE +ELKGFMDLGFVF+EEDK S LAS+IPGLQR G  D
Sbjct  121  GHGRRPRQVRTS----RSLSELEFKELKGFMDLGFVFSEEDKDSKLASLIPGLQRLGRED  176

Query  625  -EVMTNESSV----QRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTV  789
             EV  ++ SV     +PYLSEAW ++DQR++   LL WR P   NE +MKDNL+FWA TV
Sbjct  177  DEVQCDDQSVVSDNNKPYLSEAWDVLDQRELRNPLLNWRVPARGNEIDMKDNLRFWAHTV  236

Query  790  ASAVR  804
            AS VR
Sbjct  237  ASIVR  241



>gb|KEH36642.1| DUF1685 family protein [Medicago truncatula]
Length=389

 Score =   157 bits (398),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 142/231 (61%), Gaps = 11/231 (5%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKK--ESKTMMGVLSLKVRSQSDN  306
            AEEI KLFD+CWF  +IL  K+ PS   +    ++++ +  E  T+  + +   RS SD 
Sbjct  3    AEEIFKLFDTCWFGFQIL--KEYPSSSISTISHENQHHQIQEKLTLSRIKTKHTRSISDQ  60

Query  307  LLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataL--LITKKVCEIKKRRVAR--  474
            L S  TSF   S S  S + +P+L+ + +        T     I  ++  +  + + R  
Sbjct  61   LNSM-TSFKHDSMSPNSVLFQPQLQTILSGKDVTDFNTEAEKQIQLQLQAVPNKNIIRNG  119

Query  475  KKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG--SRDEVMTNESS  648
            ++  G +SLS+LE EE+KGFMDLGFVF+EEDK +SL SIIPGLQR G    +E +++ S+
Sbjct  120  RRKSGSKSLSDLEFEEVKGFMDLGFVFSEEDKDTSLVSIIPGLQRLGKNGEEEDVSDVSA  179

Query  649  VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAV  801
            +QRPYLSEAW    +RK  K L+KW+ P  +NE +MK +LK WAQTVAS V
Sbjct  180  IQRPYLSEAWEDQKRRKKEKPLMKWKIPAPTNEVDMKYSLKCWAQTVASTV  230



>ref|XP_002522240.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40098.1| conserved hypothetical protein [Ricinus communis]
Length=292

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 142/249 (57%), Gaps = 30/249 (12%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRK---QCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSD  303
            A+E++ LFDSCWF+ EI  ++      S  +  P+   +   +      V ++  RS SD
Sbjct  49   AQELMDLFDSCWFEMEIFKKQFSLSKSSGFDGNPLHQIQEIPQKPEFYRVPTIISRSMSD  108

Query  304  NL---LSFGTSFSPPSDSLKSGIIKPELEDL---QaaataaaaataLLITKKVC------  447
             L    SF + FS   DS+   ++ P+L+ +   +       ++   L T+++       
Sbjct  109  QLWPKTSFSSGFSLSPDSV---LLNPKLQTILSGKEITEEGESSITPLQTERLNVQESPK  165

Query  448  -EIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRD  624
             + + RR  +K L   +SLSELE EE+KGFMDLGFVF+EEDK SSL SIIPGLQR G++D
Sbjct  166  KKARSRRKGKKALS--KSLSELEFEEVKGFMDLGFVFSEEDKDSSLVSIIPGLQRLGNKD  223

Query  625  EVMT---------NESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFW  777
            +            +E +V RPYLSEAW  +D RK  + L+ WR P  +NE +MK NLK+W
Sbjct  224  QEEEKKEEKNSAFDEGAVSRPYLSEAWEALDNRKKEEPLMNWRIPASTNEIDMKYNLKWW  283

Query  778  AQTVASAVR  804
            A TVAS VR
Sbjct  284  AHTVASTVR  292



>gb|KDP21126.1| hypothetical protein JCGZ_21597 [Jatropha curcas]
Length=237

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 100/246 (41%), Positives = 138/246 (56%), Gaps = 29/246 (12%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRK----QCPSVHETKPVLDDEYKKESKTMMGVLSLKV--  288
            + A+E L+LFD CW++ EI  ++    Q    H       D  K+E     G+  +    
Sbjct  1    MGAKEFLELFDFCWYEMEIFKKQSNFHQSSGFHRNP----DHQKQEEALKPGIYRVPTII  56

Query  289  -RSQSDNLL---SFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIK  456
             RS SD LL   SF + FS   DS+   ++ P+L+ +++        T + +   + E  
Sbjct  57   SRSMSDQLLPKASFSSDFSQSPDSV---LLTPKLKTIRSGKEITEEETNISVP--IQESP  111

Query  457  KRRVARKKLGG---HRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDE  627
            KR+   ++ G     +SLSELE EE+KGFMDLGFVF+EEDK SSL SIIPGLQR G +D 
Sbjct  112  KRKSKSRRRGKKILSKSLSELEFEEVKGFMDLGFVFSEEDKDSSLVSIIPGLQRLGKKDG  171

Query  628  VMTNESS-----VQRPYLSEAWSI--MDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQT  786
               +        V RPYLSEAW    +D+++    L+ WR P + NE +MKDNLK+WA T
Sbjct  172  EEDSSGGDKAAIVSRPYLSEAWERLELDRKRKEDPLMNWRIPAVGNEIDMKDNLKWWAHT  231

Query  787  VASAVR  804
            VAS VR
Sbjct  232  VASTVR  237



>ref|XP_006446825.1| hypothetical protein CICLE_v10016386mg [Citrus clementina]
 gb|ESR60065.1| hypothetical protein CICLE_v10016386mg [Citrus clementina]
Length=249

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 104/254 (41%), Positives = 140/254 (55%), Gaps = 33/254 (13%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSDN  306
            +AAEEI +L DS WF+ EI T+K   S  +T P+L+ + + +   +  +  L VRS SD 
Sbjct  1    MAAEEIFELLDSYWFEHEIFTKKVTASPQKTNPILEIQQEVQEPKVSSLPILHVRSLSDY  60

Query  307  LL----SFGTSFS-------PPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEI  453
             L    S  TSFS       P   ++ SG   PE E  +             +       
Sbjct  61   ALASCKSCTTSFSSDHSLLTPKLQTIASGKEVPEFESERVNNEQHEE-----METAAKPK  115

Query  454  KKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRW-------  612
            +K ++ +KK    +SLS+LE EELKGFMDLGFVF+EEDK SSLASI+PGLQR        
Sbjct  116  RKNKMNKKKKKSSKSLSDLEFEELKGFMDLGFVFSEEDKDSSLASILPGLQRLRGSGSSA  175

Query  613  ---------GSRDEVMTNESSVQRPYLSEAWSIMD-QRKMMKKLLKWRFPPLSNETNMKD  762
                      S +    N+ +V RPYLSEAW+++D QRK+   L+ WR P + ++ NMKD
Sbjct  176  REDGRDHEEASVNNNHNNKPTVSRPYLSEAWAVLDHQRKVENSLMNWRIPSVGHDVNMKD  235

Query  763  NLKFWAQTVASAVR  804
             L+FWA TVAS  R
Sbjct  236  QLRFWAHTVASTAR  249



>ref|XP_007159478.1| hypothetical protein PHAVU_002G240700g [Phaseolus vulgaris]
 gb|ESW31472.1| hypothetical protein PHAVU_002G240700g [Phaseolus vulgaris]
Length=250

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/253 (40%), Positives = 143/253 (57%), Gaps = 30/253 (12%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMG-----------V  273
            +  E +LKLF SCWF+  IL     P    T  + + +Y+K+ +               +
Sbjct  1    METEAVLKLFHSCWFEVNILKENSSPETPITSGIENLDYEKKEEQEEEEEEELEPKLPLI  60

Query  274  LSLKVRSQSDNLLSFGTSFSPPSDSLKSGIIKP----------ELEDLQaaataaaaata  423
             +   RS SD  ++  T F+  S S  S ++ P          E+ D +  +    +   
Sbjct  61   RTSHTRSMSDQSMT-STRFNHDSLSPDSVLLLPPKLQTILSGKEVTDSEGESPTQISYHE  119

Query  424  LLI--TKKVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIP  597
            +L    KK C+I   R  +++    +SLS+LE EELKGFMDLGFVF+EEDK++SLASIIP
Sbjct  120  VLCPKNKKSCKISGNRTRKRR--DSKSLSDLEFEELKGFMDLGFVFSEEDKNTSLASIIP  177

Query  598  GLQRWGSRDEVM--TNESSVQRPYLSEAWSIMD--QRKMMKKLLKWRFPPLSNETNMKDN  765
            GLQR G ++E     NE +V RPYLSEAW + +  +RK    L+ W+ P L+NET+MKD+
Sbjct  178  GLQRLGKKEEEEGDCNELNVPRPYLSEAWEVQEYGRRKRENPLMNWKIPALNNETDMKDS  237

Query  766  LKFWAQTVASAVR  804
            L++WA TVAS VR
Sbjct  238  LRWWAHTVASTVR  250



>ref|XP_003543003.1| PREDICTED: uncharacterized protein LOC100781024 [Glycine max]
 gb|KHN47401.1| hypothetical protein glysoja_020269 [Glycine soja]
Length=230

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 134/244 (55%), Gaps = 36/244 (15%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPS-----VHETKPVLDDEYKKESKTMMGVLSLKVRSQ  297
            AEE+LKLFDSCWF  + L      S     +HE     +   +    T++ + S   RS 
Sbjct  3    AEEVLKLFDSCWFGHQNLKEHTSSSTIPTSLHENSSDHNQIKEPSEPTLLRIQSGHSRSM  62

Query  298  SDNLLSFGTSFSPPSDSLK-SGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVAR  474
            SD L S  T F    DSL    +  P+L+              +L  K V + +   V  
Sbjct  63   SDQLSSM-TCFK--DDSLSPDSVFSPKLQ-------------TILSGKDVTDAEAAHVQL  106

Query  475  KKL-----------GGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSR  621
            + L              +SLS+LE EELKGFMDLGFVF+EEDK SSLASIIPGLQR G  
Sbjct  107  QLLVLPKKRERRKKRPSKSLSDLEFEELKGFMDLGFVFSEEDKDSSLASIIPGLQRLGKS  166

Query  622  DEVMTNE---SSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVA  792
            DE   +    SSVQRPYLSEAW   ++RK    L+ W+ P L+NE ++KD+L++WAQTVA
Sbjct  167  DEEEEDSELGSSVQRPYLSEAWKAQERRKKENPLVNWKIPALNNEIDIKDSLRWWAQTVA  226

Query  793  SAVR  804
            S VR
Sbjct  227  STVR  230



>gb|AET04282.2| DUF1685 family protein [Medicago truncatula]
Length=242

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 137/244 (56%), Gaps = 26/244 (11%)
 Frame = +1

Query  136  EEILKLFDSCWFQGEILTRKQCPSV------HETKPVLDDEYKKESKTMMGVLSLKVRSQ  297
            E ILKLFDS WFQ  IL R    SV         K   ++E   E   +  + ++  RS 
Sbjct  4    ESILKLFDSFWFQFNILNRNTTSSVTSTCSEQNLKDSQNNETSYEGPKLTRIRTVHNRSM  63

Query  298  SDNLLSF--GTSFSPPS------DSLKSGIIKPELEDLQaaataaaaataLLITKKVCEI  453
            SD  ++     S SP S        L++ +   E+ D +         T  L+ KK   I
Sbjct  64   SDQSIACFNHDSLSPDSVLNIIPSKLQTILXGKEVTDSEDENNLVQTQT--LLPKKNNNI  121

Query  454  KKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEV-  630
             K  V +KK    +SLS+LE EELKGFMDLGFVF+EEDK SSL  IIPGLQR G ++E  
Sbjct  122  NK--VVKKKRES-KSLSDLEFEELKGFMDLGFVFSEEDKDSSLVEIIPGLQRLGKKNEEE  178

Query  631  ------MTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVA  792
                  + +ES VQRPYLSEAW + D RK  K L+ W+ P ++NE +MK++L+ WAQTVA
Sbjct  179  EEEEEDVYDESVVQRPYLSEAWEVYDWRKKEKPLVNWKVPAMNNEIDMKNSLRLWAQTVA  238

Query  793  SAVR  804
            S VR
Sbjct  239  STVR  242



>ref|XP_003629806.1| hypothetical protein MTR_8g086820 [Medicago truncatula]
Length=242

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 136/243 (56%), Gaps = 24/243 (10%)
 Frame = +1

Query  136  EEILKLFDSCWFQGEILTRKQCPSV------HETKPVLDDEYKKESKTMMGVLSLKVRSQ  297
            E ILKLFDS WFQ  IL R    SV         K   ++E   E   +  + ++  RS 
Sbjct  4    ESILKLFDSFWFQFNILNRNTTSSVTSTCSEQNLKDSQNNETSYEGPKLTRIRTVHNRSM  63

Query  298  SDNLLSFGTSFSPPSDSLKSGIIKPELEDL-------QaaataaaaataLLITKKVCEIK  456
            SD  ++     S   DS+   II  +L+ +        +        T  L+ KK   I 
Sbjct  64   SDQSIACFNHDSLSPDSV-LNIIPSKLQTILSGKEVTDSEDENNLVQTQTLLPKKNNNIN  122

Query  457  KRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEV--  630
            K  V +KK    +SLS+LE EELKGFMDLGFVF+EEDK SSL  IIPGLQR G ++E   
Sbjct  123  K--VVKKKRES-KSLSDLEFEELKGFMDLGFVFSEEDKDSSLVEIIPGLQRLGKKNEEEE  179

Query  631  -----MTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVAS  795
                 + +ES VQRPYLSEAW + D RK  K L+ W+ P ++NE +MK++L+ WAQTVAS
Sbjct  180  EEEEDVYDESVVQRPYLSEAWEVYDWRKKEKPLVNWKVPAMNNEIDMKNSLRLWAQTVAS  239

Query  796  AVR  804
             VR
Sbjct  240  TVR  242



>ref|XP_003531264.1| PREDICTED: uncharacterized protein LOC100814411 [Glycine max]
Length=247

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 140/249 (56%), Gaps = 29/249 (12%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCP--SVHETKPVLDDEYKKESKTMMGVL-SLKVRSQSD  303
            AE +L LFDSCWF+  IL R   P  S+      LD   K+E +  + ++ +   RS SD
Sbjct  3    AEAVLNLFDSCWFEVNILRRNSSPHTSITSYTENLDHVLKEEKEPKLPLIRTSHTRSMSD  62

Query  304  NLLSFGTSFSPPSDSLKSG---IIKPELEDL------------QaaataaaaataLLITK  438
             L    TSF+   DSL      ++ P+L+ +            +   T       +L  K
Sbjct  63   QLSMTTTSFN--QDSLSPDSVLLLHPKLQTILSGKEATDSEPDENPRTQVRPHPEVLCPK  120

Query  439  KVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGS  618
            K  +I   R  +++    +SLS+LE EELKGFMDLGFVF+EEDK SSLASIIPGLQR   
Sbjct  121  KNKKISSSRTRKRRES--KSLSDLEFEELKGFMDLGFVFSEEDKDSSLASIIPGLQRLRK  178

Query  619  RDEVMTNES-----SVQRPYLSEAWSI--MDQRKMMKKLLKWRFPPLSNETNMKDNLKFW  777
            ++E           SV RPYLSEAW +   D+RK    L+ W+ P ++NET+MK++L++W
Sbjct  179  KEEEEEENEDCDEISVPRPYLSEAWEVQEYDRRKKENSLVNWKMPAINNETDMKESLRWW  238

Query  778  AQTVASAVR  804
            A TVAS VR
Sbjct  239  AHTVASTVR  247



>gb|KDO63416.1| hypothetical protein CISIN_1g041944mg [Citrus sinensis]
Length=249

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 104/270 (39%), Positives = 140/270 (52%), Gaps = 65/270 (24%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSDN  306
            +AAEEI +L DS WF+ EI T+K   S  +T PVL+ + + +   +  +  L VRS SD 
Sbjct  1    MAAEEIFELLDSYWFEREIFTKKVTASPQKTNPVLEIQQEVQKPKVSSLPILHVRSLSDY  60

Query  307  LL----SFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVAR  474
             L    S  TSFS  SD     ++ P+L+ + +              K+V E    RV  
Sbjct  61   ALASCKSCTTSFS--SDH---SLLTPKLQTIAS-------------GKEVTEFASERVNN  102

Query  475  KKLGGHRSL-----------------------SELEIEELKGFMDLGFVFTEEDKSSSLA  585
            ++   H  +                       S+LE EELKGFMDLGFVF+EEDK SSLA
Sbjct  103  EQ---HEEMEIAVKPKRKNKMNKKKKKSSKSLSDLEFEELKGFMDLGFVFSEEDKDSSLA  159

Query  586  SIIPGLQRW----------------GSRDEVMTNESSVQRPYLSEAWSIMD-QRKMMKKL  714
            SI+PGLQR                  S +    N+ +V RPYLSEAW+++D QRK+   L
Sbjct  160  SILPGLQRLRGSGSSAREDGRDHEEASVNNNHNNKPTVSRPYLSEAWAVLDHQRKVENSL  219

Query  715  LKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            + WR P + ++ NMKD L+FWA TVAS  R
Sbjct  220  MNWRIPSVGHDVNMKDQLRFWAHTVASTAR  249



>ref|XP_006467617.1| PREDICTED: uncharacterized protein LOC102628675 [Citrus sinensis]
 gb|KDO77904.1| hypothetical protein CISIN_1g026058mg [Citrus sinensis]
Length=244

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 105/246 (43%), Positives = 136/246 (55%), Gaps = 26/246 (11%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQ----CPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQS  300
            +E ILKLFD+CWF+ EIL ++     C  +  ++   ++E K      + V +   RS S
Sbjct  3    SERILKLFDTCWFEMEILKKQSRSSICSKIEASRDNQNEE-KPSKAEFLRVPTSHKRSMS  61

Query  301  DNL---LSFGTSFSPPSDSL------------KSGIIKPELEDLQaaataaaaataLLIT  435
              L    SF  SFS   DS+            K   +  E+ + + A         +   
Sbjct  62   AQLSSETSFNNSFSFSPDSVLSPPKLQTILSGKEVTVTEEVGETKQAQAHYHVQEFVSKK  121

Query  436  KKVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEED-KSSSLASIIPGLQRW  612
            K V     RR  RKK    +SLS+LE EELKGFMDLGFVFTEED K S L  I+PGLQR 
Sbjct  122  KGVHVASTRR--RKKNSESKSLSDLEFEELKGFMDLGFVFTEEDNKDSRLVEIVPGLQRL  179

Query  613  GSRDEVMTNESSVQRPYLSEAWSIMD-QRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTV  789
            G +D+ + N S V RPYLSEAW IMD  RK    L+ W+   L+NE ++KDNL++WA TV
Sbjct  180  GKKDDTVDN-SPVSRPYLSEAWEIMDTTRKENSLLINWKISALNNEMDIKDNLRWWAHTV  238

Query  790  A-SAVR  804
            A SAVR
Sbjct  239  ALSAVR  244



>ref|XP_007132824.1| hypothetical protein PHAVU_011G127600g [Phaseolus vulgaris]
 gb|ESW04818.1| hypothetical protein PHAVU_011G127600g [Phaseolus vulgaris]
Length=235

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 99/239 (41%), Positives = 142/239 (59%), Gaps = 20/239 (8%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSV---HETKPVLDDEYKKESKTMMGVLSLKVRSQ  297
            +AAE++L+L DS WF+  IL+ K  PSV   +E + VL  + K    +++   +L+VRS 
Sbjct  1    MAAEQVLRLLDSFWFEASILSNK-TPSVSHKNEMEQVLPHDAKL---SLVPTPTLEVRSY  56

Query  298  SDNLLSFGTSF---SPPSDSL----KSGIIKPELEDLQaaataaaaataLLITKKVCEIK  456
            SD  L   +S    SP  +S+    +   I  E E ++ ++            K+     
Sbjct  57   SDQNLDSSSSILCDSPSPNSVLTLRRLRTIPSEREIIEFSSGNHEKEGVNFKRKQKGFGL  116

Query  457  KRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMT  636
             RR+ +++    RSLSELE +ELKGFMDLGFVF+EEDK S L S+IPGLQR G  ++   
Sbjct  117  GRRLRKERTS--RSLSELEFKELKGFMDLGFVFSEEDKDSKLVSLIPGLQRLGRDEDEGQ  174

Query  637  NES----SVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAV  801
            ++     S   PYLSEAW ++DQR+M   LL WR P + +E +MKDNL+FWA TVAS++
Sbjct  175  DDDESVVSDNMPYLSEAWDVLDQREMRNPLLNWRVPAMGDEIDMKDNLRFWAHTVASSI  233



>ref|XP_003524968.1| PREDICTED: uncharacterized protein LOC100792716 [Glycine max]
Length=237

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 140/237 (59%), Gaps = 15/237 (6%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCP--SVHETKPVLDDEYKKESKTMMG--VLSLKVRSQS  300
            +E +L LFDSCWF+  IL     P  S+   K  LD E K+E +      + +   RS S
Sbjct  3    SEAVLNLFDSCWFEVNILKTNSSPHTSITSYKESLDYEIKEEEEEPKLPLIRTSHTRSMS  62

Query  301  DNLLSFGTSFSPPSDSLKSGII-KPELED-LQaaataaaaataLLITKKVCEIKKRRVAR  474
            D L    TSF+  S S  S ++  P+L+  L       + +  +L  KK  +I      +
Sbjct  63   DQLSMITTSFNHDSLSPDSVLLLHPKLQIILSGKEATDSESDEVLCPKKNKKISSNGTRK  122

Query  475  KKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNES---  645
            ++    +SLS+LE EELKGFMDLGFVF+EEDK SSLASIIPGLQR G ++E    +    
Sbjct  123  RRES--KSLSDLEFEELKGFMDLGFVFSEEDKDSSLASIIPGLQRLGKKEEEKEEDDDCD  180

Query  646  --SVQRPYLSEAWSIM--DQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
              SV RPYLSEAW +   D+RK    L+ W+ P ++NET+MK++L++WA TVAS VR
Sbjct  181  EISVPRPYLSEAWEVQECDRRKKENPLVNWKMPAINNETDMKESLRWWAHTVASTVR  237



>gb|KHN36708.1| hypothetical protein glysoja_001439 [Glycine soja]
Length=229

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 97/244 (40%), Positives = 128/244 (52%), Gaps = 45/244 (18%)
 Frame = +1

Query  157  DSCWFQGEILTRKQCPSVHETKPVLDDEYKKE-----SKTMMGVLSLKVRSQSDNLL--S  315
            D+ WF+  I T K  P  H       + + KE     SK ++ V +L+VRS SD  L  S
Sbjct  2    DANWFETTIFTNKTSPPFHSALDSTPESHVKEVLTIDSKLLISVPTLQVRSFSDQNLGSS  61

Query  316  FG--TSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVARKKLGG  489
             G  + F  P+  L    ++P                 +L  K+V +  +  VA KK  G
Sbjct  62   IGVFSDFPSPNSVLTPQKLRP-----------------ILSGKEVEDFPEEEVATKKKLG  104

Query  490  H--------------RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDE  627
            H              RSLS+LE ++LKGFMDLGFVF+EEDK S   S+IPGLQR G  D+
Sbjct  105  HGHRRRRRFRKGKATRSLSDLEFKKLKGFMDLGFVFSEEDKDSRSVSLIPGLQRLGKEDD  164

Query  628  VMTNESSVQ-----RPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVA  792
               +E ++      RPYLSE W  +DQRK++  LL  R P + NE  MKDNL+FWA TVA
Sbjct  165  GRNSEQNIDETVICRPYLSETWDALDQRKVVNPLLNLRVPVVGNEIGMKDNLRFWAHTVA  224

Query  793  SAVR  804
            S V+
Sbjct  225  SIVK  228



>gb|KHN48012.1| hypothetical protein glysoja_015482 [Glycine soja]
Length=247

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 139/249 (56%), Gaps = 29/249 (12%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCP--SVHETKPVLDDEYKKESKTMMGVL-SLKVRSQSD  303
            AE +L LFDSCWF+  IL     P  S+      LD   K+E +  + ++ +   RS SD
Sbjct  3    AEAVLNLFDSCWFEVNILRTNSSPHTSITSYTENLDHVLKEEKEPKLPLIRTSHTRSMSD  62

Query  304  NLLSFGTSFSPPSDSLKSG---IIKPELEDL------------QaaataaaaataLLITK  438
             L    TSF+   DSL      ++ P+L+ +            +   T       +L  K
Sbjct  63   QLSMTTTSFN--QDSLSPDSVLLLHPKLQTILSGKEATDSEPDENPRTQVRPHPEVLCPK  120

Query  439  KVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGS  618
            K  +I   R  +++    +SLS+LE EELKGFMDLGFVF+EEDK SSLASIIPGLQR   
Sbjct  121  KNKKISSSRTRKRRES--KSLSDLEFEELKGFMDLGFVFSEEDKDSSLASIIPGLQRLRK  178

Query  619  RDEVMTNES-----SVQRPYLSEAWSI--MDQRKMMKKLLKWRFPPLSNETNMKDNLKFW  777
            ++E           SV RPYLSEAW +   D+RK    L+ W+ P ++NET+MK++L++W
Sbjct  179  KEEEEEENEDCDEISVPRPYLSEAWEVQEYDRRKKENSLVNWKMPAINNETDMKESLRWW  238

Query  778  AQTVASAVR  804
            A TVAS VR
Sbjct  239  AHTVASTVR  247



>ref|XP_009352733.1| PREDICTED: uncharacterized protein LOC103944066 [Pyrus x bretschneideri]
Length=225

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 138/247 (56%), Gaps = 43/247 (17%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQC---PSVHETKPVLDDEYKKESKTMMGVLSLKVRSQ  297
            + A+E+++L+DS WF+  I  ++     PS  E  P             + + +   RS 
Sbjct  1    MEADEVMELYDSFWFEFPIFKKQPVSSNPSNFEENP--------SKPEFLRIPTRHTRSM  52

Query  298  SDNLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRR----  465
            SD L S  TSF+  + S  S + +P+L             + +L  K+  EI+  +    
Sbjct  53   SDELSS-NTSFNLSTLSPDSVLHRPKL-------------STILSGKEAGEIENPKQIYS  98

Query  466  -----------VARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRW  612
                         RKK    +SL++L+ EELKGFMDLGFVF+EEDK S+L SIIPGLQR 
Sbjct  99   EEEPQKKVERRRRRKKKSESKSLTDLQFEELKGFMDLGFVFSEEDKDSNLVSIIPGLQRL  158

Query  613  GSRD---EVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQ  783
            G +D   E   +ES++ RPYLSE W + ++RK  K L+ WRFP L NE +MKDNLK+WA 
Sbjct  159  GKKDDSREERIDESAISRPYLSEVWEVREKRKREKPLMNWRFPALENEIDMKDNLKWWAH  218

Query  784  TVASAVR  804
            TVASAVR
Sbjct  219  TVASAVR  225



>ref|XP_007025324.1| Uncharacterized protein TCM_029658 [Theobroma cacao]
 gb|EOY27946.1| Uncharacterized protein TCM_029658 [Theobroma cacao]
Length=239

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 104/244 (43%), Positives = 130/244 (53%), Gaps = 31/244 (13%)
 Frame = +1

Query  139  EILKLFDSCWFQGEILTRKQCPS---VHETKPVLDDEYKKESKTMMGVLSLKVRSQSDNL  309
            EI+KLFDSCWF+ EI  +   PS     E  P   DE            +L  RS SD L
Sbjct  5    EIIKLFDSCWFEMEIFKKHLSPSPSTSFEPNPDRQDEENSSKPEFKRTPTLHTRSMSDQL  64

Query  310  ---LSF--GTSFSPPS-------DSLKSG--IIKPELEDLQaaataaaaataLLITKKVC  447
                SF    SFSP S         + SG  I + EL++       A    A+  T    
Sbjct  65   SLSTSFLGNGSFSPDSVLHAPKLHKIISGKEITEEELQEADGNIQEAPNNKAVTST----  120

Query  448  EIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEED-KSSSLASIIPGLQRWGSRD  624
                 R+ R+K G  +SLS+LE EELKGFMDLGFVF+EED K S L  IIPGLQR G ++
Sbjct  121  -----RITRRKKGISKSLSDLEFEELKGFMDLGFVFSEEDNKDSRLVEIIPGLQRLGKKE  175

Query  625  EVM----TNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVA  792
                    +++ V RPYLSEAW +  +R+    L+ WR P L NE +MKD+L+ WA TVA
Sbjct  176  GEEESKEADKAEVSRPYLSEAWEVSGRRRKENPLMNWRVPALGNEIDMKDSLRLWAHTVA  235

Query  793  SAVR  804
            S VR
Sbjct  236  STVR  239



>gb|KHN06416.1| hypothetical protein glysoja_010760 [Glycine soja]
Length=240

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 102/240 (43%), Positives = 139/240 (58%), Gaps = 18/240 (8%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCP--SVHETKPVLDDEYKKESKTMMG-----VLSLKVR  291
            +E +L LFDSCWF+  IL     P  S+      LD E K+E +         + +   R
Sbjct  3    SEAVLNLFDSCWFEVNILKTNSSPHISITSYNESLDYEIKEEEEEEEEPKLPLIRTSHTR  62

Query  292  SQSDNLLSFGTSFSPPSDSLKSGII-KPELED-LQaaataaaaataLLITKKVCEIKKRR  465
            S SD L    TSF+  S S  S ++  P+L+  L       + +  +L  KK  +I    
Sbjct  63   SMSDQLSMITTSFNHDSLSPDSVLLLHPKLQIILSGKEATDSESDEVLCPKKNKKISSNG  122

Query  466  VARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNES  645
              +++    +SLS+LE EELKGFMDLGFVF+EEDK SSLASIIPGLQR G ++E    + 
Sbjct  123  TRKRRES--KSLSDLEFEELKGFMDLGFVFSEEDKDSSLASIIPGLQRLGKKEEEKEEDD  180

Query  646  -----SVQRPYLSEAWSIM--DQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
                 SV RPYLSEAW +   D+RK    L+ W+ P ++NET+MK++L++WA TVAS VR
Sbjct  181  DCDEISVPRPYLSEAWEVQECDRRKKENPLVNWKMPAINNETDMKESLRWWAHTVASTVR  240



>gb|ACU23694.1| unknown [Glycine max]
Length=237

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 139/237 (59%), Gaps = 15/237 (6%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCP--SVHETKPVLDDEYKKESKTMMG--VLSLKVRSQS  300
            +E +L LFDSCWF+  IL     P  S+   K  LD E K+E +      + +   RS S
Sbjct  3    SEAVLNLFDSCWFEVNILKTNSSPHTSITSYKESLDYEIKEEEEEPKLPLIRTSHTRSMS  62

Query  301  DNLLSFGTSFSPPSDSLKSGII-KPELED-LQaaataaaaataLLITKKVCEIKKRRVAR  474
            D L    TSF+  S S  S ++  P+L+  L       + +  +L  KK  +I      +
Sbjct  63   DQLSMITTSFNHDSLSPDSVLLLHPKLQIILSGKEATDSESDEVLCPKKNKKISSNGTRK  122

Query  475  KKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNES---  645
            ++    +SLS+LE EELKGFMDLGFVF+EEDK SSLASIIPGLQR G ++E    +    
Sbjct  123  RRES--KSLSDLEFEELKGFMDLGFVFSEEDKDSSLASIIPGLQRLGKKEEEKEEDDDCD  180

Query  646  --SVQRPYLSEAWSIM--DQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
              SV RPYLSEAW +   D+RK    L+ W+ P ++NET+MK++L +WA TVAS VR
Sbjct  181  EISVPRPYLSEAWEVQECDRRKKENPLVNWKMPAINNETDMKESLGWWAHTVASTVR  237



>ref|XP_006449540.1| hypothetical protein CICLE_v10016436mg [Citrus clementina]
 gb|ESR62780.1| hypothetical protein CICLE_v10016436mg [Citrus clementina]
Length=244

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 103/248 (42%), Positives = 137/248 (55%), Gaps = 26/248 (10%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQ----CPSVHETKPVLDDEYKKESKTMMGVLSLKVRS  294
            + ++ ILKLFD+CWF+ EIL ++     C  +  ++   ++E K      + V +   RS
Sbjct  1    MGSDRILKLFDTCWFEMEILKKQSRSSICSKIEASRDNQNEE-KPSKAEFLRVPTSHKRS  59

Query  295  QSDNL---LSFGTSFSPPSDSL------------KSGIIKPELEDLQaaataaaaataLL  429
             S  L    SF  SFS   DS+            K   +  E+++ + A         + 
Sbjct  60   MSAQLSSETSFNNSFSFSPDSVLSPQKLQTILSGKEVTVTEEVKETKQAQAHYHVQEFVS  119

Query  430  ITKKVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEED-KSSSLASIIPGLQ  606
              K V     RR  R K    +SLS+LE EELKGFMDLGFVFTEED K+S L  I+PGLQ
Sbjct  120  KKKGVHVASTRR--RTKNSESKSLSDLEFEELKGFMDLGFVFTEEDNKNSRLVEIVPGLQ  177

Query  607  RWGSRDEVMTNESSVQRPYLSEAWSIMD-QRKMMKKLLKWRFPPLSNETNMKDNLKFWAQ  783
            R G +D+ + N S V RPYLSEAW IMD  RK    L+ W    L+NE ++KDNL++WA 
Sbjct  178  RLGKKDDTVDN-SPVSRPYLSEAWEIMDTTRKDNSLLINWEISALNNEMDIKDNLRWWAH  236

Query  784  TVA-SAVR  804
            TVA SAVR
Sbjct  237  TVALSAVR  244



>ref|XP_007216770.1| hypothetical protein PRUPE_ppa024447mg [Prunus persica]
 gb|EMJ17969.1| hypothetical protein PRUPE_ppa024447mg [Prunus persica]
Length=265

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 105/255 (41%), Positives = 132/255 (52%), Gaps = 35/255 (14%)
 Frame = +1

Query  142  ILKLFDSCWFQGEILTRKQCPSVHE-TKPVLDDEYKKESKTMMGV-----LSLKVRSQSD  303
            +L LFDSCWF+ EIL++K      E T P L  +   +  T   V     LS   RS SD
Sbjct  12   LLSLFDSCWFEHEILSKKSLSKPQEATNPSLQVDQSAQEATQQQVPNFPRLSCLPRSLSD  71

Query  304  NLLSFGTSFSPPSDSLKSGII----KPELEDL--------QaaataaaaataLLITKKVC  447
            +  S        SDSL    I     P+ + +         +  +          TK+V 
Sbjct  72   DQSSNTKGSLISSDSLSPHSILMSTTPKFQTVFSGKQVIEFSKQSVKQEQVPAAQTKRVH  131

Query  448  EIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGS---  618
               KR  +R+++G  +SLS+LE +ELKGFMDLGFVFTEEDK S L SIIPGLQR GS   
Sbjct  132  GHGKRNRSRRRVGPSKSLSDLEFDELKGFMDLGFVFTEEDKDSKLVSIIPGLQRLGSIGE  191

Query  619  --RDEV-----------MTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMK  759
              RDE             ++   V RPYLSEAW  +DQR    KL+ WR P    + +MK
Sbjct  192  QDRDEEDRRNNNHNNIDPSSHHVVSRPYLSEAWDALDQRNKENKLVNWRIPANLGK-DMK  250

Query  760  DNLKFWAQTVASAVR  804
             NL+FWA TVAS VR
Sbjct  251  HNLRFWAHTVASTVR  265



>ref|XP_011039395.1| PREDICTED: uncharacterized protein LOC105135974 [Populus euphratica]
Length=234

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 101/238 (42%), Positives = 136/238 (57%), Gaps = 20/238 (8%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEIL---------TRKQCPSVHETKPVLDDEYKKESKTMMGVLSLK  285
            A E L+LFDS WF+ +I          +R +  S HE +   ++  K E   +   ++  
Sbjct  3    ATEALELFDSYWFEMKIFKKQPILPKSSRLEANSDHENQ---ENALKPEISRLPATIT--  57

Query  286  VRSQSDNLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITK-KVCEIKKR  462
             RS S++L S  T     S S  S +  P+L  + +         +    K  V E  K+
Sbjct  58   -RSMSEDLCSNTTFSFGFSFSSDSVLHAPKLHTIFSGKDFTEEEYSKPTEKVYVLESHKK  116

Query  463  RVARK--KLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMT  636
            +V R+  K    +SLSELE EELKGF DLGFVF+EEDK S+LASIIPGLQR G + E  T
Sbjct  117  KVTRRRGKKVTSKSLSELEYEELKGFTDLGFVFSEEDKDSNLASIIPGLQRLGKQHEDGT  176

Query  637  --NESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
              +E +V RPYLSEAW + +QR   + L+ W  P LSNE +MKDNL++WA TVASA +
Sbjct  177  VLDEPTVSRPYLSEAWEVQEQRMKEEPLMNWAIPALSNEIDMKDNLRWWAHTVASAAK  234



>ref|XP_002277345.1| PREDICTED: uncharacterized protein LOC100260838 [Vitis vinifera]
Length=232

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 105/234 (45%), Positives = 135/234 (58%), Gaps = 13/234 (6%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSDNLL  312
            A E+L LFD  WFQ  I   +  P    T P  D E  +ESK +  + +L VRS+SD  L
Sbjct  2    AAEVLGLFDFYWFQHLIFRNEPSPPPPATDP--DHEPLQESK-LSRLPTLHVRSRSDQFL  58

Query  313  SFGTSFSPPSDSLKSGIIKPELEDL----QaaataaaaataLLITKKVCEIKKRRVARKK  480
            S   SF+P S S  S +  P+L+ +    +       A       + V + +K    RK 
Sbjct  59   SSKGSFTPDSLSPDSVLQAPKLQTVMSGKEVGEEFDDAPKKEERQRPVLDQRKVYGGRKS  118

Query  481  LGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNES-----  645
             G  +SLS+LE EELKGFMDLGFVF+EEDK+S L SI+PGLQR G +      E      
Sbjct  119  KGSSKSLSDLEFEELKGFMDLGFVFSEEDKNSKLVSIVPGLQRLGKKGGEDDEEEDAKIV  178

Query  646  SVQRPYLSEAWSIMD-QRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            SV RPYLSEAW +MD +RK +  LL WR P   +E +MK++L+FWA  VASAVR
Sbjct  179  SVSRPYLSEAWDVMDRRRKEVDPLLNWRIPDFGDEMDMKEHLRFWAHMVASAVR  232



>ref|XP_009593785.1| PREDICTED: uncharacterized protein LOC104090403 [Nicotiana tomentosiformis]
Length=238

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/242 (41%), Positives = 136/242 (56%), Gaps = 24/242 (10%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQ----------CPSVHETKPVLDDEYKKESKTMMGVLSL  282
             EE+L LF+S WF+ EIL  KQ           P++   K +L      E   +  V + 
Sbjct  3    VEELLNLFNSYWFESEILKPKQPFSGISKTNSNPNLESNKQIL------EQPKLSKVPTF  56

Query  283  KVRSQSDNLLSFGTSFSPPSDSLKSGIIKPELED-LQaaataaaaataLLITKKVCEIKK  459
             VRSQSD  LS   S     +S KS +++P+L+  L       +  ++      V   + 
Sbjct  57   IVRSQSDQCLSSKDSTFHSENSPKSVLVEPKLQPILSGKEYNESVFSSEAAEGGVKSKES  116

Query  460  RRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTN  639
             R  +KK    +SLSELE EELKGFMDLGF F+++DK SSL SI+PGL+R G  +E    
Sbjct  117  YRRRKKKSNNSKSLSELEFEELKGFMDLGFEFSDKDKDSSLVSILPGLRRLGRENEENMR  176

Query  640  ----ESSVQRPYLSEAWSIMDQRKMMKK--LLKWRFPP-LSNETNMKDNLKFWAQTVASA  798
                E+SV RP+LSEAW++ +++K M+K  L  W+  P L NE  +KD L+FWA TVAS 
Sbjct  177  FEELEASVSRPHLSEAWAVWEEKKKMEKNPLKSWKINPVLGNEMEIKDQLRFWAHTVAST  236

Query  799  VR  804
            VR
Sbjct  237  VR  238



>ref|XP_004485927.1| PREDICTED: uncharacterized protein LOC101512973 [Cicer arietinum]
Length=235

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 97/238 (41%), Positives = 130/238 (55%), Gaps = 15/238 (6%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSV----HETKPVLDDEYKKESKTMMGVLSLKVRS  294
            + AEEILKLFD  WF  + L    C S     HE +     E   E   +    +   RS
Sbjct  1    MEAEEILKLFDILWFGLQNLKEHSCTSTLTNSHENQ-YHQIEGSSEKSMLYSRKTNHTRS  59

Query  295  QSDNLLSFGTSFSPPSDSLKSGII-KPELEDLQaaataaaaataLLITKKVCEIKKR---  462
             SD L S  TSF   S S  S +  +P+L+ + +             T +   +  +   
Sbjct  60   MSDQLSSM-TSFKNDSYSPNSVLFDQPKLQTIHSGKDVTNYTETENQTPEQLHVLSKKNM  118

Query  463  -RVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSR---DEV  630
             R  R+K    +SLS+LE EE+KGFMDLGFVF+EEDK S+L SIIPGLQR G     +E 
Sbjct  119  TRSGRRKRES-KSLSDLEFEEVKGFMDLGFVFSEEDKDSNLVSIIPGLQRLGKNGEGEED  177

Query  631  MTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
              +ES++QRPYLSEAW + + R+  K ++ W+ P  +NE +MK +LK WA  VAS VR
Sbjct  178  SCDESAIQRPYLSEAWKVQEMRRKEKLMMNWKIPAPTNEVDMKYSLKCWAHNVASTVR  235



>ref|XP_010100736.1| hypothetical protein L484_005803 [Morus notabilis]
 gb|EXB84039.1| hypothetical protein L484_005803 [Morus notabilis]
Length=248

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 103/262 (39%), Positives = 132/262 (50%), Gaps = 57/262 (22%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPSV----------HETKPVLDDEYKKESKTMMGVLSL  282
            AE++L L+D CWF+ +IL  KQ  S+          H  +   ++E K+    +  V + 
Sbjct  6    AEKVLNLYDYCWFELQILKIKQPFSLNSSSSESEQDHREEITQENEKKQPKPEISRVPTH  65

Query  283  KVRSQSDNLLSFGTSFSPP------SDSLKSGIIKPELEDLQaaataaaaataLLITKKV  444
              RS SD  +   T  S P      S     G   PE E+L+                 V
Sbjct  66   HNRSMSDQSIMNTTDHSSPKLCTILSGKEIPGFENPETENLE-----------------V  108

Query  445  CEIKKRRVARK-----KLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQR  609
             E  K++V+ +     K    +SLS+LE EELKGFMDLGFVF+EED+ SSLASIIPGLQR
Sbjct  109  AEPPKKKVSNRRRRRRKGCESKSLSDLEFEELKGFMDLGFVFSEEDRESSLASIIPGLQR  168

Query  610  WG----------------SRDEVMTNESSVQRPYLSEAWSIMDQR-KMMKKLLKWRFPPL  738
             G                 RD    N S + RPYLSEAW + D R K    L+ WR P  
Sbjct  169  LGKNNKELEEEKEKEEEEKRD--FANGSVISRPYLSEAWEVFDLRPKRENPLMNWRIPAS  226

Query  739  SNETNMKDNLKFWAQTVASAVR  804
             NE +MKDNL++WA TVAS VR
Sbjct  227  ENEIDMKDNLRWWAHTVASTVR  248



>ref|XP_011083310.1| PREDICTED: uncharacterized protein LOC105165845 [Sesamum indicum]
Length=250

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 100/259 (39%), Positives = 136/259 (53%), Gaps = 42/259 (16%)
 Frame = +1

Query  127  VAAEE--ILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQS  300
            ++AEE  +L LFDS WF+  + T K   S  +  PVL     +       V++L  +S S
Sbjct  1    MSAEETVLLNLFDSYWFEYGVFTAKPSSSKLKNAPVLGQNLNR-------VITLMRKSHS  53

Query  301  DNLLSFG--------TSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIK  456
            D  LS          TS   P   L++ +   E+   Q +++        L++     + 
Sbjct  54   DQFLSSKDCSSDSSPTSVLGPQ--LQTILSGKEVRSSQDSSSPPPPRKQELMSSDTASVD  111

Query  457  K------RRVARKKLGG--------HRSLSELEIEELKGFMDLGFVFTEEDKSSSLASII  594
                   RRV+R K  G         RSLSELE EELKGFMDLGFVF++ED+ S L SII
Sbjct  112  SSRSHTVRRVSRTKHAGCRKIRRSGSRSLSELEFEELKGFMDLGFVFSDEDRDSRLVSII  171

Query  595  PGLQRWG-------SRDEVMTNESSVQRPYLSEAWSIMDQRKMMKK--LLKWRFPPLSNE  747
            PGLQR G        ++      ++V RPYLSEAW  ++  K++K   L+ WR P   NE
Sbjct  172  PGLQRLGKNVQEESGKERGEAPSTAVSRPYLSEAWECLEDEKIVKNNPLIDWRIPAFGNE  231

Query  748  TNMKDNLKFWAQTVASAVR  804
            T +KD+L+FWA TVASAVR
Sbjct  232  TELKDHLRFWAHTVASAVR  250



>ref|XP_009353410.1| PREDICTED: uncharacterized protein LOC103944673 [Pyrus x bretschneideri]
Length=229

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 99/244 (41%), Positives = 143/244 (59%), Gaps = 39/244 (16%)
 Frame = +1

Query  145  LKLFDSCWFQGEILTRKQCPSV---------HETKPVLDDEYKKESKT-MMGVLSLKVRS  294
            ++L+DS WF+ +I+ ++    +         HE    +D+  +K SK  ++ + +   RS
Sbjct  1    MELYDSFWFELQIIKKQPISPIPSRIEENADHE----IDENPEKPSKPELLRIPTGHTRS  56

Query  295  QSDNL---LSFG-TSFSPPS-------DSLKSGIIKPELEDLQaaataaaaataLLITKK  441
             SD L   ++F  +S SP S        ++ SG    E+E+ +            +  ++
Sbjct  57   MSDELSSKMTFNLSSLSPDSVLDRSKLSTVLSGKEAGEIENQKQ-----------ICAEE  105

Query  442  VCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSR  621
                K  R  RKK    +SL++L+ EELKGFMDLGFVF+EEDK S+L SIIPGLQR G +
Sbjct  106  ETPKKVERRRRKKKSESKSLTDLQFEELKGFMDLGFVFSEEDKDSNLVSIIPGLQRLGKK  165

Query  622  DEVMT---NESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVA  792
            D+      +ES++ RPYLSEAW + ++RK  K L+ WRFP L NE +MKDNLK+WA TVA
Sbjct  166  DDSRYESFDESAISRPYLSEAWKVREKRKRGKPLMNWRFPALENEIDMKDNLKWWAHTVA  225

Query  793  SAVR  804
            SAVR
Sbjct  226  SAVR  229



>gb|AFK43794.1| unknown [Lotus japonicus]
Length=248

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 98/248 (40%), Positives = 130/248 (52%), Gaps = 26/248 (10%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPSVHETKP------VLDDEYKKESKTMMGVLSLKVRS  294
            AE ++ LFDS W    IL +                 V+ +    E   +  + +   RS
Sbjct  3    AEHVMNLFDSFWLDQNILNKTSSSKSSTNSAENVENQVVKESSDSEVPKLHRIRTGHTRS  62

Query  295  QSDNLLSFGTSFSPPSDSLKSGIIKPELE---------DLQaaataaaaataLLITKKVC  447
             SD   S  TSF+  S S  S ++ P+L+         D +A  T       +L+++K  
Sbjct  63   MSDQ--SIATSFNHESLSPNSVLLAPKLQTIFSGKEVVDSEAEETPVVQHHEVLLSEKNN  120

Query  448  EIKKRRVARKKLG-GHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRD  624
                    +KK   G +SLS+LE EELKGFMDLGFVF+ EDK+SSLASIIPGLQR G ++
Sbjct  121  NGNSTSCEKKKKNRGSKSLSDLEFEELKGFMDLGFVFSLEDKNSSLASIIPGLQRLGKKE  180

Query  625  EVM--------TNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWA  780
            E          +NES V RPYLSEAW    +RK    L+ W+ P L  E +MKD+L+ WA
Sbjct  181  EEQGEEEEEEDSNESLVPRPYLSEAWEFHGKRKKENPLMNWKVPSLKKEIDMKDSLRLWA  240

Query  781  QTVASAVR  804
             TVAS VR
Sbjct  241  HTVASTVR  248



>ref|XP_011082982.1| PREDICTED: uncharacterized protein LOC105165613 [Sesamum indicum]
Length=250

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 98/261 (38%), Positives = 137/261 (52%), Gaps = 46/261 (18%)
 Frame = +1

Query  127  VAAEE--ILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQS  300
            ++AEE  +L LFDS WF+  +   K   S  +  PVL        + +  V++L  +S S
Sbjct  1    MSAEETVLLNLFDSYWFEYGVFAAKPSSSKLKNAPVL-------GQNLNRVITLMRKSHS  53

Query  301  DNLLSF-GTSFSPPSDSLKSGIIKPELEDL---------QaaataaaaataLLITKKVCE  450
            D  LS    SF    DS  + ++ P+L+ +           +++        L++     
Sbjct  54   DQFLSSKDCSF----DSSPTSVLGPQLQTILSGKEVRSFHDSSSPPPPRKQELMSTDTAG  109

Query  451  IKK------RRVARKKLGG--------HRSLSELEIEELKGFMDLGFVFTEEDKSSSLAS  588
            +        RRV+R K  G         RSLSELE EELKGFMDLGFVF++ED+ S L S
Sbjct  110  VDSSSSHTVRRVSRTKHAGCRKIRRSGSRSLSELEFEELKGFMDLGFVFSDEDRDSRLVS  169

Query  589  IIPGLQRWGSRDEVMTNE-------SSVQRPYLSEAWSIMDQRKMMKK--LLKWRFPPLS  741
            IIPGLQR G   +  + +       ++V RPYLSEAW  ++  K +K   L+ WR P   
Sbjct  170  IIPGLQRLGKNVQEESGKECREASWTAVSRPYLSEAWECLEDEKEVKNNPLIDWRIPAFG  229

Query  742  NETNMKDNLKFWAQTVASAVR  804
            NET +KD+L+FWA TVAS VR
Sbjct  230  NETELKDHLRFWAHTVASTVR  250



>ref|XP_008366054.1| PREDICTED: uncharacterized protein LOC103429701 [Malus domestica]
Length=257

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 97/230 (42%), Positives = 137/230 (60%), Gaps = 13/230 (6%)
 Frame = +1

Query  145  LKLFDSCWFQGEILTRKQC---PSVHETKP---VLDDEYKKESKTMMGVLSLKVRSQSDN  306
            + L+DS WF+  I  ++     PS  E  P   + ++  K      + + +   RS SD 
Sbjct  1    MDLYDSFWFKFPIFKKQPVSSNPSNFEEHPDHEIEENPEKPSKPEFLRIPTRHTRSMSDE  60

Query  307  LLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKK---VCEIKKRRVARK  477
            L S  TSF+  + S  + + +P+L  + +   A        I  +     ++++RR  RK
Sbjct  61   LSS-NTSFNLSTLSPDTVLHRPKLSTILSGKEAREIGNPKQIYSEEEPQKKVERRRRRRK  119

Query  478  KLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRD---EVMTNESS  648
            K    +SL++L+ EELKGFMDLGFVF+EEDK S+L SIIPGLQR G +D   E   +ES+
Sbjct  120  KKSESKSLTDLQFEELKGFMDLGFVFSEEDKDSNLVSIIPGLQRLGKKDDSREERFBESA  179

Query  649  VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASA  798
            + RPYLSEAW + ++RK  K L+ WRFP L NE +MKDNLK+WA TVASA
Sbjct  180  ISRPYLSEAWEVREKRKREKPLMNWRFPALENEIDMKDNLKWWAHTVASA  229



>emb|CDO96846.1| unnamed protein product [Coffea canephora]
Length=253

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 105/253 (42%), Positives = 138/253 (55%), Gaps = 31/253 (12%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDD----EYKKESKTMMGVLSLKVRSQS  300
             EE++ LFD CWF  EI  +        +     D    E   +++    +LS+  RS S
Sbjct  3    GEEVIALFDFCWFNQEIFKKSSSSPTSSSLKKSPDHQIGEDSPKAEFSSQLLSIHPRSNS  62

Query  301  DNLLSFGTS-----FSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKV-------  444
            D  +S  TS     FSP  DS+   +   +LE + +     A       ++KV       
Sbjct  63   DYTMSSKTSTNSGLFSP--DSVLYVLSASQLEIVLSETEGKAEFPGTPESRKVKTDDNEK  120

Query  445  ---CEIKKRRVARKKL--GGHRSLSELEIEELKGFMDLGFVFTEEDKS-SSLASIIPGLQ  606
                + KKRR +  KL  G  +SLSELE EELKGFMDLGFVF+EEDK+ SSL  IIPGLQ
Sbjct  121  KKKKKKKKRRKSNDKLKKGLSKSLSELEFEELKGFMDLGFVFSEEDKNDSSLLEIIPGLQ  180

Query  607  RWGSRDEV-------MTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDN  765
            R G   +V         +ESSV RPYLSEAW ++D+R     L+ W+ P +SNET MK++
Sbjct  181  RLGREKDVGEQRRNSAPDESSVTRPYLSEAWEVLDRRNRENPLMNWKVPAVSNETGMKNS  240

Query  766  LKFWAQTVASAVR  804
            LK+WA  VAS VR
Sbjct  241  LKWWAHVVASTVR  253



>gb|AFK40408.1| unknown [Medicago truncatula]
Length=180

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 93/133 (70%), Gaps = 10/133 (8%)
 Frame = +1

Query  427  LITKKVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQ  606
            L+ KK   I K  V +KK    +SLS+LE EELKGFMDLGFVF+EEDK SSL  IIPGLQ
Sbjct  51   LLPKKNNNINK--VVKKKRES-KSLSDLEFEELKGFMDLGFVFSEEDKDSSLVEIIPGLQ  107

Query  607  RWGSRDEV-------MTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDN  765
            R G +++        + +ES VQRPYLSEAW + D RK  K L+ W+ P ++NE +MK++
Sbjct  108  RLGKKNDEEEEEEEDVYDESVVQRPYLSEAWEVYDWRKKEKPLVNWKVPAMNNEIDMKNS  167

Query  766  LKFWAQTVASAVR  804
            L+ WAQTVAS VR
Sbjct  168  LRLWAQTVASTVR  180



>ref|XP_004504284.1| PREDICTED: uncharacterized protein LOC101494080 [Cicer arietinum]
Length=245

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 99/242 (41%), Positives = 134/242 (55%), Gaps = 23/242 (10%)
 Frame = +1

Query  142  ILKLFDSCWFQGEILTRKQCPSVHETKPV---LDDEYKKESKT------MMGVLSLKVRS  294
            IL LFDS WF   IL +    S   +      L++ Y+K   +      +  + +L  RS
Sbjct  6    ILNLFDSNWFHLNILKKSNSTSSTTSTSSKENLEERYQKNETSSESEPKLARIRTLHNRS  65

Query  295  QSDN--LLSFGT-SFSPPS----DSLKSGIIKPELEDLQaaataaaaataLLITKKVCEI  453
             SD+  + SF   S SP S      L++ +   E+ D ++          LL  K     
Sbjct  66   MSDDQSMKSFNVDSLSPDSVLISSKLQTILSGKEVTDSESDENLVPTTQTLLPKKNNIIK  125

Query  454  KKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVM  633
                V +K+    +SLS+LE EELKGFMDLGFVF+EEDK SSL SIIPGLQR G +DE +
Sbjct  126  NVVVVKKKRES--KSLSDLEFEELKGFMDLGFVFSEEDKDSSLVSIIPGLQRLGKKDEEV  183

Query  634  TNESS-----VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASA  798
              E+      VQRPYLSEAW   D+RK    L+ W+ P ++NE +MK++L+ WA TVAS+
Sbjct  184  EKENVFDECLVQRPYLSEAWEFHDRRKKEYPLMNWKVPAMNNEIDMKNSLRLWAHTVASS  243

Query  799  VR  804
            VR
Sbjct  244  VR  245



>ref|XP_008228946.1| PREDICTED: uncharacterized protein LOC103328331 [Prunus mume]
Length=268

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 103/258 (40%), Positives = 134/258 (52%), Gaps = 40/258 (16%)
 Frame = +1

Query  142  ILKLFDSCWFQGEILTRKQCPSVHE-TKPVLDDEYKKESKTMMGV-----LSLKVRSQSD  303
            +L LFDS WF+  IL++K      E T P L  +   +  T   V     LS   RS SD
Sbjct  14   LLSLFDSYWFEHGILSKKSPSKPQEATNPSLQVDQSAQEATQQQVPNFQSLSCLPRSLSD  73

Query  304  NLLSF--GTSFSPPSDSLKSGII----KPELEDLQaaataaaaataLLITKKVCEIKKRR  465
            +  S   G+ FS  SDSL    I     P+ + + +       +   +  ++V   + +R
Sbjct  74   DQSSNTKGSLFS--SDSLSPHSILMSTTPKFQTVFSGKQVTEFSKQSVKREQVPAAQTKR  131

Query  466  V--------ARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSR  621
            V        +R+++G  +SLS+LE +ELKGFMDLGFVFTEEDK S L SIIPGLQR GS 
Sbjct  132  VHGHGERNRSRRRVGPSKSLSDLEFDELKGFMDLGFVFTEEDKDSKLVSIIPGLQRLGSI  191

Query  622  DEV-----------------MTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNET  750
             E                   ++   V RPYLSEAW  +DQRK   KL+ WR P    + 
Sbjct  192  GEQDRDGEDQRNNNNDNNIDPSSHHVVSRPYLSEAWDALDQRKKENKLVNWRIPANLGK-  250

Query  751  NMKDNLKFWAQTVASAVR  804
             MK NL+FWA TVAS VR
Sbjct  251  GMKHNLRFWAHTVASTVR  268



>ref|XP_002277325.1| PREDICTED: uncharacterized protein LOC100266042 [Vitis vinifera]
Length=244

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 132/244 (54%), Gaps = 21/244 (9%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDD----EYKKESKTMMGVLSLKVRS--  294
            A ++L LFD  WFQ  I + K  P          D    +  KES     + +L VRS  
Sbjct  2    AAKLLNLFDFYWFQHLIFSNKPPPPSPPPPAPHPDLQFYDPFKESNLSEHLPTLHVRSLG  61

Query  295  QSDNLLSFGTSFSPPSDSLKSGIIKP-ELEDLQaaataaaaataLLITKKVCEIKKRRVA  471
             +D  LS   SF+  +    S +++  +L+ + +             T +  E +K    
Sbjct  62   DADQFLSSQESFTLDNSVSPSSVLQASKLQRIFSVKELGEGYPTFDETDRPIE-RKVYGG  120

Query  472  RKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMT-----  636
            R++ G  +SLSELE+EE+KGFMDLGFVF+EEDK+S L SI+PGL+R G +          
Sbjct  121  RRRKGSRKSLSELELEEVKGFMDLGFVFSEEDKNSWLVSIVPGLKRLGRKSTSGGEDHDE  180

Query  637  -------NESSVQRPYLSEAWSIMD-QRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVA  792
                    +S V RPYLSEAW ++D +RK M  LL WR P  +NE +MKD+L+ WA TVA
Sbjct  181  EEDGENIEKSEVSRPYLSEAWGVLDRRRKEMDGLLNWRIPASANEMDMKDHLRLWAHTVA  240

Query  793  SAVR  804
            SAVR
Sbjct  241  SAVR  244



>ref|XP_011101455.1| PREDICTED: uncharacterized protein LOC105179506 [Sesamum indicum]
Length=223

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 133/231 (58%), Gaps = 19/231 (8%)
 Frame = +1

Query  136  EEILKLFDSCWFQGEILTRKQCPSVHETKPVLDD-EYKKESKTMMGVLSLKVRSQSDNLL  312
            E ++ LFDS W   +I  ++   S  +  P     ++          L++  RS+SD+ L
Sbjct  4    EAVINLFDSLWSYLQIFKKQPTSSSPDPNPPPAQIQHTSPKPRFSSQLTISTRSKSDHQL  63

Query  313  ---SFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVARKKL  483
               +  T F        + ++KP L+ + +    +         KK+   +K  ++RKK 
Sbjct  64   LVPNNATVFLKTETFSPNSVLKPHLQTVLSDKEISLETPQQF--KKLP--RKGVISRKKK  119

Query  484  GGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGS---RDEVMTNESSVQ  654
               +SLSELE EELKGFMDLGFVF+EED+ S L  IIPGLQR G+   ++E +       
Sbjct  120  VLSKSLSELEFEELKGFMDLGFVFSEEDRESGLVEIIPGLQRLGADGRKEEKL-------  172

Query  655  RPYLSEAWSIMDQRKMMKK-LLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            RPYLSEAW ++++R+ ++  L+KWR P +SNE +MKDNLK+WA TVASAVR
Sbjct  173  RPYLSEAWEVLNRRREIESPLMKWRVPAVSNEIDMKDNLKWWAHTVASAVR  223



>ref|XP_008455295.1| PREDICTED: uncharacterized protein LOC103495495 [Cucumis melo]
 ref|XP_008455296.1| PREDICTED: uncharacterized protein LOC103495495 [Cucumis melo]
Length=216

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 106/238 (45%), Positives = 136/238 (57%), Gaps = 34/238 (14%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSDN  306
            +AAEEIL LFD  WFQ  I  RK         P+L   ++       G   +K+RSQS+ 
Sbjct  1    MAAEEILPLFDLFWFQQAIFPRK---------PLLKTCFQ-------GSPVMKMRSQSEY  44

Query  307  LLSFGTSFSPPSDSLKSGIIKPELED-LQaaataaaaataLLITKKVCEIKK-------R  462
            LL+    F PP  +L S     +LE  L    T    +     TKK  E+KK        
Sbjct  45   LLN-SKDFPPPVTTLNS---NQKLETVLSGQVTEFGGSGEGKATKK--EMKKLEGNENKI  98

Query  463  RVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKS-SSLASIIPGLQRWGSR-DEVMT  636
            R  +K+ G  +SLS+LE EELKGFMDLGFVF+EEDK+ S+L SIIPGL R G +  E   
Sbjct  99   RRKKKRKGLSKSLSDLEFEELKGFMDLGFVFSEEDKNDSNLGSIIPGLHRLGPQITEEKR  158

Query  637  NESSV-QRPYLSEAWSIMDQRKMMKKLLKWRFPPL-SNETNMKDNLKFWAQTVASAVR  804
            NE+ V +RPYLSEAW  +++      L+KWR P L + E ++K +LKFWA TVAS VR
Sbjct  159  NENGVLRRPYLSEAWEAIEEENEKMVLMKWRVPSLGATEMDIKHHLKFWAHTVASTVR  216



>ref|XP_009365283.1| PREDICTED: uncharacterized protein LOC103955136 [Pyrus x bretschneideri]
Length=254

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 132/242 (55%), Gaps = 23/242 (10%)
 Frame = +1

Query  142  ILKLFDSCWFQGEILTRK---QCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSDNLL  312
            +L LFDS WF  EIL++K   Q       + +  DE  +E    + +L  K+RS SD  L
Sbjct  15   LLNLFDSYWFGHEILSQKSPSQPQQATNNQTLQVDESAQEETLELPIL--KLRSLSDQFL  72

Query  313  ---SFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVARKKL  483
               SF  S +P   ++ SG                  ++ +  +       +R+  ++ L
Sbjct  73   NTPSFSPSSTPKLQTIFSGEQVTNFSKNDELPAHPTKSSRVSSSSSSSRSSERKRRKRVL  132

Query  484  GGHRSLSELEIEELKGFMDLGFVFTEEDKSSS-LASIIPGLQRWGSRDEVMTNESS----  648
            G  +S+SELE EELKGFMDLGFVFTEEDK SS L SIIPGLQR  S +E    +      
Sbjct  133  GPSKSMSELEFEELKGFMDLGFVFTEEDKDSSRLVSIIPGLQRLASCEEEDVRDYQKEEE  192

Query  649  --------VQRPYLSEAWSIMDQRKMMKK-LLKWRFPPLSN-ETNMKDNLKFWAQTVASA  798
                     +RPYLSEAW ++DQRK   + L+KWR PP +N   +MK +L+FWA +VAS+
Sbjct  193  EEEDHGVVSRRPYLSEAWDVLDQRKKENQMLMKWRIPPATNLGKDMKHHLRFWAHSVASS  252

Query  799  VR  804
            VR
Sbjct  253  VR  254



>emb|CBI22018.3| unnamed protein product [Vitis vinifera]
Length=146

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 78/103 (76%), Gaps = 3/103 (3%)
 Frame = +1

Query  505  ELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTN--ESSVQRPYLSEAW  678
            +LE EELKGFMDLGFVF+EEDK+S L SI+PGLQR G + E   N  +S V RPYLSEAW
Sbjct  44   DLEFEELKGFMDLGFVFSEEDKNSKLVSIVPGLQRLGKKGEDGENIEKSEVSRPYLSEAW  103

Query  679  SIMD-QRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
             ++D +RK M  LL WR P  +NE +MKD+L+ WA TVASAVR
Sbjct  104  GVLDRRRKEMDGLLNWRIPASANEMDMKDHLRLWAHTVASAVR  146



>ref|XP_009766224.1| PREDICTED: uncharacterized protein LOC104217628 [Nicotiana sylvestris]
Length=235

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 96/243 (40%), Positives = 127/243 (52%), Gaps = 36/243 (15%)
 Frame = +1

Query  136  EEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMG-----VLSLKVRSQS  300
            E +L LFDSCWF  +IL +   P+     P   D   +E    +      +  +++ SQS
Sbjct  4    EAVLSLFDSCWFNLQILNKHSNPTPTLNSPENPDRKIQEDSPEIAKDPSLLEKIQLGSQS  63

Query  301  DNLLSFGTSFSP----PSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRV  468
            D L     SFSP    P    +   IK E +                  K   + +KRR 
Sbjct  64   DGLSYNSDSFSPDSVLPITHFQPDPIKAEPK----------------KIKGKRKERKRRT  107

Query  469  ARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG----SRDEVMT  636
             R K G  +SLSELE EELKGFMDLGF F+EED +SSL  +IPGLQ+ G    S D+   
Sbjct  108  RRTKKGLSKSLSELEYEELKGFMDLGFEFSEEDVNSSLVEVIPGLQKLGKNRSSNDQEKV  167

Query  637  N-------ESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVAS  795
            N        S   RPYLSEAW + +++K M  L+ WR P  SNE ++K +LK+WA TVAS
Sbjct  168  NFLEKSDLHSRAIRPYLSEAWEVFERKKKMNSLMNWRIPATSNEIDVKHSLKWWAHTVAS  227

Query  796  AVR  804
            +V+
Sbjct  228  SVK  230



>ref|XP_006348891.1| PREDICTED: uncharacterized protein LOC102578884 [Solanum tuberosum]
Length=238

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 98/241 (41%), Positives = 133/241 (55%), Gaps = 18/241 (7%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLD--DEYKKESKTMMGVLSLKVRSQS  300
            +  EE L LFD  WFQ +IL  K   S   T P+L+   +  +E+  +    +  VRSQS
Sbjct  1    MEVEEFLNLFDFHWFQSQILKPKHPFST--TTPILEPIKQILEETPKLSRTPTFMVRSQS  58

Query  301  DN-LLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKR---RV  468
            D+ L+S   +F   S+  +S   K  LE       +      L  + +   +K R   R 
Sbjct  59   DHCLISKDYTFDNISEKSQSPSPKSVLEAKLQPILSGKEYNELKFSPEAA-VKNRANVRS  117

Query  469  ARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEV---MTN  639
             +K+    +SLSELE EELKGFMDLGF F+++DK S+L SIIPGL+R G  +E      +
Sbjct  118  RKKRSKNSKSLSELEFEELKGFMDLGFEFSDKDKDSNLVSIIPGLKRLGMENERGFDEND  177

Query  640  ESSVQRPYLSEAWSIMDQRKMM----KKLLK-WRF-PPLSNETNMKDNLKFWAQTVASAV  801
            ES V RP+LSEAW + +++K M    K  LK W+      NE  +KD LKFWA TVAS V
Sbjct  178  ESGVSRPHLSEAWGVWEEKKKMEDWKKNALKSWKINSDFGNEMEIKDQLKFWAHTVASTV  237

Query  802  R  804
            R
Sbjct  238  R  238



>emb|CDP15956.1| unnamed protein product [Coffea canephora]
Length=242

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 105/247 (43%), Positives = 135/247 (55%), Gaps = 26/247 (11%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESK-TMMGVLSLKVRSQSD  303
            + AEE L++FD  WF+  IL +KQ PS   + PVLD + + E K  +    S  VRS S+
Sbjct  1    MPAEEELRIFDIYWFEHCILRKKQ-PST--SNPVLDIDEEVEPKLKLSSTPSFVVRSFSE  57

Query  304  NLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVARKKL  483
              LS  +  SP + S   G   P+   L        +   +    +V E K    A KK 
Sbjct  58   QNLS--SKDSPSTASPDHGSPSPKSVLLLPKPQTILSGKEVGEFSEVEENKAGFDAGKKR  115

Query  484  --------GGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG-------S  618
                       +SLSELE EELKGFMDLGFVF++EDK SSL SIIPGLQR G        
Sbjct  116  RRRRERRRNNSKSLSELEFEELKGFMDLGFVFSDEDKESSLVSIIPGLQRLGRNVDEEEE  175

Query  619  RDEVMTNESSVQRPYLSEAWSIMDQ----RKMMKKLLKWRFPP-LSNETNMKDNLKFWAQ  783
            + +    +  V RPYLSEAW ++D+    RK+ KKL+ W+  P L NE  +KD L+FWA 
Sbjct  176  KKDFADEKPVVSRPYLSEAWDVLDEKKAERKVKKKLMNWKINPGLGNEMEIKDQLRFWAH  235

Query  784  TVASAVR  804
            TVAS VR
Sbjct  236  TVASTVR  242



>ref|XP_010314075.1| PREDICTED: uncharacterized protein LOC104644911 [Solanum lycopersicum]
Length=192

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = +1

Query  526  KGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQ-RPYLSEAWSIMDQRKM  702
            KGFMDLGF F+EEDK+SSL  I+PGL++WG  DE +  +  V  RPYLSEAW I+++RKM
Sbjct  99   KGFMDLGFEFSEEDKNSSLVRIVPGLEKWGIVDENVKKKDIVHKRPYLSEAWEILEKRKM  158

Query  703  MKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
             KKLLKWRFP + N+ NMK NL+FWAQTVAS  +
Sbjct  159  SKKLLKWRFPAMKNDMNMKHNLRFWAQTVASTFK  192



>ref|XP_009591668.1| PREDICTED: uncharacterized protein LOC104088654 [Nicotiana tomentosiformis]
Length=228

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 97/243 (40%), Positives = 126/243 (52%), Gaps = 39/243 (16%)
 Frame = +1

Query  136  EEILKLFDSCWFQGEILTRKQCPS------------VHETKPVLDDEYKKESKTMMGVLS  279
            E IL LFDS WF  EIL +   P+            + E  P   +EY         +L 
Sbjct  4    EAILSLFDSYWFDVEILKKHSNPTPPLNSQKHPDHKIQENSPETLNEYS-------SLLE  56

Query  280  LKVRSQSDNLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKK  459
            +++ SQSD+L      FSP S  L +    P     +           L   K     ++
Sbjct  57   IQLGSQSDDLSYNSDPFSPDS-VLPTTHFTPFCNKAE-----------LKKVKGRRRERR  104

Query  460  RRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG----SRDE  627
            RR  R K G  +SLSELE EELKGFMDLGF F+EED +SSL  +IPGLQ+ G    S D+
Sbjct  105  RRTRRTKKGLSKSLSELEYEELKGFMDLGFEFSEEDVNSSLVEVIPGLQKLGKNRDSGDQ  164

Query  628  VMTN----ESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVAS  795
            V  N      S  RPYLSEAW I++++  M  L+ W+ P  SNE ++K +LK WA TVAS
Sbjct  165  VKVNCFEKSESRARPYLSEAWEILEKKNRMSTLMNWKIPATSNEIDVKRSLKRWAHTVAS  224

Query  796  AVR  804
             V+
Sbjct  225  TVK  227



>ref|XP_004243270.1| PREDICTED: uncharacterized protein LOC101267910 [Solanum lycopersicum]
Length=231

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 102/245 (42%), Positives = 131/245 (53%), Gaps = 37/245 (15%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSDNLL  312
             EE L LFD  WF+ +IL  K+  S   T P+L+ E  K SKT     +  VRSQSD  L
Sbjct  3    VEEFLNLFDFHWFEYQILKPKRPFST--TTPILE-ETPKLSKTP----TFMVRSQSDLCL  55

Query  313  S-----FGT----SFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKR-  462
            S     F +    S SP   S+    ++P L   +            L +     +K R 
Sbjct  56   SSKDYIFDSISEKSQSPSPKSVLEAKLQPILSGKEYNE---------LKSSPEAAVKNRA  106

Query  463  --RVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEV--  630
              R  +KK    +SLSELE EELKGFMDLGF F+E+DK S+L SIIPGL+R G  +E   
Sbjct  107  NCRSRKKKSNNSKSLSELEFEELKGFMDLGFEFSEKDKDSNLVSIIPGLKRLGMENERGF  166

Query  631  -MTNESSVQRPYLSEAWSIMDQRKMMKKLLK-----WRF-PPLSNETNMKDNLKFWAQTV  789
               +ES V RP+LSEAW + +++K M+   K     W+F     NE  +K  LKFWA TV
Sbjct  167  DENDESGVSRPHLSEAWGVWEEQKKMEDWKKNSLKIWKFDSDFGNEMEIKHQLKFWAHTV  226

Query  790  ASAVR  804
            AS VR
Sbjct  227  ASTVR  231



>gb|KGN61130.1| hypothetical protein Csa_2G058630 [Cucumis sativus]
Length=208

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 92/238 (39%), Positives = 125/238 (53%), Gaps = 42/238 (18%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVL-----DDEYKKESKTMMGVLSLKVR  291
            +AAE+IL LFD  WFQ EI  R      H + P +     D EY   S          V 
Sbjct  1    MAAEKILPLFDLFWFQREIFARNPLLKTHSSAPEIHFQSPDSEYAVSSSMNFPASKTAVH  60

Query  292  SQSDNLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVA  471
            S ++  L      +  S  ++   ++   E ++             I  KV  + K    
Sbjct  61   STNNQKLE-----TIVSSKVREFSVEENYEKMK-------------IMGKVKRLSK----  98

Query  472  RKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKS-SSLASIIPGLQRWGSRDE----VMT  636
                    SLSELE EELKGFMDLGFVF+EEDK+ ++LASIIPGLQR+G + E     + 
Sbjct  99   --------SLSELEFEELKGFMDLGFVFSEEDKNDTNLASIIPGLQRFGEKKEEKQKQIE  150

Query  637  NESSVQRPYLSEAWSIMDQRKMMKK-LLKWRFPPL-SNETNMKDNLKFWAQTVASAVR  804
            +   ++RPYLSEAW  +++    K+ L+KWR P L + E ++K +LKFWA TVAS VR
Sbjct  151  DGVLLKRPYLSEAWEDVEKENDKKRILMKWRVPSLGATEMDIKHHLKFWAHTVASTVR  208



>ref|XP_009790979.1| PREDICTED: uncharacterized protein LOC104238348 [Nicotiana sylvestris]
Length=222

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 96/247 (39%), Positives = 133/247 (54%), Gaps = 51/247 (21%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSDNLL  312
             E++L LF+S WF+ EIL  KQ  S      + + E  K SKT   +    VRSQSD  L
Sbjct  3    VEQLLNLFNSYWFESEILKPKQPFSA-----ISNLEQPKLSKTPTFI----VRSQSDQCL  53

Query  313  SFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVARKKLGGH  492
            S   +     +S KS +++P+LE              +L  K+  E+  +  ++   GG 
Sbjct  54   SSKDTTFHSENSPKSVLVEPKLE-------------PILSGKEYNEL--QFSSKPAEGGD  98

Query  493  RS-----------------LSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSR  621
            +S                 LSELE EELKGFMDLGF F+++DK SSL SI+PGL+R G  
Sbjct  99   KSKESYRRRKKKSNNSSKSLSELEFEELKGFMDLGFEFSDKDKDSSLVSILPGLRRLGRE  158

Query  622  DEVMT-----NESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPP-LSNETNMKDNLKFWAQ  783
            +E         E++V RP+LSEAW++ ++    KK + W+  P L NE  +KD L+FWA 
Sbjct  159  NEENMRFEELEEAAVSRPHLSEAWAVWEE----KKKISWKINPVLRNEMEIKDQLRFWAH  214

Query  784  TVASAVR  804
            TVAS VR
Sbjct  215  TVASTVR  221



>ref|XP_009804439.1| PREDICTED: uncharacterized protein LOC104249662 [Nicotiana sylvestris]
Length=227

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 93/235 (40%), Positives = 129/235 (55%), Gaps = 24/235 (10%)
 Frame = +1

Query  136  EEILKLFDSCWFQGEILTRKQCPSV-HETKPVLDDEYKKESKTMMG---VLSLKVRSQSD  303
            E +L LFDS WF  EIL +   P+    ++   D + +++S   +    +L +++ SQSD
Sbjct  4    EAVLSLFDSYWFDVEILNKHSNPTPPSNSQKYPDHKIEEKSPETLNESLLLEIQIGSQSD  63

Query  304  NLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVARKKL  483
            +L      FSP S  L +    P  +  +           L   K     ++RR  R K 
Sbjct  64   DLSYNSDPFSPDS-VLPTTYFTPFCKKAE-----------LKKVKGRRRERRRRTRRTKK  111

Query  484  GGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG----SRDEVMTN----  639
            G  +SLSELE EELKGFMDLGF F+ +D +SSL  IIPGLQ+ G    S D+V  N    
Sbjct  112  GLSKSLSELEYEELKGFMDLGFDFSADDVNSSLVEIIPGLQKLGKNRDSDDQVKVNYFEK  171

Query  640  ESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
              S  RPYLSEAW I++++  M  L+ W+ P  SNE ++K +LK WA TVAS V+
Sbjct  172  SESRARPYLSEAWEILEKKNRMSTLMNWKIPATSNEIDVKQSLKRWAHTVASTVK  226



>gb|AFK41310.1| unknown [Medicago truncatula]
Length=239

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 99/249 (40%), Positives = 129/249 (52%), Gaps = 33/249 (13%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSD-  303
            ++AE+IL L DS WF+  ILT K    V E  P      +  +  ++   +L VR  S+ 
Sbjct  1    MSAEQILTLLDSFWFETTILTNKNPSKVEEILP------QDTNLLLVPTPNLDVRFYSEQ  54

Query  304  NLLSFGTSFS---PPSDSLKSG---IIKPELE----DLQaaataaaaataLLITKKVCEI  453
            NL   G+ FS    P+  L S     I  E E        ++        +  TKK    
Sbjct  55   NLSIIGSVFSDSPSPNSVLTSSKLRTIPSEREFGEFSTGTSSENHHQKEDVAYTKK----  110

Query  454  KKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG------  615
            K+ +  R++    RSLSELE +ELKGFMDLGFVF+EEDK S L S+IPGLQR G      
Sbjct  111  KQSQSYRRRRRRSRSLSELEFKELKGFMDLGFVFSEEDKDSKLVSLIPGLQRLGRENDDA  170

Query  616  ------SRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFW  777
                     ++  N  S  +PYLSEAW + DQR+    L+ WR P   +E +MKDNLKFW
Sbjct  171  EEGEDEEHKKIDENVLSDNKPYLSEAWDVFDQRERKNPLVNWRVPDKGSEIDMKDNLKFW  230

Query  778  AQTVASAVR  804
            A  VAS  R
Sbjct  231  AHAVASIAR  239



>ref|XP_003607621.1| hypothetical protein MTR_4g080340 [Medicago truncatula]
 gb|AES89818.1| DUF1685 family protein [Medicago truncatula]
Length=239

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 99/249 (40%), Positives = 129/249 (52%), Gaps = 33/249 (13%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSD-  303
            ++AE+IL L DS WF+  ILT K    V E  P      +  +  ++   +L VR  S+ 
Sbjct  1    MSAEQILTLLDSFWFETTILTNKNPSKVEEILP------QDTNLLLVPTPNLDVRFYSEQ  54

Query  304  NLLSFGTSFS---PPSDSLKSG---IIKPELE----DLQaaataaaaataLLITKKVCEI  453
            NL   G+ FS    P+  L S     I  E E        ++        +  TKK    
Sbjct  55   NLSIIGSVFSDSPSPNSVLTSSKLRTIPSEREFGEFSTGTSSENHHQKEDVAYTKK----  110

Query  454  KKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG------  615
            K+ +  R++    RSLSELE +ELKGFMDLGFVF+EEDK S L S+IPGLQR G      
Sbjct  111  KQSQSYRRRRRKSRSLSELEFKELKGFMDLGFVFSEEDKDSKLVSLIPGLQRLGRENDDA  170

Query  616  ------SRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFW  777
                     ++  N  S  +PYLSEAW + DQR+    L+ WR P   +E +MKDNLKFW
Sbjct  171  EEGEDEEHKKIDENVLSDNKPYLSEAWDVFDQRERKNPLVNWRVPDKGSEIDMKDNLKFW  230

Query  778  AQTVASAVR  804
            A  VAS  R
Sbjct  231  AHAVASIAR  239



>ref|XP_008381194.1| PREDICTED: uncharacterized protein LOC103444064 [Malus domestica]
Length=259

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 139/251 (55%), Gaps = 32/251 (13%)
 Frame = +1

Query  142  ILKLFDSCWFQGEILTRKQC--PSVHETKPVLD-DEYKKESKTMMGVLSLKVRSQSDNLL  312
            +L LFDS WF  EIL++K    P      P L  DE  +E    + +L+L  RS SD  L
Sbjct  11   LLNLFDSYWFGHEILSQKSPSQPQQATNNPTLQVDESAQEETLELPILNL--RSLSDQFL  68

Query  313  ---SFGTSFSPPSDSLKSG--IIK-------PELEDLQaaataaaaataLLITKKVCEIK  456
               SF  S +P   ++ SG  +         P      +  +++++ ++   +       
Sbjct  69   NTPSFSPSGTPKLQTIFSGEQVTNFSKNDELPAHPTKSSRVSSSSSGSSSSSSSSSRRSS  128

Query  457  KRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSS-LASIIPGLQRWGSRDE--  627
            +R+  ++ LG  +SLSELE EELKGFMDLGFVFTEEDK SS L SIIPGLQR  S +E  
Sbjct  129  ERKRRKRVLGPSKSLSELEFEELKGFMDLGFVFTEEDKDSSRLVSIIPGLQRLASCEEED  188

Query  628  --------VMTNESSV--QRPYLSEAWSIMDQRKMMKK-LLKWRFPPLSN-ETNMKDNLK  771
                        +  V  +RPYLSEAW ++DQRK   + L+KWR P  +N   +MK +L+
Sbjct  189  IRDYQKEEEEEEDHGVVSRRPYLSEAWDVLDQRKKENQMLMKWRIPAATNLGKDMKHHLR  248

Query  772  FWAQTVASAVR  804
            FWA +VAS+VR
Sbjct  249  FWAHSVASSVR  259



>ref|XP_008460386.1| PREDICTED: uncharacterized protein LOC103499218 [Cucumis melo]
Length=207

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 124/232 (53%), Gaps = 31/232 (13%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSDN  306
            +AAEEIL LFD  WFQ  I   K     H + P +   + + S++   V      S S N
Sbjct  1    MAAEEILPLFDLFWFQRAIFASKPLLKTHSSAPEI---HFQSSESEYAV------SSSKN  51

Query  307  LLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVARKKLG  486
              +  T+    ++     I+  ++ D                       +K ++  K  G
Sbjct  52   FPASKTAVHSANNQKLETIVSGKVRDFSVEGNN----------------EKMKIRGKVKG  95

Query  487  GHRSLSELEIEELKGFMDLGFVFTEEDKS-SSLASIIPGLQRWGSRDEV---MTNESSVQ  654
              +SLSELE EELKGFMDLGFVF+EEDK+ ++LASIIPGLQR G + E       +  ++
Sbjct  96   LSKSLSELEFEELKGFMDLGFVFSEEDKNDTNLASIIPGLQRIGQKKEEKQKQIEDGILK  155

Query  655  RPYLSEAWSIMDQRKMMKK-LLKWRFPPL-SNETNMKDNLKFWAQTVASAVR  804
            RPYLSEAW  +++    K+ L+KWR P L + E ++K +LK WA TVAS VR
Sbjct  156  RPYLSEAWEDVEKENDKKRILMKWRIPSLGATEMDIKHHLKSWAHTVASTVR  207



>ref|XP_010317344.1| PREDICTED: uncharacterized protein LOC104646047 [Solanum lycopersicum]
Length=225

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 93/243 (38%), Positives = 126/243 (52%), Gaps = 46/243 (19%)
 Frame = +1

Query  136  EEILKLFDSCWFQGEIL------TRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQ  297
            E +L LFDSCWF  +IL      TRK      + KP        E+      L +++ SQ
Sbjct  4    EAVLTLFDSCWFNLQILENHLNPTRKNPDGKIQEKPA-------ETVFDSTKLEIQMESQ  56

Query  298  SDNLLSFGTSFSP----PSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRR  465
            SD+L     S SP    P+   +S   K                    + KK    ++  
Sbjct  57   SDDLSYNSDSLSPDSVLPATHFQSDTKKA-------------------VPKKAKGRRREL  97

Query  466  VARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQ-----RWGSRDEV  630
              R K G  +S+SELE EELKGFMDLGF F+EED +SSL  +IPGLQ     R    D+ 
Sbjct  98   RRRIKRGLSKSISELEYEELKGFMDLGFEFSEEDVNSSLIELIPGLQKLRKNRDSDDDQQ  157

Query  631  MTN--ESSVQ---RPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVAS  795
              N  E S Q   RPYLSEAW ++++++  K L+ W+ P  SNE ++K +LK+WA TVAS
Sbjct  158  KVNFFEKSDQLRARPYLSEAWGVIEKKRKKKPLMNWKLPETSNEIDIKHSLKWWAHTVAS  217

Query  796  AVR  804
            +V+
Sbjct  218  SVK  220



>ref|XP_004136833.1| PREDICTED: uncharacterized protein LOC101209175 [Cucumis sativus]
 gb|KGN43634.1| hypothetical protein Csa_7G049160 [Cucumis sativus]
Length=218

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 92/250 (37%), Positives = 120/250 (48%), Gaps = 56/250 (22%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSDN  306
            +AAEEIL LFD  WFQ  I +RKQ        PV                 LK+RSQS+ 
Sbjct  1    MAAEEILPLFDLFWFQRAIFSRKQHLKTCFQSPVKQ--------------VLKMRSQSEY  46

Query  307  LLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVARKKLG  486
            LL+    F PP  +L S                       +++ KV E       +    
Sbjct  47   LLN-SKDFPPPETALNSN-----------------QKLETILSGKVTEFGGNEEGQATKK  88

Query  487  GHRSLS--------------------ELEIEELKGFMDLGFVFTEEDKS-SSLASIIPGL  603
              + L                     +LE EELKGFMDLGFVF+EEDK+ S+L SIIPGL
Sbjct  89   KKKKLEGNEDKIRRKKKGKGLSKSLSDLEFEELKGFMDLGFVFSEEDKNDSNLGSIIPGL  148

Query  604  QRWGSR--DEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPL-SNETNMKDNLKF  774
             R G +  +E  +    ++RPYLSEAW  +++      L+KWR P L + E ++K +LKF
Sbjct  149  HRLGPKKTEEKRSENGVLRRPYLSEAWKAIEEENEKMILMKWRVPSLGATEMDIKHHLKF  208

Query  775  WAQTVASAVR  804
            WA TVAS VR
Sbjct  209  WAHTVASTVR  218



>gb|EYU30763.1| hypothetical protein MIMGU_mgv1a025120mg [Erythranthe guttata]
Length=177

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 99/162 (61%), Gaps = 12/162 (7%)
 Frame = +1

Query  346  SLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVARKKLGGHRSLSELEIEEL  525
            S +S IIKP+L+++ +       +  +   +   EIKKR+  RK +   RSLS LE EE+
Sbjct  19   SPRSVIIKPKLQNISSGKQIVDFSKQVSAQENAKEIKKRKKWRKGIV-KRSLSALEFEEV  77

Query  526  KGFMDLGFVFTEEDKSSSLASIIPGLQRWGS------RDEVMTNESSVQRPYLSEAW---  678
            KGFMDLGFVF E+DK+SSL S+IPGLQ+ G        +E   N   + RPYLSE+W   
Sbjct  78   KGFMDLGFVFDEDDKNSSLVSVIPGLQKMGKMAGDDYYEEKSNNSQLLSRPYLSESWGSS  137

Query  679  SIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            S   +R  +  ++ W  P + NE NMKD+L+ WAQ VAS VR
Sbjct  138  SFFSERNNL--MMNWTVPSVKNEINMKDHLRIWAQNVASNVR  177



>ref|XP_009591632.1| PREDICTED: uncharacterized protein LOC104088627 [Nicotiana tomentosiformis]
Length=232

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 93/241 (39%), Positives = 131/241 (54%), Gaps = 35/241 (15%)
 Frame = +1

Query  136  EEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVL-------SLKVRS  294
            E +L LFDSCWF  + L  K   S+  + P  ++ Y K  +    +         +++ S
Sbjct  4    EAVLSLFDSCWFNLQTLN-KHSNSITSSNPQ-ENSYNKIQENSPEIAKDSSLLEEIQLGS  61

Query  295  QSDNLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVAR  474
            QSD L     +FSP S  L     +P+ +  +               KK+   +K R  R
Sbjct  62   QSDGLSYNSDTFSPDS-VLPITHFQPDPKKAE--------------PKKIKGRRKERKRR  106

Query  475  KKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG------SRDEVMT  636
             K G  +SLSELE EELKGFMDLGF F+E+D +SSL  IIPGLQ+         +++V  
Sbjct  107  TKKGLSKSLSELEYEELKGFMDLGFDFSEDDVNSSLVEIIPGLQKLSKNRSNDDQEKVNF  166

Query  637  NESSVQ-----RPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAV  801
             E S Q     RPYLSEAW ++++RK M  L+ W+ P  SNE ++K +LK+WA TVAS+V
Sbjct  167  VEKSHQYSRAIRPYLSEAWEVLEKRKRMNSLMNWKVPATSNEIDIKHSLKWWAHTVASSV  226

Query  802  R  804
            +
Sbjct  227  K  227



>ref|XP_011098377.1| PREDICTED: uncharacterized protein LOC105177052 [Sesamum indicum]
Length=208

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 109/192 (57%), Gaps = 15/192 (8%)
 Frame = +1

Query  271  VLSLKVRSQSDNLL-----SFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLIT  435
            V +L+VRS S   L     S+    +  S S +S IIKP+L+ + +       +      
Sbjct  18   VANLQVRSFSARCLGVDTRSYFKDAAGNSTSSRSVIIKPKLQKILSGKEEVDFSREAAEQ  77

Query  436  KKVCEIKKRRVAR----KKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGL  603
             +V +   ++  R    ++ G  RS S LE EE+KGF+DLGFVFTEEDKSS L SIIPGL
Sbjct  78   DRVEKSNGKKQCRTGNQERKGMRRSSSALEFEEVKGFIDLGFVFTEEDKSSGLVSIIPGL  137

Query  604  QRWG----SRDEVMTNESSVQRPYLSEAWSIMDQR-KMMKKLLKWRFPPLSNETNMKDNL  768
            Q+ G     R++V  N+  V RPYLSE W + +QR      L+ WR P   NE  MK +L
Sbjct  138  QKCGKMAEDREKVEEND-RVSRPYLSEGWGVPNQRMGSNNHLMNWRIPSSENEIRMKKHL  196

Query  769  KFWAQTVASAVR  804
            K WAQTVAS VR
Sbjct  197  KVWAQTVASFVR  208



>gb|KCW47364.1| hypothetical protein EUGRSUZ_K01150, partial [Eucalyptus grandis]
Length=182

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 81/120 (68%), Gaps = 12/120 (10%)
 Frame = +1

Query  481  LGGHRSLSELEIEELKGFMDLGFVFTEEDK-SSSLASIIPGLQRWGSRDEV---------  630
            LG  +SLSELE EELKGFMDLGFVF+E+D+  S L SI+PGLQR G +D+          
Sbjct  63   LGSSKSLSELEFEELKGFMDLGFVFSEQDRDDSDLVSILPGLQRLGLKDDGDRIEVEETK  122

Query  631  MTNESSVQRPYLSEAWSIMD-QRKMMK-KLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
              +E+ V RPYLSEAW  +D QRK  +  L+ WR P L NE  MKD+LKFWA  VAS VR
Sbjct  123  KADETKVPRPYLSEAWHGLDRQRKRYEDPLVNWRVPALGNEMAMKDHLKFWAHAVASTVR  182



>ref|XP_010686232.1| PREDICTED: uncharacterized protein LOC104900508 [Beta vulgaris 
subsp. vulgaris]
Length=242

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 90/253 (36%), Positives = 126/253 (50%), Gaps = 38/253 (15%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQC------------PSVHETKPVLDDEYKKESKTMMG  270
            + AE +L LFDS WF  EI  +K              P +  T P +  +++K +     
Sbjct  1    MEAESVLNLFDSYWFNLEIFKKKPIKNQNFPEIPTSNPEIPTTLPTIQTKFQKITPNFSP  60

Query  271  VLSLKVRSQSDNLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCE  450
                +  S S N +    + +P   ++ SG I  E ED       ++ +  L    K   
Sbjct  61   KKQSESSSSSPNSVLL--NLTPKLQTIFSGKISAEFED-------SSRSEKLNSPLKGNT  111

Query  451  IKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEV  630
            +  RR  RK  G  +SLS+LE EELKGF+DLGF+F+EEDK S+L SIIPGLQR    +  
Sbjct  112  VINRR--RKNKGFSKSLSDLEFEELKGFIDLGFIFSEEDKDSNLVSIIPGLQRLSISNHN  169

Query  631  MTNESS------------VQRPYLSEAWSIMDQRKMMKKLLKW---RFPPLSNETNMKDN  765
            +   +               RPYLSEAW  +++++    LL W   R PP  N+  MKD 
Sbjct  170  ININNDINGSIIDKSGGLFSRPYLSEAWDDLEKKRRENVLLNWRVPRLPPHDNQIEMKDY  229

Query  766  LKFWAQTVASAVR  804
            L+FWA TVAS V+
Sbjct  230  LRFWAHTVASTVK  242



>ref|XP_010040033.1| PREDICTED: uncharacterized protein LOC104428796 [Eucalyptus grandis]
 gb|KCW45542.1| hypothetical protein EUGRSUZ_L00731 [Eucalyptus grandis]
Length=250

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 95/253 (38%), Positives = 133/253 (53%), Gaps = 32/253 (13%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEILTRKQCP-----SVHETKPVLD--DEYKKESKTMM--GVL  276
            M  AE ++K+ D CWF+ EI   K+ P     S   + P  +  +  +KES  +      
Sbjct  1    MEEAEAVMKIIDRCWFELEIF--KKGPDTSPSSTSRSNPGQESIEIPEKESSCLQISRTP  58

Query  277  SLKVRSQSDNLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIK  456
            S+ VRS SD      TS    + SL    + P ++ + +        T      K   ++
Sbjct  59   SILVRSVSDQTSIIPTSLQ--ASSLSPDSVLP-MKPIHSMIYEEEVITEEEEGFKWNNLR  115

Query  457  KRRVARKK---LGGH-------RSLSELEIEELKGFMDLGFVFTEEDK-SSSLASIIPGL  603
                + +K   +GG        +SLSELE+EELKGF+DLGFVF EED+  SSL SIIPGL
Sbjct  116  SSEFSHRKKGQMGGRAKRRTLTKSLSELEVEELKGFVDLGFVFLEEDRVDSSLVSIIPGL  175

Query  604  QRWGSR-------DEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKD  762
            QR G++       DE       V RPYLSEAW   ++++    L+ W+ P L NET+MK+
Sbjct  176  QRLGNKIKDGEEDDEDAGESVVVARPYLSEAWEWWEEKRKEDPLMNWKVPALGNETDMKE  235

Query  763  NLKFWAQTVASAV  801
            +LK+WA TVAS V
Sbjct  236  SLKWWAHTVASTV  248



>ref|XP_010040036.1| PREDICTED: uncharacterized protein LOC104428799 [Eucalyptus grandis]
 gb|KCW45544.1| hypothetical protein EUGRSUZ_L00733 [Eucalyptus grandis]
Length=244

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 90/248 (36%), Positives = 128/248 (52%), Gaps = 28/248 (11%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEILTRK---QCPSVHETKPVLD--DEYKKESKTMM--GVLSL  282
            M  AE ++K+ D CWF+ EI  ++      S+  + P  +  +  +KES  +       +
Sbjct  1    MEEAEAVMKIIDRCWFELEIFKKRPDTSPSSISRSNPGQERIEIPEKESSCLQISRTTLI  60

Query  283  KVRSQSDNLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKR  462
             VRS SD      T     S S  S +    +  +            L    +  E   R
Sbjct  61   LVRSVSDQTSIIPTRLQASSLSPDSVLPMKPIHSMIYEEEEGFKWNNL----RSSEFSHR  116

Query  463  RVARKKLGGH-------RSLSELEIEELKGFMDLGFVFTEEDK-SSSLASIIPGLQRWGS  618
            +  + ++GG        +SLSELE+EELKGF+DLGFVF EED+  SSL SIIPGLQR G+
Sbjct  117  K--KGQMGGRAKRRTLTKSLSELEVEELKGFVDLGFVFLEEDRVDSSLVSIIPGLQRLGN  174

Query  619  R-------DEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFW  777
            +       DE       V RPYLSEAW   ++++    L+ W+ P L N+T+MK++LK+W
Sbjct  175  KIKDGEEDDEDAGESVVVARPYLSEAWEWWEEKRKEDPLMNWKVPALGNKTDMKESLKWW  234

Query  778  AQTVASAV  801
            A TVAS V
Sbjct  235  AHTVASTV  242



>ref|XP_010059035.1| PREDICTED: uncharacterized protein LOC104446943 [Eucalyptus grandis]
Length=263

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 97/268 (36%), Positives = 132/268 (49%), Gaps = 49/268 (18%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGV---------L  276
            M  AE ++K+ D CWF+ EI  ++  P    T     D  +K  +    V          
Sbjct  1    MEEAEAVMKIIDRCWFELEIFKKR--PDASPTSAFGSDPDQKSIEIPEKVSPCLHISRTP  58

Query  277  SLKVRSQSDNLLSFGTSF-----SPPS----DSLKSGIIKPELEDLQaaataaaaataLL  429
            S+ VRS SD      +SF     SP S      + SGI + E+   +             
Sbjct  59   SILVRSMSDQTSIIPSSFQSSPLSPDSVLHMTPIHSGIYEEEVITEEEKEGFDWNNPR--  116

Query  430  ITKKVCEIKK----RRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDK-SSSLASII  594
             + K    KK     R  R+ L   +SLSELE EELKGFMDLGFVF+EED+  SSL SII
Sbjct  117  -SSKFSRRKKGQMGERAKRRALS--KSLSELEFEELKGFMDLGFVFSEEDRVDSSLVSII  173

Query  595  PGLQRWGSR-------------------DEVMTNESSVQRPYLSEAWSIMDQRKMMKKLL  717
            PGLQR G +                   ++ +  E +V RPYLSEAW   ++++    L+
Sbjct  174  PGLQRLGKKIKDGDEDDEDGDHHREDGDEKEIVGEPAVARPYLSEAWEWWEEKRKEDPLM  233

Query  718  KWRFPPLSNETNMKDNLKFWAQTVASAV  801
             W+ P L NET+M+++LK+WA TVAS V
Sbjct  234  NWKVPALGNETDMRESLKWWAHTVASTV  261



>emb|CBI30714.3| unnamed protein product [Vitis vinifera]
Length=177

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 109/207 (53%), Gaps = 51/207 (25%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKE-SKTMMGVLSLKVRSQSDNL  309
            AEE+LKLFDSCWF  EI   K+ PS   +K   D + ++E SK ++       RSQ+ ++
Sbjct  3    AEEVLKLFDSCWFNLEIF--KEQPSSSSSKSNTDQQIQEEPSKPVLS------RSQTRHI  54

Query  310  LSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVARKKLGG  489
             S     SP   +L  G                                     R+K G 
Sbjct  55   RSIT---SPKRATLARG------------------------------------RRRKKGM  75

Query  490  HRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRD---EVMTNESSVQRP  660
             +SLS+LE +ELKGF+DLGFVF+E  K SSL SIIPGL R G +D   E   +ES+V RP
Sbjct  76   SKSLSDLEFDELKGFIDLGFVFSEGAKDSSLVSIIPGLHRLGKKDGEEEKTVDESAVPRP  135

Query  661  YLSEAWSIMDQRKMMKKLLKWRFPPLS  741
            YLSEAW ++D+RK    L+ WR P LS
Sbjct  136  YLSEAWEVLDRRKKENPLMNWRVPALS  162



>ref|XP_004303200.1| PREDICTED: uncharacterized protein LOC101313135 [Fragaria vesca 
subsp. vesca]
Length=264

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 91/265 (34%), Positives = 129/265 (49%), Gaps = 40/265 (15%)
 Frame = +1

Query  127  VAAEEI--LKLFDSCWFQGEILTRKQCPSVHET---KPVLDDEYKKESKTMMGVLSLKVR  291
            +AA E+  L LFDS WF+  + + K   +       +P  +D+ + +     G+ +L VR
Sbjct  1    MAANEVPLLNLFDSFWFEHAVFSSKPHAAADNNPSLQPDQEDQIRIKEPNPAGLPTLVVR  60

Query  292  SQSDNLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataL-----LITKKVCEI-  453
            S SD  L   +SF   S      ++      LQ   +             +  K+  E+ 
Sbjct  61   SLSDQYLDTKSSFFSDSSLSPHSVLPTRSRKLQTIPSGKEVLIDFSRESTVPVKQALEVG  120

Query  454  ----------KKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEED-KSSSLASIIPG  600
                       +R   RK+ G  +SLS+LE +ELKGFMDLGFVFTEED K S+L +IIPG
Sbjct  121  SAPLKKKVLHNERSKTRKRSGSSKSLSDLEFDELKGFMDLGFVFTEEDNKDSNLVAIIPG  180

Query  601  LQRWGSRDEVMTNESS-----------------VQRPYLSEAWSIMDQRKMMKKLLKWRF  729
            LQR    DE    +                   V RPYLSEAW  ++ ++   +L+ WR 
Sbjct  181  LQRLRVSDEGEEQDRDHEEKRIDASHHHHHSQVVSRPYLSEAWDALEYQRKENQLMNWRV  240

Query  730  PPLSNETNMKDNLKFWAQTVASAVR  804
            P  + + +MK +LKFWA TVAS VR
Sbjct  241  PS-ALDKDMKHHLKFWAHTVASTVR  264



>ref|XP_010038705.1| PREDICTED: uncharacterized protein LOC104427291 [Eucalyptus grandis]
Length=145

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 77/114 (68%), Gaps = 12/114 (11%)
 Frame = +1

Query  499  LSELEIEELKGFMDLGFVFTEEDK-SSSLASIIPGLQRWGSRDEV---------MTNESS  648
            LSELE EELKGFMDLGFVF+E+D+  S L SI+PGLQR G +D+            +E+ 
Sbjct  32   LSELEFEELKGFMDLGFVFSEQDRDDSDLVSILPGLQRLGLKDDGDRIEVEETKKADETK  91

Query  649  VQRPYLSEAWSIMD-QRKMMKK-LLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            V RPYLSEAW  +D QRK  +  L+ WR P L NE  MKD+LKFWA  VAS VR
Sbjct  92   VPRPYLSEAWHGLDRQRKRYEDPLVNWRVPALGNEMAMKDHLKFWAHAVASTVR  145



>ref|XP_008439724.1| PREDICTED: uncharacterized protein LOC103484438 [Cucumis melo]
 gb|ADN34031.1| hypothetical protein [Cucumis melo subsp. melo]
Length=212

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 87/134 (65%), Gaps = 18/134 (13%)
 Frame = +1

Query  454  KKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSR----  621
            K  R  R+KL   +SLSELE EE+KGF DLGFVFTEED++S LAS+IPGL R GS     
Sbjct  80   KPERSRRRKLE-RKSLSELEFEEVKGFKDLGFVFTEEDRNSELASVIPGLNRLGSEEEEK  138

Query  622  --------DEVMTNESSVQRPYLSEAWSI--MDQRK--MMKKLLK-WRFPPLSNETNMKD  762
                    D+    ES V RPYLSE W +  MD+R+  ++  LLK W+ P  ++E +MK 
Sbjct  139  EKEEKRTLDDDDDEESRVSRPYLSEVWEVLAMDRRREEIINPLLKNWKLPSFNSEIDMKQ  198

Query  763  NLKFWAQTVASAVR  804
            NL++WA TVAS VR
Sbjct  199  NLRWWAHTVASTVR  212



>ref|XP_003629798.1| hypothetical protein MTR_8g086670 [Medicago truncatula]
Length=97

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 70/97 (72%), Gaps = 7/97 (7%)
 Frame = +1

Query  535  MDLGFVFTEEDKSSSLASIIPGLQRWGSRDEV-------MTNESSVQRPYLSEAWSIMDQ  693
            MDLGFVF+EEDK SSL  IIPGLQR G ++E        + +ES VQRPYLSEAW + D 
Sbjct  1    MDLGFVFSEEDKDSSLVEIIPGLQRLGKKNEEEEEEEEDVYDESVVQRPYLSEAWEVYDW  60

Query  694  RKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            RK  K L+ W+ P ++NE +MK++L+ WAQTVAS VR
Sbjct  61   RKKEKPLVNWKVPAMNNEIDMKNSLRLWAQTVASTVR  97



>ref|XP_010317343.1| PREDICTED: uncharacterized protein LOC104646046 [Solanum lycopersicum]
Length=219

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 89/235 (38%), Positives = 134/235 (57%), Gaps = 32/235 (14%)
 Frame = +1

Query  136  EEILKLFDSCWFQGEILTR--KQCP-SVHETKPVLDDEYKKE-SKTMMGVLSLKVRSQSD  303
            E +L  FDSCWF  EIL       P S ++  P  DD+ ++  ++++    +L+++++S 
Sbjct  4    EAVLTHFDSCWFNLEILNNHSNSTPFSNYQKNP--DDKIQENLTESVYDSPNLEIKTESQ  61

Query  304  NLLSFGTSFSPPSDS-LKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVARKK  480
            +      S S   D+ L     +P  ++ +              +KKV   K RR  R+K
Sbjct  62   SDDLSYDSDSVSPDTVLPVTHFQPFCKNAE--------------SKKV---KGRRRRREK  104

Query  481  LGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG-SRDE------VMTN  639
              G +SLSELE EELKGFMDLG+ F+E+D +SSL  I+PGLQ+   +RD       V  +
Sbjct  105  CLG-KSLSELEYEELKGFMDLGYEFSEDDVNSSLVEILPGLQKLSKNRDNDQKLNFVEKS  163

Query  640  ESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            +    RPYLSEAW +++++K M  L+ W+ P +SNE ++K NLK WA TVAS V+
Sbjct  164  DELRARPYLSEAWEVVEKKKRMNPLMNWKVPVMSNEIDLKHNLKLWAHTVASTVK  218



>ref|XP_006294801.1| hypothetical protein CARUB_v10023852mg [Capsella rubella]
 gb|EOA27699.1| hypothetical protein CARUB_v10023852mg [Capsella rubella]
Length=267

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 88/143 (62%), Gaps = 20/143 (14%)
 Frame = +1

Query  427  LITKKVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEED-KSSSLASIIPGL  603
            L  K   ++ KR V R+K    +S+S+LE EELKGFMDLGFVF+EED K S L SI+PGL
Sbjct  128  LQRKNSNKMMKRNVRRRK---GKSMSDLEYEELKGFMDLGFVFSEEDHKDSDLVSILPGL  184

Query  604  QR------------WGSRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKL---LKWRFP-P  735
            QR                +E M+N + V RPYLSEAW     RK  K+L   +KWR P P
Sbjct  185  QRSLLKKDDGVAQAVTEEEEDMSNGNRVARPYLSEAWDHCGGRKGKKQLKPEIKWRVPAP  244

Query  736  LSNETNMKDNLKFWAQTVASAVR  804
             +NE ++KDNL+ WA  VAS +R
Sbjct  245  AANEVDLKDNLRLWAHAVASTIR  267



>gb|KGN49319.1| hypothetical protein Csa_6G519700 [Cucumis sativus]
Length=211

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 88/133 (66%), Gaps = 17/133 (13%)
 Frame = +1

Query  454  KKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVM  633
            K +R  R+KL   +SLSELE EE+KGF DLGFVF+EED++S LAS+IPGL R GS +E  
Sbjct  80   KTKRSRRRKLE-RKSLSELEFEEVKGFKDLGFVFSEEDRNSELASVIPGLNRLGSEEEEK  138

Query  634  T-----------NESSVQRPYLSEAWSI--MDQRK--MMKKLLK-WRFPPLSNETNMKDN  765
                         ES V RPYLSE W +  MD+R+  ++  LLK W+ P  ++E +MK N
Sbjct  139  EREEKRSLDDDDEESRVSRPYLSEVWEVLAMDRRREEIISPLLKNWKLPSFNSEIDMKQN  198

Query  766  LKFWAQTVASAVR  804
            L++WA TVAS VR
Sbjct  199  LRWWAHTVASTVR  211



>ref|XP_010524072.1| PREDICTED: uncharacterized protein LOC104802264 [Tarenaya hassleriana]
Length=271

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 99/277 (36%), Positives = 142/277 (51%), Gaps = 57/277 (21%)
 Frame = +1

Query  127  VAAEEILKLFDSCWF-------QGEILTR--KQCPSVH---------ETKPVLDDEYKKE  252
            +AAEEI++LFD  WF        G  L R  ++   +H         E+K  LD+ +   
Sbjct  1    MAAEEIMELFDQNWFFSKHKEPTGLPLERSNQESEGIHGSKDPEKPQESKIPLDEAFFTP  60

Query  253  SKTMMGVLSLKVRSQSD-NLLS-----FGTS---FSPPS--------DSLKSGIIKPELE  381
               ++G      RS SD NL+S     FG+S   FSP S          L++ +   E+ 
Sbjct  61   GNVLVG------RSMSDQNLMSSKTSLFGSSDDLFSPTSVLNVKHQAGKLQTILSGKEVT  114

Query  382  DLQaaataaaaataLLITKKVCEIKKRRVARKKLGGHR---SLSELEIEELKGFMDLGFV  552
            +      +     A   T++  + ++++  + + G  R   SLS+LE +ELKGFMDLGFV
Sbjct  115  EFLPDDGSPKPEKASDGTEETKDTEQKKKKKHEAGRARRRKSLSDLEYQELKGFMDLGFV  174

Query  553  FTEED-KSSSLASIIPGLQRWGSR----DEVMTNE-----SSVQRPYLSEAWSIMDQRKM  702
            F+EED K S L SI+PGLQR G      DE   N+     +   RPYLSEAW    +R  
Sbjct  175  FSEEDHKDSDLVSILPGLQRIGRNNGEDDETDENKEKRSGNRGGRPYLSEAWKFRGERTE  234

Query  703  MK---KLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
             K     ++W+FP  +NE +MKD+L+ WA  VAS+VR
Sbjct  235  KKPPPPAMRWKFPAPANEVDMKDHLRLWAHNVASSVR  271



>ref|XP_010040035.1| PREDICTED: uncharacterized protein LOC104428798 [Eucalyptus grandis]
Length=259

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 129/251 (51%), Gaps = 29/251 (12%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSVHET-KPVLDDEY----KKESKTMM--GVLSLK  285
            +  E ++K+ D CWF+ +I  ++   S   T +  L  E     +KES  +      S+ 
Sbjct  10   LTVEAVMKIIDRCWFELKIFKKRPDTSPSSTSRSNLGQESIEIPEKESSCLQISWTPSIL  69

Query  286  VRSQSDNLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRR  465
            +RS SD      TS    + SL    + P ++ +          T      K   ++   
Sbjct  70   IRSVSDQTSIIPTSLQ--ASSLSPDSVLP-MKPIHIMIYEEGVITEEEEGFKWNNLRSSE  126

Query  466  VARKK----LGGH-------RSLSELEIEELKGFMDLGFVFTEEDK-SSSLASIIPGLQR  609
             + +K    +GG        +SLSE+E EELKGF+DLGFVF EED+  SSL SIIPGLQR
Sbjct  127  FSHRKKKGQMGGRAKRRTLIKSLSEIEFEELKGFVDLGFVFLEEDRVDSSLVSIIPGLQR  186

Query  610  WGSR------DEVMTNESSV-QRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNL  768
             G++      D+    ES V  RPYLSE W   ++++    L+ W+ P   NET+MK++L
Sbjct  187  LGNKIKDGEEDDGDAGESVVVARPYLSEVWEWWEEKRKEDPLMNWKVPAFGNETDMKESL  246

Query  769  KFWAQTVASAV  801
            K+WA TVAS V
Sbjct  247  KWWAHTVASTV  257



>gb|KCW45543.1| hypothetical protein EUGRSUZ_L00732 [Eucalyptus grandis]
Length=244

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 83/129 (64%), Gaps = 15/129 (12%)
 Frame = +1

Query  460  RRVARKKLGGH-------RSLSELEIEELKGFMDLGFVFTEEDK-SSSLASIIPGLQRWG  615
             R  + ++GG        +SLSE+E EELKGF+DLGFVF EED+  SSL SIIPGLQR G
Sbjct  114  HRKKKGQMGGRAKRRTLIKSLSEIEFEELKGFVDLGFVFLEEDRVDSSLVSIIPGLQRLG  173

Query  616  SR------DEVMTNESSV-QRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKF  774
            ++      D+    ES V  RPYLSE W   ++++    L+ W+ P   NET+MK++LK+
Sbjct  174  NKIKDGEEDDGDAGESVVVARPYLSEVWEWWEEKRKEDPLMNWKVPAFGNETDMKESLKW  233

Query  775  WAQTVASAV  801
            WA TVAS V
Sbjct  234  WAHTVASTV  242



>gb|ACU17606.1| unknown [Glycine max]
Length=220

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 116/210 (55%), Gaps = 19/210 (9%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSV--HETKPVLDDEYKKESKTMMGVLS--LKVRS  294
            +AAE +L+L DS WF+  IL+ K   +   H+   V+++    +   ++ V +  L+VRS
Sbjct  1    MAAEHVLRLLDSFWFEASILSNKTLSNSISHDHNKVVEEVLPLDDAKLLLVPTPTLEVRS  60

Query  295  QSDNLLSFGTSF-----SPPSDSLKSGIIK--PELEDLQaaataaaaataLLITKKVCEI  453
             SD  L   T         P+  L    ++  P   +++  ++       + I +K    
Sbjct  61   YSDQNLDSTTCLLCDYSQSPNSVLTPQRLRTIPSEREIREFSSGNHRKEGMSIKRKQKSF  120

Query  454  KKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSR--DE  627
               R ARK +   RSLSELE +ELKGFMDLGFVF+EEDK S LAS+IPGLQR G    +E
Sbjct  121  GHGRRARK-VRTSRSLSELEFKELKGFMDLGFVFSEEDKDSKLASLIPGLQRLGREEDEE  179

Query  628  VMTNESSV-----QRPYLSEAWSIMDQRKM  702
               ++ SV      +PYLSEAW ++DQR+M
Sbjct  180  GQGDDQSVVSDNNNKPYLSEAWDVLDQREM  209



>ref|XP_006411544.1| hypothetical protein EUTSA_v10017132mg [Eutrema salsugineum]
 gb|ESQ52997.1| hypothetical protein EUTSA_v10017132mg [Eutrema salsugineum]
Length=254

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 83/130 (64%), Gaps = 15/130 (12%)
 Frame = +1

Query  454  KKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEED-KSSSLASIIPGLQRWGSRD--  624
            KK+   R + G  +S+S+LE EELKGFMDLGFVF+EED K S L SI+PGLQR   +D  
Sbjct  127  KKQSNVRTRRG--KSMSDLEYEELKGFMDLGFVFSEEDHKDSDLVSILPGLQRLVKKDDG  184

Query  625  ------EVMTNESSVQRPYLSEAWSIMDQRKMMKKL---LKWRFP-PLSNETNMKDNLKF  774
                  E ++N + V RPYLSEAW +   RK  +++   +KWR P P   E  +KD+LK 
Sbjct  185  GLRVTEENISNGNRVARPYLSEAWDLCGGRKGKRQMTPEIKWRVPAPAVKEVELKDHLKL  244

Query  775  WAQTVASAVR  804
            WA  VAS +R
Sbjct  245  WAHAVASTIR  254



>ref|XP_007148013.1| hypothetical protein PHAVU_006G173300g [Phaseolus vulgaris]
 gb|ESW20007.1| hypothetical protein PHAVU_006G173300g [Phaseolus vulgaris]
Length=220

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 113/195 (58%), Gaps = 16/195 (8%)
 Frame = +1

Query  133  AEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYK-KESKT---MMGVLSLKVRSQS  300
            AEE+  LFDSCWF G   +++   S   T    + +++ KE  +   ++ + S   RS S
Sbjct  3    AEEVFNLFDSCWF-GHQTSKEHTSSSTPTNSHENSDHQIKEEPSEPMLLRLQSTHSRSMS  61

Query  301  DNLLSFGTSFSPPSDSLK-SGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVARK  477
            D L S  T F    DSL    +  P+L+ + +      +   +       E+  ++  RK
Sbjct  62   DQLSSM-TCFK--DDSLSPDSVFSPKLQTILSGKDVTDSEAQVQH-----EVLPKKRERK  113

Query  478  KLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVM--TNESSV  651
            K    +SLS+LE EELKGFMDLGFVF+EEDK SSLASIIPGLQR G  DE    ++ S+V
Sbjct  114  KKRQSKSLSDLESEELKGFMDLGFVFSEEDKDSSLASIIPGLQRLGKSDEEEEDSDGSAV  173

Query  652  QRPYLSEAWSIMDQR  696
            QRPYLSEAW + ++R
Sbjct  174  QRPYLSEAWKVQEKR  188



>ref|XP_010102120.1| hypothetical protein L484_021354 [Morus notabilis]
 ref|XP_010113102.1| hypothetical protein L484_000078 [Morus notabilis]
 gb|EXB92370.1| hypothetical protein L484_021354 [Morus notabilis]
 gb|EXC64798.1| hypothetical protein L484_000078 [Morus notabilis]
Length=280

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 88/149 (59%), Gaps = 30/149 (20%)
 Frame = +1

Query  436  KKVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEED-KSSSLASIIPGLQRW  612
            KKV E++ RR         +SL +LE EELKGFMDLGFVFTEE+ K S L S+IPGLQR+
Sbjct  136  KKVNELRSRRTR----TSSKSLPDLEFEELKGFMDLGFVFTEEECKDSRLVSMIPGLQRF  191

Query  613  ------GSRD--------------EVMTNESSV-QRPYLSEAWSIMD----QRKMMKKLL  717
                  GS                E+  N   V  RPYLSEAW ++D    ++K MK+++
Sbjct  192  CKKCTDGSDHDDDQEDHDKEKNNYEIKRNSDQVISRPYLSEAWDVLDLEYQRKKEMKQVV  251

Query  718  KWRFPPLSNETNMKDNLKFWAQTVASAVR  804
              + P L ++ +MKD L+FWA TVAS VR
Sbjct  252  NLKIPTLVSDIDMKDQLRFWAHTVASTVR  280



>ref|XP_002881871.1| hypothetical protein ARALYDRAFT_483373 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58130.1| hypothetical protein ARALYDRAFT_483373 [Arabidopsis lyrata subsp. 
lyrata]
Length=260

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 13/117 (11%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEED-KSSSLASIIPGLQRWGSRD----------EVMTN  639
            +S+S+LE EELKGFMDLGFVF+EED K S+L SI+PGLQR   +D          E  ++
Sbjct  143  KSMSDLEYEELKGFMDLGFVFSEEDHKDSNLVSILPGLQRLVKKDDGVVQVTKEEEDKSS  202

Query  640  ESSVQRPYLSEAWSIMDQRK-MMKKLLKWRFP-PLSNETNMKDNLKFWAQTVASAVR  804
             + V RPYLSEAW     RK  +   +KWR P P++NE ++KDNL+ WA  VAS +R
Sbjct  203  GNRVARPYLSEAWDHCGGRKGKITTEIKWRVPAPVANEVDLKDNLRHWAHAVASTIR  259



>ref|XP_008366658.1| PREDICTED: uncharacterized protein LOC103430300 [Malus domestica]
Length=93

 Score =   103 bits (258),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 68/93 (73%), Gaps = 3/93 (3%)
 Frame = +1

Query  535  MDLGFVFTEEDKSSSLASIIPGLQRWGSRDEV---MTNESSVQRPYLSEAWSIMDQRKMM  705
            MDLGFVF+EEDK S+L SII GLQR G +D+     ++E ++ R YLSEAW + ++RK+ 
Sbjct  1    MDLGFVFSEEDKDSNLVSIIHGLQRLGKKDDSKDESSDEFAITRLYLSEAWEVKEKRKIE  60

Query  706  KKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            K L+   FP L NE +MKDNLK+WA  VASA++
Sbjct  61   KPLMNSGFPALENEIDMKDNLKWWAHIVASAIK  93



>gb|KGN65040.1| hypothetical protein Csa_1G181530 [Cucumis sativus]
Length=167

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 85/136 (63%), Gaps = 18/136 (13%)
 Frame = +1

Query  445  CEIKKRRVARKKLGG-HRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSR  621
             E +++   RK  G  +RS  ELE EELKGFMDLGFVF+EEDK S LASI+PGL   G R
Sbjct  34   AESRRKPRGRKTRGAENRSQLELEFEELKGFMDLGFVFSEEDKGSILASIVPGLNWLGKR  93

Query  622  DEVMTNE----SSVQRPYLSEAWSIMDQRKM---------MKK--LLKWRFPPLSNETNM  756
            +E    E      + RPYLSEAW  M++ +          +KK  ++KWRFP  SNE +M
Sbjct  94   EEEEEEEQKLCGEISRPYLSEAWETMEEEEEEEEEEEKVELKKPLMMKWRFP--SNEIHM  151

Query  757  KDNLKFWAQTVASAVR  804
            K NLK+WA  VAS ++
Sbjct  152  KVNLKWWAHAVASTIK  167



>gb|KGN65608.1| hypothetical protein Csa_1G470240 [Cucumis sativus]
Length=251

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 102/254 (40%), Positives = 140/254 (55%), Gaps = 37/254 (15%)
 Frame = +1

Query  136  EEILKLFDSCWFQGEILTRKQCPSVHET-KPVLDDEYKKESKTMMGVLSLKVRSQSDNLL  312
            + +L LFDS WFQ ++L     PS  +  +P + D      ++ + +  L+ RS S++L 
Sbjct  4    DHLLNLFDSFWFQRQVLNNHPFPSNPQILQPQIQDPDPLPKESFL-IPRLRTRSISEDLS  62

Query  313  SFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKR---------R  465
            S   SF   S+S  S ++ P+L+ + ++   A A +    T    EI++R         R
Sbjct  63   S-KLSFMSNSNSPDSVLLSPKLQTIFSSKDIAGAESPE--TSHKVEIERRPKTEYRRRLR  119

Query  466  VARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNE-  642
              R +    RSLSELE EELKGFMDLGFVF+EEDK SSLASI+PGL R G R+E    E 
Sbjct  120  GRRTRRSESRSLSELEFEELKGFMDLGFVFSEEDKGSSLASIVPGLNRLGKREEKGNKEG  179

Query  643  --------------SSVQRPYLSEAWSIMDQRKMMKKLL------KWRFPPLSNETNMKD  762
                            + RPYLSEAW  + + +  ++LL      KWRFP  SN+ +MKD
Sbjct  180  EEEEEEKEEERKLGGEISRPYLSEAWEAIAEEEEKEELLKRPLMMKWRFP--SNQIDMKD  237

Query  763  NLKFWAQTVASAVR  804
            NLK+WA  VAS VR
Sbjct  238  NLKWWAHAVASTVR  251



>gb|KCW74140.1| hypothetical protein EUGRSUZ_E02771 [Eucalyptus grandis]
Length=263

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 92/268 (34%), Positives = 132/268 (49%), Gaps = 49/268 (18%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEILTRK---QCPSVHETKPVLDD-EYKKESKTMMGV---LSL  282
            M  AE ++K+ D+CWF+ EIL ++      S   + P  +  E  ++    + +    S+
Sbjct  1    MEEAEAVMKIIDTCWFELEILKKRPDTSPSSASRSDPGQESIEIPEKGSPRLQISRTPSI  60

Query  283  KVRSQSDNLLSFGTSF--SP--PSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCE  450
             VRS SD      +SF  SP  P+  L++         + +               K  E
Sbjct  61   LVRSMSDQTSIIPSSFQSSPLSPASVLRA-------TPMHSMIYEEEVIREEEEGFKWNE  113

Query  451  IKKRRVARK---KLGGH-------RSLSELEIEELKGFMDLGFVFTEEDK-SSSLASIIP  597
             +    +R+   ++GG        +SLSELE EE+KGFMDLGFVF EED   SSL SIIP
Sbjct  114  PRSSEFSRRNKGQMGGRGKRRALSKSLSELEFEEVKGFMDLGFVFAEEDSVDSSLVSIIP  173

Query  598  GLQRWGSR--------------------DEVMTNESSVQRPYLSEAWSIMDQRKMMKKLL  717
            GLQR G +                     E++   + V RPYLSEAW   +++K    L+
Sbjct  174  GLQRLGKKIKDGDEDDEDGDHHQEDGDEKEIVGEPAVVARPYLSEAWEWWEEKKEEDPLM  233

Query  718  KWRFPPLSNETNMKDNLKFWAQTVASAV  801
             W+ P L NET+M+++LK WA TVAS V
Sbjct  234  NWKVPALGNETDMRESLKSWAHTVASTV  261



>ref|XP_009115260.1| PREDICTED: uncharacterized protein LOC103840505 [Brassica rapa]
Length=139

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = +1

Query  496  SLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSEA  675
            S+S+LE EE KGF+DLGFVFTEED +S L  I+PGL+ +  R+E    +SSV RPYLSEA
Sbjct  38   SVSDLEAEETKGFIDLGFVFTEEDLNSELPEILPGLRTFLHREEQSKTDSSVPRPYLSEA  97

Query  676  WSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            W +   +K    +L  R   + +ETNMKD LK+WA++VAS+++
Sbjct  98   WELHSNKK-DSIVLDLRMAKICSETNMKDCLKWWARSVASSLK  139



>ref|XP_009142082.1| PREDICTED: uncharacterized protein LOC103865964 [Brassica rapa]
 emb|CDY47987.1| BnaA04g24650D [Brassica napus]
Length=244

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 75/112 (67%), Gaps = 8/112 (7%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEED-KSSSLASIIPGLQRWGSRDEVMTNE--SSVQRPY  663
            +S+S+LE EELKGF+DLGFVF+EED + S L SI+PGLQR   +D+V   E  S+V RPY
Sbjct  133  KSMSDLEFEELKGFIDLGFVFSEEDQRDSELVSILPGLQRLVKKDDVTEEEDMSNVNRPY  192

Query  664  LSEAWSIMDQRKMMKKL---LKWRFP--PLSNETNMKDNLKFWAQTVASAVR  804
            LSEAW     RK  + +   +KW+ P  P   E  +KD+LK WA  VAS +R
Sbjct  193  LSEAWDHCGGRKGKRHITPAIKWKVPAVPEVKEVELKDHLKQWAHAVASTIR  244



>ref|XP_010517817.1| PREDICTED: uncharacterized protein LOC104793203 [Camelina sativa]
Length=265

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 83/136 (61%), Gaps = 22/136 (16%)
 Frame = +1

Query  457  KRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEED-KSSSLASIIPGLQRWGSRDE--  627
            K  V R++ G  +S+S+LE EELKGFMDLGFVF+EED K S L SI+PGLQR  ++D   
Sbjct  131  KSNVRRRRKG--KSMSDLEYEELKGFMDLGFVFSEEDHKDSDLVSILPGLQRLVTKDHDG  188

Query  628  -------------VMTNESSVQRPYLSEAWSIMDQRKMMKKL---LKWRFPPL-SNETNM  756
                           +N + V RPYLSEAW     RK  K++   +KWR P L + E ++
Sbjct  189  LVQVTKEEEGEEEDKSNINRVARPYLSEAWDHCGGRKGEKQITTKIKWRVPVLAAKEVDL  248

Query  757  KDNLKFWAQTVASAVR  804
            KDNL+ WA  VAS +R
Sbjct  249  KDNLRLWAHAVASTIR  264



>emb|CDY50782.1| BnaA09g54110D [Brassica napus]
Length=145

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 76/108 (70%), Gaps = 5/108 (5%)
 Frame = +1

Query  496  SLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSEA  675
            S+S+LE EE KGF+DLGFVFTEED +S L  I+PGLQ +  R+E    +SSV RPYLSEA
Sbjct  38   SVSDLEAEETKGFIDLGFVFTEEDLNSELPEILPGLQTFLHREEQSKTDSSVPRPYLSEA  97

Query  676  WSIMDQR--KMMKK---LLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            W +   +  +  KK   +L  R   + +ETNMKD LK+WA++VAS+++
Sbjct  98   WELHSNKWSERAKKDSIVLDLRMAKICSETNMKDCLKWWARSVASSLK  145



>ref|XP_010059032.1| PREDICTED: uncharacterized protein LOC104446940 [Eucalyptus grandis]
Length=466

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 92/274 (34%), Positives = 136/274 (50%), Gaps = 49/274 (18%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEILTRK---QCPSVHETKPVLDD-EYKKESKTMMGVL---SL  282
            M  AE ++K+ D+CWF+ EIL ++      S   + P  +  E  ++    + +    S+
Sbjct  1    MEEAEAVMKIIDTCWFELEILKKRPDTSPSSASRSDPGQESIEIPEKGSPRLQISRTPSI  60

Query  283  KVRSQSDNLLSFGTSF--SP--PSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCE  450
             VRS SD      +SF  SP  P+  L++         + +               K  E
Sbjct  61   LVRSMSDQTSIIPSSFQSSPLSPASVLRA-------TPMHSMIYEEEVIREEEEGFKWNE  113

Query  451  IKKRRVARK---KLGGH-------RSLSELEIEELKGFMDLGFVFTEEDK-SSSLASIIP  597
             +    +R+   ++GG        +SLSELE EE+KGFMDLGFVF EED   SSL SIIP
Sbjct  114  PRSSEFSRRNKGQMGGRGKRRALSKSLSELEFEEVKGFMDLGFVFAEEDSVDSSLVSIIP  173

Query  598  GLQRWGSR--------------------DEVMTNESSVQRPYLSEAWSIMDQRKMMKKLL  717
            GLQR G +                     E++   + V RPYLSEAW   +++K    L+
Sbjct  174  GLQRLGKKIKDGDEDDEDGDHHQEDGDEKEIVGEPAVVARPYLSEAWEWWEEKKEEDPLM  233

Query  718  KWRFPPLSNETNMKDNLKFWAQTVASAVR*CFLL  819
             W+ P L NET+M+++LK WA TVAS V+  +++
Sbjct  234  NWKVPALGNETDMRESLKSWAHTVASTVQSSYVV  267



>ref|XP_010040852.1| PREDICTED: uncharacterized protein LOC104429715 [Eucalyptus grandis]
 gb|KCW44864.1| hypothetical protein EUGRSUZ_L01560 [Eucalyptus grandis]
Length=250

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 128/251 (51%), Gaps = 28/251 (11%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEILTRK---QCPSVHETKPVLDD-EYKKESKTMMGV---LSL  282
            M  AE ++ + D CWF+ EI  ++      S   + P  +  E  ++  + + +    S+
Sbjct  1    MEEAEAVMNIIDRCWFELEIFKKRPDTSPSSTSRSNPGQESIEIPEKESSCLQISRNPSI  60

Query  283  KVRSQSDNLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKR  462
             VRS SD      TS    + SL    + P ++ + +        T      K   +++ 
Sbjct  61   LVRSVSDQTSIIPTSLQ--ASSLSPDSVLP-MKPIHSMIYEEGVITEEEEGFKWNNLRRS  117

Query  463  RVARK---KLGGHRSLSEL-------EIEELKGFMDLGFVFTEEDK-SSSLASIIPGLQR  609
              +R+   ++GG      L       E+EELKGF+DLGFVF EED+  SSL SIIPGLQR
Sbjct  118  EFSRRNKGQMGGRAKRGTLTKSLSELELEELKGFVDLGFVFLEEDRVDSSLVSIIPGLQR  177

Query  610  WGSR-------DEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNL  768
             G++       DE       V RPYLSEAW   ++++    L+ W+ P L NET+MK++L
Sbjct  178  LGNKIKDGEEDDEDAGESVVVARPYLSEAWEWWEEKRKEDPLMNWKVPALGNETDMKESL  237

Query  769  KFWAQTVASAV  801
            K+WA TVAS V
Sbjct  238  KWWAHTVASTV  248



>gb|KCW74145.1| hypothetical protein EUGRSUZ_E02780 [Eucalyptus grandis]
Length=250

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 85/248 (34%), Positives = 119/248 (48%), Gaps = 22/248 (9%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEY-----KKESKTMM--GVLSL  282
            M  AE ++ + D CWF+ EI  ++   S   T      +      +KES  +      S+
Sbjct  1    MEEAEAVMNIIDRCWFELEIFKKRPDTSPSSTSRSNPGQESIEIPEKESSCLQISRTPSI  60

Query  283  KVRSQSDNLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKR  462
             VRS SD      TS    S S  S +    +  +                  +  ++  
Sbjct  61   LVRSVSDQTSIIPTSLQASSLSPDSVLPMKPIHSMIYEEGVITEEEEGFKWNNLRSLEFS  120

Query  463  RVARKKLGGHRSLSEL-------EIEELKGFMDLGFVFTEEDK-SSSLASIIPGLQRWGS  618
               + ++GG      L       E+EELKGF+DLGFVF EED+  SSL SIIPGLQR G+
Sbjct  121  HRNKGQMGGRAKRGTLTKSLSELELEELKGFVDLGFVFLEEDRVDSSLVSIIPGLQRLGN  180

Query  619  R-------DEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFW  777
            +       DE       V RPYLSEAW   ++++    L+ W+ P L NET+MK++LK+W
Sbjct  181  KIKDGEEDDEDAGESVVVARPYLSEAWEWWEEKRKEDPLMNWKVPALGNETDMKESLKWW  240

Query  778  AQTVASAV  801
            A TVAS V
Sbjct  241  AHTVASTV  248



>ref|XP_006850606.1| hypothetical protein AMTR_s00034p00131640 [Amborella trichopoda]
 gb|ERN12187.1| hypothetical protein AMTR_s00034p00131640 [Amborella trichopoda]
Length=229

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 87/245 (36%), Positives = 119/245 (49%), Gaps = 39/245 (16%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSD  303
            M   + +  L D+ WFQ  IL  +   S   +K + D   K +  +    + LKV     
Sbjct  1    MGEYQTLTTLMDTNWFQQNILVHRSS-STSLSKIIGDSISKIDGDSTE--MQLKV-----  52

Query  304  NLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVA----  471
             LL+      PP  +L+    +P+L +L+            L   +  ++K RR A    
Sbjct  53   PLLTTEIDECPPLPNLR----RPQLLNLEEPPREPE-----LAVVESTQLKLRRTASRLD  103

Query  472  -------RKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG-----  615
                   R +L   +SLSELEI+ELKGFMDLGFVF +ED S    S+IPGLQR G     
Sbjct  104  SGKPQQRRSRLKNSKSLSELEIDELKGFMDLGFVFNKEDLSPRTMSVIPGLQRLGEEEKY  163

Query  616  --SRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNE-TNMKDNLKFWAQT  786
                +E       V+RPYLSEAW I   R+    LL  R PP +   T MK +L+ WA+T
Sbjct  164  REEEEEEEAENEQVRRPYLSEAWLI---RRPDSPLLNLRMPPPTAAGTEMKRHLRSWART  220

Query  787  VASAV  801
            VAS +
Sbjct  221  VASVI  225



>gb|KFK37122.1| hypothetical protein AALP_AA4G215600 [Arabis alpina]
Length=251

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 80/128 (63%), Gaps = 11/128 (9%)
 Frame = +1

Query  454  KKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEED-KSSSLASIIPGLQRWGSRDEV  630
            KK+   R +    +S+S+LE EE+KGFMDLGFVF+EED K S L SI+PGLQR   R++ 
Sbjct  124  KKQSNVRTRTRRGKSMSDLECEEIKGFMDLGFVFSEEDHKDSDLVSILPGLQRLVKREDG  183

Query  631  MTNESSV-----QRPYLSEAWSIMDQRKMMKKL---LKWRFPP--LSNETNMKDNLKFWA  780
            +   +       +RPY+SE W   ++RK  K+    +KWR P    +NE + KD+LK WA
Sbjct  184  VVKVTEEEEEDNRRPYMSEVWDRCERRKGKKQFTPEIKWRVPAPVTTNEVDYKDHLKLWA  243

Query  781  QTVASAVR  804
              VAS +R
Sbjct  244  HAVASTIR  251



>gb|EYU28109.1| hypothetical protein MIMGU_mgv1a022012mg, partial [Erythranthe 
guttata]
Length=149

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 74/112 (66%), Gaps = 19/112 (17%)
 Frame = +1

Query  505  ELEIEELKGFMDLGFVFTEEDK-SSSLASIIPGLQRWGSR--------DEVMTNESSVQR  657
            ELE EELKGFMDLGFVF+EEDK  SSLA IIPGL + G +        D+    E   +R
Sbjct  45   ELEFEELKGFMDLGFVFSEEDKLDSSLADIIPGLHKLGQKKKMDCNLSDDYYHEEHERER  104

Query  658  PYLSEAWSIMDQRKMMKKLLKWRFPP--LSNETNMKDNLKFWAQTV-ASAVR  804
            PYLSE W    +R+++K   KWR P   + NE +MKD+LK+WA +V ASAVR
Sbjct  105  PYLSEVW----ERELLK---KWRVPVDIVGNEIDMKDSLKWWAHSVIASAVR  149



>ref|XP_006303781.1| hypothetical protein CARUB_v10012027mg [Capsella rubella]
 gb|EOA36679.1| hypothetical protein CARUB_v10012027mg [Capsella rubella]
Length=170

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 85/123 (69%), Gaps = 7/123 (6%)
 Frame = +1

Query  457  KRRVARKKLGGHRS-LSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVM  633
            KR  + +++G +R  +S+LE EE+KGFMDLGFVFT+ED +S L  I+PGL+ +   +E +
Sbjct  48   KRSGSTRRIGDNRERVSDLEAEEIKGFMDLGFVFTKEDLNSELPKILPGLRAFLCPEEHL  107

Query  634  TNESSV-QRPYLSEAWSIMDQR--KMMKK---LLKWRFPPLSNETNMKDNLKFWAQTVAS  795
              E SV  RPYLSEAW + D +  ++ +K   ++ +R   L  E NMKD+LK WA++VAS
Sbjct  108  EKEPSVLPRPYLSEAWDVYDDKCSRLTEKDSTVIDFRMAKLRGEKNMKDSLKLWARSVAS  167

Query  796  AVR  804
            +++
Sbjct  168  SLK  170



>ref|XP_004155514.1| PREDICTED: uncharacterized protein LOC101232662 [Cucumis sativus]
Length=202

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 85/248 (34%), Positives = 112/248 (45%), Gaps = 68/248 (27%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSDN  306
            +AAEEIL LFD  WFQ  I +RKQ        PV                 LK+RSQS+ 
Sbjct  1    MAAEEILPLFDLFWFQRAIFSRKQHLKTCFQSPVKQ--------------VLKMRSQSEY  46

Query  307  LLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVARKKLG  486
             L+    F PP  +L S                       +++ KV E       +    
Sbjct  47   FLN-SKDFPPPETALNSN-----------------QKLETILSGKVTEFGGNEEGQATKK  88

Query  487  GHRSLS--------------------ELEIEELKGFMDLGFVFTEEDKS-SSLASIIPGL  603
              + L                     +LE EELKGFMDLGFVF+EEDK+ S+L SIIPGL
Sbjct  89   KKKKLEGNEDKIRRKKKGKGLSKSLSDLEFEELKGFMDLGFVFSEEDKNDSNLGSIIPGL  148

Query  604  QRWGSRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPL-SNETNMKDNLKFWA  780
             R G + +    + S++           +  KM+  L+KWR P L + E ++K +LKFWA
Sbjct  149  HRLGPKKQ--RKKESIEE----------ENEKMI--LMKWRVPSLGATEMDIKHHLKFWA  194

Query  781  QTVASAVR  804
             TVAS VR
Sbjct  195  HTVASTVR  202



>emb|CDY14852.1| BnaC04g48490D [Brassica napus]
Length=252

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 82/129 (64%), Gaps = 12/129 (9%)
 Frame = +1

Query  454  KKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEED-KSSSLASIIPGLQRWGSRDEV  630
            KK+   R++    +S+S+LE EELKGF+DLGFVF+EED + S L SI+PGLQR   +D+ 
Sbjct  124  KKQNDVRRRTRRGKSMSDLEFEELKGFIDLGFVFSEEDQRDSELVSILPGLQRLVKKDDG  183

Query  631  ---MTNE---SSVQRPYLSEAWSIMDQRKMMKKL---LKWRFP--PLSNETNMKDNLKFW  777
               +T E   S++ RPYLSEAW     RK  + +   +KW+ P  P   E  +KD+LK W
Sbjct  184  VGDVTEEEDISNINRPYLSEAWDHCGGRKGKRHITPAIKWKVPAVPEVKEVELKDHLKQW  243

Query  778  AQTVASAVR  804
            A  VAS +R
Sbjct  244  AHAVASTIR  252



>ref|XP_010059038.1| PREDICTED: uncharacterized protein LOC104446946 [Eucalyptus grandis]
 gb|KCW74144.1| hypothetical protein EUGRSUZ_E02779 [Eucalyptus grandis]
Length=250

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 87/253 (34%), Positives = 126/253 (50%), Gaps = 32/253 (13%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYK-------KESKTMM--GVL  276
            M  AE ++ + D CWF+ EI  ++  P    +     +  +       KES  +      
Sbjct  1    MEEAEAVMNIIDRCWFELEIFKKR--PDTSPSSTSSSNPGQESIEIPEKESSCLQISRTP  58

Query  277  SLKVRSQSDNLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIK  456
            S+ VRS SD      TS    + SL    + P ++ + +        T      K   ++
Sbjct  59   SILVRSVSDQTSIIPTSLQ--ASSLSPDSVLP-MKPIHSMIYEEGVITEEEEGFKWNNLR  115

Query  457  KRRVARK---KLGGHRSLSEL-------EIEELKGFMDLGFVFTEEDK-SSSLASIIPGL  603
            +   +R+   ++GG      L       E+EELKGF+DLGFVF EED+  SSL SIIPGL
Sbjct  116  RSEFSRRNKGQMGGRAKRGTLTKSLSELELEELKGFVDLGFVFLEEDRVDSSLVSIIPGL  175

Query  604  QRWGSR-------DEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKD  762
            QR G++       DE       V RPYLSEAW   ++++    L+ W+ P L NET+MK+
Sbjct  176  QRLGNKIKDGEEDDEDAGESVVVGRPYLSEAWEWWEEKRKEDPLMNWKVPALGNETDMKE  235

Query  763  NLKFWAQTVASAV  801
            +LK+WA TVAS V
Sbjct  236  SLKWWAHTVASTV  248



>gb|EYU37337.1| hypothetical protein MIMGU_mgv11b016324mg [Erythranthe guttata]
Length=225

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 66/110 (60%), Gaps = 9/110 (8%)
 Frame = +1

Query  484  GGHRSLSELEIEELKGFMDLGFVFTEEDK---SSSLASIIPGLQRWGSRDE---VMTNES  645
            G  +SLSELE EELKGFMDLGFVFT  D     S L SIIPGLQR G   +     +   
Sbjct  113  GAVKSLSELEFEELKGFMDLGFVFTAGDDQKLDSKLVSIIPGLQRLGKNVDESASESESE  172

Query  646  SVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVAS  795
            SV RPYLSEAW+       MK    WR P   NE  +K +L+FWA +VAS
Sbjct  173  SVSRPYLSEAWNYSSNNPAMK---DWRIPAFGNEMELKHHLRFWAHSVAS  219



>ref|XP_006830214.1| hypothetical protein AMTR_s00130p00028330 [Amborella trichopoda]
 gb|ERM97630.1| hypothetical protein AMTR_s00130p00028330 [Amborella trichopoda]
Length=335

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 76/124 (61%), Gaps = 8/124 (6%)
 Frame = +1

Query  448  EIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRW-----  612
            EI ++   + K    +SLSELE EELKGF+DLGF F E + S  L SIIPGLQR      
Sbjct  215  EIHRQMNTQGKKSLSKSLSELEFEELKGFIDLGFTFEESELSPRLKSIIPGLQRMVKTKE  274

Query  613  GSRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVA  792
               ++   +  ++ RPYLSEAW +   RK   KL++W+ P LS   +MK++LK WA  VA
Sbjct  275  KENEKQEEDNKNISRPYLSEAWLV---RKPESKLIQWKIPELSQGMDMKEHLKLWAHNVA  331

Query  793  SAVR  804
            S VR
Sbjct  332  STVR  335



>ref|NP_181804.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD21731.1| unknown protein [Arabidopsis thaliana]
 gb|ABF83685.1| At2g42760 [Arabidopsis thaliana]
 gb|AEC10165.1| uncharacterized protein AT2G42760 [Arabidopsis thaliana]
Length=267

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 77/122 (63%), Gaps = 18/122 (15%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEED-KSSSLASIIPGLQRWGSRDEVMTNE---------  642
            +S+S+LE EELKGFMDLGFVF+E+D K S L SI+PGLQR   +D+ +T E         
Sbjct  145  KSMSDLEYEELKGFMDLGFVFSEDDHKDSDLVSILPGLQRLVKKDDGVTKEEEEEEEEDK  204

Query  643  ---SSVQRPYLSEAWSIMDQRKMMKKL---LKWRF--PPLSNETNMKDNLKFWAQTVASA  798
               +   RPYLSEAW     RK  K++   +KWR   P  ++E ++KDNL+ WA  VAS 
Sbjct  205  IGGNRAARPYLSEAWDHCGGRKGKKQITPEIKWRVPAPAAASEVDLKDNLRLWAHAVAST  264

Query  799  VR  804
            +R
Sbjct  265  IR  266



>ref|XP_010925601.1| PREDICTED: putative WAS protein family homolog 3 [Elaeis guineensis]
Length=253

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 69/116 (59%), Gaps = 15/116 (13%)
 Frame = +1

Query  499  LSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEV--------------MT  636
            LSELE EE+KGFMDLGF F++ +    L SI+PGLQR G R                 + 
Sbjct  139  LSELEFEEVKGFMDLGFTFSDAEADPRLMSIVPGLQRLGKRAAGDGEPAEEGSSCASDVV  198

Query  637  NESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            +ES++ RPYLSEAW   ++ +    L  WR P  ++  ++KD+L+FWA  VAS VR
Sbjct  199  DESAISRPYLSEAWDAQEEEE-ENMLRNWRIPAAADGVDLKDHLRFWAHAVASTVR  253



>emb|CDX99803.1| BnaC05g22250D [Brassica napus]
Length=145

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 75/108 (69%), Gaps = 5/108 (5%)
 Frame = +1

Query  496  SLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSEA  675
            S+S+LE EE KGF+DLGFVFTEED +S L  I+PGL+ +   +E    +SSV RPYLSEA
Sbjct  38   SVSDLEAEETKGFIDLGFVFTEEDLNSELPEILPGLRTFLHGEEQSKTDSSVPRPYLSEA  97

Query  676  WSIMDQR--KMMKK---LLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            W +   +  +  KK   +L  R   + +ETNMKD LK+WA++VAS+++
Sbjct  98   WELHSNKWSERAKKDSIVLDLRMAKICSETNMKDCLKWWARSVASSLK  145



>ref|XP_010059037.1| PREDICTED: uncharacterized protein LOC104446945 [Eucalyptus grandis]
Length=174

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 77/129 (60%), Gaps = 23/129 (18%)
 Frame = +1

Query  463  RVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDK-SSSLASIIPGLQRW---------  612
            R  R+ L   +SLSELE EELKGF+DLGFVF+EED+ +SSL SIIP LQR          
Sbjct  42   RAKRRTL--TKSLSELEFEELKGFVDLGFVFSEEDRVNSSLVSIIPRLQRLDKKIKDGNE  99

Query  613  -----------GSRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMK  759
                       G   E+++  S V RPYLSEAW   ++++    L+ W+ P L NET+M+
Sbjct  100  DDEDGNHRREDGDEKEIVSEPSVVGRPYLSEAWEWWEEKRKEDPLMNWKVPALGNETDMR  159

Query  760  DNLKFWAQT  786
            ++LK+W   
Sbjct  160  ESLKWWGSN  168



>ref|XP_006303202.1| hypothetical protein CARUB_v10011127mg [Capsella rubella]
 gb|EOA36100.1| hypothetical protein CARUB_v10011127mg [Capsella rubella]
Length=145

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 73/112 (65%), Gaps = 12/112 (11%)
 Frame = +1

Query  496  SLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEV-MTNESSVQRPYLSE  672
            S+S+LE EE KGFMDLGFVFTEED +S L  I+PGL+ + SR+E   T ESSV+RPYLSE
Sbjct  37   SVSDLEAEETKGFMDLGFVFTEEDLNSELPEILPGLRTFLSREEQKRTEESSVRRPYLSE  96

Query  673  AWSI--------MDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
             W           D+  M   ++ +       E NMK++LK+WA++VAS ++
Sbjct  97   TWDFNSDNWSGRTDEESM---VIDFTMAKSCGENNMKESLKWWARSVASNLK  145



>emb|CDP06723.1| unnamed protein product [Coffea canephora]
Length=270

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 75/126 (60%), Gaps = 26/126 (21%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRW---GS----RDEVMTN----  639
            +SL ELE+EE++GFMDLGF+F +E+ S  + S+IPGLQR    GS    +D ++      
Sbjct  144  KSLCELELEEVQGFMDLGFIFNKENMSKRMMSVIPGLQRLELSGSTIQGKDNILMGSPPR  203

Query  640  ------------ESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQ  783
                        E ++ RPYLSEAW I   R+    LL  R P +S   +MK +LK+WA+
Sbjct  204  HETRRVEVEGGAEQTITRPYLSEAWLI---RRPDSPLLNLRIPRVSTAADMKKHLKYWAR  260

Query  784  TVASAV  801
            TVASA+
Sbjct  261  TVASAI  266



>ref|XP_004249495.1| PREDICTED: uncharacterized protein LOC101249595 [Solanum lycopersicum]
Length=203

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 77/127 (61%), Gaps = 19/127 (15%)
 Frame = +1

Query  463  RVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMT--  636
            RV +K +  ++S  +LE+EEL+GFMDLGF F +E  S  + ++IPGLQR   R+ V+   
Sbjct  80   RVLKKTMSNYKSFGDLELEELRGFMDLGFTFRKEHISKRMINVIPGLQR---REIVICEC  136

Query  637  -----------NESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQ  783
                       ++  + RPYLSEAW I   ++    LL  R P +S  ++MK +L++WA+
Sbjct  137  EDTKAIVAEEEDKREIVRPYLSEAWLI---KRPNSPLLNMRIPRISAPSDMKKHLRYWAK  193

Query  784  TVASAVR  804
            TVA+ VR
Sbjct  194  TVATVVR  200



>gb|KHN02356.1| hypothetical protein glysoja_002380 [Glycine soja]
Length=247

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 68/114 (60%), Gaps = 13/114 (11%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESS--------  648
            R+L ELE++E+KGFMDLGF F +E  S  + S+IPGLQR G  D   T E +        
Sbjct  135  RTLGELELDEVKGFMDLGFTFKKECLSPRMMSVIPGLQRLGVMDATETVEGNHIEAEEQK  194

Query  649  --VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
              + RPYLSEAW I   ++    LL  + P   +  NMK +L+FWA+TVAS + 
Sbjct  195  RGIMRPYLSEAWPI---KRPDSPLLNLKIPKRCSSANMKKHLRFWAKTVASEIH  245



>ref|XP_003553543.1| PREDICTED: uncharacterized protein LOC100786645 [Glycine max]
Length=259

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 68/114 (60%), Gaps = 13/114 (11%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESS--------  648
            R+L ELE++E+KGFMDLGF F +E  S  + S+IPGLQR G  D   T E +        
Sbjct  147  RTLGELELDEVKGFMDLGFTFKKECLSPRMMSVIPGLQRLGVMDATETVEGNHIEAEEQK  206

Query  649  --VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
              + RPYLSEAW I   ++    LL  + P   +  NMK +L+FWA+TVAS + 
Sbjct  207  RGIMRPYLSEAWPI---KRPDSPLLNLKIPKRCSSANMKKHLRFWAKTVASEIH  257



>ref|XP_002519556.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42970.1| conserved hypothetical protein [Ricinus communis]
Length=183

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 76/146 (52%), Gaps = 35/146 (24%)
 Frame = +1

Query  460  RRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG--------  615
            R+V +K +   RSL ELE+EE+KGFMDLGF+F +E  S  + S++PGL R G        
Sbjct  39   RKVLQKSMSC-RSLGELELEEVKGFMDLGFIFKKEQISPRMISVVPGLSRLGLYKHKHNT  97

Query  616  -----------------------SRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWR  726
                                    RD+    E  + RPYLSEAW I   R+    LL  R
Sbjct  98   TKLINSEVVPEDEDCYDSDDHDIVRDDQQEQEKGIIRPYLSEAWLI---RRPDSPLLNLR  154

Query  727  FPPLSNETNMKDNLKFWAQTVASAVR  804
             P +S   +MK +LKFWA+TVAS ++
Sbjct  155  LPKVSAAADMKKHLKFWARTVASEIQ  180



>ref|XP_008790021.1| PREDICTED: uncharacterized protein LOC103707351 [Phoenix dactylifera]
Length=252

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 67/116 (58%), Gaps = 19/116 (16%)
 Frame = +1

Query  499  LSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRD--------------EVMT  636
            LSEL+ EE+KGFMDLGF F+E +    L SI+PGLQ+ G R+                  
Sbjct  142  LSELQFEEVKGFMDLGFTFSEAEADPRLISIVPGLQQLGKREPGDGEQAAEGSSCASEEV  201

Query  637  NESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            +ES++ RPYLSEAW   +      KL+ WR P  ++   +KD+L+ WA  VAS VR
Sbjct  202  DESAISRPYLSEAWDAPE-----NKLVNWRIPKAADGVVLKDHLRSWAHAVASTVR  252



>ref|XP_008239371.1| PREDICTED: uncharacterized protein LOC103337975 [Prunus mume]
Length=298

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 68/125 (54%), Gaps = 24/125 (19%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG-------------------  615
            RSL ELE+EE+KGFMDLGF F  E  S  + S++PGLQR G                   
Sbjct  174  RSLGELELEEVKGFMDLGFTFKREHLSPRMMSLVPGLQRLGMSNNKKLQNGEDDDDSVEV  233

Query  616  --SRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTV  789
               +DE    E  V RPYLSEAW I   ++    LL  R P +S   +MK +LKFWA+TV
Sbjct  234  AADKDEDGEGEVEVTRPYLSEAWLI---KRPDSPLLNLRLPRVSAAADMKKHLKFWARTV  290

Query  790  ASAVR  804
            AS + 
Sbjct  291  ASEIH  295



>gb|AFW86969.1| hypothetical protein ZEAMMB73_882946 [Zea mays]
Length=171

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 70/124 (56%), Gaps = 21/124 (17%)
 Frame = +1

Query  496  SLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSV--------  651
            S+SELE EE+KG  DLGF F + +  + LASI+PGL+R  S ++  +  ++         
Sbjct  48   SMSELEFEEVKGLQDLGFTFADAEVDAELASIVPGLRRKRSEEDNNSRATAASTSSARPE  107

Query  652  -------------QRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVA  792
                         +RPYLSEAW   ++ ++ + L  WR PP  +   +K++L+ WA TVA
Sbjct  108  AADDASVAAVVAPRRPYLSEAWDSEEEEEVRRALRSWRIPPAGDGNELKEHLRMWAHTVA  167

Query  793  SAVR  804
            SAVR
Sbjct  168  SAVR  171



>ref|XP_006577012.1| PREDICTED: uncharacterized protein LOC102667501 [Glycine max]
 gb|KHN09486.1| hypothetical protein glysoja_016585 [Glycine soja]
Length=260

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 69/114 (61%), Gaps = 13/114 (11%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESS--------  648
            R+L ELE++E+KGFMDLGF F +E  S  + S++PGLQR G  D   T E +        
Sbjct  148  RTLGELELDEVKGFMDLGFTFKKEYLSPRMMSVVPGLQRLGVVDARETVEGNHIEAEEQK  207

Query  649  --VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
              + RPYLSEAW I   ++    LL  + P   + +NMK +L+FWA+TVAS + 
Sbjct  208  RDIMRPYLSEAWLI---KRPDSPLLNLKIPKCCSSSNMKKHLRFWAKTVASEIH  258



>ref|XP_010915479.1| PREDICTED: programmed cell death protein 7-like [Elaeis guineensis]
Length=263

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 70/125 (56%), Gaps = 24/125 (19%)
 Frame = +1

Query  496  SLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSR----------------DE  627
            SL ELE EE+KGFMDLGF F+E + +  L SI+PGLQR G R                +E
Sbjct  141  SLPELESEEVKGFMDLGFTFSEAEVNPRLLSIVPGLQRLGKRAAGDSEPAAEGSSCTSEE  200

Query  628  VMTNESSVQRPYLSEAWS------IMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTV  789
            V  +ES++ RPYLSEAW              +K L  WR P  ++  ++KD+L+ WA  V
Sbjct  201  V--DESAILRPYLSEAWDAQQEEEAAAAVAALKPLKNWRIPKAADGVDLKDHLRSWAHAV  258

Query  790  ASAVR  804
            AS VR
Sbjct  259  ASTVR  263



>ref|XP_009358150.1| PREDICTED: uncharacterized protein LOC103948809 [Pyrus x bretschneideri]
Length=294

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 70/124 (56%), Gaps = 24/124 (19%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRD--------------EV  630
            RSL ELE+EE+KGF+DLGF F +E  S  + S++PGLQR G  +              EV
Sbjct  172  RSLGELELEEVKGFIDLGFTFKKEHLSPRMMSLVPGLQRLGVSNSKKLRNKNDDSAEIEV  231

Query  631  MTNE-------SSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTV  789
              NE         V RPYLSEAW I   ++    LL  R P +S   +MK +LKFWA+TV
Sbjct  232  APNEDKDDEKAGEVMRPYLSEAWLI---KRPDSPLLNLRLPRVSAAADMKKHLKFWARTV  288

Query  790  ASAV  801
            AS V
Sbjct  289  ASEV  292



>ref|XP_008659691.1| PREDICTED: uncharacterized protein LOC103638600 [Zea mays]
 ref|XP_008659692.1| PREDICTED: uncharacterized protein LOC103638601 isoform X1 [Zea 
mays]
 ref|XP_008659693.1| PREDICTED: uncharacterized protein LOC103638601 isoform X2 [Zea 
mays]
 gb|AFW86967.1| hypothetical protein ZEAMMB73_603245 [Zea mays]
 gb|AFW86968.1| hypothetical protein ZEAMMB73_418121 [Zea mays]
Length=264

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 70/124 (56%), Gaps = 21/124 (17%)
 Frame = +1

Query  496  SLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSV--------  651
            S+SELE EE+KG  DLGF F + +  + LASI+PGL+R  S ++  +  ++         
Sbjct  141  SMSELEFEEVKGLQDLGFTFADAEVDAELASIVPGLRRKRSEEDNNSRATAASTSSARPE  200

Query  652  -------------QRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVA  792
                         +RPYLSEAW   ++ ++ + L  WR PP  +   +K++L+ WA TVA
Sbjct  201  AADDASVAAVVAPRRPYLSEAWDSEEEEEVRRALRSWRIPPAGDGNELKEHLRMWAHTVA  260

Query  793  SAVR  804
            SAVR
Sbjct  261  SAVR  264



>ref|XP_010046753.1| PREDICTED: uncharacterized protein LOC104435755 [Eucalyptus grandis]
 gb|KCW88827.1| hypothetical protein EUGRSUZ_A01165 [Eucalyptus grandis]
Length=260

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 69/112 (62%), Gaps = 12/112 (11%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRD----EVMTNES----S  648
            R+  ELE++E+KGFMDLGF+F +E  S  + S++PGL R G RD    E  TN+      
Sbjct  150  RTFEELEMKEVKGFMDLGFIFKKEHLSPRMVSVVPGLHRLG-RDASIPESATNDEEGKRE  208

Query  649  VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            + RPYLSEAW I   ++    LL  R P     ++MK +LKFWA+TVAS + 
Sbjct  209  IMRPYLSEAWLI---KRPDSPLLNLRVPRAYEASDMKKHLKFWARTVASEIH  257



>gb|KHG19373.1| rna exonuclease 3 [Gossypium arboreum]
Length=295

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 73/124 (59%), Gaps = 23/124 (19%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG-SRDEVMTNESSVQ-----  654
            RSL +LE+EE+KGFMDLGFVFT+E  ++ +  +IPGL R G SR + + NE +V      
Sbjct  172  RSLKDLELEEVKGFMDLGFVFTKEHLNARMIGVIPGLLRLGFSRTKRIHNEVNVDADQLS  231

Query  655  --------------RPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVA  792
                          RPYLSEAW I   ++    LL  R P +S   +MK +LKFWA+TVA
Sbjct  232  KDDDIEQEEKRGVIRPYLSEAWLI---KRPDSPLLNLRVPRVSAAADMKKHLKFWARTVA  288

Query  793  SAVR  804
              V+
Sbjct  289  YVVQ  292



>gb|KDP29097.1| hypothetical protein JCGZ_16486 [Jatropha curcas]
Length=264

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 73/129 (57%), Gaps = 22/129 (17%)
 Frame = +1

Query  475  KKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG-------------  615
            KK    RSL ELE+EE+KGF+DLGF+F +E+ S+ + +++PGL R G             
Sbjct  136  KKSMSCRSLGELEMEEVKGFLDLGFIFKKENVSARMITVVPGLLRLGLCQNDKNYNTKII  195

Query  616  ---SRDEVMT---NESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFW  777
                 DEV      E  + RPYLSEAW I   ++    LL  R P +    +MK +LKFW
Sbjct  196  NNEEEDEVRDEKEEEKEIMRPYLSEAWII---KRPDSPLLNLRLPRVYAAADMKKHLKFW  252

Query  778  AQTVASAVR  804
            A+TVAS ++
Sbjct  253  ARTVASVIQ  261



>ref|XP_008369743.1| PREDICTED: uncharacterized protein LOC103433275 [Malus domestica]
Length=295

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 68/124 (55%), Gaps = 23/124 (19%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG-------------------  615
            RSL ELE+EE+KGF+DLGF F +E  S  + S++PGLQR G                   
Sbjct  172  RSLGELELEEVKGFIDLGFTFKKEHLSPRMMSLVPGLQRLGVSNSKKLRNKNDDSAEIEV  231

Query  616  -SRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVA  792
               D+    E  V RPYLSEAW I   ++    LL  R P +S   +MK +LKFWA+TVA
Sbjct  232  PKEDKDDEKEGEVMRPYLSEAWLI---KRPDSPLLNLRLPRVSAAADMKKHLKFWARTVA  288

Query  793  SAVR  804
            S + 
Sbjct  289  SEIH  292



>ref|XP_006381475.1| hypothetical protein POPTR_0006s13180g [Populus trichocarpa]
 gb|ERP59272.1| hypothetical protein POPTR_0006s13180g [Populus trichocarpa]
Length=281

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 72/126 (57%), Gaps = 25/126 (20%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG-----------------SR  621
            RSL ELE+EE+KGFMDLGF+F +E  S  + S++PGLQR G                   
Sbjct  156  RSLGELELEEVKGFMDLGFIFKKEYLSPRMMSVVPGLQRLGLYQNRQNINLRDSKEAEDH  215

Query  622  DEVM-----TNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQT  786
            DE++       E  + RPYLSE+W I   ++    LL  R P +S   +MK +LKFWA+T
Sbjct  216  DELIRKQEEDEEKGIIRPYLSESWLI---KRPDSPLLNLRVPRVSVAADMKIHLKFWART  272

Query  787  VASAVR  804
            VAS ++
Sbjct  273  VASEIQ  278



>ref|XP_007162732.1| hypothetical protein PHAVU_001G175800g [Phaseolus vulgaris]
 gb|ESW34726.1| hypothetical protein PHAVU_001G175800g [Phaseolus vulgaris]
Length=263

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 68/116 (59%), Gaps = 15/116 (13%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG--------SRDEVMTNES-  645
            R+L ELE++E+KGFMDLGF F +E  S  + S++PGLQR G          D +  +E  
Sbjct  149  RTLGELELDEVKGFMDLGFTFNKEYLSPRMMSVVPGLQRLGVMNGKETVEGDYIEADEDE  208

Query  646  ---SVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
                + RPYLSEAW I   ++    LL  + P   +  NMK +L+FWA+TVAS + 
Sbjct  209  GKRDIMRPYLSEAWLI---KRPDSPLLNLKIPKRCSSANMKKHLRFWAKTVASEIH  261



>ref|XP_007027287.1| Uncharacterized protein TCM_022118 [Theobroma cacao]
 gb|EOY07789.1| Uncharacterized protein TCM_022118 [Theobroma cacao]
Length=301

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 21/122 (17%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG------------------S  618
            RSL +LE+EE+KGFMDLGF+F +E+ ++ + S++PGL R G                   
Sbjct  180  RSLKDLELEEVKGFMDLGFIFKKENLNARMISVVPGLLRLGFLKTKQKTELNLAADELPK  239

Query  619  RDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASA  798
             D++   E+ V RPYLSE W I   ++    LL  R P +    +MK +LKFWA+TVAS 
Sbjct  240  DDDIEPEETGVVRPYLSETWLI---KRPDSPLLNLRVPRVYAAADMKKHLKFWARTVASV  296

Query  799  VR  804
             +
Sbjct  297  AQ  298



>ref|XP_011048575.1| PREDICTED: uncharacterized protein LOC105142581 isoform X2 [Populus 
euphratica]
Length=280

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 70/126 (56%), Gaps = 25/126 (20%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG-------------------  615
            RS+ ELE+EE+KGFMDLGF+F +E  S  + S++PGLQR G                   
Sbjct  155  RSMGELELEEVKGFMDLGFIFKKEHLSPRMMSVVPGLQRLGLYQNRQNINLRDSKEAEDH  214

Query  616  ---SRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQT  786
                R +    E  + RPYLSE+W I   ++    LL  R P +S   +MK +LKFWA+T
Sbjct  215  GELIRKQEEDEEKGIIRPYLSESWLI---KRPDSPLLNLRVPRVSVAADMKKHLKFWART  271

Query  787  VASAVR  804
            VAS ++
Sbjct  272  VASEIQ  277



>ref|XP_011048574.1| PREDICTED: uncharacterized protein LOC105142581 isoform X1 [Populus 
euphratica]
Length=281

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 70/126 (56%), Gaps = 25/126 (20%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG-------------------  615
            RS+ ELE+EE+KGFMDLGF+F +E  S  + S++PGLQR G                   
Sbjct  156  RSMGELELEEVKGFMDLGFIFKKEHLSPRMMSVVPGLQRLGLYQNRQNINLRDSKEAEDH  215

Query  616  ---SRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQT  786
                R +    E  + RPYLSE+W I   ++    LL  R P +S   +MK +LKFWA+T
Sbjct  216  GELIRKQEEDEEKGIIRPYLSESWLI---KRPDSPLLNLRVPRVSVAADMKKHLKFWART  272

Query  787  VASAVR  804
            VAS ++
Sbjct  273  VASEIQ  278



>gb|KCW75609.1| hypothetical protein EUGRSUZ_E04347, partial [Eucalyptus grandis]
Length=244

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 121/251 (48%), Gaps = 49/251 (20%)
 Frame = +1

Query  145  LKLFDSCWFQGEILTRK---QCPSVHETKPVLDD-EYKKESKTMMGV---LSLKVRSQSD  303
            +K+ D+CWF+ EIL ++      S   + P  +  E  ++    + +    S+ VRS SD
Sbjct  1    MKIIDTCWFELEILKKRPDTSPSSASRSDPGQESIEIPEKGSPRLQISRTPSILVRSMSD  60

Query  304  NLLSFGTSF--SP--PSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKRRVA  471
                  +SF  SP  P+  L++         + +               K  E +    +
Sbjct  61   QTSIIPSSFQSSPLSPASVLRA-------TPMHSMIYEEEVIREEEEGFKWNEPRSSEFS  113

Query  472  RK---KLGGH-------RSLSELEIEELKGFMDLGFVFTEEDK-SSSLASIIPGLQRWGS  618
            R+   ++GG        +SLSELE EE+KGFMDLGFVF+EED   SSL SIIPGLQR G 
Sbjct  114  RRNKGQMGGRGKRRALSKSLSELEFEEVKGFMDLGFVFSEEDSVDSSLVSIIPGLQRLGK  173

Query  619  R--------------------DEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPL  738
            +                     E++   + V RPYLSEAW   ++ +    L+ W+ P L
Sbjct  174  KIKDGDEDDEDGDHHREDGDEKEIVGEPAVVARPYLSEAWEWWEEERKEDPLMNWKVPAL  233

Query  739  SNETNMKDNLK  771
             NET+M+++LK
Sbjct  234  GNETDMRESLK  244



>ref|XP_004294142.1| PREDICTED: uncharacterized protein LOC101306310 [Fragaria vesca 
subsp. vesca]
Length=307

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 71/117 (61%), Gaps = 19/117 (16%)
 Frame = +1

Query  472  RKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSV  651
            R+KL   +SLS+LEIEE++GF DLGF F ++D + S+ SI+PGLQ     +E+  N   V
Sbjct  204  RRKLLSRKSLSDLEIEEVQGFKDLGFTFDKKDIAPSVVSILPGLQEKKRNEEL--NLDMV  261

Query  652  QRPYLSEAWSIMDQRKMMKKLLKWRFPPLSN------ETNMKDNLKFWAQTVASAVR  804
            +RPYLSEAW           L++   PP  N        +MK  +KFWA++VAS VR
Sbjct  262  RRPYLSEAW-----------LVQSCAPPPPNLGAGRSAEDMKAQIKFWARSVASNVR  307



>ref|NP_001057835.1| Os06g0550800 [Oryza sativa Japonica Group]
 dbj|BAD53711.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF19749.1| Os06g0550800 [Oryza sativa Japonica Group]
 gb|EAZ37306.1| hypothetical protein OsJ_21644 [Oryza sativa Japonica Group]
Length=283

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 74/136 (54%), Gaps = 35/136 (26%)
 Frame = +1

Query  496  SLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTN------------  639
            S+SELE EE+KG  DLGF F+E+D  + LASI+PGL+R  S ++                
Sbjct  150  SMSELEFEEVKGLQDLGFTFSEDDVDAELASIVPGLRRRRSDEDDAREAPAAAAASAEEE  209

Query  640  ------------------ESSVQRPYLSEAWSIMDQRKMMKKLLK-WRFPPL--SNETNM  756
                               S+ +RPYLSEAW   D+ + M+++L+ WR PP    +  ++
Sbjct  210  AASSRRIGSAPAGTSSSFSSAPRRPYLSEAWD--DEEEEMRRMLRNWRIPPAGDGDGADL  267

Query  757  KDNLKFWAQTVASAVR  804
            K+ L+ WA TVASAVR
Sbjct  268  KEQLRLWAHTVASAVR  283



>ref|XP_003563777.1| PREDICTED: uncharacterized protein LOC100825390 [Brachypodium 
distachyon]
Length=251

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 70/116 (60%), Gaps = 15/116 (13%)
 Frame = +1

Query  496  SLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEV------------MTN  639
            SLSELE EE+KG  DLGF F++ D  + LASI+PGL+R  + ++                
Sbjct  138  SLSELEFEEVKGLQDLGFTFSDADVDAELASIVPGLRRIRAEEDARKAKAEEEEAWSRNR  197

Query  640  ESSVQRPYLSEAWSIMDQRKMMKKLL-KWRFPPLSNETNMKDNLKFWAQTVASAVR  804
             ++ +RPYLSEAW   D+   ++++L  +R P      ++K++L+ WA +VASAVR
Sbjct  198  AAAPRRPYLSEAWE--DEEAEVRRMLNNFRIPAAQEGADLKEHLRLWAHSVASAVR  251



>gb|KCW74146.1| hypothetical protein EUGRSUZ_E02782 [Eucalyptus grandis]
Length=230

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 81/234 (35%), Positives = 114/234 (49%), Gaps = 39/234 (17%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEILTRK---QCPSVHETKPVLD--DEYKKESKTMM--GVLSL  282
            M  AE ++K+ D CWF+ EI  ++      S   + P  +  +  +KES  +      S+
Sbjct  1    MEEAEAVMKIIDRCWFELEIFKKRPDTSPSSTSRSNPSQESIEIPEKESSCLQISRTPSI  60

Query  283  KVRSQSDNLLSFGTSFSPPSDSLKSGI-IKPELEDLQaaataaaaataLLITKKVCEIKK  459
             VRS SD      TS    S S  S + +KP                   I   + E + 
Sbjct  61   LVRSVSDQTSIIPTSLQASSLSPDSVLPMKP-------------------IHSMIYEEEG  101

Query  460  RRVAR-KKLGGHRSLSELEIEELKGFMDLGFVFTEEDK-SSSLASIIPGL---------Q  606
            +   R K+    +SLSELE EELKGF+DLGFVF EED+  SSL SII GL          
Sbjct  102  QMGGRAKRRTLTKSLSELEFEELKGFVDLGFVFLEEDRVDSSLVSIISGLCNIIKDGEED  161

Query  607  RWGSRDEVMTNES-SVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDN  765
                 +++   ES  V RPYLSEAW   +++     L+KW+ P L NET++K++
Sbjct  162  DEDGDEKLTAGESVVVARPYLSEAWKWWEEKGKEDPLMKWKVPSLGNETDIKES  215



>ref|XP_010107564.1| hypothetical protein L484_024420 [Morus notabilis]
 gb|EXC16246.1| hypothetical protein L484_024420 [Morus notabilis]
Length=254

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 71/120 (59%), Gaps = 18/120 (15%)
 Frame = +1

Query  490  HRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQR---WGSRDEVMTN-------  639
            +RSL +LE+ E+KGFMDLGF+F +E  S  + S+IPGLQR   + S++    N       
Sbjct  138  YRSLGDLELREVKGFMDLGFIFKKEHLSPRMMSLIPGLQRLKVYKSKENGSENLEGDQEE  197

Query  640  -----ESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
                 E  V RPYLSEAW I   ++    LL  R P +S   +MK +L+FWA+ VAS ++
Sbjct  198  EEEEEERGVIRPYLSEAWLI---KRPGSPLLNLRVPRVSAAADMKKHLRFWARIVASEIQ  254



>gb|KCW45545.1| hypothetical protein EUGRSUZ_L00734 [Eucalyptus grandis]
Length=224

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 83/250 (33%), Positives = 120/250 (48%), Gaps = 52/250 (21%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYK-------KESKTMM--GVL  276
            M  AE ++K+ D CWF+ EI   K+ P +  +     +  +       KES  +      
Sbjct  1    MEEAEAVMKIIDRCWFELEIF--KKGPDISPSSTSRSNPGQESIEIPEKESSCLQISRTP  58

Query  277  SLKVRSQSDNLLSFGTSFSPPSDSLKSGIIKPE----LEDLQaaataaaaataLLITKKV  444
            S+ VRS SD      TS  P   SL++  + P+    ++ + +        T      K 
Sbjct  59   SILVRSVSDQ-----TSIIP--TSLQASSLSPDSVLPMKPIHSMIYEEEVITEEEEGFKW  111

Query  445  CEIKKRRVARKK---LGGH-------RSLSELEIEELKGFMDLGFVFTEEDK-SSSLASI  591
              ++    + +K   +GG        +SLSELE+EELKGF+DLGFVF EED+  SSL SI
Sbjct  112  NNLRSSEFSHRKKGQMGGRAKRRTLTKSLSELEVEELKGFVDLGFVFLEEDRVDSSLVSI  171

Query  592  IPGLQRWGSRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLK  771
            IPGLQR G++  +   E               D     + LL      + NET+MK++LK
Sbjct  172  IPGLQRLGNK--IKDGEE--------------DDEDAGEFLL---LGTIGNETDMKESLK  212

Query  772  FWAQTVASAV  801
            +WA TVAS V
Sbjct  213  WWAHTVASTV  222



>ref|XP_008226466.1| PREDICTED: uncharacterized protein LOC103326040 [Prunus mume]
Length=333

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 72/122 (59%), Gaps = 21/122 (17%)
 Frame = +1

Query  460  RRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQ-RWGSRDEVMT  636
            RR +  +L   +SLS+LEIEEL+GF DLGF F +++ S S+ +I+PGLQ + G+ D    
Sbjct  226  RRRSLNQLTARKSLSDLEIEELQGFKDLGFTFDKKELSPSVVNILPGLQEKKGTED---L  282

Query  637  NESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSN------ETNMKDNLKFWAQTVASA  798
            N   V+RPYLSEAW           L++   PP  N        +MK  +KFWA+ VAS 
Sbjct  283  NPEKVRRPYLSEAW-----------LVQSCAPPPPNLGASRSAEDMKAQIKFWARAVASN  331

Query  799  VR  804
            VR
Sbjct  332  VR  333



>ref|XP_006591846.1| PREDICTED: uncharacterized protein LOC100527250 isoform X1 [Glycine 
max]
 gb|KHN28084.1| hypothetical protein glysoja_007816 [Glycine soja]
Length=331

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 78/127 (61%), Gaps = 21/127 (17%)
 Frame = +1

Query  442  VCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSR  621
            + E+++R + +K +   RSLS+LE EE++GF DLGF F +E  S SLASI+PGLQ    R
Sbjct  217  IMEMRRRFLNQKTM--RRSLSDLEFEEVQGFKDLGFSFEKEALSPSLASILPGLQE-KKR  273

Query  622  DEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSN------ETNMKDNLKFWAQ  783
            DE   ++++ +RPYLSEAW           L++   PP+ N        +MK+ +KFWA+
Sbjct  274  DETEEDKAA-RRPYLSEAW-----------LVQSCAPPIPNWASHKSSGDMKEQIKFWAR  321

Query  784  TVASAVR  804
             VAS V 
Sbjct  322  AVASNVH  328



>gb|KDO35922.1| hypothetical protein CISIN_1g025682mg [Citrus sinensis]
Length=249

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 78/136 (57%), Gaps = 21/136 (15%)
 Frame = +1

Query  451  IKKRRVAR---KKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQR----  609
            +KKRR ++   +K    RSL ELE+EE+KGFMDLGF F +E  S  + S++PGLQR    
Sbjct  114  LKKRRYSKSLPQKSKSCRSLMELELEEVKGFMDLGFRFNKECLSPRMMSVLPGLQRVKLH  173

Query  610  ----------WGSRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNET-NM  756
                         + +    E  V RPYLSEAW I   ++    LL +R P ++    +M
Sbjct  174  QVARDGDDDDETDQQDDEDYEKRVMRPYLSEAWLI---KRPDSPLLNFRMPRVTAAADDM  230

Query  757  KDNLKFWAQTVASAVR  804
            K +L+FWA+TVAS ++
Sbjct  231  KKHLRFWAKTVASEIQ  246



>ref|XP_006480639.1| PREDICTED: uncharacterized protein LOC102612278 [Citrus sinensis]
Length=250

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 78/136 (57%), Gaps = 21/136 (15%)
 Frame = +1

Query  451  IKKRRVAR---KKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQR----  609
            +KKRR ++   +K    RSL ELE+EE+KGFMDLGF F +E  S  + S++PGLQR    
Sbjct  115  LKKRRYSKSLPQKSKSCRSLMELELEEVKGFMDLGFRFNKECLSPRMMSVLPGLQRVKLH  174

Query  610  ----------WGSRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNET-NM  756
                         + +    E  V RPYLSEAW I   ++    LL +R P ++    +M
Sbjct  175  QVARDGDDDDETDQQDDEDYEKRVMRPYLSEAWLI---KRPDSPLLNFRMPRVTAAADDM  231

Query  757  KDNLKFWAQTVASAVR  804
            K +L+FWA+TVAS ++
Sbjct  232  KKHLRFWAKTVASEIQ  247



>ref|XP_010253606.1| PREDICTED: uncharacterized protein LOC104594811 [Nelumbo nucifera]
Length=260

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 73/145 (50%), Gaps = 32/145 (22%)
 Frame = +1

Query  454  KKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDE--  627
            + RR+ +K     +SL ELE EE+KGFMDLGF F +E  +  + S+IPGLQR G  ++  
Sbjct  117  RSRRILQKTTSC-KSLWELEYEEVKGFMDLGFTFDKEYLTPRMMSVIPGLQRLGKYNDHE  175

Query  628  --------------------------VMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRF  729
                                          +  V+RPYLSEAW I   ++    LL  R 
Sbjct  176  DEGEDYRCGMEAAEKKKFKDDEEIEVEKEEKRGVRRPYLSEAWLI---KRPDSPLLNLRL  232

Query  730  PPLSNETNMKDNLKFWAQTVASAVR  804
            P  S    MK +L+FWA+TVAS VR
Sbjct  233  PRASATAEMKKHLRFWARTVASVVR  257



>ref|XP_007021600.1| Serine/arginine repetitive matrix protein 2, putative [Theobroma 
cacao]
 gb|EOY13125.1| Serine/arginine repetitive matrix protein 2, putative [Theobroma 
cacao]
Length=337

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 71/127 (56%), Gaps = 22/127 (17%)
 Frame = +1

Query  442  VCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSR  621
            V EI++    +K L   RSLS+L  EEL+GF DLGF F +ED S S+ +I+PGLQ     
Sbjct  226  VQEIRRPYTNQKTL--QRSLSDLAFEELQGFKDLGFTFDKEDLSPSVVNILPGLQENKIE  283

Query  622  DEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSN------ETNMKDNLKFWAQ  783
            D     +  V+RPYLSEAW           L + R PP+ N        +MK  +KFWA+
Sbjct  284  D---LKQDKVRRPYLSEAW-----------LAQSRGPPIPNCVSKDSADDMKAQIKFWAR  329

Query  784  TVASAVR  804
             VA+ VR
Sbjct  330  AVATNVR  336



>ref|XP_007149427.1| hypothetical protein PHAVU_005G069500g [Phaseolus vulgaris]
 gb|ESW21421.1| hypothetical protein PHAVU_005G069500g [Phaseolus vulgaris]
Length=317

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 80/125 (64%), Gaps = 14/125 (11%)
 Frame = +1

Query  433  TKKVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRW  612
            T+ + E+++R + +K +   RSLS+LE EE++GF DLGF F +E  S SLA+I+PGLQ  
Sbjct  201  TEGIMEMRRRYLNQKTM--RRSLSDLEYEEVQGFKDLGFSFEKETLSPSLANILPGLQE-  257

Query  613  GSRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNET--NMKDNLKFWAQT  786
              RDE   ++++ +RPYLSEAW +    +    +  W     SN++  +MK  +KFWA+ 
Sbjct  258  KKRDETEEDKAA-RRPYLSEAWLV----QSCAPIPNW----ASNKSAGDMKQQIKFWARA  308

Query  787  VASAV  801
            VAS V
Sbjct  309  VASNV  313



>ref|XP_009339321.1| PREDICTED: uncharacterized protein LOC103931537 [Pyrus x bretschneideri]
Length=324

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 71/119 (60%), Gaps = 14/119 (12%)
 Frame = +1

Query  460  RRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTN  639
            RR    +L   +SLS+LEIEEL+GF DLGF F +E+ S S+ +I+PGLQ   + +++  N
Sbjct  216  RRRCPNQLTTRKSLSDLEIEELQGFKDLGFTFDKEELSPSVVNILPGLQEKKTSEDL--N  273

Query  640  ESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNET----NMKDNLKFWAQTVASAVR  804
             + V+RPYLSE W        + +      PP    T    +MK  +KFWA++VAS VR
Sbjct  274  PAHVRRPYLSEVW--------LAQSCAAPPPPNLGATKSAEDMKAQIKFWARSVASNVR  324



>ref|XP_007213579.1| hypothetical protein PRUPE_ppa014990mg [Prunus persica]
 gb|EMJ14778.1| hypothetical protein PRUPE_ppa014990mg [Prunus persica]
Length=333

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 71/121 (59%), Gaps = 19/121 (16%)
 Frame = +1

Query  460  RRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTN  639
            RR +  +L   +SLS+LEIEEL+GF DLGF F +++ S S+ +I+PGLQ     +++  N
Sbjct  226  RRRSLNQLTTRKSLSDLEIEELQGFKDLGFTFDKKELSPSVVNILPGLQEKKRTEDL--N  283

Query  640  ESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSN------ETNMKDNLKFWAQTVASAV  801
               V+RPYLSEAW           L++   PP  N        +MK  +KFWA+ VAS V
Sbjct  284  PEKVRRPYLSEAW-----------LVQSCAPPPPNLGASRSAEDMKAQIKFWARAVASNV  332

Query  802  R  804
            R
Sbjct  333  R  333



>ref|XP_009784159.1| PREDICTED: uncharacterized protein LOC104232609 [Nicotiana sylvestris]
Length=256

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 71/145 (49%), Gaps = 45/145 (31%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGS---RDEVMTNESS-----  648
            +SL ELE+EE+KGFMDLGF+F +E  S  + ++IPGLQR       DE   NE S     
Sbjct  111  KSLGELELEEVKGFMDLGFIFRKEHISKRMINVIPGLQRLEEVMPEDEETNNEDSEEGQP  170

Query  649  ----------------------------------VQRPYLSEAWSIMDQRKMMKKLLKWR  726
                                              + RPYLSEAW I   +K    LL  R
Sbjct  171  GTLSFYYARGSEKGQTTRVNYTPPYAAEEEDKREIVRPYLSEAWLI---KKPDSPLLNMR  227

Query  727  FPPLSNETNMKDNLKFWAQTVASAV  801
             P +S  T+MK +L++WA+TVA+ V
Sbjct  228  VPRISAATDMKKHLRYWAKTVATVV  252



>gb|KHG27555.1| hypothetical protein F383_14062 [Gossypium arboreum]
Length=265

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 74/146 (51%), Gaps = 34/146 (23%)
 Frame = +1

Query  460  RRVARKKLGGH-------RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG-  615
            R    + LGG        +SL +LE+EE+KGFMDLGF+F +E   S +  ++PGL R G 
Sbjct  120  RHSTSRSLGGKLKKSTSCKSLEDLELEEVKGFMDLGFIFKKEHLDSRMIDVVPGLLRLGF  179

Query  616  -------SRDEVMTN----------------ESSVQRPYLSEAWSIMDQRKMMKKLLKWR  726
                     DE   +                ES V RPYLSEAW I   ++    LL  +
Sbjct  180  LKTQPNLPADEHEVSKDDDDDDDDDIEQEKQESGVIRPYLSEAWLI---KRPDSPLLNLK  236

Query  727  FPPLSNETNMKDNLKFWAQTVASAVR  804
             P +S   +MK +LK WA+TVAS V+
Sbjct  237  VPRVSAAADMKKHLKCWARTVASVVQ  262



>ref|XP_004517128.1| PREDICTED: uncharacterized protein LOC101512525 [Cicer arietinum]
Length=317

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 74/122 (61%), Gaps = 20/122 (16%)
 Frame = +1

Query  457  KRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMT  636
            KR+V  KK    RSLS+LE+EE++GF DLGF F +E  S SLA+IIPGLQ   +RDE   
Sbjct  205  KRKVLNKKTI-RRSLSDLELEEVQGFKDLGFSFEKEGLSPSLANIIPGLQE-KNRDESEE  262

Query  637  NESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSN--ETNM-----KDNLKFWAQTVAS  795
            ++++ + PYLSEAW +               PP+ N   TNM     K N+KFWA+ VAS
Sbjct  263  DKAA-RGPYLSEAWLVQS----------CCAPPVPNCGNTNMSKADIKKNIKFWARAVAS  311

Query  796  AV  801
             V
Sbjct  312  NV  313



>dbj|BAK07204.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=262

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 69/120 (58%), Gaps = 22/120 (18%)
 Frame = +1

Query  505  ELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG-------------------SRDE  627
            ELE EE+KG  DLGF F+E +  + LASI+PGL+R                     +R  
Sbjct  145  ELEFEEVKGLQDLGFTFSETEVDAELASIVPGLRRLRAEEEAKRAKAEAEEEACRRNRAA  204

Query  628  VMTNESSVQRPYLSEAWSIMDQRKMMKKLL-KWRFPPLSNETNMKDNLKFWAQTVASAVR  804
               + ++ +RPYLSEAW   D+   ++++L  +R P  ++  ++K+NL+ WA TVASAVR
Sbjct  205  AEASHAAPRRPYLSEAWE--DEEAEVRRMLSNFRIPAAADGADLKENLRLWAHTVASAVR  262



>emb|CBI20241.3| unnamed protein product [Vitis vinifera]
Length=184

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 90/195 (46%), Gaps = 40/195 (21%)
 Frame = +1

Query  268  GVLSLKVRSQSDNLLSFGTSFSPP--------SDSLKSGIIKPELEDLQaaataaaaata  423
            G++  K R    + L+  TS SPP        S  L      P    L+           
Sbjct  9    GLIQYKERDPRSSKLTRTTSLSPPDILPRQHTSKGLAQNYGTPRHRLLRKQEEGT-----  63

Query  424  LLITKKVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGL  603
              ++  V +  +RR   +     +SLS+LE EE++GF DLGF F +ED S S+ +I+PGL
Sbjct  64   --MSMNVAKEMRRRYLNQTNVIRKSLSDLEYEEVQGFKDLGFTFEKEDLSPSVVNILPGL  121

Query  604  Q---RWGSRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSN------ETNM  756
            Q   R G        E SV+RPYLSEAW           + +   PP+ N        +M
Sbjct  122  QVKDRGGP-----VEEDSVRRPYLSEAW-----------IEQCSAPPIPNWVGKSSAQDM  165

Query  757  KDNLKFWAQTVASAV  801
            K  +KFWA+ VAS V
Sbjct  166  KAQIKFWARAVASNV  180



>ref|XP_004493960.1| PREDICTED: uncharacterized protein LOC101490574 [Cicer arietinum]
Length=268

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 71/125 (57%), Gaps = 24/125 (19%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG--------SRDEVMTN---  639
            R+L ELE++E+KGFMDLGF F +E     + S++PGLQR+         S+ ++M +   
Sbjct  145  RTLGELELDEVKGFMDLGFTFNKECIDQKMISVVPGLQRFCLLQNKQHYSQSQIMASTKE  204

Query  640  ----------ESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTV  789
                      +  + RPYLSEAW I   ++    LL  + P   + +NMK +++FWA+ V
Sbjct  205  NDEIIEVCEEKRDIMRPYLSEAWLI---KRPDSPLLNMKIPKSCSASNMKKHIRFWAKIV  261

Query  790  ASAVR  804
            AS ++
Sbjct  262  ASEIQ  266



>ref|XP_010675463.1| PREDICTED: uncharacterized protein LOC104891465 [Beta vulgaris 
subsp. vulgaris]
Length=327

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 77/130 (59%), Gaps = 13/130 (10%)
 Frame = +1

Query  436  KKVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVF-TEEDKSSSLASIIPGLQRW  612
            +++ E K +++ + K    +SL++LE+EEL+GF DLGF F  ++D S  +  I+P LQR 
Sbjct  201  EQITETKPQKLDKSK--SQKSLTDLEVEELQGFKDLGFSFDNKDDLSPGVTQILPALQRR  258

Query  613  GSRD-EVMTNESSVQRPYLSEAWSIMDQRKMMKKL-----LKWRFPPLSNETNMKDNLKF  774
             S D   + N   V+RPYLSE+W    Q+K    +     LKW     S+  +MK  +KF
Sbjct  259  ASLDSNNVDNIGKVRRPYLSESW----QQKTSSPISAPPALKWDDQKASSSEDMKAQIKF  314

Query  775  WAQTVASAVR  804
            WA+ VAS VR
Sbjct  315  WARAVASNVR  324



>ref|XP_004965581.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Setaria 
italica]
Length=264

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 70/128 (55%), Gaps = 26/128 (20%)
 Frame = +1

Query  496  SLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDE----------------  627
            S+SELE EE+KG  DLGF F++ +  + LASI+PGL+R  S +E                
Sbjct  138  SMSELEFEEVKGLQDLGFTFSDAEVDAELASIVPGLRRKRSEEENSRATASAPAAPRAAA  197

Query  628  ---------VMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWA  780
                           + +RPYLSEAW   ++ ++ + L  WR PP  N  ++K++L+ WA
Sbjct  198  SSSALREEEATAAAPAPRRPYLSEAWDD-EEEEVRRALRNWRIPPPGNGNDLKEHLRMWA  256

Query  781  QTVASAVR  804
             TVASAVR
Sbjct  257  HTVASAVR  264



>ref|XP_008363621.1| PREDICTED: uncharacterized protein LOC103427337 [Malus domestica]
Length=320

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 70/119 (59%), Gaps = 14/119 (12%)
 Frame = +1

Query  460  RRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTN  639
            RR    +L   +SLS+LEIEEL+GF DLGF F +E+ + S+ +I+PGLQ     +++  N
Sbjct  212  RRRCPNQLTTRKSLSDLEIEELQGFKDLGFTFXKEELTPSVVNILPGLQDKKRSEDL--N  269

Query  640  ESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNET----NMKDNLKFWAQTVASAVR  804
             + V+RPYLSE W        + +      PP    T    +MK  +KFWA++VAS VR
Sbjct  270  PAHVRRPYLSEVW--------LAQSCAAPPPPNLGATQSAEDMKAQIKFWARSVASNVR  320



>ref|XP_003541833.1| PREDICTED: uncharacterized protein LOC100803315 [Glycine max]
 gb|KHN36857.1| hypothetical protein glysoja_001588 [Glycine soja]
Length=334

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 75/120 (63%), Gaps = 9/120 (8%)
 Frame = +1

Query  442  VCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSR  621
            + E+++R + +K +   RSLS+LE EE++GF DLGF F +E  S SLASI+PGLQ    R
Sbjct  220  IMEMRRRYLNQKTM--RRSLSDLEFEEVQGFKDLGFSFEKETLSPSLASILPGLQE-KKR  276

Query  622  DEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAV  801
            DE   ++++ +RPYLSEAW +   +     +  W      +  +MK  +KFWA+ VAS V
Sbjct  277  DETEEDKAA-RRPYLSEAWLV---QSCAPAIPNWTS--HKSSGDMKVQIKFWARAVASNV  330



>ref|XP_010279224.1| PREDICTED: uncharacterized protein LOC104613196 [Nelumbo nucifera]
Length=282

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 70/124 (56%), Gaps = 20/124 (16%)
 Frame = +1

Query  448  EIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGL-----QRW  612
            +I KR   RK     +SLS+LE EEL+GF DLGF F +ED S ++ +IIP L     Q W
Sbjct  171  KIPKRLTHRK---SRKSLSDLEFEELQGFKDLGFTFNKEDLSPTVVNIIPALKEKTQQNW  227

Query  613  GSRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVA  792
               DE    ++ V+RPYLSEAW +      M   +        +  +MK +LKFWA+ VA
Sbjct  228  ---DE----DNKVRRPYLSEAWLVQRSASPMPNWVH-----SESAGDMKAHLKFWARVVA  275

Query  793  SAVR  804
            S VR
Sbjct  276  SNVR  279



>ref|XP_010098450.1| hypothetical protein L484_012165 [Morus notabilis]
 gb|EXB75041.1| hypothetical protein L484_012165 [Morus notabilis]
Length=353

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 73/126 (58%), Gaps = 23/126 (18%)
 Frame = +1

Query  448  EIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEED-KSSSLASIIPGLQRWGSRD  624
            E+++R    + LG  RSLSELEIEE++GF DLGF F  +D  S ++ +I+PGLQ    ++
Sbjct  241  EMRRRYFKGRNLG--RSLSELEIEEVQGFKDLGFKFDNKDLLSPNVVNILPGLQE--RKE  296

Query  625  EVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSN------ETNMKDNLKFWAQT  786
            E M  ++ V+RPYLSEAW            +    PP  N         MK  +KFWA++
Sbjct  297  EDMGLQNKVRRPYLSEAW------------MAQSAPPTPNWAASRSSQEMKAQIKFWARS  344

Query  787  VASAVR  804
            VAS VR
Sbjct  345  VASNVR  350



>ref|XP_007205680.1| hypothetical protein PRUPE_ppa009620mg [Prunus persica]
 gb|EMJ06879.1| hypothetical protein PRUPE_ppa009620mg [Prunus persica]
Length=285

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 63/112 (56%), Gaps = 11/112 (10%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASI--------IPGLQRWGSRDEVMTNESS  648
            RSL ELE+EE+KGFMDLGF F  E  S  + S+           ++    +DE    E  
Sbjct  174  RSLGELELEEVKGFMDLGFTFKREHLSPRMMSLKLQNGEDDDDSVEVAAEKDEDGEGEVE  233

Query  649  VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            V RPYLSEAW I   ++    LL  R P +S   +MK +LK+WA+TVAS + 
Sbjct  234  VTRPYLSEAWLI---KRPDSPLLNLRLPRVSAAADMKKHLKYWARTVASEIH  282



>gb|KCW74143.1| hypothetical protein EUGRSUZ_E02775 [Eucalyptus grandis]
Length=219

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 79/226 (35%), Positives = 103/226 (46%), Gaps = 49/226 (22%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGV---------L  276
            M  AE ++K+ D CWF+ EI  ++  P    T     D  +K  +    V          
Sbjct  1    MEEAEAVMKIIDRCWFELEIFKKR--PDASPTSAFGSDPDQKSIEIPEKVSPCLHISRTP  58

Query  277  SLKVRSQSDNLLSFGTSF-----SPPS----DSLKSGIIKPELEDLQaaataaaaataLL  429
            S+ VRS SD      +SF     SP S      + SGI + E+   +             
Sbjct  59   SILVRSMSDQTSIIPSSFQSSPLSPDSVLHMTPIHSGIYEEEVITEEEKEGFDWNNPR--  116

Query  430  ITKKVCEIKK----RRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDK-SSSLASII  594
             + K    KK     R  R+ L   +SLSELE EELKGFMDLGFVF+EED+  SSL SII
Sbjct  117  -SSKFSRRKKGQMGERAKRRALS--KSLSELEFEELKGFMDLGFVFSEEDRVDSSLVSII  173

Query  595  PGLQRWGSR-------------------DEVMTNESSVQRPYLSEA  675
            PGLQR G +                   ++ +  E +V RPYLSEA
Sbjct  174  PGLQRLGKKIKDGDEDDEDGDHHREDGDEKEIVGEPAVARPYLSEA  219



>ref|XP_011077361.1| PREDICTED: uncharacterized protein LOC105161392 [Sesamum indicum]
Length=248

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 71/135 (53%), Gaps = 38/135 (28%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQR---------------WG----  615
            +SL+ELE+EE+KGFMDLGF F +E+ S  + +++PGLQR               W     
Sbjct  118  KSLAELELEEVKGFMDLGFTFKKENMSQRVMNLVPGLQRIESCNKTSKDKDDSSWDGFGF  177

Query  616  SRDEVMTNESS--------VQRPYLSEAWSIMDQRKMMKK----LLKWRFPPLSNETNMK  759
            + D+   N           + RPYLSEAW       +MK     LL  R P +S   +MK
Sbjct  178  THDDHTDNNVEEKNETMMMMMRPYLSEAW-------LMKTPDSPLLNLRIPRVSTTEDMK  230

Query  760  DNLKFWAQTVASAVR  804
             +LK WA+TVASA+ 
Sbjct  231  KHLKDWARTVASAIH  245



>ref|XP_010040037.1| PREDICTED: uncharacterized protein LOC104428800 [Eucalyptus grandis]
Length=225

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 116/248 (47%), Gaps = 47/248 (19%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYK-------KESKTMM--GVL  276
            M  AE ++K+ D CWF+ EI   K+ P +  +     +  +       KES  +      
Sbjct  1    MEEAEAVMKIIDRCWFELEIF--KKGPDISPSSTSRSNPGQESIEIPEKESSCLQISRTP  58

Query  277  SLKVRSQSDNLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIK  456
            S+ VRS SD      TS    + SL    + P ++ + +        T      K   ++
Sbjct  59   SILVRSVSDQTSIIPTSLQ--ASSLSPDSVLP-MKPIHSMIYEEEVITEEEEGFKWNNLR  115

Query  457  KRRVARKK---LGGH-------RSLSELEIEELKGFMDLGFVFTEEDK-SSSLASIIPGL  603
                + +K   +GG        +SLSELE+EELKGF+DLGFVF EED+  SSL SIIPGL
Sbjct  116  SSEFSHRKKGQMGGRAKRRTLTKSLSELEVEELKGFVDLGFVFLEEDRVDSSLVSIIPGL  175

Query  604  QRWGS--RDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFW  777
            QR G+  +D    +E + +   +S     M                    T+MK++LK+W
Sbjct  176  QRLGNKIKDGEEDDEDAGESVVVSVGGVGM--------------------TDMKESLKWW  215

Query  778  AQTVASAV  801
            A TVAS V
Sbjct  216  AHTVASTV  223



>emb|CBI32707.3| unnamed protein product [Vitis vinifera]
Length=267

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 74/163 (45%), Gaps = 40/163 (25%)
 Frame = +1

Query  427  LITKKVCEIKKRRVARKKLGGHR---------------SLSELEIEELKGFMDLGFVFTE  561
            L+T+K          +K+   HR               SL ELE+EE+KGFMDLGF F  
Sbjct  105  LMTRKTRSFSSSPATKKRAKNHRYLGAVTSLPKTMSCKSLRELELEEVKGFMDLGFKFKR  164

Query  562  EDKSSSLASIIPGLQRWGSRDEVMTNESS----------------------VQRPYLSEA  675
            E  S  + ++IPGLQR G  +     E S                      V RPYLSEA
Sbjct  165  EHLSPRMITVIPGLQRLGGYNNEQETELSDSTQSANYKDDKIEEEEEEERAVVRPYLSEA  224

Query  676  WSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            W I   ++    LL  + P +S   +MK +L  WA+TVA  ++
Sbjct  225  WLI---KRPDSPLLNLKMPRVSASADMKKHLWHWARTVAYVIQ  264



>emb|CAN63558.1| hypothetical protein VITISV_034122 [Vitis vinifera]
Length=399

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 64/112 (57%), Gaps = 25/112 (22%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQ---RWGSRDEVMTNESSVQRPY  663
            +SLS+LE EE++GF DLGF F +ED S S+ +I+PGLQ   R G        E SV+RPY
Sbjct  300  KSLSDLEYEEVQGFKDLGFTFEKEDLSPSVVNILPGLQVKDRGGP-----VEEDSVRRPY  354

Query  664  LSEAWSIMDQRKMMKKLLKWRFPPLSN------ETNMKDNLKFWAQTVASAV  801
            LSEAW           + +   PP+ N        +MK  +KFWA+ VAS V
Sbjct  355  LSEAW-----------IEQCSAPPIPNWVGKSSAQDMKAQIKFWARAVASNV  395



>ref|XP_002285236.1| PREDICTED: uncharacterized protein LOC100257151 [Vitis vinifera]
Length=399

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 64/112 (57%), Gaps = 25/112 (22%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQ---RWGSRDEVMTNESSVQRPY  663
            +SLS+LE EE++GF DLGF F +ED S S+ +I+PGLQ   R G        E SV+RPY
Sbjct  300  KSLSDLEYEEVQGFKDLGFTFEKEDLSPSVVNILPGLQVKDRGGP-----VEEDSVRRPY  354

Query  664  LSEAWSIMDQRKMMKKLLKWRFPPLSN------ETNMKDNLKFWAQTVASAV  801
            LSEAW           + +   PP+ N        +MK  +KFWA+ VAS V
Sbjct  355  LSEAW-----------IEQCSAPPIPNWVGKSSAQDMKAQIKFWARAVASNV  395



>ref|XP_010059036.1| PREDICTED: uncharacterized protein LOC104446944 [Eucalyptus grandis]
Length=133

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 60/104 (58%), Gaps = 21/104 (20%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDK-SSSLASIIPGLQRWGSRDEVMT-----------  636
            +SLSE E +ELKGFMDLGFVF+ EDK +SSL SIIPGLQR G + +              
Sbjct  26   KSLSEPEFKELKGFMDLGFVFSGEDKVNSSLVSIIPGLQRLGKKIKDGDEDDEDSDNHRE  85

Query  637  --NESS-------VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLS  741
              NE +       V RPYLSEAW   ++++    L+ W+ P L 
Sbjct  86   DGNEKASIGEPAVVGRPYLSEAWEWWEEKRKEDPLMNWKIPALG  129



>ref|XP_009601138.1| PREDICTED: uncharacterized protein LOC104096470 isoform X1 [Nicotiana 
tomentosiformis]
Length=274

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 76/164 (46%), Gaps = 53/164 (32%)
 Frame = +1

Query  457  KRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG---SRDE  627
            +RRV  K +   +SL ELE+EE+KGF+DLGF+F +E  S  + S+IPGLQR     S DE
Sbjct  111  ERRVLEKHMSC-KSLGELELEEVKGFVDLGFIFRKEHISKRMISVIPGLQRLEVVVSEDE  169

Query  628  VMTNESS----------------------------------------------VQRPYLS  669
               NE S                                              + RPYLS
Sbjct  170  ETNNEDSEEEEGQPGTPSSRYAWGPGNGRTTRIYCAQPYATEEEEEEEEDKREIVRPYLS  229

Query  670  EAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAV  801
            EAW I   +K    LL  R P +S   +MK +L+ WA+TVA+ V
Sbjct  230  EAWLI---KKPDSPLLNLRVPRISAAADMKKHLRCWAKTVATVV  270



>ref|XP_010916029.1| PREDICTED: uncharacterized protein LOC105040958 isoform X2 [Elaeis 
guineensis]
Length=250

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 64/105 (61%), Gaps = 9/105 (9%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSS-SLASIIPGLQRWGSRDEVMTNESSVQRPYLS  669
            +SLS+LE  E++GF DLGFVF EE  SS SLA++IPGL+    +      +  V+RPYLS
Sbjct  151  KSLSDLEFIEVQGFKDLGFVFDEEGTSSASLANVIPGLR---DKKAGELGDDKVRRPYLS  207

Query  670  EAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            EAW +      M K +  R     +  +MK+ LKFWA+ VA  VR
Sbjct  208  EAWFVQRSAPPMIKWVDKR-----SAADMKEQLKFWARAVACNVR  247



>ref|XP_010653545.1| PREDICTED: uncharacterized protein LOC100854914 [Vitis vinifera]
Length=242

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 65/126 (52%), Gaps = 25/126 (20%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESS--------  648
            +SL ELE+EE+KGFMDLGF F  E  S  + ++IPGLQR G  +     E S        
Sbjct  117  KSLRELELEEVKGFMDLGFKFKREHLSPRMITVIPGLQRLGGYNNEQETELSDSTQSANY  176

Query  649  --------------VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQT  786
                          V RPYLSEAW I   ++    LL  + P +S   +MK +L  WA+T
Sbjct  177  KDDKIEEEEEEERAVVRPYLSEAWLI---KRPDSPLLNLKMPRVSASADMKKHLWHWART  233

Query  787  VASAVR  804
            VA  ++
Sbjct  234  VAYVIQ  239



>ref|XP_009601139.1| PREDICTED: uncharacterized protein LOC104096470 isoform X2 [Nicotiana 
tomentosiformis]
Length=269

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 80/172 (47%), Gaps = 55/172 (32%)
 Frame = +1

Query  433  TKKVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRW  612
            ++ +C   +RRV  K +   +SL ELE+EE+KGF+DLGF+F +E  S  + S+IPGLQR 
Sbjct  100  SRNLC--SERRVLEKHMSC-KSLGELELEEVKGFVDLGFIFRKEHISKRMISVIPGLQRL  156

Query  613  G---SRDEVMTNESS---------------------------------------------  648
                S DE   NE S                                             
Sbjct  157  EVVVSEDEETNNEDSEEEEGQPGTPSSRYAWGPGNGRTTRIYCAQPYATEEEEEEEEDKR  216

Query  649  -VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAV  801
             + RPYLSEAW I   +K    LL  R P +S   +MK +L+ WA+TVA+ V
Sbjct  217  EIVRPYLSEAWLI---KKPDSPLLNLRVPRISAAADMKKHLRCWAKTVATVV  265



>ref|XP_010916028.1| PREDICTED: uncharacterized protein LOC105040958 isoform X1 [Elaeis 
guineensis]
Length=276

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 64/105 (61%), Gaps = 9/105 (9%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSS-SLASIIPGLQRWGSRDEVMTNESSVQRPYLS  669
            +SLS+LE  E++GF DLGFVF EE  SS SLA++IPGL+    +      +  V+RPYLS
Sbjct  177  KSLSDLEFIEVQGFKDLGFVFDEEGTSSASLANVIPGLR---DKKAGELGDDKVRRPYLS  233

Query  670  EAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            EAW +      M K +  R     +  +MK+ LKFWA+ VA  VR
Sbjct  234  EAWFVQRSAPPMIKWVDKR-----SAADMKEQLKFWARAVACNVR  273



>ref|XP_008442668.1| PREDICTED: late secretory pathway protein AVL9-like [Cucumis 
melo]
Length=248

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 70/139 (50%), Gaps = 29/139 (21%)
 Frame = +1

Query  466  VARK--KLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTN  639
            V RK  K    +SL ELE+EE+KGFMDLGF F  E  S  +  ++PGLQR  ++      
Sbjct  113  VGRKLNKSTSCKSLGELELEEVKGFMDLGFEFKRESLSPQMVKLVPGLQRLRTQTNKQNL  172

Query  640  ESS------------------------VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNE  747
            E                          + RPYLSEAW I   R+    LL  R P +S+ 
Sbjct  173  EEDDDGDGDDHQENDDDDDDDDDKKREIARPYLSEAWII---RRPNSPLLNLRMPKVSST  229

Query  748  TNMKDNLKFWAQTVASAVR  804
            ++MK +L+ WA+TVA  ++
Sbjct  230  SDMKKHLRSWAKTVAFEIQ  248



>gb|KEH38674.1| hypothetical protein MTR_2g078620 [Medicago truncatula]
Length=322

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 63/107 (59%), Gaps = 18/107 (17%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            RSLS+LE EE++GF DLGF F +E  S SLA+IIPGLQ   +RDE    + + + PYLSE
Sbjct  225  RSLSDLEYEEVQGFKDLGFSFEKEALSPSLANIIPGLQE-KNRDES-EEDKAARGPYLSE  282

Query  673  AWSIMDQRKMMKKLLKWRFPPLSNETN------MKDNLKFWAQTVAS  795
            AW +               PP+ N  N      MK ++KFWA+ VAS
Sbjct  283  AWLVQS----------CATPPVPNWGNKMSADDMKKHIKFWARAVAS  319



>gb|KCW74141.1| hypothetical protein EUGRSUZ_E02773 [Eucalyptus grandis]
Length=220

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 102/224 (46%), Gaps = 39/224 (17%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGV---------L  276
            M  AE ++K+   CWF+ EI  ++  P    +     D  +K  +    V          
Sbjct  1    MEEAEAVMKIIARCWFELEIFKKR--PDASPSSAFGSDPDQKSIEIPEKVSPCLHISRTP  58

Query  277  SLKVRSQSDNLLSFGTSF-----SPPS----DSLKSGIIKPELEDLQaaataaaaataLL  429
            S+ VRS SD      +SF     SP S      + SGI + E+   +             
Sbjct  59   SILVRSMSDQTSIIPSSFQSSPLSPDSVLHMTPIHSGIYEEEVITEEEKEGFDWNNPR--  116

Query  430  ITKKVCEIKK----RRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDK-SSSLASII  594
             + K    KK     R  R+ L   +SLSELE EELKGFMDLGFVF+EED+  SSL SII
Sbjct  117  -SSKFSRRKKGQMGERAKRRALS--KSLSELEFEELKGFMDLGFVFSEEDRVDSSLVSII  173

Query  595  PGLQRWGSR---------DEVMTNESSVQRPYLSEAWSIMDQRK  699
            PGLQR G +         D     E  V RPYLSE   +  +RK
Sbjct  174  PGLQRLGKKIKDGDEDDEDGDHHREDVVARPYLSERGMVGGERK  217



>ref|XP_004137815.1| PREDICTED: uncharacterized protein LOC101215662 [Cucumis sativus]
Length=247

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 73/141 (52%), Gaps = 28/141 (20%)
 Frame = +1

Query  457  KRRVARK--KLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSR---  621
            K  V RK  K    +SL ELE+EE+KGFMDLGF F  E  S  +  ++PGLQR  ++   
Sbjct  110  KFSVGRKLNKSTSCKSLGELELEEVKGFMDLGFEFKRESLSPQMVKLVPGLQRLRTQINK  169

Query  622  --------------------DEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLS  741
                                D+    +  + RPYLSEAW I   R+    LL  R P +S
Sbjct  170  QNLEDDEDGDGDHDKENDDDDDDKNKKREIARPYLSEAWII---RRPNSPLLDLRMPKVS  226

Query  742  NETNMKDNLKFWAQTVASAVR  804
            + ++MK +L+ WA+TVA  ++
Sbjct  227  STSDMKKHLRSWAKTVAFEIQ  247



>ref|XP_004165143.1| PREDICTED: uncharacterized LOC101215662 [Cucumis sativus]
Length=274

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 73/141 (52%), Gaps = 28/141 (20%)
 Frame = +1

Query  457  KRRVARK--KLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSR---  621
            K  V RK  K    +SL ELE+EE+KGFMDLGF F  E  S  +  ++PGLQR  ++   
Sbjct  137  KFSVGRKLNKSTSCKSLGELELEEVKGFMDLGFEFKRESLSPQMVKLVPGLQRLRTQINK  196

Query  622  --------------------DEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLS  741
                                D+    +  + RPYLSEAW I   R+    LL  R P +S
Sbjct  197  QNLEDDEDGDGDHDKENDDDDDDKNKKREIARPYLSEAWII---RRPNSPLLDLRMPKVS  253

Query  742  NETNMKDNLKFWAQTVASAVR  804
            + ++MK +L+ WA+TVA  ++
Sbjct  254  STSDMKKHLRSWAKTVAFEIQ  274



>ref|XP_008783125.1| PREDICTED: uncharacterized protein LOC103702463 [Phoenix dactylifera]
Length=265

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 64/103 (62%), Gaps = 9/103 (9%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            +SLS+LE  E++GF DLGFVF E+  S+SLA++IPGL+  G +      +  V+RPYLSE
Sbjct  168  KSLSDLEFIEVQGFKDLGFVFDEQGSSASLANVIPGLR--GRK--AGEGDDKVRRPYLSE  223

Query  673  AWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAV  801
            AW +      M + +  R     +  ++K+ L+FWA+ VA  V
Sbjct  224  AWFVQGSAPPMIQWVDKR-----SAADIKEQLRFWARAVACNV  261



>ref|XP_007212450.1| hypothetical protein PRUPE_ppa017283mg, partial [Prunus persica]
 gb|EMJ13649.1| hypothetical protein PRUPE_ppa017283mg, partial [Prunus persica]
Length=203

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 60/103 (58%), Gaps = 18/103 (17%)
 Frame = +1

Query  433  TKKVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRW  612
            TK+V    +R  +R+++G  +SLS+LE +ELKGFMDLGF        S L SIIPGLQR 
Sbjct  62   TKRVHGHGERNRSRRRVGPSKSLSDLEFDELKGFMDLGF-------DSKLVSIIPGLQRL  114

Query  613  GSRDEVMTNESSVQR----------PYLSEAWSIMDQRKMMKK  711
            GS  E   +E   QR           +LSEAW  +DQR + KK
Sbjct  115  GSIGEQDRDEED-QRNNNNNNIDPSSHLSEAWDALDQRNLKKK  156



>ref|XP_010059033.1| PREDICTED: uncharacterized protein LOC104446941 [Eucalyptus grandis]
Length=231

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 104/235 (44%), Gaps = 50/235 (21%)
 Frame = +1

Query  124  MVAAEEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGV---------L  276
            M  AE ++K+   CWF+ EI  ++  P    +     D  +K  +    V          
Sbjct  1    MEEAEAVMKIIARCWFELEIFKKR--PDASPSSAFGSDPDQKSIEIPEKVSPCLHISRTP  58

Query  277  SLKVRSQSDNLLSFGTSF-----SPPS----DSLKSGIIKPELEDLQaaataaaaataLL  429
            S+ VRS SD      +SF     SP S      + SGI + E+   +             
Sbjct  59   SILVRSMSDQTSIIPSSFQSSPLSPDSVLHMTPIHSGIYEEEVITEEEKEGFDWNNPR--  116

Query  430  ITKKVCEIKK----RRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDK-SSSLASII  594
             + K    KK     R  R+ L   +SLSELE EELKGFMDLGFVF+EED+  SSL SII
Sbjct  117  -SSKFSRRKKGQMGERAKRRALS--KSLSELEFEELKGFMDLGFVFSEEDRVDSSLVSII  173

Query  595  PGLQRWGSR--------------------DEVMTNESSVQRPYLSEAWSIMDQRK  699
            PGLQR G +                     E++   + V RPYLSE   +  +RK
Sbjct  174  PGLQRLGKKIKDGDEDDEDGDHHREDGDEKEIVGEPAVVARPYLSERGMVGGERK  228



>ref|XP_009385553.1| PREDICTED: uncharacterized protein LOC103972892 [Musa acuminata 
subsp. malaccensis]
Length=238

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 66/109 (61%), Gaps = 11/109 (10%)
 Frame = +1

Query  499  LSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG--SRDEVMTN-----ESSVQR  657
            ++ELE  E+KGFMDLGFVF +E+ S  + +IIPGLQR G   RD+  +      +  V+R
Sbjct  127  VTELENYEVKGFMDLGFVFRKEELSMEIMNIIPGLQRLGKEGRDDEASREEKEEDEGVER  186

Query  658  PYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            PYLSEAW   D   ++   L+ R P      +MK  L+FWA+ VAS + 
Sbjct  187  PYLSEAWMRHDL-SVVSPSLQPRSP---YGADMKRQLRFWAREVASVIH  231



>ref|XP_006451767.1| hypothetical protein CICLE_v10010201mg [Citrus clementina]
 ref|XP_006464821.1| PREDICTED: uncharacterized protein LOC102621220 [Citrus sinensis]
 gb|ESR65007.1| hypothetical protein CICLE_v10010201mg [Citrus clementina]
 gb|KDO58529.1| hypothetical protein CISIN_1g018815mg [Citrus sinensis]
Length=350

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 75/124 (60%), Gaps = 4/124 (3%)
 Frame = +1

Query  433  TKKVCEIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRW  612
            T  + E+ +R    +K+   +SL++LE EE++GF DLGF F ++D S ++ +I+PGLQ  
Sbjct  228  TNGIKEMSRRYHNHQKMI-RKSLNDLETEEVQGFKDLGFTFEKKDLSPNVVNILPGLQE-  285

Query  613  GSRDEVMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVA  792
              ++++   +  ++RPYLSEAW +         +      P ++  +MK+ LKFWA+ VA
Sbjct  286  KKQEKLSQMDYKMRRPYLSEAWVVQSCAPPAAPVPNCV--PKNSTEDMKEQLKFWARAVA  343

Query  793  SAVR  804
            S VR
Sbjct  344  SNVR  347



>ref|XP_009404523.1| PREDICTED: forkhead box protein G1-like [Musa acuminata subsp. 
malaccensis]
Length=272

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 63/113 (56%), Gaps = 10/113 (9%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG-SRDEVMTNE--------S  645
            +SL++LE EELKG +DLGF F++ +    L  I+P LQR G  R+     E        +
Sbjct  161  KSLTDLEFEELKGLVDLGFTFSDAETDPRLLEIVPALQRLGLGRNRASEEEAPPAAPVDA  220

Query  646  SVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            +V RPYLSEAW + +  K  ++LL    P      ++K  L+ WA  VAS VR
Sbjct  221  AVSRPYLSEAWEVAEA-KPEERLLMNLIPAGVAGADLKGQLRSWAHAVASTVR  272



>ref|XP_009341291.1| PREDICTED: uncharacterized protein LOC103933323 [Pyrus x bretschneideri]
Length=324

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 67/114 (59%), Gaps = 14/114 (12%)
 Frame = +1

Query  475  KKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQ  654
             +L   +SLS+LEIEEL+GF DLGF F  ++ S ++ +I+PGLQ     +++  N   V+
Sbjct  221  NQLTTRKSLSDLEIEELQGFKDLGFTFDTKELSPNVVNILPGLQEKKRSEDL--NLIHVR  278

Query  655  RPYLSEAWSIMDQRKMMKKLLKWRFPPLSNET----NMKDNLKFWAQTVASAVR  804
            RPYLSE W        + +      PP+   T    ++K  +KFWA++VAS VR
Sbjct  279  RPYLSEVW--------LAQSCAAPPPPILGATRSTEDIKAQIKFWARSVASNVR  324



>ref|XP_010696407.1| PREDICTED: uncharacterized protein LOC104908935 [Beta vulgaris 
subsp. vulgaris]
Length=276

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 63/117 (54%), Gaps = 17/117 (15%)
 Frame = +1

Query  496  SLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNES----------  645
            +L +LE EELKGFMDLGF F E+  S    +++PGLQR G       NE+          
Sbjct  160  TLHDLEQEELKGFMDLGFEFEEDQLSPRTMTVVPGLQRIGGNVVTTKNENYGASTLDDKE  219

Query  646  ----SVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
                   +PYLSEAW +   ++    LL+ R   +S   +MK  LK WA+TV ++++
Sbjct  220  VESDEKTKPYLSEAWLV---KRPDSPLLRLRMARVSTAEDMKKCLKLWARTVTTSMQ  273



>ref|XP_009390733.1| PREDICTED: uncharacterized protein LOC103977053 [Musa acuminata 
subsp. malaccensis]
Length=320

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 60/100 (60%), Gaps = 8/100 (8%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            RS S+LE  E++GF DLGFVF +E  ++ LA +IPGL+   + D+       V RPYLSE
Sbjct  222  RSYSDLESFEIQGFKDLGFVFDKEASNAGLADVIPGLRERRNSDD---GHGRVPRPYLSE  278

Query  673  AWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVA  792
            AW +    +     L+W      + T+MK+ L+FWA+ VA
Sbjct  279  AWFV---ERSAPPRLEW--AEKRSATDMKEQLRFWARAVA  313



>ref|XP_002523267.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39106.1| conserved hypothetical protein [Ricinus communis]
Length=342

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 62/104 (60%), Gaps = 6/104 (6%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            +S S+LE +E++GF DLGF F ++D   S+  I+PGLQ+   R +    +  V+RPYLSE
Sbjct  245  KSQSDLESQEVQGFKDLGFTFNKQDLDPSVVGILPGLQQDNKRQD-QDQKDEVKRPYLSE  303

Query  673  AWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            AW +   +     +  W     ++  +MK  LK+WA+ VAS VR
Sbjct  304  AWHV---QSCAPPIPLWAT--KNSAEDMKVQLKYWARAVASNVR  342



>ref|XP_011082714.1| PREDICTED: uncharacterized protein LOC105165412 [Sesamum indicum]
Length=315

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 64/109 (59%), Gaps = 9/109 (8%)
 Frame = +1

Query  478  KLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQR  657
            +L   +SLS LE +EL+GF DLGF F ++D + ++ SIIPGLQ     ++    E +  R
Sbjct  216  RLKPQKSLSYLESKELQGFRDLGFDFDKKDLNPNVVSIIPGLQEKKRIED--DEEKNRTR  273

Query  658  PYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            PYLSEAW   +   M  K    R    S E N+K  +KFWA+ VAS VR
Sbjct  274  PYLSEAW---NSAPMAPKWGGKR----SKEDNIKAQIKFWARAVASNVR  315



>ref|XP_010264742.1| PREDICTED: uncharacterized protein LOC104602661 [Nelumbo nucifera]
Length=273

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 74/157 (47%), Gaps = 43/157 (27%)
 Frame = +1

Query  454  KKRRVARKKLGGH-----------RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPG  600
            KKRR  ++  GG            +SL ELE EE+KGFMDLGF F +   S  + S+IPG
Sbjct  117  KKRRKHQRYTGGDPSRRIQKTMSCKSLWELEYEEVKGFMDLGFRFDKMYLSPRMMSVIPG  176

Query  601  LQRWG--------------SRDEVMTNESSVQ---------------RPYLSEAWSIMDQ  693
            LQR G               R ++ T +   +               RPYLSEAW I   
Sbjct  177  LQRLGQYQDDDDDDAEEQEDRCDMKTGKEEDKDEEVEEEKQEERVVIRPYLSEAWLI---  233

Query  694  RKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            ++    LL  R P  S   +MK +L+ WA+T+A  ++
Sbjct  234  KRPDSPLLNLRIPRASATADMKKHLRSWARTIAYVIQ  270



>ref|XP_004159879.1| PREDICTED: uncharacterized protein LOC101225687 [Cucumis sativus]
Length=443

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 61/103 (59%), Gaps = 7/103 (7%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            RS SELE EEL+GF DLGF F ++D + ++  IIPGL+    + E        +RPYLSE
Sbjct  347  RSQSELESEELQGFKDLGFTFDKKDINPTVVDIIPGLR---EKKEEELESERTRRPYLSE  403

Query  673  AWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAV  801
            AW  M Q  ++  + KW      +  +MK  +KFWA+ VAS V
Sbjct  404  AW--MLQTHLLPPIPKWDN--RKSAEDMKQQIKFWARAVASNV  442



>gb|KGN57636.1| hypothetical protein Csa_3G236040 [Cucumis sativus]
Length=484

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 61/104 (59%), Gaps = 7/104 (7%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            RS SELE EEL+GF DLGF F ++D + ++  IIPGL+    + E        +RPYLSE
Sbjct  388  RSQSELESEELQGFKDLGFTFDKKDINPTVVDIIPGLR---EKKEEELESERTRRPYLSE  444

Query  673  AWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            AW  M Q  ++  + KW      +  +MK  +KFWA+ VAS V 
Sbjct  445  AW--MLQTHLLPPIPKWDN--RKSAEDMKQQIKFWARAVASNVH  484



>gb|EYU30762.1| hypothetical protein MIMGU_mgv1a022590mg [Erythranthe guttata]
Length=157

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 58/112 (52%), Gaps = 32/112 (29%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEE------DK---SSSLASIIPGLQRW-GSRDEVMTNE  642
            RSLSELE EELKGFMDLGFVF  E      DK    S L SI+PGLQ +  SR     NE
Sbjct  64   RSLSELEFEELKGFMDLGFVFRPELEEVKMDKYYNYSRLVSIVPGLQIFRHSRRRDHKNE  123

Query  643  SSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASA  798
                         ++D          W+ P   NE ++K++L+FWA +V S 
Sbjct  124  -------------LLDY---------WKIPAFVNEIDLKNHLRFWAHSVVST  153



>ref|XP_002457038.1| hypothetical protein SORBIDRAFT_03g000320 [Sorghum bicolor]
 gb|EES02158.1| hypothetical protein SORBIDRAFT_03g000320 [Sorghum bicolor]
Length=341

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 58/104 (56%), Gaps = 13/104 (13%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            +S S+LE  E++GF DLGFVF  E+   SLA ++PGL+    +    T+ S   RPYLSE
Sbjct  248  KSSSDLESIEVQGFRDLGFVFEHEELRESLADVLPGLK----QQTKSTSTSPRPRPYLSE  303

Query  673  AWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            AW  + +  + +         + +   MKD L+ WAQ VA  VR
Sbjct  304  AWQQVRRPALAR---------VQSAAEMKDQLRMWAQAVACNVR  338



>ref|XP_010541165.1| PREDICTED: uncharacterized protein LOC104814689 [Tarenaya hassleriana]
Length=172

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 86/193 (45%), Gaps = 46/193 (24%)
 Frame = +1

Query  127  VAAEEILKLFDSCWFQGEILTRK---QCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQ  297
            +  +E L LFDSCWF+ +I   +     PS     P  DD+ ++            + S 
Sbjct  1    MNVQETLNLFDSCWFERKIFKNRWNSLSPSNFTANP--DDKTEE------------IVSG  46

Query  298  SDNLLSFGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVC---EIKKRRV  468
                 S GT    PS + +S I      D             +L+   V    E ++ R 
Sbjct  47   PRENPSIGT----PSRNERSRIYDSSSPD------------RVLLHGSVFPGKETEENRS  90

Query  469  ARKKLGGHR-------SLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDE  627
            AR++  G R       S SELE EELKGFMDLGF F EE  +S L  I+PGLQ +  R E
Sbjct  91   ARRRTKGLRGRSETSKSASELESEELKGFMDLGFAFKEESVNSELVEILPGLQGFLGRQE  150

Query  628  VMTNESSVQRPYL  666
                 S + RPY+
Sbjct  151  ---KRSEIPRPYV  160



>gb|AFK41563.1| unknown [Lotus japonicus]
Length=226

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 54/104 (52%), Gaps = 30/104 (29%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            R+L ELE++E+KGFMDLGF+F +E  S  + S++PGLQR  S                  
Sbjct  151  RTLGELELDEVKGFMDLGFMFKKEYISPRMISVLPGLQRPDS------------------  192

Query  673  AWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
                         LL  + P   +  NMK +LKFWA+TVAS ++
Sbjct  193  ------------PLLNLKVPKHCSADNMKKHLKFWAKTVASEIQ  224



>ref|XP_010059034.1| PREDICTED: uncharacterized protein LOC104446942 [Eucalyptus grandis]
Length=149

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 59/104 (57%), Gaps = 21/104 (20%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDK-SSSLASIIPGLQRWGSRDEVMT-----------  636
            +SLSE E +ELKGFMDLGFVF+ EDK +SSL SIIPGLQR G + +              
Sbjct  42   KSLSEPEFKELKGFMDLGFVFSGEDKVNSSLVSIIPGLQRLGKKMKDGDEDDEDSDNHRE  101

Query  637  --NESS-------VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLS  741
              NE +       V RPYLSEAW   ++ +    L+ W+ P L 
Sbjct  102  DGNEKASIGEPAVVGRPYLSEAWEWWEEERKEDPLMNWKIPALG  145



>gb|KCW74142.1| hypothetical protein EUGRSUZ_E02774 [Eucalyptus grandis]
Length=174

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 59/104 (57%), Gaps = 21/104 (20%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDK-SSSLASIIPGLQRWGSRDEVMT-----------  636
            +SLSE E +ELKGFMDLGFVF+ EDK +SSL SIIPGLQR G + +              
Sbjct  67   KSLSEPEFKELKGFMDLGFVFSGEDKVNSSLVSIIPGLQRLGKKMKDGDEDDEDSDNHRE  126

Query  637  --NESS-------VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLS  741
              NE +       V RPYLSEAW   ++ +    L+ W+ P L 
Sbjct  127  DGNEKASIGEPAVVGRPYLSEAWEWWEEERKEDPLMNWKIPALG  170



>gb|EPS61787.1| hypothetical protein M569_13011, partial [Genlisea aurea]
Length=95

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 57/104 (55%), Gaps = 20/104 (19%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG-SRDEVMTNESSVQRPYLS  669
            +S +ELE+EELKGFMDLGF F  E+ S  L  +IPGL+R      E+       +RPYLS
Sbjct  11   KSSAELEMEELKGFMDLGFEFRRENLSDRLILLIPGLRRLADEDPEIEEETEITERPYLS  70

Query  670  EAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAV  801
            E+W    Q       LKWR             LK WA+TVAS++
Sbjct  71   ESWVWGSQD------LKWR-------------LKLWARTVASSL  95



>ref|XP_010062846.1| PREDICTED: uncharacterized protein LOC104450110 [Eucalyptus grandis]
 gb|KCW69982.1| hypothetical protein EUGRSUZ_F03292 [Eucalyptus grandis]
Length=349

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 66/119 (55%), Gaps = 9/119 (8%)
 Frame = +1

Query  448  EIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDE  627
            E+++R + R      +SLS+LE EE++GF +LGF F E+  +  L  I+PGLQ     +E
Sbjct  237  EMRRRYLTRSN--SRKSLSDLEDEEVRGFKELGFSFEEKHLNPKLVDILPGLQEKTQENE  294

Query  628  VMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
               + +  + PYLSE W     +     + KW     S E +MK  +KFWA+ VAS VR
Sbjct  295  ---DGNGNEAPYLSEGWLA---QSYAPAVPKWNAKGGSPE-DMKAQIKFWARVVASNVR  346



>ref|XP_004967336.1| PREDICTED: uncharacterized protein LOC101777454 [Setaria italica]
Length=383

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 58/104 (56%), Gaps = 8/104 (8%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            RS  +LE  E++GF DLGFVF +ED   SLA ++PGL++  +  +   + SS  RPYLSE
Sbjct  285  RSSGDLESIEVQGFRDLGFVFDKEDLRESLAGVLPGLKQQAA-GKTGRSRSSSGRPYLSE  343

Query  673  AWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
            AW        ++   +       +   +KD L+ WAQ VA  VR
Sbjct  344  AWQRPPALVRVQSEAR-------SAAEVKDQLRMWAQAVACNVR  380



>ref|XP_006643978.1| PREDICTED: uncharacterized protein LOC102712021 [Oryza brachyantha]
Length=374

 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 62/123 (50%), Gaps = 20/123 (16%)
 Frame = +1

Query  496  SLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQ-------RWGSRDEVM-------  633
            S S+LE  E++GF DLGFVF +E+    LA ++PGL+         GS  +V        
Sbjct  249  SSSDLESIEVQGFRDLGFVFDQEELRERLADVLPGLRGKSKTPSGSGSASDVDNDDANTT  308

Query  634  ------TNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVAS  795
                  ++  +V+RPYLSEAW  + +       L+ +     +   MKD ++ WAQ VA 
Sbjct  309  AAAATGSDNGTVRRPYLSEAWYHVRRPAATAAALRLQQSDARSAAEMKDQIRMWAQAVAC  368

Query  796  AVR  804
             VR
Sbjct  369  NVR  371



>ref|XP_004146273.1| PREDICTED: uncharacterized protein LOC101208087 [Cucumis sativus]
Length=466

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 57/98 (58%), Gaps = 7/98 (7%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            RS SELE EEL+GF DLGF F ++D + ++  IIPGL+    + E        +RPYLSE
Sbjct  376  RSQSELESEELQGFKDLGFTFDKKDINPTVVDIIPGLR---EKKEEELESERTRRPYLSE  432

Query  673  AWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQT  786
            AW  M Q  ++  + KW      +  +MK  +KFWA+ 
Sbjct  433  AW--MLQTHLLPPIPKWDN--RKSAEDMKQQIKFWARA  466



>ref|NP_001042550.1| Os01g0241000 [Oryza sativa Japonica Group]
 dbj|BAB40104.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04464.1| Os01g0241000 [Oryza sativa Japonica Group]
 gb|EAY73235.1| hypothetical protein OsI_01112 [Oryza sativa Indica Group]
 gb|EAZ11208.1| hypothetical protein OsJ_01062 [Oryza sativa Japonica Group]
 dbj|BAG99776.1| unnamed protein product [Oryza sativa Japonica Group]
Length=383

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 61/124 (49%), Gaps = 20/124 (16%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQ---------RWGSRDEVMTNE-  642
            +S S+LE  E++GF DLGFVF +E+   SLA ++PGL+              D+  T   
Sbjct  257  KSSSDLESIEVQGFRDLGFVFDQEELRESLADVLPGLRGKPTPTGSGSASDNDDANTATT  316

Query  643  -------SSVQRPYLSEAW---SIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVA  792
                   ++V+RPYLSEAW        R      ++ +     +   MKD L+ WAQ VA
Sbjct  317  ATGSDAVAAVRRPYLSEAWYHVRRPAPRSPAAAAMRLQQADARSAAEMKDQLRMWAQAVA  376

Query  793  SAVR  804
              VR
Sbjct  377  CNVR  380



>ref|XP_008445628.1| PREDICTED: uncharacterized protein LOC103488589 [Cucumis melo]
Length=76

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 15/73 (21%)
 Frame = +1

Query  448  EIKKRRVARKKLGGHRS--------------LSELEIEELKGFMDLGFVFTEEDK-SSSL  582
            E +KR + +KKL G+ +              LSELE +ELKGFM LGFVF+EEDK +S+L
Sbjct  2    EKEKRMMNKKKLEGNENKIRRKKKRKESSKSLSELEFDELKGFMVLGFVFSEEDKINSNL  61

Query  583  ASIIPGLQRWGSR  621
            +SIIPG   +G +
Sbjct  62   SSIIPGFHIFGPK  74



>ref|XP_009390133.1| PREDICTED: uncharacterized protein LOC103976591 [Musa acuminata 
subsp. malaccensis]
Length=201

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 58/104 (56%), Gaps = 11/104 (11%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDE-VMTNESSVQRPYLS  669
            RS SE+E  E++GF DLGFVF EE  S+ LA ++  L     RD+  ++ +    R YLS
Sbjct  105  RSYSEMEAFEVQGFRDLGFVFVEEGPSARLADVVRCL-----RDKRPISGDGGGCRAYLS  159

Query  670  EAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAV  801
            EAW I  +R    KL    +    +  + K+ L+ WA+TVA  V
Sbjct  160  EAWLI--ERTAPPKLA---WEERRSAADAKEQLRLWARTVARNV  198



>ref|XP_008446725.1| PREDICTED: uncharacterized protein LOC103489359 [Cucumis melo]
Length=200

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 114/232 (49%), Gaps = 44/232 (19%)
 Frame = +1

Query  136  EEILKLFDSCWFQGEILTRKQCPSVHETKPVLDDEYKKESKTMMGVLSLKVRSQSDNLLS  315
            E++L LFDS WF+  +  +   P +   +P + D      ++ + +  L  RS S++L S
Sbjct  4    EQLLNLFDSFWFERGVFNKH--PFLSNLQPQIQDPDSLPKESFI-IPRLPTRSISEDLSS  60

Query  316  FGTSFSPPSDSLKSGIIKPELEDLQaaataaaaataLLITKKVCEIKKR---------RV  468
              +  S  S+S  S +  P+L+ + ++   A A +    T +  EI++R         R 
Sbjct  61   KLSFMSS-SNSPDSVLFSPKLQTIFSSKDIAGAESPE--TSRKLEIERRPKTEYRRRFRG  117

Query  469  ARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESS  648
             R +    RSLSELE EELKGFMDLGFVF+EEDK +  A      +   ++  +M     
Sbjct  118  RRTRRSESRSLSELEFEELKGFMDLGFVFSEEDKEAWEAMEEEEEKEELAKKPLM-----  172

Query  649  VQRPYLSEAWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
                                  +KWRFP  SN+ +MKDNLK+WA  VAS VR
Sbjct  173  ----------------------MKWRFP--SNQIDMKDNLKWWAHAVASTVR  200



>gb|AFG65733.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65734.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65735.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65736.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65737.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65738.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65739.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65740.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65741.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65742.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65743.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65744.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65745.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65746.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65747.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65748.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
 gb|AFG65749.1| hypothetical protein 0_3683_01, partial [Pinus taeda]
Length=141

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 60/118 (51%), Gaps = 18/118 (15%)
 Frame = +1

Query  454  KKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVM  633
            +KR + ++  G  +S  +LE++ELKG M+LGF F  +  +  L S++PGL+R    +   
Sbjct  31   RKRVMQKESKGSPKSRVDLELQELKGLMELGFEFRRDHLTPRLLSLLPGLKRLADHENSS  90

Query  634  TNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFP-PLSNETNMKDNLKFWAQTVASAVR  804
             N    + P                 L  W  P P + + +MK +LK WA++VAS ++
Sbjct  91   KNLGFQESP-----------------LENWELPNPNAADVDMKKHLKLWARSVASKLK  131



>gb|ABK22856.1| unknown [Picea sitchensis]
Length=161

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 68/120 (57%), Gaps = 19/120 (16%)
 Frame = +1

Query  448  EIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDE  627
            E+ ++R  +KK G  +S  +LEI+ELKGFM+LGF F+++  S  L  ++PGL+R      
Sbjct  59   ELPQQRQKKKKRG-PKSTCDLEIQELKGFMELGFDFSQDKLSPRLLDLLPGLKR------  111

Query  628  VMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPL-SNETNMKDNLKFWAQTVASAVR  804
            ++   +  ++    E+            L  W  P L +   ++K++LK WA++VAS+++
Sbjct  112  LLIGRNFNKKIEFRES-----------PLENWELPTLNATGVDLKEHLKLWARSVASSLK  160



>gb|EYU26356.1| hypothetical protein MIMGU_mgv1a010685mg [Erythranthe guttata]
Length=305

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 56/108 (52%), Gaps = 9/108 (8%)
 Frame = +1

Query  505  ELEIEEL-KGFMDLGFVFTEEDKSSSLASIIPGLQ---RWGSRDEVMTNESSVQRPYLSE  672
            +LE EEL +GF DL      +D S +  SI PGLQ   R    ++ +   S   RPYLSE
Sbjct  196  DLESEELLRGFNDLRLDSGGKDSSPNPISIAPGLQERKRVDEEEDEVVKHSRAMRPYLSE  255

Query  673  AWSIMDQRKMMKKLLKWRFPPL----SNETNMKDNLKFWAQTVASAVR  804
            AW+   ++       KW         SNE ++K  +KFWA+ VAS VR
Sbjct  256  AWAAAPKQSSAPPFPKWGGGGGKAKRSNE-DVKAQIKFWARAVASNVR  302



>ref|XP_010230679.1| PREDICTED: uncharacterized protein LOC100823668 [Brachypodium 
distachyon]
Length=406

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 61/126 (48%), Gaps = 22/126 (17%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQ---------------RWGSRDE  627
            +S S LE  E++GF DLGFVF +E+   SLA ++PGL+                  S D 
Sbjct  278  KSSSALESIEVQGFKDLGFVFDKEELRESLADVLPGLRDSKAAKSSGSVSAGSGSASDDN  337

Query  628  VMTNESS------VQRPYLSEAWSIMDQRKMMKKL-LKWRFPPLSNETNMKDNLKFWAQT  786
              TN S+      V+RPYLSEAW    +        ++ +     +   MKD ++ WAQ 
Sbjct  338  DDTNGSAVGDGETVRRPYLSEAWHHGARSAPPAAAGIRLQQADARSAAEMKDQIRMWAQA  397

Query  787  VASAVR  804
            VA  VR
Sbjct  398  VACNVR  403



>gb|ABK23726.1| unknown [Picea sitchensis]
Length=178

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 68/120 (57%), Gaps = 19/120 (16%)
 Frame = +1

Query  448  EIKKRRVARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDE  627
            E+ ++R  +KK G  +S  +LEI+ELKGFM+LGF F+++  S  L  ++PGL+R      
Sbjct  76   ELPQQRQKKKKRG-PKSTCDLEIQELKGFMELGFDFSQDKLSPRLLDLLPGLKR------  128

Query  628  VMTNESSVQRPYLSEAWSIMDQRKMMKKLLKWRFPPL-SNETNMKDNLKFWAQTVASAVR  804
            ++   +  ++    E+            L  W  P L +   ++K++LK WA++VAS+++
Sbjct  129  LLIGRNFNKKIEFRES-----------PLENWELPTLNATGGDLKEHLKLWARSVASSLK  177



>ref|XP_004304411.1| PREDICTED: uncharacterized protein LOC101305283 [Fragaria vesca 
subsp. vesca]
Length=294

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 57/113 (50%), Gaps = 26/113 (23%)
 Frame = +1

Query  535  MDLGFVFTEEDKSSSLASIIPGLQRWG-----SRDEVMTNESSVQ---------------  654
            MDLGF F +E+ +  + S++PGLQR G     S  +   N S                  
Sbjct  182  MDLGFTFKKENLNPRMMSLVPGLQRLGVGGRHSHSKKRQNSSDDDDVVEVVGGGGDEEGE  241

Query  655  --RPYLSEAWSIMDQRKMMKKLLKWRFPP-LSNETNMKDNLKFWAQTVASAVR  804
              RPYLSEAW I   ++    LL  R P  +S+  +MK +LK WA+TVAS ++
Sbjct  242  VARPYLSEAWLI---KRPDSPLLNLRLPTRVSSAADMKKHLKSWARTVASEIQ  291



>ref|XP_002893555.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69814.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=175

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 5/76 (7%)
 Frame = +1

Query  565  DKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSEAWSIM--DQRKMMKK---LLKWRF  729
            D +S L  I+PGL+ +  R+E   +ESSV RPYLSE W+    + R+  +K   ++  R 
Sbjct  73   DLNSELPEILPGLRTFLCREEQRRSESSVPRPYLSETWNFYGDNWRRREEKDSMVIDLRL  132

Query  730  PPLSNETNMKDNLKFW  777
              L  ETNMK+NLK W
Sbjct  133  AKLCGETNMKENLKLW  148



>ref|XP_001753980.1| predicted protein [Physcomitrella patens]
 gb|EDQ81302.1| predicted protein [Physcomitrella patens]
Length=512

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 69/125 (55%), Gaps = 15/125 (12%)
 Frame = +1

Query  466  VARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG---SRDEVMT  636
            V R++L G +SL++LE EEL+G  DLGF  +++D +  +  + PGLQR G          
Sbjct  386  VRRRRLKGTKSLTDLEYEELRGLKDLGFEVSKDDLTPPVVRMFPGLQRQGIPPYNSPQSQ  445

Query  637  NESSVQRPYLSEAWSIMDQRKM--MKKLLKWRFP--PLSN------ETNMKDNLKFWAQT  786
            +++SVQ  + ++  +++ Q +   ++ LL  R P  PL N        +MK  LK WA  
Sbjct  446  SQASVQNTHPNQ--NVLSQSRFTPVQHLLWPRRPDSPLINTPFLDPSIDMKGQLKTWASE  503

Query  787  VASAV  801
            +AS V
Sbjct  504  MASIV  508



>emb|CDM85321.1| unnamed protein product [Triticum aestivum]
Length=158

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 56/111 (50%), Gaps = 16/111 (14%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            RSL+E ++EELKG +DLGF F+  D+   L   +PGL+             S+ R +L E
Sbjct  58   RSLTEEDLEELKGCLDLGFGFS-YDEIPGLCGTLPGLELC----------YSMTRRFLDE  106

Query  673  AWSIMDQ----RKMMKKLLKWRFP-PLSNETNMKDNLKFWAQTVASAVR*C  810
              +++ Q          +  W+   P  N   +K  LK+WAQTVA  V+ C
Sbjct  107  QRAVVGQLEPAAAAAAPIPDWKISGPGDNPEEVKARLKYWAQTVACTVKLC  157



>ref|XP_009780657.1| PREDICTED: uncharacterized protein LOC104229676 [Nicotiana sylvestris]
Length=312

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 53/102 (52%), Gaps = 25/102 (25%)
 Frame = +1

Query  502  SELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPY-LSEAW  678
            S  EIE+L+GF +L   + ++D    +A+ IPG            NE + ++P  LSE  
Sbjct  235  SSSEIEDLQGFKNLDLTYEKKDSIPKMANTIPGY-----------NEKNKKKPVGLSE--  281

Query  679  SIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
                       L K R PP S E +MK+ +KFWA+TVAS VR
Sbjct  282  -----------LDKIRKPPYSPEDHMKEQIKFWARTVASNVR  312



>emb|CDY47701.1| BnaA10g03900D [Brassica napus]
Length=163

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 59/114 (52%), Gaps = 6/114 (5%)
 Frame = +1

Query  472  RKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSV  651
            +  L   +SL++ ++E+LKG +DLGF F+  D+   L S +P L+   S  +  +++++ 
Sbjct  54   QDDLTRSKSLTDDDLEDLKGCLDLGFGFS-YDEIPELCSTLPALELCYSMSQRFSDDNNK  112

Query  652  QRPYLSEAWSIMDQRKMMKKLLKWRF-PPLSNETNMKDNLKFWAQTVASAVR*C  810
              P      S +D       +  W+   P  N  ++K  LK+WAQ VA  V+ C
Sbjct  113  SSP----ENSPVDDSSPAPPIANWKISSPGDNPDDVKARLKYWAQAVACTVQLC  162



>ref|XP_003564844.1| PREDICTED: uncharacterized protein LOC100842634 [Brachypodium 
distachyon]
Length=153

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 53/108 (49%), Gaps = 13/108 (12%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            RSL+E ++EELKG +DLGF F+  +    L   +PGL+             S+ R +L E
Sbjct  56   RSLTEEDLEELKGCLDLGFGFSYHEI-PGLCGTLPGLELC----------YSMTRRFLDE  104

Query  673  A-WSIMDQRKMMKKLLKWRFP-PLSNETNMKDNLKFWAQTVASAVR*C  810
               S   Q      +  WR   P  +   +K  LK+WAQTVA  V+ C
Sbjct  105  QRASAGPQEPATPPIPNWRISGPGDDPEEVKARLKYWAQTVACTVKLC  152



>ref|XP_006443074.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 ref|XP_006443075.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 ref|XP_006443076.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 ref|XP_006443077.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 ref|XP_006443078.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 ref|XP_006443079.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 ref|XP_006494181.1| PREDICTED: uncharacterized protein LOC102619684 isoform X1 [Citrus 
sinensis]
 gb|ESR56314.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 gb|ESR56315.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 gb|ESR56316.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 gb|ESR56317.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 gb|ESR56318.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 gb|ESR56319.1| hypothetical protein CICLE_v10022453mg [Citrus clementina]
 gb|KDO43493.1| hypothetical protein CISIN_1g029447mg [Citrus sinensis]
 gb|KDO43494.1| hypothetical protein CISIN_1g029447mg [Citrus sinensis]
 gb|KDO43495.1| hypothetical protein CISIN_1g029447mg [Citrus sinensis]
 gb|KDO43496.1| hypothetical protein CISIN_1g029447mg [Citrus sinensis]
 gb|KDO43497.1| hypothetical protein CISIN_1g029447mg [Citrus sinensis]
 gb|KDO43498.1| hypothetical protein CISIN_1g029447mg [Citrus sinensis]
 gb|KDO43499.1| hypothetical protein CISIN_1g029447mg [Citrus sinensis]
 gb|KDO43500.1| hypothetical protein CISIN_1g029447mg [Citrus sinensis]
Length=185

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 56/107 (52%), Gaps = 2/107 (2%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            +SL++ +++ELKG +DLGF F+  D+   L + +P L+   S  +   +E   Q+   S 
Sbjct  79   KSLTDEDLDELKGCLDLGFGFS-YDEIPELCNTLPALELCYSMSQKFMDEHQSQKSPESH  137

Query  673  AWSIMDQRKMMKKLLKWRF-PPLSNETNMKDNLKFWAQTVASAVR*C  810
              S +    +   +  W+   P  +  ++K  LK+WAQ VA  VR C
Sbjct  138  GNSPVSTDPVSSPIANWKISSPGDHPEDVKARLKYWAQAVACTVRLC  184



>dbj|BAK00756.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=160

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 56/111 (50%), Gaps = 16/111 (14%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            +SL+E+++EELKG +DLGF F+   +   L   +PGL+             S+ R +L E
Sbjct  60   KSLTEVDLEELKGCLDLGFGFSYH-QIPGLCGTLPGLELC----------YSMTRRFLDE  108

Query  673  AWSIMDQ----RKMMKKLLKWRFP-PLSNETNMKDNLKFWAQTVASAVR*C  810
              +++ Q          +  W+   P  N   +K  LK+WAQTVA  V+ C
Sbjct  109  QRAVVGQLEPAAPAAPPIPDWKISGPGDNPEEVKARLKYWAQTVACTVKLC  159



>ref|XP_006428825.1| hypothetical protein CICLE_v10013612mg, partial [Citrus clementina]
 gb|ESR42065.1| hypothetical protein CICLE_v10013612mg, partial [Citrus clementina]
Length=202

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQR  609
            RSL ELE+EE+KGFMDLGF F +E  S  + S++PGLQR
Sbjct  132  RSLMELELEEVKGFMDLGFRFNKECLSPRMMSVLPGLQR  170



>ref|XP_009119110.1| PREDICTED: uncharacterized protein LOC103844090 [Brassica rapa]
Length=165

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 60/114 (53%), Gaps = 5/114 (4%)
 Frame = +1

Query  472  RKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSV  651
            +  L   +SL++ ++E+LKG +DLGF F+  D+   L S +P L+   S  +  +++++ 
Sbjct  55   QDDLTRSKSLTDDDLEDLKGCLDLGFGFS-YDEIPELCSTLPALELCYSMSQRFSDDNNN  113

Query  652  QRPYLSEAWSIMDQRKMMKKLLKWRF-PPLSNETNMKDNLKFWAQTVASAVR*C  810
            +    S   S +D       +  W+   P  N  ++K  LK+WAQ VA  V+ C
Sbjct  114  KS---SPENSPVDDSSPAPPIANWKISSPGDNPDDVKARLKYWAQAVACTVQLC  164



>emb|CDM85320.1| unnamed protein product [Triticum aestivum]
Length=157

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 57/115 (50%), Gaps = 16/115 (14%)
 Frame = +1

Query  481  LGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRP  660
            +G  RSL+E ++EELKG +DLGF F+  +    L   +PGL+             S+ R 
Sbjct  53   VGRTRSLTEEDLEELKGCLDLGFGFSYHEI-PGLCGTLPGLELC----------YSMTRR  101

Query  661  YLSEAWSIMDQ----RKMMKKLLKWRFP-PLSNETNMKDNLKFWAQTVASAVR*C  810
            +L E  +++ Q          +  W+   P  +   +K  LK+WAQTVA  V+ C
Sbjct  102  FLDEQRTLVGQLEPAAVAAPPIPDWKISGPGDDPDQVKARLKYWAQTVACTVKLC  156



>emb|CDY10158.1| BnaC05g04010D [Brassica napus]
Length=162

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 60/114 (53%), Gaps = 7/114 (6%)
 Frame = +1

Query  472  RKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSV  651
            +  L   +SL++ ++E+LKG +DLGF F+  D+   L S +P L+   S  +  +++++ 
Sbjct  54   QDDLTRSKSLTDDDLEDLKGCLDLGFGFS-YDEIPELCSTLPALELCYSMSQRFSDDNNK  112

Query  652  QRPYLSEAWSIMDQRKMMKKLLKWRF-PPLSNETNMKDNLKFWAQTVASAVR*C  810
              P   E  S+ D       +  W+   P  N  ++K  LK+WAQ VA  V+ C
Sbjct  113  SSP---ENSSVDDSP--APPIANWKISSPGDNPDDVKARLKYWAQAVACTVQLC  161



>ref|XP_008790647.1| PREDICTED: uncharacterized protein LOC103707781 [Phoenix dactylifera]
Length=182

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 60/119 (50%), Gaps = 6/119 (5%)
 Frame = +1

Query  469  ARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESS  648
              +  G  R+L++ ++E+LKG +DLGF F+ E+    L + +P L+   S      +E  
Sbjct  64   GEEGYGRTRNLTDDDLEDLKGCLDLGFGFSYEEI-PELCNTLPALELCYSMSHRFLDEHL  122

Query  649  VQRPYLSEAWS--IMDQRKMMKK--LLKWRFP-PLSNETNMKDNLKFWAQTVASAVR*C  810
             Q+ + S   S   ++Q   M    +  WR   P     ++K  LK+WAQTVA  VR C
Sbjct  123  QQQQHGSPDGSGDAVEQCAAMSSPPIANWRISGPGDQPEDVKARLKYWAQTVACTVRLC  181



>gb|KDP45851.1| hypothetical protein JCGZ_15295 [Jatropha curcas]
Length=307

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 56/104 (54%), Gaps = 6/104 (6%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            +SLS LE  +++GF DL F F ++D + S A IIP  +    +++ +  +   +RP LSE
Sbjct  210  KSLSNLE-SQIEGFKDLEFPFNKQDLNPSKAGIIPVSENKKKQNQDLDQDKVRRRPCLSE  268

Query  673  AWSIMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
             W +   +     +  W     S+  +MK  LK WA+ VAS VR
Sbjct  269  TWHV---QSCASPIPIWAA--KSSTQDMKAQLKCWARAVASNVR  307



>emb|CDM85319.1| unnamed protein product [Triticum aestivum]
Length=167

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 55/111 (50%), Gaps = 16/111 (14%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            RSL+E ++EELKG +DLGF F+   +   L   +PGL+             S+ R +L E
Sbjct  67   RSLTEEDLEELKGCLDLGFGFSYH-QIPGLCGTLPGLELC----------YSMTRRFLDE  115

Query  673  AWSIMDQ----RKMMKKLLKWRFP-PLSNETNMKDNLKFWAQTVASAVR*C  810
              +++ Q          +  W+   P  +   +K  LK+WAQTVA  V+ C
Sbjct  116  QRTLVGQLEPATAAAAPIPDWKISGPGDDPDEVKARLKYWAQTVACTVKLC  166



>ref|XP_001752059.1| predicted protein [Physcomitrella patens]
 gb|EDQ83494.1| predicted protein [Physcomitrella patens]
Length=578

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 65/126 (52%), Gaps = 17/126 (13%)
 Frame = +1

Query  466  VARKKLGGHRSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWG-----SRDEV  630
            + R++L G +SL++LE EEL+G+ DLGF  +++D +  +  + PGL+R G     S   +
Sbjct  290  IRRRRLKGTKSLTDLEYEELRGWKDLGFEVSKDDLTPHVVRMFPGLERQGIPPYNSPQSL  349

Query  631  MTNESSVQRPYLSEAWSIMDQRKMMKKLLKW-RFP--PLSN------ETNMKDNLKFWAQ  783
              N +    P  +   ++   R    + L W R P  PL+N        +MK  LK WA 
Sbjct  350  SKNPAHNVNPNQN---ALPHNRAPPVQHLLWPRRPDSPLTNTPFLDPSIDMKGQLKSWAS  406

Query  784  TVASAV  801
             +AS V
Sbjct  407  EMASIV  412



>ref|XP_009609883.1| PREDICTED: uncharacterized protein LOC104103669 [Nicotiana tomentosiformis]
Length=312

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 47/101 (47%), Gaps = 23/101 (23%)
 Frame = +1

Query  502  SELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSEAWS  681
            S  EIE+L+GF  L   + ++D    L + IPG +    +  V  +E             
Sbjct  235  SSSEIEDLQGFKKLDLNYEKKDSIPKLPNTIPGFKEKNKKKSVGLSE-------------  281

Query  682  IMDQRKMMKKLLKWRFPPLSNETNMKDNLKFWAQTVASAVR  804
                      L K R PP S E +MK+ +KFWA+TVAS VR
Sbjct  282  ----------LDKIRRPPYSPEDHMKEKIKFWARTVASNVR  312



>ref|XP_002862293.1| hypothetical protein ARALYDRAFT_497529 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38551.1| hypothetical protein ARALYDRAFT_497529 [Arabidopsis lyrata subsp. 
lyrata]
Length=202

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 52/107 (49%), Gaps = 2/107 (2%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            +SL+E ++EELKG +DLGF F+  D+   L + +P L+   S  +   ++         +
Sbjct  96   KSLTEDDLEELKGCLDLGFGFS-YDEIPELCNTLPALELCYSMSQKFLDDKQQNHHKSPD  154

Query  673  AWSIMDQRKMMKKLLKWRF-PPLSNETNMKDNLKFWAQTVASAVR*C  810
                         +  W+   P  +  ++K  LK+WAQTVA  VR C
Sbjct  155  EDDSPPPPNTTVPIANWKISSPGDDPDDVKARLKYWAQTVACTVRLC  201



>ref|XP_009402693.1| PREDICTED: uncharacterized protein LOC103986406 [Musa acuminata 
subsp. malaccensis]
Length=154

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 59/115 (51%), Gaps = 12/115 (10%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            RSL++ ++EELKG +DLGF F+ E+    L + +P L+   S  + +  +    R Y S 
Sbjct  48   RSLTDEDLEELKGCLDLGFGFSYEEI-PGLCNTLPALELCYSLCQSVRLDDHPDR-YPSP  105

Query  673  AWSIMDQRKMMKKLLKWRF-PPLSNETNMKDNLKFWAQTVASAVR*CFLLSILSL  834
            + S          +  WRF  P  +   +K  LK+WAQ VA  VR C L  + S+
Sbjct  106  SSS---------PVANWRFSSPGDDPDEVKARLKYWAQAVACTVRLCSLKRVKSV  151



>ref|XP_006295428.1| hypothetical protein CARUB_v10024525mg [Capsella rubella]
 gb|EOA28326.1| hypothetical protein CARUB_v10024525mg [Capsella rubella]
Length=205

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 54/107 (50%), Gaps = 4/107 (4%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEEDKSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLSE  672
            +SL++ ++EELKG +DLGF F+  D+   L + +P L+   S  +   ++  + +    E
Sbjct  101  KSLTDDDLEELKGCLDLGFGFSY-DEIPELCNTLPALELCYSMSQKFLDDKQIHQKSPDE  159

Query  673  AWSIMDQRKMMKKLLKWRFP-PLSNETNMKDNLKFWAQTVASAVR*C  810
                         +  W+   P  N  ++K  LK+WAQTVA  VR C
Sbjct  160  E--DSPPPPTSTPIANWKISSPGDNPDDVKARLKYWAQTVACTVRLC  204



>ref|XP_002984723.1| hypothetical protein SELMODRAFT_423830 [Selaginella moellendorffii]
 gb|EFJ14368.1| hypothetical protein SELMODRAFT_423830 [Selaginella moellendorffii]
Length=374

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 54/107 (50%), Gaps = 15/107 (14%)
 Frame = +1

Query  493  RSLSELEIEELKGFMDLGFVFTEED-KSSSLASIIPGLQRWGSRDEVMTNESSVQRPYLS  669
            RS SELE +E++G  DLGF  +E D     + S+     R   R E         R Y S
Sbjct  277  RSWSELEFDEVRGLRDLGFKPSEGDLMPRRVVSLATSTARSSPRRE---------RIYPS  327

Query  670  EAWSIMDQRKMMKKLLKWRFPPLSNET--NMKDNLKFWAQTVASAVR  804
             AWSI   R+    LL  R P  + +   +MK +LKFWA+ VAS VR
Sbjct  328  HAWSI---RRPDSPLLNLRMPDPNRQGVEDMKAHLKFWARAVASTVR  371



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2242237191290