BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15666_g3_i1 len=168 path=[1196:0-167]

Length=168
                                                                      Score     E

ref|XP_002540513.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...  74.7    7e-15   Ricinus communis
gb|ABF74607.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  73.9    1e-14   Agave tequilana
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...  75.1    4e-14   Ricinus communis
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  74.7    5e-14   
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  74.7    5e-14   
gb|ACU20783.1|  unknown                                               74.7    5e-14   Glycine max [soybeans]
ref|NP_001240080.1|  uncharacterized protein LOC100806482             74.7    5e-14   
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...  74.7    5e-14   
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...  74.7    5e-14   
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  74.7    5e-14   
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  74.7    6e-14   
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B       75.5    8e-14   
gb|KDP36765.1|  hypothetical protein JCGZ_08056                       74.3    8e-14   
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase             72.8    9e-14   Capsicum annuum
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...  73.9    9e-14   
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  73.9    1e-13   
emb|CDP07271.1|  unnamed protein product                              73.9    1e-13   
emb|CAN69459.1|  hypothetical protein VITISV_021576                   73.9    1e-13   Vitis vinifera
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg           73.6    1e-13   
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  73.6    1e-13   Vitis vinifera
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase             73.6    1e-13   
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  73.2    1e-13   
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                 73.2    2e-13   
emb|CDY69523.1|  BnaC08g46180D                                        73.2    2e-13   
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B          73.2    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...  73.2    2e-13   
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  73.2    2e-13   
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  73.2    2e-13   
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                  73.2    2e-13   
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  73.2    2e-13   
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  73.2    2e-13   
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190        72.8    2e-13   
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457           72.8    2e-13   
dbj|BAK05515.1|  predicted protein                                    70.1    2e-13   
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517           72.8    2e-13   
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg           72.8    2e-13   
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  72.8    2e-13   
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B            72.8    2e-13   
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g           72.8    3e-13   Populus trichocarpa [western balsam poplar]
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase             72.4    3e-13   Marchantia polymorpha
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  72.4    3e-13   
gb|KGN49135.1|  hypothetical protein Csa_6G514950                     70.1    3e-13   
gb|EYU41184.1|  hypothetical protein MIMGU_mgv1a014833mg              70.1    3e-13   
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  72.4    3e-13   
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...  72.4    4e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  72.0    4e-13   
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  72.0    4e-13   
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  72.0    4e-13   
gb|AAG23800.1|  chloroplast NADP-dependent glyceraldehyde 3-phosp...  69.7    4e-13   Cucurbita pepo
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  72.0    5e-13   
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B            71.2    5e-13   
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  72.0    5e-13   
ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  72.0    5e-13   
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  72.0    5e-13   
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  72.0    5e-13   
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...  71.6    5e-13   Nicotiana tabacum [American tobacco]
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  71.6    6e-13   
gb|AES74101.2|  glyceraldehyde-3-phosphate dehydrogenase B            70.5    6e-13   
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  71.2    7e-13   
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase              70.9    7e-13   
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg           71.2    8e-13   
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  71.2    8e-13   
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  71.2    8e-13   
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  71.2    8e-13   
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  71.2    8e-13   
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...  71.2    8e-13   
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B            71.2    8e-13   
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  71.2    8e-13   
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B            71.2    8e-13   
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  70.9    8e-13   Marchantia polymorpha
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  71.2    8e-13   
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  71.2    8e-13   
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit    70.9    8e-13   Arabidopsis thaliana [mouse-ear cress]
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...  71.2    9e-13   Pisum sativum [garden pea]
emb|CAA33262.1|  unnamed protein product                              71.2    9e-13   Pisum sativum [garden pea]
gb|ACJ84309.1|  unknown                                               71.2    9e-13   Medicago truncatula
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase         71.2    9e-13   
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase         70.9    1e-12   
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  71.2    1e-12   
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase         71.2    1e-12   
gb|ABK24645.1|  unknown                                               70.9    1e-12   Picea sitchensis
gb|ACN40006.1|  unknown                                               70.9    1e-12   Picea sitchensis
gb|ACN40526.1|  unknown                                               70.9    1e-12   Picea sitchensis
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  70.9    1e-12   
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  71.2    1e-12   
ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  70.9    1e-12   
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  70.5    1e-12   
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g           70.5    2e-12   
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  70.5    2e-12   
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg           70.5    2e-12   
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  70.5    2e-12   
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  70.5    2e-12   
gb|EPS70760.1|  hypothetical protein M569_03997                       70.5    2e-12   
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  70.1    2e-12   
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g           70.1    2e-12   
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.7    3e-12   
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.7    3e-12   
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  69.3    3e-12   Mesostigma viride
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B    69.3    4e-12   Mesostigma viride
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...  68.9    4e-12   
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...  68.9    5e-12   
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  68.9    5e-12   Ostreococcus tauri
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B       68.9    5e-12   Micromonas commoda
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  68.9    5e-12   
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...  68.9    6e-12   Spinacia oleracea
dbj|BAJ87214.1|  predicted protein                                    68.9    6e-12   
dbj|BAJ86633.1|  predicted protein                                    68.9    6e-12   
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  68.9    6e-12   
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase             67.8    7e-12   Coleochaete scutata
ref|XP_001415434.1|  predicted protein                                68.2    8e-12   Ostreococcus lucimarinus CCE9901
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B    67.4    8e-12   Spirogyra sp. SAG 170.80
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...  67.8    9e-12   
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  67.8    1e-11   
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339           67.4    1e-11   
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  67.8    2e-11   
ref|NP_001048847.1|  Os03g0129300                                     67.8    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ABF93789.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  66.6    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B    67.0    3e-11   Chlorokybus atmophyticus
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403           65.5    8e-11   
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  65.5    9e-11   
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase             64.7    2e-10   Chara vulgaris
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...  62.8    6e-10   Micromonas commoda
gb|ADB81483.1|  glyceraldehyde-3-phosphate dehydrogenase              59.7    1e-09   
gb|ABK00067.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  61.6    1e-09   Chlorokybus atmophyticus
gb|ABS72003.1|  putative chloroplast glyceradehyde-3-phosphate de...  59.7    1e-09   Olea europaea
ref|XP_001420043.1|  predicted protein                                61.6    2e-09   Ostreococcus lucimarinus CCE9901
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    60.8    2e-09   Chlorokybus atmophyticus
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  61.2    2e-09   Ostreococcus 'lucimarinus'
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...  60.8    3e-09   
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  60.8    3e-09   Ostreococcus tauri
gb|ABS86942.1|  glyceraldehyde-3-phosphate dehydrogenase              58.2    5e-09   Garcinia mangostana [mangosteen]
gb|ACN57670.1|  At3g26650-like protein                                57.8    5e-09   Capsella rubella
gb|ACC59148.1|  At3G26650-like protein                                57.4    5e-09   Arabidopsis lyrata subsp. petraea
gb|ACC59155.1|  At3G26650-like protein                                57.4    5e-09   Arabidopsis lyrata subsp. lyrata
gb|ADB81487.1|  glyceraldehyde-3-phosphate dehydrogenase              59.3    6e-09   
dbj|BAD93961.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit   58.2    6e-09   Arabidopsis thaliana [mouse-ear cress]
gb|EPS59235.1|  hypothetical protein M569_15573                       60.1    6e-09   
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase             59.7    6e-09   Spirogyra sp.
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg              60.5    7e-09   
ref|WP_002844711.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  59.7    7e-09   
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A            60.1    7e-09   
gb|ABW89104.1|  glyceraldehyde-3-phosphate dehydrogenase              57.8    7e-09   Helianthus annuus
gb|ADB81484.1|  glyceraldehyde-3-phosphate dehydrogenase              58.9    8e-09   
gb|ABD37960.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    59.3    8e-09   Coleochaete scutata
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  59.7    8e-09   
gb|AAG23799.1|  chloroplast NADP-dependent glyceraldehyde 3-phosp...  57.8    8e-09   Cucurbita pepo
gb|ABW89099.1|  glyceraldehyde-3-phosphate dehydrogenase              57.8    8e-09   Helianthus annuus
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662            59.7    9e-09   
gb|ADD54591.1|  putative glyceraldehyde-3-phosphate dehydrogenase     57.8    9e-09   Linum usitatissimum
gb|ADB81493.1|  glyceraldehyde-3-phosphate dehydrogenase              57.4    9e-09   
gb|ABY20971.1|  glyceraldehyde-3-phosphate dehydrogenase A subunit    57.4    1e-08   Hypericum perforatum
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...  58.9    1e-08   
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...  58.9    1e-08
gb|ADB81495.1|  glyceraldehyde-3-phosphate dehydrogenase              57.0    1e-08   
gb|ADB81491.1|  glyceraldehyde-3-phosphate dehydrogenase              58.5    1e-08   
sp|P09672.1|G3PA_SINAL  RecName: Full=Glyceraldehyde-3-phosphate ...  57.8    1e-08   Sinapis alba [bai jie]
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase         58.9    1e-08   
emb|CAC80391.2|  glyceraldehyde-3-phosphate dehydrogenase             58.5    2e-08   Klebsormidium flaccidum
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase         58.9    2e-08   Chlamydomonas reinhardtii
gb|ACN57671.1|  At3g26650-like protein                                56.2    2e-08   Capsella rubella
gb|KFM26247.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  58.9    2e-08   
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    58.5    2e-08   Cladophora rupestris
gb|ADB81490.1|  glyceraldehyde-3-phosphate dehydrogenase              56.6    2e-08   
emb|CAC80394.1|  glyceraldehyde-3-phosphate dehydrogenase             57.8    2e-08   Sphagnum cuspidatum
gb|ADB81482.1|  glyceraldehyde-3-phosphate dehydrogenase              56.6    2e-08   
gb|ABK00066.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  57.8    2e-08   Chara vulgaris
gb|ABG35267.1|  glyceraldehyde-3-phosphate dehydrogenase              57.0    2e-08   Helianthus annuus
gb|ADB81480.1|  glyceraldehyde-3-phosphate dehydrogenase              56.2    2e-08   
dbj|BAD72793.1|  glyceraldehyde-3-phosphate dehydrogenase             56.6    2e-08   Pinus thunbergii [green pine]
gb|ACN39951.1|  unknown                                               58.2    2e-08   Picea sitchensis
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  58.5    2e-08   
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825           58.5    3e-08   
gb|AFC88822.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...  57.8    3e-08   
gb|ADB81481.1|  glyceraldehyde-3-phosphate dehydrogenase              56.2    3e-08   
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  58.5    3e-08   
emb|CDP18560.1|  unnamed protein product                              58.2    3e-08   
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561           58.5    3e-08   
gb|AAZ79661.1|  putative glyceraldehyde 3-phosphate dehydrogenase     55.8    3e-08   Fagus sylvatica
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  58.2    3e-08   
gb|ABG35250.1|  glyceraldehyde-3-phosphate dehydrogenase              56.6    3e-08   Helianthus annuus
ref|XP_009148557.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.8    3e-08   
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  58.2    3e-08   Marchantia polymorpha
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  58.2    3e-08   
ref|XP_010528120.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.4    3e-08   
ref|WP_036761887.1|  glyceraldehyde-3-phosphate dehydrogenase         57.8    3e-08   
gb|ABG35254.1|  glyceraldehyde-3-phosphate dehydrogenase              56.6    3e-08   Helianthus annuus
gb|ACN40000.1|  unknown                                               58.2    3e-08   Picea sitchensis
gb|ABK24313.1|  unknown                                               58.2    3e-08   Picea sitchensis
gb|ABK25233.1|  unknown                                               58.2    4e-08   Picea sitchensis
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase             58.2    4e-08   Marchantia polymorpha
gb|ACN40537.1|  unknown                                               58.2    4e-08   Picea sitchensis
dbj|BAA94304.1|  NADP-glyceraldehyde-3-phosphate dehydrogenase        57.8    4e-08   Chlamydomonas sp. W80
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                58.2    4e-08   Pinus sylvestris [Scotch pine]
emb|CAA30152.1|  GADPH (383 AA)                                       57.8    4e-08   Zea mays [maize]
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680        57.8    4e-08   
ref|NP_001077529.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2   57.4    4e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase             57.4    4e-08   Sphagnum cuspidatum
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1       57.8    4e-08   
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...  57.8    4e-08   Zea mays [maize]
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase         57.8    4e-08   
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...  57.4    5e-08   
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  57.4    5e-08   Chlamydomonas incerta
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...  57.8    5e-08   Ricinus communis
gb|KDO63479.1|  hypothetical protein CISIN_1g013492mg                 57.0    5e-08   
gb|ADU04755.1|  glyceraldehyde-3-phosphate dehydrogenase              57.0    5e-08   
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...  57.4    5e-08   
gb|ADU04754.1|  glyceraldehyde-3-phosphate dehydrogenase              56.6    5e-08   
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  57.4    5e-08   Chlamydomonas incerta
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A           57.4    6e-08   
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A            57.0    6e-08   
dbj|BAJ34149.1|  unnamed protein product                              57.4    6e-08   
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...  57.4    6e-08   
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase             57.0    6e-08   Capsicum annuum
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase             57.0    6e-08   
dbj|BAN09110.1|  glyceraldehyde-3-phosphate dehydrogenase             56.2    6e-08   
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    57.0    6e-08   Chara vulgaris
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.4    6e-08   
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.4    6e-08   
emb|CDY16038.1|  BnaC08g40850D                                        57.4    6e-08   
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg           57.4    6e-08   
ref|XP_010458726.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    6e-08   
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                  57.4    6e-08   
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg           57.4    6e-08   
emb|CDY26599.1|  BnaA09g46780D                                        57.4    7e-08   
ref|XP_002892719.1|  GAPA-2                                           57.4    7e-08   
ref|XP_010476270.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.0    7e-08   
ref|XP_010494750.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.0    7e-08   
ref|XP_009118049.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.0    7e-08   
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase             56.6    7e-08   Capsicum annuum
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.4    7e-08   
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg           57.4    7e-08   
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.4    7e-08   
emb|CDY19412.1|  BnaC05g09210D                                        57.4    7e-08   
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2      57.4    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.0    7e-08   
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...  57.0    7e-08   
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...  57.0    7e-08   
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase             57.0    7e-08   
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...  57.0    7e-08   
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit    57.0    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.0    7e-08   
emb|CDY13649.1|  BnaA06g32740D                                        57.0    7e-08   
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...  57.0    7e-08   Spinacia oleracea
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.0    8e-08   
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...  57.0    8e-08   
gb|AGJ50596.1|  GAPDH                                                 57.0    8e-08   
ref|WP_039634088.1|  glyceraldehyde-3-phosphate dehydrogenase         56.6    8e-08   
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.0    8e-08   
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.0    8e-08   
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A            57.0    8e-08   
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2   56.6    9e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.0    9e-08   
gb|AAB66887.1|  glyceraldehyde-3-phosphate dehydrogenase              55.8    9e-08   Oryza sativa [red rice]
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg           56.6    9e-08   
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.0    9e-08   
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase              56.6    9e-08   
gb|ACU21011.1|  unknown                                               57.0    9e-08   Glycine max [soybeans]
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.0    9e-08   
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.0    9e-08   
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...  57.0    9e-08   
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g           57.0    9e-08   
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2   56.6    9e-08   Physcomitrella patens
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase              57.0    9e-08   
dbj|BAH57068.1|  AT1G12900                                            56.6    9e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A       57.0    9e-08   
ref|XP_010502598.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    9e-08   
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  57.0    9e-08   
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  57.0    9e-08   
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.0    9e-08   
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...  57.0    9e-08   
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.0    1e-07   
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    1e-07   
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g           57.0    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    1e-07   
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase              56.6    1e-07   
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.0    1e-07   
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    1e-07   
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg           56.6    1e-07   
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A           56.6    1e-07   
ref|WP_010175278.1|  glyceraldehyde-3-phosphate dehydrogenase         56.6    1e-07   
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    1e-07   
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    1e-07   
ref|XP_002875330.1|  gapa                                             56.6    1e-07   
emb|CDX83635.1|  BnaC07g23750D                                        56.6    1e-07   
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  56.6    1e-07   
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...  56.6    1e-07   
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    1e-07   
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    1e-07   
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    1e-07   
ref|XP_010425376.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.2    1e-07   
gb|KDP41897.1|  hypothetical protein JCGZ_26915                       56.6    1e-07   
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    1e-07   
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    1e-07   
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    1e-07   
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...  56.6    1e-07   
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit  56.6    1e-07   
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase              56.6    1e-07   
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    1e-07   
dbj|BAJ90530.1|  predicted protein                                    56.6    1e-07   
dbj|BAJ90885.1|  predicted protein                                    56.6    1e-07   
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    1e-07   
gb|AHH08019.1|  Glyceraldehyde 3-phosphate dehydrogenase              56.2    1e-07   
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    1e-07   
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    1e-07   
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg           56.6    1e-07   
ref|NP_001052984.1|  Os04g0459500                                     56.6    1e-07   
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.2    1e-07   
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg           56.2    1e-07   
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                  56.2    1e-07   
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  56.2    1e-07   
dbj|BAK02737.1|  predicted protein                                    55.8    1e-07   
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                 56.2    1e-07   
gb|AAB82133.1|  glyceralehyde-3-phosphate dehydrogenase subunit       55.8    2e-07   
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                 56.2    2e-07   
emb|CDY28536.1|  BnaC02g36240D                                        55.8    2e-07   
gb|ADB81494.1|  glyceraldehyde-3-phosphate dehydrogenase              55.8    2e-07   
ref|WP_021281480.1|  glyceraldehyde-3-phosphate dehydrogenase         55.8    2e-07   
ref|XP_001766703.1|  predicted protein                                55.8    2e-07   
ref|WP_011098686.1|  glyceraldehyde-3-phosphate dehydrogenase         55.8    2e-07   
ref|WP_039260564.1|  glyceraldehyde-3-phosphate dehydrogenase         55.5    2e-07   
ref|WP_023437217.1|  glyceraldehyde 3-phosphate dehydrogenase         55.5    2e-07   
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase  55.8    2e-07   
ref|WP_010261680.1|  glyceraldehyde 3-phosphate dehydrogenase (gap)   53.5    2e-07   
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase              55.8    2e-07   
ref|WP_032086619.1|  glyceraldehyde-3-phosphate dehydrogenase         55.5    2e-07   
emb|CBI29293.3|  unnamed protein product                              55.5    2e-07   
ref|XP_001771209.1|  predicted protein                                55.8    2e-07   
ref|WP_028393604.1|  glyceraldehyde-3-phosphate dehydrogenase         55.5    2e-07   
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase              55.5    2e-07   
ref|XP_010929533.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...  54.7    2e-07   
ref|XP_001771246.1|  predicted protein                                55.5    2e-07   
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1   55.5    3e-07   
gb|ABY71860.1|  glyceraldehyde-3-phosphate dehydrogenase              53.1    3e-07   
gb|ADB81489.1|  glyceraldehyde-3-phosphate dehydrogenase              55.1    3e-07   
ref|XP_001753934.1|  predicted protein                                55.5    3e-07   
ref|XP_001779769.1|  predicted protein                                55.5    3e-07   
ref|XP_005843104.1|  hypothetical protein CHLNCDRAFT_49269            55.1    3e-07   
ref|XP_001779753.1|  predicted protein                                55.5    3e-07   
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  55.1    3e-07   
ref|WP_031541700.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    3e-07   
ref|WP_027358717.1|  glyceraldehyde-3-phosphate dehydrogenase         55.1    3e-07   
ref|WP_034439122.1|  glyceraldehyde-3-phosphate dehydrogenase         55.1    3e-07   
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase     55.5    3e-07   
ref|WP_040375827.1|  glyceraldehyde-3-phosphate dehydrogenase         55.1    3e-07   
ref|WP_038537249.1|  glyceraldehyde-3-phosphate dehydrogenase         55.1    3e-07   
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    55.1    3e-07   
ref|WP_028324839.1|  glyceraldehyde-3-phosphate dehydrogenase         55.1    3e-07   
gb|KHG21941.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  55.1    4e-07   
gb|ABA41014.1|  glyceraldehyde-3-phosphate dehydrogenase              53.5    4e-07   
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A       55.1    4e-07   
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase         55.1    4e-07   
gb|ABA41007.1|  glyceraldehyde-3-phosphate dehydrogenase              53.5    4e-07   
gb|ABA41008.1|  glyceraldehyde-3-phosphate dehydrogenase              53.5    4e-07   
gb|ACA04297.1|  glyceraldehyde-3-phosphate dehydrogenase              53.5    4e-07   
ref|WP_007788681.1|  glyceraldehyde-3-phosphate dehydrogenase         54.7    4e-07   
gb|ACA04347.1|  glyceraldehyde-3-phosphate dehydrogenase              53.5    4e-07   
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase              54.7    4e-07   
emb|CAA33264.1|  unnamed protein product                              55.1    4e-07   
ref|WP_031368666.1|  glyceraldehyde-3-phosphate dehydrogenase         52.8    4e-07   
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...  55.1    4e-07   
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  55.1    4e-07   
gb|ABD37953.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    54.7    4e-07   
ref|WP_013675528.1|  glyceraldehyde-3-phosphate dehydrogenase         54.7    4e-07   
emb|CDY48981.1|  BnaA02g28150D                                        54.7    4e-07   
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  55.1    4e-07   
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  54.7    4e-07   
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  55.1    4e-07   
emb|CAN78872.1|  hypothetical protein VITISV_021726                   55.1    4e-07   
ref|WP_014721817.1|  glyceraldehyde-3-phosphate dehydrogenase         54.3    4e-07   
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  54.7    4e-07   
ref|WP_033051313.1|  glyceraldehyde-3-phosphate dehydrogenase         52.8    5e-07   
ref|WP_002016071.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  54.7    5e-07   
ref|WP_020954451.1|  glyceraldehyde-3-phosphate dehydrogenase         54.7    5e-07   
gb|ABY71870.1|  glyceraldehyde-3-phosphate dehydrogenase              52.4    5e-07   
ref|WP_000161234.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  54.3    5e-07   
ref|WP_002174168.1|  glyceraldehyde-3-phosphate dehydrogenase         54.3    5e-07   
gb|EWH23303.1|  glyceraldehyde-3-phosphate dehydrogenase              54.3    5e-07   
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase         54.3    5e-07   
ref|WP_020453005.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  54.3    5e-07   
ref|WP_007438711.1|  glyceraldehyde-3-phosphate dehydrogenase         54.3    5e-07   
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  54.7    5e-07   
gb|ABK00056.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  54.3    5e-07   
ref|WP_007409954.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  54.3    6e-07   
ref|WP_003151611.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  54.3    6e-07   
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [       54.3    6e-07   
ref|WP_015080375.1|  type I glyceraldehyde-3-phosphate dehydrogenase  54.3    7e-07   
ref|WP_035239781.1|  glyceraldehyde-3-phosphate dehydrogenase         53.9    7e-07   
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase         53.9    7e-07   
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  53.9    7e-07   
gb|ABY71853.1|  glyceraldehyde-3-phosphate dehydrogenase              52.0    7e-07   
ref|WP_007083464.1|  glyceraldehyde-3-phosphate dehydrogenase         53.9    7e-07   
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase              54.3    7e-07   
gb|ADB81488.1|  glyceraldehyde-3-phosphate dehydrogenase              53.9    7e-07   
gb|EZP74974.1|  glyceraldehyde-3-phosphate dehydrogenase              53.9    7e-07   
gb|ABY71843.1|  glyceraldehyde-3-phosphate dehydrogenase              52.0    7e-07   
ref|WP_020961191.1|  glyceraldehyde-3-phosphate dehydrogenase         53.9    7e-07   
ref|WP_036198701.1|  glyceraldehyde-3-phosphate dehydrogenase         53.9    8e-07   
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase         53.9    8e-07   
ref|WP_026588822.1|  glyceraldehyde-3-phosphate dehydrogenase         53.9    8e-07   
ref|WP_010196833.1|  glyceraldehyde-3-phosphate dehydrogenase         53.9    8e-07   
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase         53.9    8e-07   
ref|WP_039964099.1|  glyceraldehyde-3-phosphate dehydrogenase         53.9    8e-07   
ref|WP_035391159.1|  glyceraldehyde-3-phosphate dehydrogenase         53.9    8e-07   
ref|WP_028085442.1|  glyceraldehyde-3-phosphate dehydrogenase         53.9    8e-07   
ref|WP_017367827.1|  glyceraldehyde-3-phosphate dehydrogenase         53.9    9e-07   
ref|WP_027409933.1|  glyceraldehyde-3-phosphate dehydrogenase         53.9    9e-07   
ref|WP_018131164.1|  hypothetical protein                             53.9    9e-07   
gb|AGJ81638.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    9e-07   
ref|WP_039200023.1|  glyceraldehyde-3-phosphate dehydrogenase         53.9    9e-07   
ref|WP_039168875.1|  glyceraldehyde-3-phosphate dehydrogenase         53.9    9e-07   
gb|AGJ81614.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    9e-07   
gb|ADB81485.1|  glyceraldehyde-3-phosphate dehydrogenase              53.5    1e-06   
gb|AGJ81619.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|AGJ81615.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|AGJ81618.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
ref|WP_027623758.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
gb|AGJ81612.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|AGJ81620.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
ref|WP_026677540.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
gb|AGJ81634.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|AGJ81622.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|AGJ81608.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|AGJ81613.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|AGJ81617.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|AGJ81607.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
ref|WP_034309982.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
gb|AGJ81604.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|AGJ81599.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
emb|CAC81001.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  53.5    1e-06   
ref|WP_004071988.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
gb|AGJ81629.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
ref|WP_034674243.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
ref|WP_012576013.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
ref|WP_019417454.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
gb|ABQ43038.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|AGJ81600.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|ABQ43028.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|ABQ43030.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|ABQ43037.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...  53.5    1e-06   
ref|WP_035150823.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
ref|WP_004892494.1|  glyceraldehyde-3-phosphate dehydrogenase, typeI  53.5    1e-06   
gb|ABQ43026.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
ref|WP_032101170.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
ref|WP_035049811.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
ref|WP_003397294.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
ref|WP_009362289.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  53.5    1e-06   
gb|AGJ81605.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|AGJ81601.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|AGJ81627.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
ref|WP_009793075.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  53.5    1e-06   
gb|ABQ43040.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|ABQ43039.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|AGJ81602.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
gb|ABQ43041.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
ref|WP_006320213.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
ref|WP_002656453.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  53.5    1e-06   
gb|AGJ81603.1|  glyceraldehyde 3-phosphate dehydrogenase              53.5    1e-06   
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  53.5    1e-06   
ref|WP_039075458.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
ref|WP_002658311.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
ref|WP_010331916.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
ref|WP_010328646.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
ref|WP_017416743.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g           53.5    1e-06   
gb|ABK94956.1|  unknown                                               53.5    1e-06   
ref|WP_033916465.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
ref|WP_019242993.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
ref|WP_011772018.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
ref|WP_014023315.1|  glyceraldehyde-3-phosphate dehydrogenase         53.5    1e-06   
ref|WP_033827865.1|  glyceraldehyde-3-phosphate dehydrogenase         53.1    1e-06   
ref|WP_010294251.1|  glyceraldehyde-3-phosphate dehydrogenase         53.1    1e-06   
gb|ABK96233.1|  unknown                                               53.5    1e-06   
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  53.5    1e-06   
ref|WP_020587561.1|  glyceraldehyde-3-phosphate dehydrogenase         53.1    1e-06   
gb|AHH05361.1|  Glyceraldehyde 3-phosphate dehydrogenase              53.1    1e-06   
pdb|3HJA|A  Chain A, Crystal Structure Of Glyceraldehyde-3-Phosph...  53.5    1e-06   
ref|WP_000161239.1|  glyceraldehyde-3-phosphate dehydrogenase         53.1    1e-06   
ref|WP_007200553.1|  glyceraldehyde-3-phosphate dehydrogenase         53.1    1e-06   
gb|AEW46689.1|  glyceraldehyde-3-phosphate dehydrogenase              53.1    1e-06   
ref|WP_037038705.1|  glyceraldehyde-3-phosphate dehydrogenase         53.1    1e-06   
ref|WP_036173916.1|  glyceraldehyde-3-phosphate dehydrogenase         53.1    1e-06   
gb|ABD37956.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    52.8    2e-06   
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    53.5    2e-06   
emb|CEA05649.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           53.1    2e-06   
ref|WP_036142314.1|  glyceraldehyde-3-phosphate dehydrogenase         53.1    2e-06   
ref|WP_024423501.1|  glyceraldehyde-3-phosphate dehydrogenase         53.1    2e-06   
ref|WP_022668496.1|  glyceraldehyde-3-phosphate dehydrogenase         53.1    2e-06   
ref|WP_012011304.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  53.1    2e-06   
ref|WP_038605357.1|  glyceraldehyde-3-phosphate dehydrogenase         53.1    2e-06   
ref|WP_007500174.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  53.1    2e-06   
ref|WP_038536649.1|  glyceraldehyde-3-phosphate dehydrogenase         53.1    2e-06   
emb|CAC81003.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  52.8    2e-06   
ref|WP_003326869.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  53.1    2e-06   
ref|WP_012421836.1|  glyceraldehyde-3-phosphate dehydrogenase         52.8    2e-06   
ref|WP_003347486.1|  glyceraldehyde-3-phosphate dehydrogenase         52.8    2e-06   
ref|WP_027985267.1|  glyceraldehyde-3-phosphate dehydrogenase         52.8    2e-06   
gb|ABY71869.1|  glyceraldehyde-3-phosphate dehydrogenase              50.8    2e-06   
gb|ABY71866.1|  glyceraldehyde-3-phosphate dehydrogenase              50.8    2e-06   
gb|ABK96725.1|  unknown                                               53.1    2e-06   



>ref|XP_002540513.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF21870.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=193

 Score = 74.7 bits (182),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  36   TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  91



>gb|ABF74607.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase B subunit 
[Agave tequilana]
Length=174

 Score = 73.9 bits (180),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  15   TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  70



>ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=458

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  301  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  356



>gb|KHN20097.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=452

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  296  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  351



>ref|XP_006581071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B subunit 
isoform X1 [Glycine max]
Length=453

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  297  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  352



>gb|ACU20783.1| unknown [Glycine max]
Length=452

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  296  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  351



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  350



>ref|XP_006577850.1| PREDICTED: uncharacterized protein LOC100806482 isoform X1 [Glycine 
max]
Length=452

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  296  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  351



>ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
 gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
Length=451

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  350



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  296  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  351



>ref|XP_010061201.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68119.1| hypothetical protein EUGRSUZ_F01793 [Eucalyptus grandis]
Length=454

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  296  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  351



>ref|XP_010094540.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
 gb|EXB56294.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
Length=1333

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAEDVNAAFR
Sbjct  298  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEDVNAAFR  353



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  350



>emb|CAC80374.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=317

 Score = 72.8 bits (177),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAEDVNAAFR
Sbjct  206  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEDVNAAFR  261



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  350



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  350



>emb|CDP07271.1| unnamed protein product [Coffea canephora]
Length=458

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+K+GLTAEDVNAAFR
Sbjct  301  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKRGLTAEDVNAAFR  356



>emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera]
Length=453

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  296  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  351



>ref|XP_006435406.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48646.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=453

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  296  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  351



>ref|XP_002273754.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Vitis vinifera]
 emb|CBI40744.3| unnamed protein product [Vitis vinifera]
Length=453

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  296  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  351



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGL+AEDVNAAFR
Sbjct  294  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLSAEDVNAAFR  349



>ref|XP_010478985.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X1 [Camelina sativa]
Length=402

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  246  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  301



>gb|KDO85174.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=409

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLV+PQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  296  TSTGAAKAVSLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  351



>emb|CDY69523.1| BnaC08g46180D, partial [Brassica napus]
Length=402

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  245  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  300



>ref|NP_174996.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
 sp|P25857.2|G3PB_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPB, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase B; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51517.1|AC068324_5 glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAA32795.1| glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAK62594.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAK64065.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAL85133.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAM19948.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAM98232.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72278.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 dbj|BAF02115.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AEE31933.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
Length=447

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  291  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  346



>ref|XP_002891244.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67503.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=447

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  291  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  346



>ref|XP_006473831.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85173.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=453

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLV+PQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  296  TSTGAAKAVSLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  351



>ref|XP_009107645.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Brassica rapa]
 emb|CDY35800.1| BnaA08g04610D [Brassica napus]
Length=448

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  291  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  346



>gb|KFK29151.1| hypothetical protein AALP_AA7G095400 [Arabis alpina]
Length=448

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  291  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  346



>ref|XP_010478986.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X2 [Camelina sativa]
Length=445

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  289  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  344



>ref|XP_010500213.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic-like 
[Camelina sativa]
Length=447

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  291  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  346



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  257  TSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  312



>ref|XP_002981126.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
 gb|EFJ17827.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
Length=431

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFR
Sbjct  274  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVDKKGMTAEDVNAAFR  329



>dbj|BAK05515.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=147

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  34   TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFR  89



>ref|XP_002982608.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
 gb|EFJ16361.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
Length=431

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFR
Sbjct  274  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVDKKGMTAEDVNAAFR  329



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG++AEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFR  350



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG++AEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFR  350



>gb|AEO45784.1| glyceraldehyde-3-phosphate dehydrogenase B [Scoparia dulcis]
Length=452

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN+AFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNSAFR  350



>ref|XP_002300632.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
 gb|EEE79905.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
Length=474

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  317  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  372



>emb|CAC80389.2| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=457

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKGLTAEDVN AFR
Sbjct  301  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGLTAEDVNNAFR  356



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFR
Sbjct  293  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFR  348



>gb|KGN49135.1| hypothetical protein Csa_6G514950 [Cucumis sativus]
Length=191

 Score = 70.1 bits (170),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFR
Sbjct  34   TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFR  89



>gb|EYU41184.1| hypothetical protein MIMGU_mgv1a014833mg [Erythranthe guttata]
Length=177

 Score = 70.1 bits (170),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG++AE++NAAFR
Sbjct  90   TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEEINAAFR  145



>ref|XP_011041188.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Populus euphratica]
Length=452

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFR  350



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFR  350



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  294  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  349



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  294  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  349



>ref|XP_010270515.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nelumbo nucifera]
Length=452

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  350



>gb|AAG23800.1| chloroplast NADP-dependent glyceraldehyde 3-phosphate dehydrogenase 
B subunit [Cucurbita pepo]
Length=171

 Score = 69.7 bits (169),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFR
Sbjct  60   TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFR  115



>ref|XP_008786670.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Phoenix dactylifera]
Length=452

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNQAFR  350



>gb|AIU56855.1| glyceraldehyde-3-phosphate dehydrogenase B, partial [Brassica 
rapa subsp. chinensis]
Length=367

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  211  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  266



>ref|XP_011034837.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Populus euphratica]
Length=450

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  350



>ref|XP_011034836.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Populus euphratica]
Length=452

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  350



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  297  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  352



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  298  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  353



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFR
Sbjct  264  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFR  319



>ref|XP_004985859.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Setaria italica]
Length=445

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKG+TA+DVNAAFR
Sbjct  287  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGMTADDVNAAFR  342



>gb|AES74101.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=317

 Score = 70.5 bits (171),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFR
Sbjct  161  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFR  216



>ref|XP_009362873.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=408

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFR  350



>gb|ADH43199.1| glyceraldehyde-3-phosphate dehydrogenase [Vicia sativa]
Length=380

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFR
Sbjct  273  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFR  328



>ref|XP_006395998.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
 dbj|BAJ34314.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33284.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
Length=447

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKGLTAEDVN AFR
Sbjct  291  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGLTAEDVNEAFR  346



>ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55522.1| hypothetical protein Csa_4G664300 [Cucumis sativus]
Length=451

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFR
Sbjct  294  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFR  349



>ref|XP_008452998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Cucumis melo]
Length=451

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFR
Sbjct  294  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFR  349



>ref|XP_008452997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Cucumis melo]
Length=452

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFR  350



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFR  350



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFR  350



>gb|AES74103.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=415

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFR  350



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFR  350



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFR  350



>gb|ABK00053.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=393

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTG AKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKGLTAEDVN AFR
Sbjct  272  TSTGVAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGLTAEDVNNAFR  327



>ref|XP_009362872.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=450

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFR  350



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFR
Sbjct  294  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFR  349



>gb|AAD10210.1| glyceraldehyde 3-phosphate dehydrogenase B subunit [Arabidopsis 
thaliana]
Length=402

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  246  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  301



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFR  350



>emb|CAA33262.1| unnamed protein product [Pisum sativum]
Length=447

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFR
Sbjct  291  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFR  346



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFR  350



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFR  350



>ref|XP_007515295.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO14174.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=405

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAFR
Sbjct  250  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGITAEEVNAAFR  305



>ref|XP_004300121.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=452

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG+TAEDVN AFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGITAEDVNGAFR  350



>ref|XP_003603850.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=490

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFR  350



>gb|ABK24645.1| unknown [Picea sitchensis]
Length=460

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR
Sbjct  303  TTTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFR  358



>gb|ACN40006.1| unknown [Picea sitchensis]
Length=460

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR
Sbjct  303  TTTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFR  358



>gb|ACN40526.1| unknown [Picea sitchensis]
Length=460

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR
Sbjct  303  TTTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFR  358



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFR
Sbjct  293  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFR  348



>ref|XP_004500847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFR
Sbjct  369  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFR  424



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++AEDVNAAFR
Sbjct  293  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISAEDVNAAFR  348



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR
Sbjct  293  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFR  348



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFR
Sbjct  264  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFR  319



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG++AEDVNAAFR
Sbjct  294  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFR  349



>ref|XP_006307502.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
 gb|EOA40400.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
Length=447

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAE+VN AFR
Sbjct  291  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEEVNEAFR  346



>ref|XP_009384600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=447

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVN AFR
Sbjct  290  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGMTAEDVNNAFR  345



>ref|XP_009384599.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=449

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVN AFR
Sbjct  292  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGMTAEDVNNAFR  347



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+ AED+N+AFR
Sbjct  283  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGIAAEDINSAFR  338



>ref|XP_009382077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=452

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGMTAEDVNDAFR  350



>ref|XP_007135965.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
 gb|ESW07959.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
Length=451

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVN AFR
Sbjct  295  TSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNGAFR  350



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG+TAEDVN AFR
Sbjct  294  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGITAEDVNNAFR  349



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFR
Sbjct  295  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNQAFR  350



>gb|ABK00057.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Mesostigma 
viride]
Length=384

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLV+N  KKG+TAE+VNAAFR
Sbjct  230  TSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVINTTKKGMTAEEVNAAFR  285



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLV+N  KKG+TAE+VNAAFR
Sbjct  258  TSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVINTTKKGMTAEEVNAAFR  313



>emb|CEF96577.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=407

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF+
Sbjct  251  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFK  306



>ref|XP_003074208.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC) [Ostreococcus 
tauri]
Length=434

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF+
Sbjct  278  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFK  333



>gb|ABG85191.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
B [Ostreococcus tauri]
Length=439

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF+
Sbjct  283  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFK  338



>ref|XP_002507103.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
 gb|ACO68361.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
Length=405

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLV NV+KKG+TAE+VNAAF+
Sbjct  250  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVCNVEKKGVTAEEVNAAFK  305



>gb|EMT30317.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Aegilops 
tauschii]
Length=442

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  287  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFR  342



>sp|P12860.1|G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Spinacia oleracea]
 emb|CAA33263.1| unnamed protein product [Spinacia oleracea]
 gb|AAD10218.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
B [Spinacia oleracea]
Length=451

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++K G+TAEDVN AFR
Sbjct  294  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFR  349



>dbj|BAJ87214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  287  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFR  342



>dbj|BAJ86633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  287  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFR  342



>gb|EMS49604.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Triticum 
urartu]
Length=444

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  287  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFR  342



>emb|CAC80390.1| glyceraldehyde-3-phosphate dehydrogenase [Coleochaete scutata]
Length=317

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVVN  KKG TAEDVN AFR
Sbjct  205  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVNTVKKGFTAEDVNTAFR  260



>ref|XP_001415434.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABG85192.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
B [Ostreococcus 'lucimarinus']
 gb|ABO93726.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=406

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAE+VNAAF+
Sbjct  251  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGVTAEEVNAAFK  306



>gb|ABD37966.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Spirogyra 
sp. SAG 170.80]
Length=321

 Score = 67.4 bits (163),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+N +KKG+TAE+VNAAFR
Sbjct  209  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVINTEKKGMTAEEVNAAFR  264



>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|Q Chain Q, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|T Chain T, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=368

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++K G+TAEDVN AFR
Sbjct  211  TSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFR  266



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  290  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTAKTGITADDVNAAFR  345



>ref|XP_003056194.1| hypothetical protein MICPUCDRAFT_25339 [Micromonas pusilla CCMP1545]
 gb|EEH59570.1| hypothetical protein MICPUCDRAFT_25339 [Micromonas pusilla CCMP1545]
Length=406

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF+
Sbjct  250  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFK  305



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  287  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFR  342



>ref|NP_001048847.1| Os03g0129300 [Oryza sativa Japonica Group]
 dbj|BAA85402.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AAN17393.1| Putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 gb|ABF93788.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10761.1| Os03g0129300 [Oryza sativa Japonica Group]
 gb|EAY88378.1| hypothetical protein OsI_09835 [Oryza sativa Indica Group]
 gb|EAZ25455.1| hypothetical protein OsJ_09272 [Oryza sativa Japonica Group]
Length=444

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  287  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFR  342



>gb|ABF93789.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG90581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  161  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFR  216



>gb|ABD37964.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Chlorokybus 
atmophyticus]
Length=458

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKG+TA+ VNAAFR
Sbjct  298  TTTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGITADQVNAAFR  353



>ref|XP_003055659.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
 gb|EEH60911.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
Length=380

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVD+V+ V+KK  TAEDVNAAFR
Sbjct  251  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDMVIQVEKK-CTAEDVNAAFR  305



>ref|XP_008650588.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Zea mays]
 gb|ACF78460.1| unknown [Zea mays]
 gb|ACF87738.1| unknown [Zea mays]
 gb|ACG28147.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACG29047.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACR36877.1| unknown [Zea mays]
 tpg|DAA43140.1| TPA: glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
Length=449

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  292  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFR  347



>emb|CAC80378.2| glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=480

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+ KG TAEDVN AFR
Sbjct  321  TTTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVNVENKGCTAEDVNDAFR  376



>ref|XP_002503470.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
 gb|ACO64728.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
Length=377

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVD+ +  +KK  TAE++NAAFR
Sbjct  249  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDMCIQTEKK-CTAEEINAAFR  303



>gb|ADB81483.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Boodlea composita]
Length=168

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 52/56 (93%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK LT E+VN AFR
Sbjct  59   TTTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTLT-EEVNEAFR  113



>gb|ABK00067.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlorokybus atmophyticus]
Length=325

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLV+  +KK   AE+VNAAFR
Sbjct  186  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVIQTEKKTF-AEEVNAAFR  240



>gb|ABS72003.1| putative chloroplast glyceradehyde-3-phosphate dehydrogenase 
subunit B [Olea europaea]
Length=149

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -1

Query  141  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG+TAEDVNAAFR
Sbjct  1    SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGITAEDVNAAFR  47



>ref|XP_001420043.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98336.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=341

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+   KK +TA++VNAAFR
Sbjct  214  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVIQTSKK-VTADEVNAAFR  268



>gb|ABD37959.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorokybus 
atmophyticus]
Length=347

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLV+  +KK   AE+VNAAFR
Sbjct  208  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVIQTEKKTF-AEEVNAAFR  262



>gb|ABG85190.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus 'lucimarinus']
Length=380

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+   KK +TA++VNAAFR
Sbjct  253  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVIQTSKK-VTADEVNAAFR  307



>ref|XP_003081785.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC), partial [Ostreococcus 
tauri]
Length=378

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV   KK  TA++VNAAFR
Sbjct  251  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQTSKK-CTADEVNAAFR  305



>gb|ABG85189.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus tauri]
 emb|CEF99493.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=380

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV   KK  TA++VNAAFR
Sbjct  253  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQTSKK-CTADEVNAAFR  307



>gb|ABS86942.1| glyceraldehyde-3-phosphate dehydrogenase [Garcinia mangostana]
Length=136

 Score = 58.2 bits (139),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  36   TSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  90



>gb|ACN57670.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57672.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57673.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57674.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57675.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57676.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57678.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57679.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57682.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57683.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57684.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57685.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57686.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57687.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57688.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57689.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57690.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57691.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57692.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57693.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57694.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57695.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57696.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57697.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57698.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57699.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57700.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57701.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57702.1| At3g26650-like protein [Capsella grandiflora]
Length=127

 Score = 57.8 bits (138),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  20   TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  74



>gb|ACC59148.1| At3G26650-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ACC59149.1| At3G26650-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ACC59150.1| At3G26650-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ACC59151.1| At3G26650-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ACC59152.1| At3G26650-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ACC59153.1| At3G26650-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ACC59154.1| At3G26650-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ACC59156.1| At3G26650-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ACC59157.1| At3G26650-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ACC59158.1| At3G26650-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ACC59159.1| At3G26650-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ACC59160.1| At3G26650-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ACC59161.1| At3G26650-like protein [Arabidopsis lyrata subsp. lyrata]
Length=93

 Score = 57.4 bits (137),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  19   TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  73



>gb|ACC59155.1| At3G26650-like protein [Arabidopsis lyrata subsp. lyrata]
Length=91

 Score = 57.4 bits (137),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  17   TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  71



>gb|ADB81487.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Cladophora 
albida]
Length=273

 Score = 59.3 bits (142),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+ V+KK L AE+VN AFR
Sbjct  185  TTTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVIQVEKKTL-AEEVNQAFR  239



>dbj|BAD93961.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=161

 Score = 58.2 bits (139),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  34   TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  88



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 52/56 (93%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  268  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  322



>emb|CAC80392.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Spirogyra 
sp.]
Length=318

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLP LKGKLNGIALRVPTPNVSVVDLV+  +KK   AE+VNAAFR
Sbjct  207  TSTGAAKAVSLVLPSLKGKLNGIALRVPTPNVSVVDLVIQTEKKTF-AEEVNAAFR  261



>gb|EYU35565.1| hypothetical protein MIMGU_mgv1a005886mg [Erythranthe guttata]
Length=466

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 52/56 (93%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  339  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  393



>ref|WP_002844711.1| MULTISPECIES: glyceraldehyde-3-phosphate dehydrogenase [Peptostreptococcus]
 gb|EFD04189.1| glyceraldehyde-3-phosphate dehydrogenase, type I [Peptostreptococcus 
anaerobius 653-L]
 gb|EKX89146.1| glyceraldehyde-3-phosphate dehydrogenase, type I [Peptostreptococcus 
anaerobius VPI 4330 = DSM 2949]
 emb|CCY50230.1| glyceraldehyde-3-phosphate dehydrogenase type I [Peptostreptococcus 
anaerobius CAG:621]
Length=339

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAV+LVLPQLKGKLNG +LRVPT  VS+VDLVVNV+KK +TAE+VNAA +
Sbjct  211  TTTGAAKAVALVLPQLKGKLNGFSLRVPTQTVSIVDLVVNVRKKDITAEEVNAALK  266



>gb|AEO45783.1| glyceraldehyde-3-phosphate dehydrogenase A [Scoparia dulcis]
Length=398

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 52/56 (93%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  271  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  325



>gb|ABW89104.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
Length=195

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  68   TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  122



>gb|ADB81484.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Bornetella 
sphaerica]
Length=277

 Score = 58.9 bits (141),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAV+LVLPQLKGKLNGIALRVPTP VSVVDLVV  +KK   AE+VNAAF+
Sbjct  185  TTTGAAKAVALVLPQLKGKLNGIALRVPTPTVSVVDLVVQTEKKTF-AEEVNAAFK  239



>gb|ABD37960.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Coleochaete 
scutata]
Length=314

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAA+AV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+  +KK   AE+VNAAFR
Sbjct  206  TSTGAAQAVALVLPQLKGKLNGIALRVPTPNVSVVDLVIQTEKKTF-AEEVNAAFR  260



>ref|XP_011070460.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Sesamum indicum]
Length=399

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 52/56 (93%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  272  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  326



>gb|AAG23799.1| chloroplast NADP-dependent glyceraldehyde 3-phosphate dehydrogenase 
A subunit [Cucurbita pepo]
Length=170

 Score = 57.8 bits (138),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  60   TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  114



>gb|ABW89099.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89100.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89101.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89102.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89103.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89105.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89106.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89107.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89108.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89109.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89110.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89111.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89112.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89113.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89114.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89115.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89116.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89117.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
Length=206

 Score = 57.8 bits (138),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  79   TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  133



>ref|XP_002955293.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
 gb|EFJ43593.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
Length=374

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAV+LVLPQLKGKLNGIALRVPTP VSVVDLVV V+KK   AE+VNAAFR
Sbjct  246  TTTGAAKAVALVLPQLKGKLNGIALRVPTPTVSVVDLVVQVEKKTF-AEEVNAAFR  300



>gb|ADD54591.1| putative glyceraldehyde-3-phosphate dehydrogenase [Linum usitatissimum]
Length=203

 Score = 57.8 bits (138),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  107  TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  161



>gb|ADB81493.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Nephroselmis 
olivacea]
Length=173

 Score = 57.4 bits (137),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVS+VDLVV V+KK   AE+VNAA R
Sbjct  59   TSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSIVDLVVQVEKKTF-AEEVNAAMR  113



>gb|ABY20971.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Hypericum 
perforatum]
Length=141

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  14   TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFR  68



>pdb|1JN0|O Chain O, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|A Chain A, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|B Chain B, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
Length=335

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  207  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  261



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  209  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  263



>gb|ADB81495.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Ulva intestinalis]
Length=166

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAV+LVLP++KGKLNGIALRVPTP VS+VDLV   +KK   AE+VNAAF+
Sbjct  57   TTTGAAKAVALVLPEVKGKLNGIALRVPTPTVSIVDLVXQTEKKTF-AEEVNAAFK  111



>gb|ADB81491.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Klebsormidium 
flaccidum]
Length=314

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+  +KK   AE+VN AFR
Sbjct  205  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVIQTEKKTF-AEEVNNAFR  259



>sp|P09672.1|G3PA_SINAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A, partial [Sinapis alba]
 emb|CAA27845.1| chloroplast GAPDH (233aa) [Sinapis alba]
Length=233

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  106  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  160



>ref|XP_007510189.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO18534.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=379

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLV+   KK +TAE+VN AFR
Sbjct  252  TSTGAAKAVALVLPELKGKLNGIALRVPTPNVSVVDLVIQTSKK-VTAEEVNNAFR  306



>emb|CAC80391.2| glyceraldehyde-3-phosphate dehydrogenase [Klebsormidium flaccidum]
Length=315

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+  +KK   AE+VN AFR
Sbjct  207  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVIQTEKKTF-AEEVNNAFR  261



>ref|XP_001689871.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 sp|P50362.1|G3PA_CHLRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAA86855.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP09609.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
Length=374

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAVSLVLP LKGKLNGIALRVPTP VSVVDLVV V+KK   AE+VNAAFR
Sbjct  246  TTTGAAKAVSLVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTF-AEEVNAAFR  300



>gb|ACN57671.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57677.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57680.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57681.1| At3g26650-like protein [Capsella rubella]
Length=127

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNA FR
Sbjct  20   TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNATFR  74



>gb|KFM26247.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
Length=412

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAV+LVLPQLKGKLNG+ALRVPTP VSVVDLV+  +KK  T E+VN+AFR
Sbjct  285  TTTGAAKAVALVLPQLKGKLNGVALRVPTPTVSVVDLVIQTEKKTFT-EEVNSAFR  339



>gb|ABD37957.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Cladophora 
rupestris]
Length=376

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 52/56 (93%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK L AE+VN AFR
Sbjct  249  TTTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTL-AEEVNQAFR  303



>gb|ADB81490.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Ignatius tetrasporus]
Length=168

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VN AFR
Sbjct  59   TTTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNNAFR  113



>emb|CAC80394.1| glyceraldehyde-3-phosphate dehydrogenase [Sphagnum cuspidatum]
Length=283

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  172  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  226



>gb|ADB81482.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Bolbocoleon 
piliferum]
Length=164

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAV+LVLP++ GKLNGIALR+PTP VS+VDLVV V+KK   AE+VNAAFR
Sbjct  59   TTTGAAKAVALVLPEVAGKLNGIALRIPTPTVSIVDLVVQVEKKTF-AEEVNAAFR  113



>gb|ABK00066.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=275

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV   KK   AE+VN AFR
Sbjct  184  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQTAKKTF-AEEVNNAFR  238



>gb|ABG35267.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
Length=224

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  97   TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  151



>gb|ADB81480.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Ulvella repens]
Length=168

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAV+LVLP++ GKLNGIALR+PTP VS+VDLVV V+KK   AE+VNAAFR
Sbjct  59   TTTGAAKAVALVLPEVAGKLNGIALRIPTPTVSIVDLVVQVEKKTF-AEEVNAAFR  113



>dbj|BAD72793.1| glyceraldehyde-3-phosphate dehydrogenase [Pinus thunbergii]
Length=207

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNA FR
Sbjct  106  TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAGFR  160



>gb|ACN39951.1| unknown [Picea sitchensis]
Length=330

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  202  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  256



>ref|XP_003579898.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR
Sbjct  276  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFR  330



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 52/56 (93%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  275  TSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  329



>gb|AFC88822.1| glyceraldehyde-3-phosphate dehydrogenase-like protein, partial 
[Miscanthus sinensis]
Length=316

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR
Sbjct  189  TSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFR  243



>gb|ADB81481.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Blastophysa 
rhizopus]
Length=168

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAV+LV+P LKGKLNGIALRVPTP VSVVDLV+ V+KK  +AE+VN AFR
Sbjct  59   TTTGAAKAVALVIPSLKGKLNGIALRVPTPTVSVVDLVLQVEKKT-SAEEVNEAFR  113



>ref|XP_006652373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=401

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR
Sbjct  274  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFR  328



>emb|CDP18560.1| unnamed protein product [Coffea canephora]
Length=386

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 52/56 (93%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  272  TSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  326



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 52/56 (93%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  275  TSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  329



>gb|AAZ79661.1| putative glyceraldehyde 3-phosphate dehydrogenase [Fagus sylvatica]
Length=125

 Score = 55.8 bits (133),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VN AFR
Sbjct  21   TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNLAFR  75



>ref|XP_006652372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=403

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR
Sbjct  276  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFR  330



>gb|ABG35250.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35251.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35252.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35253.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35256.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35257.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35258.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35259.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35260.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35261.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35262.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35263.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35264.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35265.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35266.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35268.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35269.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35270.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35271.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35272.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35273.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35274.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35275.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35276.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35277.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35278.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35279.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35280.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35281.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35282.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35283.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35284.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35285.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35286.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35287.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35288.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35289.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35290.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35291.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35292.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35293.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35294.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35295.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35296.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35297.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35298.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35299.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35300.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35301.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35302.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35303.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35304.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35305.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35306.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35307.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35308.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35309.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35310.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35311.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35312.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35313.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
Length=224

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  97   TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  151



>ref|XP_009148557.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  190  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  244



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  230  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  284



>ref|XP_009404713.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=404

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR
Sbjct  277  TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFR  331



>ref|XP_010528120.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=280

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  153  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  207



>ref|WP_036761887.1| glyceraldehyde-3-phosphate dehydrogenase [Peptostreptococcus 
sp. MV1]
 gb|KGF15631.1| glyceraldehyde-3-phosphate dehydrogenase [Peptostreptococcus 
sp. MV1]
Length=340

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAVSLVLPQL+GKLNG +LRVPT  VSVVDLVVN++KK +TAE++NAA +
Sbjct  212  TTTGAAKAVSLVLPQLEGKLNGFSLRVPTQTVSVVDLVVNLKKKDVTAEEINAALK  267



>gb|ABG35254.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35255.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
Length=224

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  97   TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  151



>gb|ACN40000.1| unknown [Picea sitchensis]
Length=410

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  282  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  336



>gb|ABK24313.1| unknown [Picea sitchensis]
Length=410

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  282  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  336



>gb|ABK25233.1| unknown [Picea sitchensis]
 gb|ABK26169.1| unknown [Picea sitchensis]
 gb|ACN40026.1| unknown [Picea sitchensis]
 gb|ACN40459.1| unknown [Picea sitchensis]
Length=410

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  282  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  336



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  271  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  325



>gb|ACN40537.1| unknown [Picea sitchensis]
Length=410

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  282  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  336



>dbj|BAA94304.1| NADP-glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas 
sp. W80]
Length=369

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP +KGKLNGIALRVPTPNVS+VDLVV V+KK   AE+VNAAFR
Sbjct  242  TSTGAAKAVALVLPSMKGKLNGIALRVPTPNVSIVDLVVQVEKKTF-AEEVNAAFR  296



>gb|AAA33780.1| glyceraldehyde-phosphate dehydrogenase [Pinus sylvestris]
Length=411

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  283  TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  337



>emb|CAA30152.1| GADPH (383 AA) [Zea mays]
Length=383

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR
Sbjct  256  TSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFR  310



>ref|XP_006844714.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
 gb|ERN06389.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
Length=398

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  271  TSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  325



>ref|NP_001077529.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28945.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=317

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  190  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  244



>emb|CAC80393.1| glyceraldehyde-3-phosphate dehydrogenase [Sphagnum cuspidatum]
Length=318

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  207  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  261



>tpg|DAA37469.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=403

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR
Sbjct  276  TSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFR  330



>ref|NP_001105414.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic precursor 
[Zea mays]
 sp|P09315.1|G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Zea mays]
 gb|AAA33464.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 emb|CAA33455.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=403

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAVSLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR
Sbjct  276  TSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFR  330



>ref|XP_005644071.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19527.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
Length=393

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 52/56 (93%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK L AE+VN AFR
Sbjct  267  TTTGAAKAVALVLPELKGKLNGIALRVPTPNVSVVDLVIQVEKKTL-AEEVNEAFR  321



>ref|XP_003548929.2| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde 3-phosphate dehydrogenase 
GAPA2, chloroplastic-like [Glycine max]
Length=346

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNA FR
Sbjct  218  TSTGAAKAVVLVLPTLKGKLNGIALRVPTPNVSVVDLVVQVTKKXTFAEEVNAVFR  273



>gb|ABA01156.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas 
incerta]
Length=342

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAV+LVLP LKGKLNGIALRVPTP VSVVDLVV V+KK   AE+VNAAFR
Sbjct  233  TTTGAAKAVALVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTF-AEEVNAAFR  287



>ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=404

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  277  TSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  331



>gb|KDO63479.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=293

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  166  TSTGAAKAVALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  220



>gb|ADU04755.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04760.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04761.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04762.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R
Sbjct  159  TSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALR  213



>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=337

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  210  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  264



>gb|ADU04754.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score = 56.6 bits (135),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R
Sbjct  159  TSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALR  213



>gb|ABA01125.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlamydomonas incerta]
Length=369

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAV+LVLP LKGKLNGIALRVPTP VSVVDLVV V+KK   AE+VNAAFR
Sbjct  241  TTTGAAKAVALVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTF-AEEVNAAFR  295



>emb|CCF55355.1| Glyceraldehyde-3-phosphate dehydrogenase A [Cucumis sativus]
Length=403

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPN SVVDLVV V KK   AE+VNAAFR
Sbjct  276  TSTGAAKAVALVLPSLKGKLNGIALRVPTPNASVVDLVVQVSKKTF-AEEVNAAFR  330



>gb|AIU56856.1| glyceraldehyde-3-phosphate dehydrogenase A, partial [Brassica 
rapa subsp. chinensis]
Length=336

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  209  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  263



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  273  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  327



>pdb|2PKR|O Chain O, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|R Chain R, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|P Chain P, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|Q Chain Q, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|A Chain A, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|B Chain B, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|C Chain C, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|D Chain D, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|H Chain H, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|I Chain I, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|L Chain L, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|M Chain M, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
Length=365

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  209  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  263



>emb|CAC80372.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=314

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  205  TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  259



>dbj|BAG68209.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=328

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  201  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  255



>dbj|BAN09110.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Artemisia 
indica]
Length=241

 Score = 56.2 bits (134),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKA +LVLP LKGKLNGIALR PTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  130  TSTGAAKAAALVLPSLKGKLNGIALRAPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  184



>gb|ABD37958.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Chara vulgaris]
Length=318

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV   KK   AE+VN AFR
Sbjct  207  TSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQTAKKTF-AEEVNNAFR  261



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  273  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  327



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  273  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  327



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  273  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  327



>ref|XP_010458726.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010458727.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=283

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  223  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  277



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326



>ref|XP_010476270.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  190  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  244



>ref|XP_010494750.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  190  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  244



>ref|XP_009118049.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  190  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  244



>emb|CAC80373.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=312

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  205  TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  259



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  209  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  263



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  209  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  263



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  209  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  263



>gb|AAD10209.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=350

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  223  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  277



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  253  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFR  307



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  274  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  328



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  282  TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  336



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  273  TSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFR  327



>gb|AGJ50596.1| GAPDH [Pericallis cruenta]
Length=399

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  271  TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  325



>ref|WP_039634088.1| glyceraldehyde-3-phosphate dehydrogenase [Clostridium argentinense]
 gb|KIE46117.1| glyceraldehyde-3-phosphate dehydrogenase, type I [Clostridium 
argentinense CDC 2741]
Length=335

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            T+TGAAKAVSLVLPQLKGKLNG+A+RVPTP VS+ DLV  ++K   TAE++NAAFR
Sbjct  209  TTTGAAKAVSLVLPQLKGKLNGMAVRVPTPTVSMTDLVCELEKTA-TAEEINAAFR  263



>ref|XP_004161334.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
Length=403

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  276  TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  330



>ref|XP_004145622.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57690.1| hypothetical protein Csa_3G252490 [Cucumis sativus]
Length=403

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  276  TSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  330



>gb|AHA84230.1| glyceraldehyde-3-phosphate dehydrogenase A [Phaseolus vulgaris]
Length=402

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  168  TSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  1
            TSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  275  TSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  329



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 527645914101