BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15666_g2_i1 len=376 path=[658:0-375]

Length=376
                                                                      Score     E

gb|ABK95316.1|  unknown                                                 126   5e-35   Populus trichocarpa [western balsam poplar]
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    133   3e-34   
ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    133   4e-34   
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    132   8e-34   
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    132   1e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g             131   1e-33   
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    131   2e-33   
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g             131   2e-33   Populus trichocarpa [western balsam poplar]
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    131   2e-33   
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    130   3e-33   
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B              130   3e-33   
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    130   5e-33   
ref|XP_002540513.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    125   5e-33   Ricinus communis
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg             130   6e-33   
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    130   6e-33   
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    129   6e-33   
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...    129   7e-33   
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...    129   1e-32   
gb|ABS72003.1|  putative chloroplast glyceradehyde-3-phosphate de...    123   1e-32   Olea europaea
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B         132   1e-32   
emb|CAN69459.1|  hypothetical protein VITISV_021576                     128   2e-32   Vitis vinifera
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    129   2e-32   
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    128   2e-32   Vitis vinifera
gb|ABF74607.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    123   2e-32   Agave tequilana
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                    128   2e-32   
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    128   2e-32   
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg             128   2e-32   
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    128   3e-32   
emb|CDY69523.1|  BnaC08g46180D                                          127   3e-32   
ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    127   3e-32   
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    127   3e-32   
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg             127   4e-32   
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    127   5e-32   
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    127   5e-32   
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    127   5e-32   Ricinus communis
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    127   6e-32   
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    127   6e-32   
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    127   6e-32   
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    127   6e-32   
emb|CDP07271.1|  unnamed protein product                                127   6e-32   
gb|ACU20783.1|  unknown                                                 127   7e-32   Glycine max [soybeans]
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    127   7e-32   
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    127   7e-32   
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    126   8e-32   
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    126   9e-32   
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    126   1e-31   
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg             126   1e-31   
ref|NP_001240080.1|  uncharacterized protein LOC100806482               126   1e-31   
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...    126   1e-31   
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B              125   1e-31   
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    126   1e-31   
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B              125   2e-31   
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    125   2e-31   
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               125   2e-31   
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B            125   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    125   3e-31   
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g             125   3e-31   
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit      124   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    125   4e-31   
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    124   4e-31   
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    124   4e-31   
gb|KGN49135.1|  hypothetical protein Csa_6G514950                       120   4e-31   
gb|AES74101.2|  glyceraldehyde-3-phosphate dehydrogenase B              122   7e-31   
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    124   7e-31   
gb|ABF93789.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    122   7e-31   Oryza sativa Japonica Group [Japonica rice]
gb|KDP36765.1|  hypothetical protein JCGZ_08056                         124   7e-31   
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           124   9e-31   
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    124   9e-31   
ref|NP_001048847.1|  Os03g0129300                                       123   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    123   1e-30   
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    123   1e-30   
emb|CAA33262.1|  unnamed protein product                                123   1e-30   Pisum sativum [garden pea]
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    123   1e-30   Pisum sativum [garden pea]
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    122   2e-30   
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    122   3e-30   
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    122   3e-30   
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    122   4e-30   
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    121   5e-30   
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    121   7e-30   
dbj|BAJ86633.1|  predicted protein                                      121   7e-30   
gb|EPS70760.1|  hypothetical protein M569_03997                         121   8e-30   
dbj|BAJ87214.1|  predicted protein                                      120   9e-30   
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    120   9e-30   
gb|ACJ84309.1|  unknown                                                 120   1e-29   Medicago truncatula
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    119   4e-29   
gb|ACJ13972.1|  putative glyceraldehyde-3-phosphate dehydrogenase       109   3e-28   Helianthus annuus
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    116   3e-28   
gb|ACN40006.1|  unknown                                                 116   3e-28   Picea sitchensis
gb|ABK24645.1|  unknown                                                 116   4e-28   Picea sitchensis
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             116   4e-28   
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             116   4e-28   
gb|ACN40526.1|  unknown                                                 116   4e-28   Picea sitchensis
gb|ACJ13973.1|  putative glyceraldehyde-3-phosphate dehydrogenase       107   9e-28   Helianthus annuus
gb|ACJ13997.1|  putative glyceraldehyde-3-phosphate dehydrogenase       106   3e-27   Helianthus petiolaris
gb|ABF93790.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    109   9e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190          111   2e-26   
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    108   2e-25   Spinacia oleracea
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...    107   3e-25   
gb|ACF84938.1|  unknown                                                 100   6e-25   Zea mays [maize]
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase               107   6e-25   Chara vulgaris
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase               107   7e-25   Marchantia polymorpha
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...    106   1e-24   
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    105   4e-24   
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      100   1e-22   Mesostigma viride
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      100   2e-22   Chlorokybus atmophyticus
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase           100   3e-22   
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  98.2    2e-21   
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  96.3    4e-21   Mesostigma viride
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.2    1e-19   
gb|AAA72117.1|  unnamed protein product                               85.5    4e-19   Zea mays [maize]
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339           86.7    2e-17   
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase         83.6    2e-16   
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B       83.6    3e-16   Micromonas commoda
ref|XP_001415434.1|  predicted protein                                82.8    4e-16   Ostreococcus lucimarinus CCE9901
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...  79.3    9e-15   
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...  79.3    1e-14   Nicotiana tabacum [American tobacco]
gb|AEW08707.1|  hypothetical protein CL1325Contig1_03                 73.2    1e-14   
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...  77.8    4e-14   
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  77.8    4e-14   Ostreococcus tauri
ref|XP_001771209.1|  predicted protein                                74.7    3e-13   
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  74.3    3e-13   Marchantia polymorpha
ref|XP_001771246.1|  predicted protein                                74.7    3e-13   
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase             74.3    4e-13   Marchantia polymorpha
gb|ABR18416.1|  unknown                                               74.7    5e-13   Picea sitchensis
gb|ABD37956.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    72.4    7e-13   Spermatozopsis similis
ref|XP_010430771.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  70.1    1e-12   
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680        73.2    1e-12   
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1   73.2    1e-12   Physcomitrella patens
ref|XP_001753934.1|  predicted protein                                73.2    1e-12   
ref|XP_001779753.1|  predicted protein                                73.2    2e-12   
ref|XP_001779769.1|  predicted protein                                72.8    2e-12   
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase              72.8    2e-12   
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  72.8    2e-12   
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  72.8    2e-12   
gb|ABY20971.1|  glyceraldehyde-3-phosphate dehydrogenase A subunit    70.1    2e-12   Hypericum perforatum
gb|KFM26247.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  72.8    2e-12   
gb|ABK96725.1|  unknown                                               72.8    2e-12   Populus trichocarpa x Populus deltoides
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  72.8    2e-12   
gb|ABK96233.1|  unknown                                               72.8    2e-12   Populus trichocarpa x Populus deltoides
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g           72.8    2e-12   
gb|ABK94956.1|  unknown                                               72.8    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010425376.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  71.6    2e-12   
ref|XP_010502598.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  71.6    2e-12   
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase  72.4    3e-12   Botryococcus braunii
gb|AFK24459.1|  glyceraldehyde-3-phosphate dehydrogenase              68.6    3e-12   
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  72.0    3e-12   
dbj|BAG90619.1|  unnamed protein product                              69.3    3e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...  72.4    3e-12   
gb|ELS46726.1|  glyceraldehyde-3-phosphate dehydrogenase 2            70.5    3e-12   
ref|WP_018398495.1|  glyceraldehyde-3-phosphate dehydrogenase         71.2    4e-12   
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2   70.9    5e-12   Physcomitrella patens
ref|WP_015163373.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  70.9    5e-12   
ref|XP_010507000.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  68.2    5e-12   
ref|XP_001766703.1|  predicted protein                                71.2    5e-12   
dbj|BAD94928.1|  glyceraldehyde 3-phosphate dehydrogenase A           67.4    5e-12   Arabidopsis thaliana [mouse-ear cress]
ref|WP_002760704.1|  glyceraldehyde-3-phosphate dehydrogenase         70.9    6e-12   
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...  70.5    6e-12   
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A            71.2    6e-12   
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...  70.5    6e-12   
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase         70.5    6e-12   
ref|WP_002752737.1|  glyceraldehyde-3-phosphate dehydrogenase         70.9    6e-12   
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...  70.5    6e-12   
ref|WP_002789220.1|  glyceraldehyde-3-phosphate dehydrogenase         70.9    7e-12   
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...  70.5    7e-12   
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...  70.5    7e-12
dbj|BAD93961.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit   68.6    7e-12   Arabidopsis thaliana [mouse-ear cress]
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...  70.5    7e-12   
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2       70.5    7e-12   
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase         70.5    7e-12   
emb|CDY28536.1|  BnaC02g36240D                                        70.9    7e-12   
gb|EPS59235.1|  hypothetical protein M569_15573                       71.2    7e-12   
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...  70.9    7e-12   Micromonas commoda
gb|ABW89104.1|  glyceraldehyde-3-phosphate dehydrogenase              68.9    7e-12   Helianthus annuus
emb|CDX83635.1|  BnaC07g23750D                                        70.9    7e-12   
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g           71.2    7e-12   
gb|ABG35250.1|  glyceraldehyde-3-phosphate dehydrogenase              69.3    7e-12   Helianthus annuus
emb|CDY13649.1|  BnaA06g32740D                                        70.9    7e-12   
gb|ABW89099.1|  glyceraldehyde-3-phosphate dehydrogenase              68.9    7e-12   Helianthus annuus
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  70.9    8e-12   
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  70.9    8e-12   
ref|WP_023068106.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  69.7    8e-12   
gb|ABG35254.1|  glyceraldehyde-3-phosphate dehydrogenase              68.9    8e-12   Helianthus annuus
dbj|BAK02737.1|  predicted protein                                    70.1    8e-12   
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A            70.9    8e-12   
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  70.9    8e-12   
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...  70.9    8e-12   
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561           70.9    8e-12   
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825           70.9    8e-12   
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg           70.9    8e-12   
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...  70.9    8e-12   
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  70.9    8e-12   
gb|ABQ53991.1|  glyceraldehyde 3-phosphate dehydrogenase              66.6    8e-12   Cicer arietinum [garbanzo]
sp|P09672.1|G3PA_SINAL  RecName: Full=Glyceraldehyde-3-phosphate ...  68.9    9e-12   Sinapis alba [bai jie]
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...  70.9    9e-12   Spinacia oleracea
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  70.9    9e-12   Vitis vinifera
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit  70.9    9e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875330.1|  gapa                                             70.9    9e-12   
ref|XP_010929533.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...  69.3    9e-12   
dbj|BAA94304.1|  NADP-glyceraldehyde-3-phosphate dehydrogenase        70.5    9e-12   Chlamydomonas sp. W80
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg           70.9    9e-12   
emb|CAN78872.1|  hypothetical protein VITISV_021726                   70.9    9e-12   Vitis vinifera
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase              70.5    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148557.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.7    1e-11   
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  70.5    1e-11   Dunaliella viridis
ref|XP_010528120.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.3    1e-11   
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  70.5    1e-11   
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    70.5    1e-11   Cladophora rupestris
emb|CDY16038.1|  BnaC08g40850D                                        70.5    1e-11   
gb|ADU04755.1|  glyceraldehyde-3-phosphate dehydrogenase              69.3    1e-11   
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  70.1    1e-11   Chlamydomonas incerta
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase         69.7    1e-11   
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403           70.1    1e-11   
gb|ABK00067.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  69.7    1e-11   Chlorokybus atmophyticus
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  70.1    1e-11   
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...  69.7    1e-11   
gb|AAA33485.1|  glyceraldehyde-3-phosphate dehydrogenase precursor    66.6    1e-11   Zea mays [maize]
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase         69.7    2e-11   Chlamydomonas reinhardtii
ref|XP_010476270.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.3    2e-11   
gb|ADU04754.1|  glyceraldehyde-3-phosphate dehydrogenase              68.6    2e-11   
ref|NP_001077529.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2   69.3    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010494750.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.3    2e-11   
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase         69.3    2e-11   
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662            69.7    2e-11   
gb|AAM94008.1|  glyceraldehyde-3-phosphate dehydrogenase              66.6    2e-11   Griffithsia japonica
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.7    2e-11   
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.7    2e-11   
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase              69.7    2e-11   
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase              69.7    2e-11   Dunaliella salina
emb|CDY48981.1|  BnaA02g28150D                                        69.7    2e-11   
ref|WP_025781786.1|  glyceraldehyde-3-phosphate dehydrogenase         69.3    2e-11   
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase         69.7    2e-11   
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.7    2e-11   
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.7    2e-11   
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.7    2e-11   
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.7    2e-11   
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.7    2e-11   
dbj|BAJ90530.1|  predicted protein                                    69.7    2e-11   
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.7    2e-11   
gb|AAM21776.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    65.1    2e-11   Zea mays [maize]
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.7    2e-11   
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...  69.7    2e-11   Nicotiana tabacum [American tobacco]
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.7    2e-11   
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.7    2e-11   
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    69.3    2e-11   Chlorokybus atmophyticus
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.7    2e-11   
ref|NP_001052984.1|  Os04g0459500                                     69.7    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ABK00056.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  68.6    2e-11   Mesostigma viride
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.7    2e-11   
dbj|BAJ90885.1|  predicted protein                                    69.7    2e-11   
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A           69.7    2e-11   
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  69.3    3e-11   
gb|ACN39951.1|  unknown                                               68.9    3e-11   Picea sitchensis
gb|ACU21011.1|  unknown                                               69.3    3e-11   Glycine max [soybeans]
gb|KEI65516.1|  Gap2                                                  68.9    3e-11   
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  68.9    3e-11   
dbj|BAJ34149.1|  unnamed protein product                              69.3    3e-11   
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase             68.9    3e-11   
ref|WP_008180745.1|  glyceraldehyde-3-phosphate dehydrogenase         68.9    3e-11   
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase              68.9    3e-11   
gb|KDO63479.1|  hypothetical protein CISIN_1g013492mg                 68.2    3e-11   
ref|XP_009118049.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  68.6    3e-11   
ref|WP_008205912.1|  glyceraldehyde-3-phosphate dehydrogenase         68.9    3e-11   
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  68.9    3e-11   
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A            68.9    3e-11   
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase         68.9    3e-11   
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg           69.3    3e-11   
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                  69.3    3e-11   
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  68.9    3e-11   
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g           69.3    3e-11   Populus trichocarpa [western balsam poplar]
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...  68.6    3e-11   
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.3    3e-11   
gb|ACN40537.1|  unknown                                               69.3    3e-11   Picea sitchensis
gb|ACN40000.1|  unknown                                               69.3    3e-11   Picea sitchensis
gb|ABK25233.1|  unknown                                               69.3    3e-11   Picea sitchensis
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase         68.6    3e-11   
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A       69.3    3e-11   
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.3    3e-11   
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.3    3e-11   
emb|CAA33264.1|  unnamed protein product                              69.3    3e-11   Pisum sativum [garden pea]
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.3    3e-11   
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.3    3e-11   
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.3    3e-11   
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase         68.6    3e-11   
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg           69.3    3e-11   
gb|EDX87031.1|  glyceraldehyde-3-phosphate dehydrogenase, type I      68.6    3e-11   
gb|KDP41897.1|  hypothetical protein JCGZ_26915                       69.3    3e-11   
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...  69.3    3e-11   
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  68.9    3e-11   
emb|CDY26599.1|  BnaA09g46780D                                        69.3    3e-11   
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase         68.6    3e-11   
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.3    3e-11   
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.3    3e-11   
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.3    3e-11   
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.3    3e-11   
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2      69.3    3e-11   
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase              69.3    3e-11   
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  68.9    3e-11   
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                  68.9    3e-11   
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg           68.9    3e-11   
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase         68.6    3e-11   
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.3    3e-11   
ref|XP_002892719.1|  GAPA-2                                           68.9    3e-11   
gb|KHG21941.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  68.9    3e-11   
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...  69.3    3e-11   
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...  69.3    3e-11   
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...  69.3    3e-11   
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase             68.9    3e-11   
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                69.3    4e-11   
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit    68.6    4e-11   
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg           68.6    4e-11   
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  68.9    4e-11   
emb|CDY19412.1|  BnaC05g09210D                                        68.9    4e-11   
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  69.3    4e-11   
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  68.9    4e-11   
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    68.9    4e-11   
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  68.6    4e-11   
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase         68.6    4e-11   
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  68.9    4e-11   
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase     68.9    4e-11   
ref|XP_001420043.1|  predicted protein                                68.6    4e-11   
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A       68.9    4e-11   
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  68.6    4e-11   
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    68.2    4e-11   
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2   68.6    4e-11   
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  68.9    4e-11   
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase         68.2    4e-11   
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...  68.9    5e-11   
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg              68.9    5e-11   
gb|ABG35267.1|  glyceraldehyde-3-phosphate dehydrogenase              66.6    5e-11   
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  68.2    5e-11   
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  68.2    5e-11   
ref|WP_016876187.1|  glyceraldehyde-3-phosphate dehydrogenase         68.2    5e-11   
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...  68.6    5e-11   
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase         68.2    5e-11   
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase         67.8    6e-11   
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase         67.8    6e-11   
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase         67.8    7e-11   
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase         68.2    7e-11   
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase         67.8    7e-11   
ref|WP_009555393.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  67.8    8e-11   
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  67.8    8e-11   
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase         67.4    8e-11   
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A           68.2    9e-11   
gb|AFC88822.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...  67.0    9e-11   
gb|AGJ50596.1|  GAPDH                                                 67.8    9e-11   
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  67.8    9e-11   
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase              67.4    9e-11   
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  67.8    9e-11   
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg           67.8    9e-11   
ref|WP_035157424.1|  glyceraldehyde-3-phosphate dehydrogenase         67.4    9e-11   
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase         67.4    9e-11   
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                 67.8    1e-10   
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase         67.4    1e-10   
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [       67.4    1e-10   
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  67.4    1e-10   
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase              67.8    1e-10   
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                 67.8    1e-10   
ref|WP_022607378.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  67.4    1e-10   
ref|WP_039200023.1|  glyceraldehyde-3-phosphate dehydrogenase         67.4    1e-10   
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase         67.0    1e-10   
ref|WP_015080375.1|  type I glyceraldehyde-3-phosphate dehydrogenase  67.0    1e-10   
ref|WP_015212526.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  67.0    1e-10   
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  67.0    1e-10   
ref|WP_016951733.1|  glyceraldehyde-3-phosphate dehydrogenase         67.0    1e-10   
gb|AHJ31016.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...  65.9    1e-10   
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...  67.4    1e-10   
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1       67.4    1e-10   
ref|WP_006172746.1|  glyceraldehyde-3-phosphate dehydrogenase         67.0    1e-10   
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...  67.4    1e-10   
emb|CAA30152.1|  GADPH (383 AA)                                       67.4    1e-10   
gb|ABK24313.1|  unknown                                               67.4    1e-10   
ref|WP_006099248.1|  glyceraldehyde-3-phosphate dehydrogenase         66.6    2e-10   
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase         66.6    2e-10   
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase         66.6    2e-10   
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase         66.6    2e-10   
ref|WP_019493013.1|  glyceraldehyde-3-phosphate dehydrogenase         66.6    2e-10   
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  66.6    2e-10   
ref|WP_015222961.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  66.6    2e-10   
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase         66.6    2e-10   
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase         66.6    2e-10   
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase         66.2    2e-10   
gb|AIE73346.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...  66.2    2e-10   
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase         66.2    3e-10   
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  66.2    3e-10   
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...  66.2    3e-10   
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...  66.2    3e-10   
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    66.6    3e-10   
ref|WP_010999188.1|  glyceraldehyde-3-phosphate dehydrogenase         66.2    3e-10   
ref|WP_011319102.1|  glyceraldehyde-3-phosphate dehydrogenase         66.2    3e-10   
gb|AAA21996.1|  glyceraldehyde-3-phosphate dehydrogenase              65.9    3e-10   
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase         65.9    3e-10   
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase         65.9    3e-10   
gb|ABD37953.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    65.9    3e-10   
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase         65.9    3e-10   
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase         65.9    3e-10   
ref|WP_017291296.1|  glyceraldehyde-3-phosphate dehydrogenase         65.9    3e-10   
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...  66.2    3e-10   
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase         66.2    3e-10   
dbj|BAH57068.1|  AT1G12900                                            65.9    4e-10   
ref|WP_008311916.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  65.5    4e-10   
ref|WP_019477438.1|  glyceraldehyde-3-phosphate dehydrogenase         65.9    4e-10   
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase         65.5    4e-10   
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  65.9    4e-10   
ref|WP_015189930.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  65.5    4e-10   
ref|WP_025961703.1|  hypothetical protein                             63.2    5e-10   
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase         65.5    5e-10   
ref|WP_015109880.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  65.5    5e-10   
ref|WP_023075014.1|  glyceraldehyde 3-phosphate dehydrogenase (na...  65.5    5e-10   
ref|WP_028085442.1|  glyceraldehyde-3-phosphate dehydrogenase         65.1    6e-10   
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase         65.1    6e-10   
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  65.1    6e-10   
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase         65.1    6e-10   
ref|WP_017312563.1|  glyceraldehyde-3-phosphate dehydrogenase         65.1    6e-10   
ref|WP_015228987.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  65.1    6e-10   
ref|WP_026719817.1|  glyceraldehyde-3-phosphate dehydrogenase         65.1    6e-10   
ref|WP_016860363.1|  glyceraldehyde-3-phosphate dehydrogenase         65.1    6e-10   
gb|AAM68969.1|AF406629_1  glyceraldehyde-3-phosphate dehydrogenase    63.5    6e-10   
ref|WP_025955008.1|  hypothetical protein                             62.4    7e-10   
ref|WP_015113093.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  65.1    7e-10   
ref|WP_015191528.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  65.1    7e-10   
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  65.1    7e-10   
ref|WP_039728353.1|  glyceraldehyde-3-phosphate dehydrogenase         64.7    7e-10   
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase         64.7    7e-10   
ref|WP_006669576.1|  glyceraldehyde-3-phosphate dehydrogenase         64.7    8e-10   
ref|WP_014274525.1|  glyceraldehyde-3-phosphate dehydrogenase         64.7    8e-10   
ref|WP_006619928.1|  glyceraldehyde-3-phosphate dehydrogenase         64.7    8e-10   
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  64.7    8e-10   
ref|WP_029979140.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    9e-10   
ref|WP_036922813.1|  glyceraldehyde-3-phosphate dehydrogenase         64.7    9e-10   
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase         64.7    9e-10   
ref|WP_019480411.1|  glyceraldehyde-3-phosphate dehydrogenase         64.7    9e-10   
ref|WP_036899283.1|  glyceraldehyde-3-phosphate dehydrogenase         64.7    9e-10   
ref|WP_019477913.1|  glyceraldehyde-3-phosphate dehydrogenase         64.7    1e-09   
ref|WP_019474872.1|  glyceraldehyde-3-phosphate dehydrogenase         64.7    1e-09   
ref|WP_036532393.1|  glyceraldehyde-3-phosphate dehydrogenase         64.3    1e-09   
ref|YP_002049068.1|  Glyceraldehyde 3-phosphate dehydrogenase NAD...  64.3    1e-09   
ref|WP_032525730.1|  glyceraldehyde-3-phosphate dehydrogenase         64.3    1e-09   
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  64.3    1e-09   
ref|WP_032514080.1|  glyceraldehyde-3-phosphate dehydrogenase         64.3    1e-09   
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  64.3    1e-09   
ref|WP_011375588.1|  glyceraldehyde-3-phosphate dehydrogenase         64.3    1e-09   
ref|WP_035830661.1|  glyceraldehyde-3-phosphate dehydrogenase         64.3    1e-09   
ref|WP_025965118.1|  glyceraldehyde-3-phosphate dehydrogenase         62.8    1e-09   
ref|WP_011140533.1|  glyceraldehyde-3-phosphate dehydrogenase         63.9    1e-09   
ref|WP_012626430.1|  glyceraldehyde-3-phosphate dehydrogenase         63.9    2e-09   
ref|WP_006911098.1|  glyceraldehyde-3-phosphate dehydrogenase         63.9    2e-09   
ref|WP_036913110.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  63.5    2e-09   
ref|WP_023172550.1|  glyceraldehyde-3-phosphate dehydrogenase         63.5    2e-09   
ref|WP_011131661.1|  glyceraldehyde-3-phosphate dehydrogenase         63.5    2e-09   
ref|WP_011819348.1|  glyceraldehyde-3-phosphate dehydrogenase         63.5    2e-09   
ref|WP_015126379.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  63.9    2e-09   
gb|KGG26981.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...  63.5    2e-09   
ref|WP_026082358.1|  glyceraldehyde-3-phosphate dehydrogenase         63.5    2e-09   
gb|AAM68968.1|AF406628_1  glyceraldehyde-3-phosphate dehydrogenase    63.9    2e-09   
ref|WP_025944290.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    2e-09   
ref|WP_011129407.1|  glyceraldehyde-3-phosphate dehydrogenase         63.5    2e-09   
ref|WP_015156647.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  63.2    3e-09   
ref|WP_025900197.1|  glyceraldehyde-3-phosphate dehydrogenase         62.8    3e-09   
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  63.2    3e-09   
ref|WP_015224818.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  63.2    3e-09   
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase         63.2    3e-09   
gb|AIQ96116.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...  62.8    3e-09   
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  62.8    4e-09   
ref|WP_038650443.1|  glyceraldehyde-3-phosphate dehydrogenase         62.8    4e-09   
ref|WP_038089676.1|  glyceraldehyde-3-phosphate dehydrogenase         62.8    4e-09   
ref|WP_011293983.1|  glyceraldehyde-3-phosphate dehydrogenase         62.8    4e-09   
ref|WP_011822824.1|  glyceraldehyde-3-phosphate dehydrogenase         62.8    4e-09   
ref|WP_036906091.1|  glyceraldehyde-3-phosphate dehydrogenase         62.8    4e-09   
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  62.8    4e-09   
ref|WP_032518091.1|  glyceraldehyde-3-phosphate dehydrogenase         62.8    5e-09   
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_025943135.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_025929031.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_025932858.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_025970042.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_025937822.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_025895306.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  62.4    5e-09   
ref|WP_025947080.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_011862050.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_025905712.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  62.4    5e-09   
ref|WP_032519865.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_025938864.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_025924004.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  62.4    5e-09   
ref|WP_025887309.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  62.4    5e-09   
ref|WP_025880015.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  62.4    5e-09   
gb|AIQ94051.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...  62.4    5e-09   
ref|WP_025951324.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_025935563.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_025925726.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  62.4    5e-09   
ref|WP_025941106.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_025915332.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_011817500.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_017659782.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_025952189.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_025923775.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_025921298.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  62.4    5e-09   
ref|WP_032523814.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_025970551.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_032515148.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    5e-09   
ref|WP_032523054.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    6e-09   



>gb|ABK95316.1| unknown [Populus trichocarpa]
Length=65

 Score =   126 bits (317),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA+KWPGVA AGSGDPLED+CKTNP D+EC
Sbjct  1    MVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVANKWPGVAAAGSGDPLEDFCKTNPADEEC  60

Query  182  KVFEA  196
            KV+EA
Sbjct  61   KVYEA  65



>ref|XP_011041188.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Populus euphratica]
Length=452

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVASKWPGVA AGSGDPLED+CKTNP D+EC
Sbjct  388  MVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAAAGSGDPLEDFCKTNPADEEC  447

Query  182  KVFEA  196
            KV+EA
Sbjct  448  KVYEA  452



>ref|XP_011034836.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Populus euphratica]
Length=452

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVASKWPGVA AGSGDPLED+CKTNP D+EC
Sbjct  388  MVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAAAGSGDPLEDFCKTNPADEEC  447

Query  182  KVFEA  196
            KV+EA
Sbjct  448  KVYEA  452



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG AVAGSGDPLED+C+TNP D+EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAAVAGSGDPLEDFCQTNPADEEC  447

Query  182  KVFEA  196
            KV+EA
Sbjct  448  KVYEA  452



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA+KWPGVA AGSGDPLED+CKTNP D+EC
Sbjct  388  MVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVANKWPGVAAAGSGDPLEDFCKTNPADEEC  447

Query  182  KVFEA  196
            KV+EA
Sbjct  448  KVYEA  452



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA+KWPGVA AGSGDPLED+CKTNP D+EC
Sbjct  357  MVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVANKWPGVAAAGSGDPLEDFCKTNPADEEC  416

Query  182  KVFEA  196
            KV+EA
Sbjct  417  KVYEA  421



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A AGSGDPLED+CKTNP D+EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGTAQAGSGDPLEDFCKTNPADEEC  447

Query  182  KVFEA  196
            KV+EA
Sbjct  448  KVYEA  452



>ref|XP_002300632.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
 gb|EEE79905.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
Length=474

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDM+KVVAWYDNEWGYSQRVVDL HLVASKWPGVA AGSGDPLED+CKTNP D+EC
Sbjct  410  MVMGDDMIKVVAWYDNEWGYSQRVVDLGHLVASKWPGVAAAGSGDPLEDFCKTNPADEEC  469

Query  182  KVFEA  196
            KV+EA
Sbjct  470  KVYEA  474



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+ VAGSGDPLEDYCK NP D+EC
Sbjct  390  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMPVAGSGDPLEDYCKANPADEEC  449

Query  182  KVFEA  196
            KV+EA
Sbjct  450  KVYEA  454



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG + AGSGDPLED+CKTNP D+EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGTSQAGSGDPLEDFCKTNPADEEC  447

Query  182  KVFEA  196
            KV+EA
Sbjct  448  KVYEA  452



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG AV GSGDPLED+C+TNP D+EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAAVVGSGDPLEDFCQTNPADEEC  447

Query  182  KVFEA  196
            KV+EA
Sbjct  448  KVYEA  452



>ref|XP_010270515.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nelumbo nucifera]
Length=452

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVASKWPG A +GSGDPLED+CKTNP D+EC
Sbjct  388  MVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVASKWPGAAASGSGDPLEDFCKTNPADEEC  447

Query  182  KVFEA  196
            KV+EA
Sbjct  448  KVYEA  452



>ref|XP_002540513.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF21870.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=193

 Score =   125 bits (314),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG + AGSGD LED+C+TNP DKEC
Sbjct  129  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGASAAGSGDALEDFCETNPADKEC  188

Query  182  KVFEA  196
            KVFE+
Sbjct  189  KVFES  193



>ref|XP_006435406.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48646.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=453

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPGVA  GSGDPLED+C+TNP D+EC
Sbjct  389  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVATKWPGVAAGGSGDPLEDFCQTNPADEEC  448

Query  182  KVFEA  196
            KV+EA
Sbjct  449  KVYEA  453



>ref|XP_006473831.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85173.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=453

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPGVA  GSGDPLED+C+TNP D+EC
Sbjct  389  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVATKWPGVAAGGSGDPLEDFCQTNPADEEC  448

Query  182  KVFEA  196
            KV+EA
Sbjct  449  KVYEA  453



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A   SGDPLED+C+TNP DKEC
Sbjct  389  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAAAGSSGDPLEDFCETNPADKEC  448

Query  182  KVFEA  196
            KVFEA
Sbjct  449  KVFEA  453



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score =   129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  AGS DPLED+CKTNP D+EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVPAAGSADPLEDFCKTNPADEEC  447

Query  182  KVFEA  196
            KV+EA
Sbjct  448  KVYEA  452



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A  GSGDPLED+CKTNP D+EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAAEVGSGDPLEDFCKTNPADEEC  447

Query  182  KVFEA  196
            KV+EA
Sbjct  448  KVYEA  452



>gb|ABS72003.1| putative chloroplast glyceradehyde-3-phosphate dehydrogenase 
subunit B [Olea europaea]
Length=149

 Score =   123 bits (308),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWPG+A   SGDPLED+CKTNP D+EC
Sbjct  85   MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAYKWPGMAAQESGDPLEDFCKTNPADEEC  144

Query  182  KVFEA  196
            KV+EA
Sbjct  145  KVYEA  149



>ref|XP_010094540.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
 gb|EXB56294.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
Length=1333

 Score =   132 bits (332),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 57/71 (80%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG    GSGDPLED+CKTNP D+EC
Sbjct  391  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGSGTGGSGDPLEDFCKTNPADEEC  450

Query  182  KVFEA*FTTNF  214
            K+  A F   F
Sbjct  451  KIVIASFIGCF  461



>emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera]
Length=453

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG A  GSGDPLED+CKTNP D+EC
Sbjct  389  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGFAAEGSGDPLEDFCKTNPADEEC  448

Query  182  KVFEA  196
            KV+EA
Sbjct  449  KVYEA  453



>ref|XP_004500847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score =   129 bits (323),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG    GSGDPLED+C+TNP D EC
Sbjct  462  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGTPQKGSGDPLEDFCETNPADDEC  521

Query  182  KVFE  193
            KV+E
Sbjct  522  KVYE  525



>ref|XP_002273754.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Vitis vinifera]
 emb|CBI40744.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG A  GSGDPLED+CKTNP D+EC
Sbjct  389  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGFAAEGSGDPLEDFCKTNPADEEC  448

Query  182  KVFEA  196
            KV+EA
Sbjct  449  KVYEA  453



>gb|ABF74607.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase B subunit 
[Agave tequilana]
Length=174

 Score =   123 bits (308),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+   GS DPLED+CKTNP  +EC
Sbjct  108  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMPAQGSSDPLEDFCKTNPETEEC  167

Query  182  KVFEA*F  202
            KV+EA F
Sbjct  168  KVYEAGF  174



>gb|KFK29151.1| hypothetical protein AALP_AA7G095400 [Arabis alpina]
Length=448

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG   AGSGDPLED+CKTNP D+EC
Sbjct  384  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGEVAAGSGDPLEDFCKTNPADEEC  443

Query  182  KVFEA  196
            KV+EA
Sbjct  444  KVYEA  448



>ref|XP_009107645.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Brassica rapa]
 emb|CDY35800.1| BnaA08g04610D [Brassica napus]
Length=448

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG   AGSGDPLED+CKTNP D+EC
Sbjct  384  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGEVAAGSGDPLEDFCKTNPADEEC  443

Query  182  KVFEA  196
            KV+EA
Sbjct  444  KVYEA  448



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG   AGSGDPLE++CKTNP D+EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGTPQAGSGDPLEEFCKTNPADEEC  447

Query  182  KVFEA  196
            KV+EA
Sbjct  448  KVYEA  452



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG +V GSGD LEDYCKTNP DKEC
Sbjct  386  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGSSVEGSGDSLEDYCKTNPADKEC  445

Query  182  KVFE  193
            KV+E
Sbjct  446  KVYE  449



>emb|CDY69523.1| BnaC08g46180D, partial [Brassica napus]
Length=402

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG   AGSGDPLED+CKTNP D+EC
Sbjct  338  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGEVAAGSGDPLEDFCKTNPADEEC  397

Query  182  KVFEA  196
            KV+EA
Sbjct  398  KVYEA  402



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/64 (91%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG +V GSGD LEDYCKTNP DKEC
Sbjct  386  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGSSVEGSGDALEDYCKTNPADKEC  445

Query  182  KVFE  193
            KV+E
Sbjct  446  KVYE  449



>ref|XP_010500213.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic-like 
[Camelina sativa]
Length=447

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG    G+GDPLED+C+TNPGD+EC
Sbjct  384  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGEKAVGTGDPLEDFCQTNPGDEEC  443

Query  182  KVFE  193
            KVFE
Sbjct  444  KVFE  447



>ref|XP_006307502.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
 gb|EOA40400.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
Length=447

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG    GSGDPLED+C+TNPG++EC
Sbjct  384  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGEKAVGSGDPLEDFCQTNPGEEEC  443

Query  182  KVFE  193
            KVFE
Sbjct  444  KVFE  447



>ref|XP_009384599.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV   GSGDPLED+C+TNP  KEC
Sbjct  385  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVPAQGSGDPLEDFCQTNPETKEC  444

Query  182  KVFEA  196
            KV+EA
Sbjct  445  KVYEA  449



>ref|XP_009384600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV   GSGDPLED+C+TNP  KEC
Sbjct  383  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVPAQGSGDPLEDFCQTNPETKEC  442

Query  182  KVFEA  196
            KV+EA
Sbjct  443  KVYEA  447



>ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=458

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG + AGSGD LED+C+TNP DKEC
Sbjct  394  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGASAAGSGDALEDFCETNPADKEC  453

Query  182  KVFEA  196
            KVFE+
Sbjct  454  KVFES  458



>ref|XP_004300121.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=452

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  V GSGDPLED+CK NP D+EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGTPVEGSGDPLEDFCKDNPADEEC  447

Query  182  KVFEA  196
            KV+EA
Sbjct  448  KVYEA  452



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPGVAV GSGDPL+++CKTNP D+EC
Sbjct  386  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGVAVPGSGDPLDEFCKTNPADEEC  445

Query  182  KVFE  193
            KV+E
Sbjct  446  KVYE  449



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPGVAV GSGDPL+++CKTNP D+EC
Sbjct  386  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGVAVPGSGDPLDEFCKTNPADEEC  445

Query  182  KVFE  193
            KV+E
Sbjct  446  KVYE  449



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/64 (89%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVK+VAWYDNEWGYSQRVVDLAHLVASKWPG A  GSGD LEDYCKTNP DKEC
Sbjct  387  MVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVASKWPGSAAEGSGDALEDYCKTNPADKEC  446

Query  182  KVFE  193
            KV+E
Sbjct  447  KVYE  450



>emb|CDP07271.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+ + GSGDPLEDYCKTN  D+EC
Sbjct  394  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGLFIDGSGDPLEDYCKTNAADEEC  453

Query  182  KVFEA  196
            KV+EA
Sbjct  454  KVYEA  458



>gb|ACU20783.1| unknown [Glycine max]
Length=452

 Score =   127 bits (318),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A AGSGDPLE++C+TNP D+EC
Sbjct  389  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGTAKAGSGDPLEEFCETNPADEEC  448

Query  182  KVFE  193
            KV+E
Sbjct  449  KVYE  452



>ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
 gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
Length=451

 Score =   127 bits (318),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A AGSGDPLE++C+TNP D+EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAAKAGSGDPLEEFCETNPADEEC  447

Query  182  KVFE  193
            KV+E
Sbjct  448  KVYE  451



>ref|XP_006581071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B subunit 
isoform X1 [Glycine max]
Length=453

 Score =   127 bits (318),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A AGSGDPLE++C+TNP D+EC
Sbjct  390  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAAKAGSGDPLEEFCETNPADEEC  449

Query  182  KVFE  193
            KV+E
Sbjct  450  KVYE  453



>gb|KHN20097.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=452

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG A AGSGDPLE++C+TNP D+EC
Sbjct  389  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAAKAGSGDPLEEFCETNPADEEC  448

Query  182  KVFE  193
            KV+E
Sbjct  449  KVYE  452



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score =   126 bits (317),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWPG    GSGDPLED+CKTNP D+EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVADKWPGATAEGSGDPLEDFCKTNPADEEC  447

Query  182  KVFEA  196
            KV+EA
Sbjct  448  KVYEA  452



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+   GS DPLED+CKTNP D+EC
Sbjct  391  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMPAGGSSDPLEDFCKTNPADEEC  450

Query  182  KVFEA  196
            KV+EA
Sbjct  451  KVYEA  455



>ref|XP_006395998.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
 dbj|BAJ34314.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33284.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
Length=447

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG   AGSGDPLED+CKTNP D+EC
Sbjct  384  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGEVAAGSGDPLEDFCKTNPADEEC  443

Query  182  KVFE  193
            KV+E
Sbjct  444  KVYE  447



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG   AGSGDPLED+C+TNP D+EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAPKAGSGDPLEDFCETNPADEEC  447

Query  182  KVFE  193
            KV+E
Sbjct  448  KVYE  451



>ref|XP_006577850.1| PREDICTED: uncharacterized protein LOC100806482 isoform X1 [Glycine 
max]
Length=452

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG   AGSGDPLED+C+TNP D+EC
Sbjct  389  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAPKAGSGDPLEDFCETNPADEEC  448

Query  182  KVFE  193
            KV+E
Sbjct  449  KVYE  452



>gb|AIU56855.1| glyceraldehyde-3-phosphate dehydrogenase B, partial [Brassica 
rapa subsp. chinensis]
Length=367

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG   AGSGDPLED+CKTNP D+EC
Sbjct  304  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGEVAAGSGDPLEDFCKTNPADEEC  363

Query  182  KVFE  193
            KV+E
Sbjct  364  KVYE  367



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+ V GSGDPLED+CKT+P  +EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMPVQGSGDPLEDFCKTSPATEEC  447

Query  182  KVFEA  196
            KV+EA
Sbjct  448  KVYEA  452



>gb|AEO45784.1| glyceraldehyde-3-phosphate dehydrogenase B [Scoparia dulcis]
Length=452

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MV+GDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWPG  V+GSGDPLED+CKTNP D+EC
Sbjct  388  MVLGDDMVKVVAWYDNEWGYSQRVVDLAHLVAYKWPGATVSGSGDPLEDFCKTNPADEEC  447

Query  182  KVFE  193
            KV+E
Sbjct  448  KVYE  451



>ref|XP_002891244.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67503.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=447

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG    GSGDPLED+CKTNP D+EC
Sbjct  384  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGEEAVGSGDPLEDFCKTNPADEEC  443

Query  182  KVFE  193
            KV+E
Sbjct  444  KVYE  447



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVK+VAWYDNEWGYSQRVVDLAHLVA+KWPG A  GSGD LEDYCKTNP DKEC
Sbjct  387  MVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVANKWPGSAAEGSGDALEDYCKTNPADKEC  446

Query  182  KVFE  193
            KV+E
Sbjct  447  KVYE  450



>ref|NP_174996.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
 sp|P25857.2|G3PB_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPB, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase B; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51517.1|AC068324_5 glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAA32795.1| glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAK62594.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAK64065.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAL85133.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAM19948.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAM98232.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72278.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 dbj|BAF02115.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AEE31933.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
Length=447

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG    GSGDPLED+CKTNP D+EC
Sbjct  384  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAEAVGSGDPLEDFCKTNPADEEC  443

Query  182  KVFE  193
            KV++
Sbjct  444  KVYD  447



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  GSGDPL+++C+TNP D+EC
Sbjct  387  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAAPGSGDPLDEFCETNPSDEEC  446

Query  182  KVFE  193
            KV+E
Sbjct  447  KVYE  450



>ref|XP_007135965.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
 gb|ESW07959.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
Length=451

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG   AGSGDPLE++C+TNP D+EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGTPKAGSGDPLEEFCETNPADEEC  447

Query  182  KVFE  193
            KV+E
Sbjct  448  KVYE  451



>gb|AAD10210.1| glyceraldehyde 3-phosphate dehydrogenase B subunit [Arabidopsis 
thaliana]
Length=402

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG    GSGDPLED+CKTNP D+EC
Sbjct  339  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAEAVGSGDPLEDFCKTNPADEEC  398

Query  182  KVFE  193
            KV++
Sbjct  399  KVYD  402



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVK+VAWYDNEWGYSQRVVDLAHLVA KWPG A  GSGD LEDYCKTNP DKEC
Sbjct  387  MVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVADKWPGSAAEGSGDALEDYCKTNPADKEC  446

Query  182  KVFE  193
            KV+E
Sbjct  447  KVYE  450



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKV+AWYDNEWGYSQRVVDLAHLVASKWPGVA  GSGDPL+++C+TNP D+EC
Sbjct  387  MVMGDDMVKVIAWYDNEWGYSQRVVDLAHLVASKWPGVAAPGSGDPLDEFCETNPSDEEC  446

Query  182  KVFE  193
            KV+E
Sbjct  447  KVYE  450



>ref|XP_009382077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=452

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+   GSGDPLED+C+TNP  KEC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGIPAQGSGDPLEDFCQTNPETKEC  447

Query  182  KVFE  193
            KV+E
Sbjct  448  KVYE  451



>gb|KGN49135.1| hypothetical protein Csa_6G514950 [Cucumis sativus]
Length=191

 Score =   120 bits (301),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA KWPG     SGDPLED+C+TNP D+EC
Sbjct  127  MVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVADKWPGAGSGKSGDPLEDFCQTNPADEEC  186

Query  182  KVFEA  196
            KV+EA
Sbjct  187  KVYEA  191



>gb|AES74101.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=317

 Score =   122 bits (307),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG   AGSGDPLED+C+TNP   EC
Sbjct  254  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGTPQAGSGDPLEDFCETNPSTDEC  313

Query  182  KVFE  193
            KVFE
Sbjct  314  KVFE  317



>ref|XP_011034837.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Populus euphratica]
Length=450

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 2/65 (3%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDM+KVVAWYDNEWGY  RVVDLAHLVASKWPGVA AGSGDPLED+CKTNP D+EC
Sbjct  388  MVMGDDMIKVVAWYDNEWGY--RVVDLAHLVASKWPGVAAAGSGDPLEDFCKTNPADEEC  445

Query  182  KVFEA  196
            KV+EA
Sbjct  446  KVYEA  450



>gb|ABF93789.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG90581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score =   122 bits (307),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG AV GSGDPLED+CK NP   EC
Sbjct  254  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAAVQGSGDPLEDFCKDNPETDEC  313

Query  182  KVFE  193
            KV+E
Sbjct  314  KVYE  317



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA++WPGVA  GSGDPLE++C+ NP D+EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANEWPGVAATGSGDPLEEFCEKNPADEEC  447

Query  182  KVFEA  196
            KV+EA
Sbjct  448  KVYEA  452



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   124 bits (310),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG   AGSGDPLED+C+TNP   EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGTPQAGSGDPLEDFCETNPSTDEC  447

Query  182  KVFE  193
            KVFE
Sbjct  448  KVFE  451



>ref|XP_008786670.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Phoenix dactylifera]
Length=452

 Score =   124 bits (310),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+ V GSGDPLED+C+T+P  +EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMPVQGSGDPLEDFCQTSPDTEEC  447

Query  182  KVFEA  196
            KV+EA
Sbjct  448  KVYEA  452



>ref|NP_001048847.1| Os03g0129300 [Oryza sativa Japonica Group]
 dbj|BAA85402.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AAN17393.1| Putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 gb|ABF93788.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10761.1| Os03g0129300 [Oryza sativa Japonica Group]
 gb|EAY88378.1| hypothetical protein OsI_09835 [Oryza sativa Indica Group]
 gb|EAZ25455.1| hypothetical protein OsJ_09272 [Oryza sativa Japonica Group]
Length=444

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG AV GSGDPLED+CK NP   EC
Sbjct  380  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAAVQGSGDPLEDFCKDNPETDEC  439

Query  182  KVFE  193
            KV+E
Sbjct  440  KVYE  443



>ref|XP_010478986.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X2 [Camelina sativa]
Length=445

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG    GSGDPLED+C+TNP ++EC
Sbjct  382  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGEKAVGSGDPLEDFCQTNPANEEC  441

Query  182  KVFE  193
            KV+E
Sbjct  442  KVYE  445



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVA  GSGDPLED+CK NP   EC
Sbjct  380  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAAQGSGDPLEDFCKDNPETDEC  439

Query  182  KVFE  193
            KV+E
Sbjct  440  KVYE  443



>emb|CAA33262.1| unnamed protein product [Pisum sativum]
Length=447

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG    GSGDPLED+C+TNP D+EC
Sbjct  384  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGTPKVGSGDPLEDFCETNPADEEC  443

Query  182  KVFE  193
            KV+E
Sbjct  444  KVYE  447



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG    GSGDPLED+C+TNP D+EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGTPKVGSGDPLEDFCETNPADEEC  447

Query  182  KVFE  193
            KV+E
Sbjct  448  KVYE  451



>ref|XP_010478985.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X1 [Camelina sativa]
Length=402

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG    GSGDPLED+C+TNP ++EC
Sbjct  339  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGEKAVGSGDPLEDFCQTNPANEEC  398

Query  182  KVFE  193
            KV+E
Sbjct  399  KVYE  402



>ref|XP_009362872.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=450

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 60/65 (92%), Gaps = 2/65 (3%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGY  RVVDLAHLVASKWPG A AGSGDPLED+CKTNP D+EC
Sbjct  388  MVMGDDMVKVVAWYDNEWGY--RVVDLAHLVASKWPGTAQAGSGDPLEDFCKTNPADEEC  445

Query  182  KVFEA  196
            KV+EA
Sbjct  446  KVYEA  450



>ref|XP_008452997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Cucumis melo]
Length=452

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA+KWPG     SGDPLED+C+TNP D+EC
Sbjct  388  MVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVATKWPGAGSGKSGDPLEDFCQTNPADEEC  447

Query  182  KVFEA  196
            KV+EA
Sbjct  448  KVYEA  452



>ref|XP_008452998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Cucumis melo]
Length=451

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA+KWPG     SGDPLED+C+TNP D+EC
Sbjct  387  MVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVATKWPGAGSGKSGDPLEDFCQTNPADEEC  446

Query  182  KVFEA  196
            KV+EA
Sbjct  447  KVYEA  451



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  V G+GDPLEDYCKTNP   EC
Sbjct  383  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGSEVKGTGDPLEDYCKTNPETDEC  442

Query  182  KVFE  193
            KV++
Sbjct  443  KVYD  446



>ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55522.1| hypothetical protein Csa_4G664300 [Cucumis sativus]
Length=451

 Score =   121 bits (303),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA KWPG     SGDPLED+C+TNP D+EC
Sbjct  387  MVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVADKWPGAGSGKSGDPLEDFCQTNPADEEC  446

Query  182  KVFEA  196
            KV+EA
Sbjct  447  KVYEA  451



>dbj|BAJ86633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   121 bits (303),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG    GSGDPLEDYCKT+P   EC
Sbjct  380  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAGTGGSGDPLEDYCKTDPNAVEC  439

Query  182  KVFE  193
            KVF+
Sbjct  440  KVFD  443



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score =   121 bits (303),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVA-GSGDPLEDYCKTNPGDKE  178
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG   A GSGDPLEDYCKT+P D+E
Sbjct  376  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGATPAEGSGDPLEDYCKTSPADEE  435

Query  179  CKVFE  193
            CKV+E
Sbjct  436  CKVYE  440



>dbj|BAJ87214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG    GSGDPLEDYCKT+P   EC
Sbjct  380  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAGTGGSGDPLEDYCKTDPNAVEC  439

Query  182  KVFE  193
            KVF+
Sbjct  440  KVFD  443



>gb|EMS49604.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Triticum 
urartu]
Length=444

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG    GSGDPLEDYCKT+P   EC
Sbjct  380  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAGTGGSGDPLEDYCKTDPNAVEC  439

Query  182  KVFE  193
            KVF+
Sbjct  440  KVFD  443



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEW YSQRVVDLAHLVA+KWPG   AGSGDPLED+C+TNP   EC
Sbjct  388  MVMGDDMVKVVAWYDNEWDYSQRVVDLAHLVANKWPGTPQAGSGDPLEDFCETNPSTDEC  447

Query  182  KVFE  193
            KVFE
Sbjct  448  KVFE  451



>ref|XP_010061201.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68119.1| hypothetical protein EUGRSUZ_F01793 [Eucalyptus grandis]
Length=454

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGS-GDPLEDYCKTNPGDKE  178
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWPG+ + GS GDPLED+CK NP D+E
Sbjct  389  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAVKWPGIEIPGSTGDPLEDFCKKNPADEE  448

Query  179  CKVFE  193
            CKV+E
Sbjct  449  CKVYE  453



>gb|ACJ13972.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13974.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13975.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13976.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13977.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13978.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13979.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13980.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13981.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13984.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13985.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13986.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13989.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13990.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13991.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13993.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13994.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
Length=59

 Score =   109 bits (272),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  20   MVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  193
            MVKVVAWYDNEWGYSQRVVDLAHLVA+KWPGVA  GSGDPLED+CK NPG++ECKV+E
Sbjct  1    MVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGVAPVGSGDPLEDFCKKNPGEEECKVYE  58



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVA-GSGDPLEDYCKTNPGDKE  178
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG+  A  SGDPLED+CK NP D+E
Sbjct  387  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGMEGAISSGDPLEDFCKDNPADEE  446

Query  179  CKVFE  193
            CKV+E
Sbjct  447  CKVYE  451



>gb|ACN40006.1| unknown [Picea sitchensis]
Length=460

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG    GS DPL+++CKTNP   EC
Sbjct  396  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAGKGGSDDPLDEFCKTNPATDEC  455

Query  182  KVFEA  196
            +V+EA
Sbjct  456  RVYEA  460



>gb|ABK24645.1| unknown [Picea sitchensis]
Length=460

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG    GS DPL+++CKTNP   EC
Sbjct  396  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAGKGGSDDPLDEFCKTNPATDEC  455

Query  182  KVFEA  196
            +V+EA
Sbjct  456  RVYEA  460



>ref|XP_002981126.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
 gb|EFJ17827.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
Length=431

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWPG A A SGDPL+++CKTNP   EC
Sbjct  367  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAEKWPGGAPAPSGDPLDEFCKTNPDTDEC  426

Query  182  KVFEA  196
            KV++A
Sbjct  427  KVYDA  431



>ref|XP_002982608.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
 gb|EFJ16361.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
Length=431

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWPG A A SGDPL+++CKTNP   EC
Sbjct  367  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVADKWPGGAAAPSGDPLDEFCKTNPDTDEC  426

Query  182  KVFEA  196
            +V++A
Sbjct  427  RVYDA  431



>gb|ACN40526.1| unknown [Picea sitchensis]
Length=460

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG    GS DPL+++CKTNP   EC
Sbjct  396  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAGKGGSDDPLDEFCKTNPATDEC  455

Query  182  KVFEA  196
            +V+EA
Sbjct  456  RVYEA  460



>gb|ACJ13973.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13982.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13983.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13987.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13988.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13992.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13995.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13996.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
annuus]
 gb|ACJ13998.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
petiolaris]
Length=59

 Score =   107 bits (268),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  20   MVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  193
            MVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG A  GSGDPLED+CK NPG++ECKV+E
Sbjct  1    MVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAAPVGSGDPLEDFCKKNPGEEECKVYE  58



>gb|ACJ13997.1| putative glyceraldehyde-3-phosphate dehydrogenase [Helianthus 
petiolaris]
Length=59

 Score =   106 bits (265),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +2

Query  20   MVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  193
            MVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG    GSGDPLED+CK NPG++ECKV+E
Sbjct  1    MVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGATPVGSGDPLEDFCKKNPGEEECKVYE  58



>gb|ABF93790.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
Length=207

 Score =   109 bits (272),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  20   MVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  193
            ++KVVAWYDNEWGYSQRVVDLAHLVASKWPG AV GSGDPLED+CK NP   ECKV+E
Sbjct  149  LIKVVAWYDNEWGYSQRVVDLAHLVASKWPGAAVQGSGDPLEDFCKDNPETDECKVYE  206



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 58/65 (89%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW G A +G GDPLE++C+T+P   EC
Sbjct  350  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWSGAAKSG-GDPLEEFCQTSPETVEC  408

Query  182  KVFEA  196
            KV+EA
Sbjct  409  KVYEA  413



>sp|P12860.1|G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Spinacia oleracea]
 emb|CAA33263.1| unnamed protein product [Spinacia oleracea]
 gb|AAD10218.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
B [Spinacia oleracea]
Length=451

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV-AVAGSGDPLEDYCKTNPGDKE  178
            MVMG DMVKVVAWYDNEWGYSQRVVDLA LVA+KWPG+     SGDPLED+CK NP D+E
Sbjct  387  MVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEE  446

Query  179  CKVFE  193
            CK++E
Sbjct  447  CKLYE  451



>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|Q Chain Q, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|T Chain T, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=368

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV-AVAGSGDPLEDYCKTNPGDKE  178
            MVMG DMVKVVAWYDNEWGYSQRVVDLA LVA+KWPG+     SGDPLED+CK NP D+E
Sbjct  304  MVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEE  363

Query  179  CKVFE  193
            CK++E
Sbjct  364  CKLYE  368



>gb|ACF84938.1| unknown [Zea mays]
Length=65

 Score =   100 bits (250),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG A AGSGDPLED+CK NP   EC
Sbjct  1    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAAAAGSGDPLEDFCKDNPETDEC  60

Query  182  KVFEA  196
            KV+EA
Sbjct  61   KVYEA  65



>emb|CAC80378.2| glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=480

 Score =   107 bits (268),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSG---DPLEDYCKTNPGD  172
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG   A  G   DPL  YC++NP D
Sbjct  414  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAKPAPDGKDADPLGTYCESNPDD  473

Query  173  KECKVFE  193
             EC+VFE
Sbjct  474  AECRVFE  480



>emb|CAC80389.2| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=457

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 1/64 (2%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA++WPGVA   SGDPLE++C TNP   EC
Sbjct  394  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAQWPGVA-KPSGDPLEEFCVTNPDTDEC  452

Query  182  KVFE  193
            ++ +
Sbjct  453  RLHD  456



>pdb|2PKR|O Chain O, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|R Chain R, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|P Chain P, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|Q Chain Q, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|A Chain A, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|B Chain B, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|C Chain C, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|D Chain D, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|H Chain H, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|I Chain I, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|L Chain L, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|M Chain M, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
Length=365

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV-AVAGSGDPLEDYCKTNPGDKE  178
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW G+     SGDPLED+CK NP D+E
Sbjct  301  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQGLEGSVASGDPLEDFCKDNPADEE  360

Query  179  CKVFE  193
            CK++E
Sbjct  361  CKLYE  365



>ref|XP_008650588.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Zea mays]
 gb|ACF78460.1| unknown [Zea mays]
 gb|ACF87738.1| unknown [Zea mays]
 gb|ACG28147.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACG29047.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACR36877.1| unknown [Zea mays]
 tpg|DAA43140.1| TPA: glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
Length=449

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG A AGSGDPLED+CK NP   EC
Sbjct  385  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAAAAGSGDPLEDFCKDNPETDEC  444

Query  182  KVFEA  196
            KV+EA
Sbjct  445  KVYEA  449



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA+ WPG+      DPLE +C TNP   EC
Sbjct  351  MVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNWPGMVQETGSDPLETFCNTNPDADEC  410

Query  182  KVFE  193
            +V+ 
Sbjct  411  RVYN  414



>gb|ABD37964.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Chlorokybus 
atmophyticus]
Length=458

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAG---SGDPLEDYCKTNPGD  172
            MVMGDDM+KVVAWYDNEWGYSQRVVDLAH+VA+ WPG        SGDPL+ YC TNP  
Sbjct  391  MVMGDDMLKVVAWYDNEWGYSQRVVDLAHIVANNWPGQKADSEEESGDPLDKYCATNPEA  450

Query  173  KECKVFE  193
             EC+V++
Sbjct  451  DECRVYD  457



>ref|XP_003603850.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=490

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 58/103 (56%), Gaps = 39/103 (38%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWG---------------------------------------YS  64
            MVMGDDMVKVVAWYDNEWG                                       ++
Sbjct  388  MVMGDDMVKVVAWYDNEWGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKYKVCFHN  447

Query  65   QRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  193
            QRVVDLAHLVA+KWPG   AGSGDPLED+C+TNP   ECKVFE
Sbjct  448  QRVVDLAHLVANKWPGTPQAGSGDPLEDFCETNPSTDECKVFE  490



>gb|EMT30317.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Aegilops 
tauschii]
Length=442

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 53/64 (83%), Gaps = 2/64 (3%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG    G G   EDYCKT+P   EC
Sbjct  380  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAGTGGGG--GEDYCKTDPNAVEC  437

Query  182  KVFE  193
            KVF+
Sbjct  438  KVFD  441



>gb|ABK00057.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Mesostigma 
viride]
Length=384

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWY NEWGYSQRVVDLA +VA+ WPG+      DPLE +C TNP   EC
Sbjct  323  MVMGDDMVKVVAWYGNEWGYSQRVVDLADIVANNWPGMVQETGSDPLETFCNTNPDADEC  382

Query  182  KV  187
            +V
Sbjct  383  RV  384



>ref|XP_004985859.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Setaria italica]
Length=445

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV-ASKWPGVAVAGSGDPLEDYCKTNPGDKE  178
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV A      A  GSGDPLED+CK NP   E
Sbjct  380  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAAAAGGSGDPLEDFCKDNPETDE  439

Query  179  CKVFEA  196
            CKV+EA
Sbjct  440  CKVYEA  445



>gb|AAA72117.1| unnamed protein product, partial [Zea mays]
Length=57

 Score = 85.5 bits (210),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  26   KVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  196
            KVVAWYDNEWGYSQRVVDLAHLVA+KWPG A AGSGDPLED+CK NP   ECKV+EA
Sbjct  1    KVVAWYDNEWGYSQRVVDLAHLVAAKWPGAAAAGSGDPLEDFCKDNPETDECKVYEA  57



>ref|XP_003056194.1| hypothetical protein MICPUCDRAFT_25339 [Micromonas pusilla CCMP1545]
 gb|EEH59570.1| hypothetical protein MICPUCDRAFT_25339 [Micromonas pusilla CCMP1545]
Length=406

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGY+QRVVDL H+VA+          GDP++ +C  +P  +EC
Sbjct  343  MVMGDDMVKVVAWYDNEWGYTQRVVDLTHIVAAGLIEGGEVTVGDPMDAFCADDPSAEEC  402

Query  182  KVFE  193
            KVF+
Sbjct  403  KVFD  406



>ref|XP_007515295.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO14174.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=405

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGY+QRVVDL  +VA K     V    DP++  C ++PG +EC
Sbjct  343  MVMGDDMVKVVAWYDNEWGYTQRVVDLTLIVA-KALVTGVENFSDPMDALCASDPGAEEC  401

Query  182  KVFE  193
            KVF+
Sbjct  402  KVFD  405



>ref|XP_002507103.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
 gb|ACO68361.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
Length=405

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 5/66 (8%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAG--SGDPLEDYCKTNPGDK  175
            MVMGDDMVKVVAWYDNEWGY+QRVVDL H+VA    G+   G  S DP++  C  +P  +
Sbjct  343  MVMGDDMVKVVAWYDNEWGYTQRVVDLTHIVAK---GLIEGGDVSADPMDALCADDPSAE  399

Query  176  ECKVFE  193
            ECKVF+
Sbjct  400  ECKVFD  405



>ref|XP_001415434.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABG85192.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
B [Ostreococcus 'lucimarinus']
 gb|ABO93726.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=406

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGY+QRVVDL+ +VA+      VA S DP++  C  +P   EC
Sbjct  344  MVMGDDMVKVVAWYDNEWGYTQRVVDLSLIVANGLINEGVA-SADPMDQLCADDPSADEC  402

Query  182  KVFE  193
            KVF+
Sbjct  403  KVFD  406



>emb|CEF96577.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=407

 Score = 79.3 bits (194),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MVMGDDMVKVVAWYDNEWGY+QRVVDL  +VA+       + + DPL+  C  +P   EC
Sbjct  344  MVMGDDMVKVVAWYDNEWGYTQRVVDLTLIVANSLINEG-SVTLDPLDQLCSDDPSADEC  402

Query  182  KVFEA  196
            KVF++
Sbjct  403  KVFDS  407



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  112
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+ WPG
Sbjct  357  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANNWPG  393



>gb|AEW08707.1| hypothetical protein CL1325Contig1_03, partial [Pinus radiata]
 gb|AFG57811.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
 gb|AFG57812.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
 gb|AFG57813.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
 gb|AFG57814.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
 gb|AFG57815.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
 gb|AFG57816.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
 gb|AFG57817.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
 gb|AFG57818.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
 gb|AFG57819.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
 gb|AFG57820.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
 gb|AFG57821.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
 gb|AFG57822.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
 gb|AFG57823.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
 gb|AFG57824.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
 gb|AFG57825.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
 gb|AFG57826.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
 gb|AFG57827.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
 gb|AFG57828.1| hypothetical protein CL1325Contig1_03, partial [Pinus taeda]
Length=45

 Score = 73.2 bits (178),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +2

Query  62   SQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  196
            SQRVVDLAHLVA+KWPG    GSGDPL+D+CK NP   EC+V+EA
Sbjct  1    SQRVVDLAHLVAAKWPGAGKGGSGDPLDDFCKDNPATDECRVYEA  45



>ref|XP_003074208.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC) [Ostreococcus 
tauri]
Length=434

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MV+GDDMVKVVAWYDNEWGY+QRVVDL  +VA+       + + DPL+  C  +P   EC
Sbjct  371  MVIGDDMVKVVAWYDNEWGYTQRVVDLTLIVANSLINEG-SVTLDPLDQLCSDDPSADEC  429

Query  182  KVFEA  196
            KVF++
Sbjct  430  KVFDS  434



>gb|ABG85191.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
B [Ostreococcus tauri]
Length=439

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKEC  181
            MV+GDDMVKVVAWYDNEWGY+QRVVDL  +VA+       + + DPL+  C  +P   EC
Sbjct  376  MVIGDDMVKVVAWYDNEWGYTQRVVDLTLIVANSLINEG-SVTLDPLDQLCSDDPSADEC  434

Query  182  KVFEA  196
            KVF++
Sbjct  435  KVFDS  439



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAH+VA KW
Sbjct  364  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHIVAEKW  398



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  112
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW G
Sbjct  322  MVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKWTG  358



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAH+VA KW
Sbjct  371  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHIVAEKW  405



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  112
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW G
Sbjct  363  MVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKWTG  399



>gb|ABR18416.1| unknown [Picea sitchensis]
 gb|ACN40948.1| unknown [Picea sitchensis]
Length=471

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 5/69 (7%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDY----CKTNPG  169
            MV+G+DM+KVVAWYDNEW YSQRVVDLAH V ++W  +A+ GS     +Y    C+ +  
Sbjct  404  MVVGEDMIKVVAWYDNEWAYSQRVVDLAHTVQARWE-LAMGGSASAALEYEQSICRVDSE  462

Query  170  DKECKVFEA  196
            + ECK+ + 
Sbjct  463  NIECKIHDT  471



>gb|ABD37956.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Spermatozopsis 
similis]
Length=263

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVK+VAWYDNEWGYSQRVVDLA L ASKW
Sbjct  228  MVMGDDMVKIVAWYDNEWGYSQRVVDLAELAASKW  262



>ref|XP_010430771.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like, 
partial [Camelina sativa]
Length=118

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  83   MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  117



>ref|XP_006844714.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
 gb|ERN06389.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
Length=398

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLAH+VA++W
Sbjct  363  MVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVANQW  397



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  343  MVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  377



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  371  MVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  405



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  371  MVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  405



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  365  MVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  399



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  342  MVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  376



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  365  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  399



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  365  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  399



>gb|ABY20971.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Hypericum 
perforatum]
Length=141

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +2

Query  5    VMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            VMGDDMVKV+AWYDNEWGYSQRVVDLA LVA+KW
Sbjct  107  VMGDDMVKVIAWYDNEWGYSQRVVDLADLVANKW  140



>gb|KFM26247.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
Length=412

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA LVA KW
Sbjct  377  MVMGDDMVKVIAWYDNEWGYSQRVVDLAELVAQKW  411



>gb|ABK96725.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLAH+VA +W
Sbjct  369  MVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADQW  403



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  365  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  399



>gb|ABK96233.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLAH+VA +W
Sbjct  369  MVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADQW  403



>ref|XP_006386825.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
 gb|ERP64622.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
Length=403

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLAH+VA +W
Sbjct  368  MVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADQW  402



>gb|ABK94956.1| unknown [Populus trichocarpa]
Length=403

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLAH+VA +W
Sbjct  368  MVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADQW  402



>ref|XP_010425376.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  282  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  316



>ref|XP_010502598.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=317

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  282  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  316



>gb|ACX37507.1| chloroplast glyceraldehyde 3-phosphate dehydrogenase [Botryococcus 
braunii]
Length=411

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA KW
Sbjct  376  MVMGDDMVKVVAWYDNEWGYSQRVVDLAEIVAKKW  410



>gb|AFK24459.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Ziziphus jujuba]
Length=96

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  109
            MVMGDD+VKV+AWYDNEWGYSQRVVDLA +VA+KW 
Sbjct  61   MVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANKWK  96



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLAH+VA  W
Sbjct  367  MVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADNW  401



>dbj|BAG90619.1| unnamed protein product [Oryza sativa Japonica Group]
Length=140

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  105  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  139



>ref|XP_010942312.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
A, chloroplastic-like [Elaeis guineensis]
Length=445

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  410  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  444



>gb|ELS46726.1| glyceraldehyde-3-phosphate dehydrogenase 2 [Microcystis aeruginosa 
DIANCHI905]
Length=288

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  112
            MVMG DMVKV+AWYDNEWGYSQRVVDLA +VASKW G
Sbjct  252  MVMGGDMVKVIAWYDNEWGYSQRVVDLAEVVASKWKG  288



>ref|WP_018398495.1| glyceraldehyde-3-phosphate dehydrogenase [filamentous cyanobacterium 
ESFC-1]
Length=338

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  109
            MVMG D+VKVVAWYDNEWGYSQRVVDLA LVA KWP
Sbjct  302  MVMGGDLVKVVAWYDNEWGYSQRVVDLAELVAQKWP  337



>gb|ABD37963.1| glyceraldehyde-3-phosphate dehydrogenase subunit A2 [Physcomitrella 
patens]
Length=323

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMG+DMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  288  MVMGEDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  322



>ref|WP_015163373.1| glyceraldehyde-3-phosphate dehydrogenase, type I [Pseudanabaena 
sp. PCC 7367]
 ref|YP_007100827.1| glyceraldehyde-3-phosphate dehydrogenase, type I [Pseudanabaena 
sp. PCC 7367]
 gb|AFY68399.1| glyceraldehyde-3-phosphate dehydrogenase, type I [Pseudanabaena 
sp. PCC 7367]
Length=337

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGD+MVKVVAWYDNEWGYSQRVVDLA LVA KW
Sbjct  302  MVMGDNMVKVVAWYDNEWGYSQRVVDLAELVAKKW  336



>ref|XP_010507000.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like, 
partial [Camelina sativa]
 ref|XP_010507006.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like, 
partial [Camelina sativa]
Length=120

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  85   MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  119



>ref|XP_001766703.1| predicted protein [Physcomitrella patens]
 gb|EDQ68556.1| predicted protein [Physcomitrella patens]
Length=376

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMG+DMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  341  MVMGEDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  375



>dbj|BAD94928.1| glyceraldehyde 3-phosphate dehydrogenase A [Arabidopsis thaliana]
Length=73

 Score = 67.4 bits (163),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  38   MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  72



>ref|WP_002760704.1| glyceraldehyde-3-phosphate dehydrogenase [Microcystis aeruginosa]
 emb|CCH97953.1| Glyceraldehyde-3-phosphate dehydrogenase 2 [Microcystis aeruginosa 
PCC 9717]
Length=357

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  112
            MVMG DMVKV+AWYDNEWGYSQRVVDLA +VASKW G
Sbjct  321  MVMGGDMVKVIAWYDNEWGYSQRVVDLAEVVASKWKG  357



>pdb|1JN0|O Chain O, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|A Chain A, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|B Chain B, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
Length=335

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  299  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  333



>gb|AHA84230.1| glyceraldehyde-3-phosphate dehydrogenase A [Phaseolus vulgaris]
Length=402

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  367  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  401



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  301  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  335



>ref|WP_012265625.1| glyceraldehyde-3-phosphate dehydrogenase [Microcystis aeruginosa]
 ref|YP_001657517.1| glyceraldehyde-3-phosphate dehydrogenase [Microcystis aeruginosa 
NIES-843]
 dbj|BAG02325.1| NAD(P)-dependent glyceraldehyde-3-phosphate dehydrogenase [Microcystis 
aeruginosa NIES-843]
Length=338

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  112
            MVMG DMVKV+AWYDNEWGYSQRVVDLA +VASKW G
Sbjct  302  MVMGGDMVKVIAWYDNEWGYSQRVVDLAEVVASKWKG  338



>ref|WP_002752737.1| glyceraldehyde-3-phosphate dehydrogenase [Microcystis aeruginosa]
 emb|CCH91489.1| Glyceraldehyde-3-phosphate dehydrogenase 2 [Microcystis aeruginosa 
PCC 9432]
 emb|CCI05723.1| Glyceraldehyde-3-phosphate dehydrogenase 2 [Microcystis aeruginosa 
PCC 7941]
 emb|CCI25769.1| Glyceraldehyde-3-phosphate dehydrogenase 2 [Microcystis aeruginosa 
PCC 9808]
Length=357

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  112
            MVMG DMVKV+AWYDNEWGYSQRVVDLA +VASKW G
Sbjct  321  MVMGGDMVKVIAWYDNEWGYSQRVVDLAEVVASKWKG  357



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  301  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  335



>ref|WP_002789220.1| glyceraldehyde-3-phosphate dehydrogenase [Microcystis aeruginosa]
 emb|CCI19184.1| Glyceraldehyde-3-phosphate dehydrogenase 2 [Microcystis aeruginosa 
PCC 9807]
Length=357

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  112
            MVMG DMVKV+AWYDNEWGYSQRVVDLA +VASKW G
Sbjct  321  MVMGGDMVKVIAWYDNEWGYSQRVVDLAEVVASKWKG  357



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  301  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  335



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  301  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  335



>dbj|BAD93961.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=161

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  126  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  160



>dbj|GAL93645.1| NADPH-dependent glyceraldehyde-3-phosphate dehydrogenase [Microcystis 
aeruginosa NIES-44]
Length=338

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  112
            MVMG DMVKV+AWYDNEWGYSQRVVDLA +VASKW G
Sbjct  302  MVMGGDMVKVIAWYDNEWGYSQRVVDLAEVVASKWKG  338



>ref|WP_002780388.1| Glyceraldehyde-3-phosphate dehydrogenase 2 [Microcystis aeruginosa]
 emb|CCI14466.1| Glyceraldehyde-3-phosphate dehydrogenase 2 [Microcystis aeruginosa 
PCC 9806]
Length=338

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  112
            MVMG DMVKV+AWYDNEWGYSQRVVDLA +VASKW G
Sbjct  302  MVMGGDMVKVIAWYDNEWGYSQRVVDLAEVVASKWKG  338



>ref|WP_002731954.1| glyceraldehyde-3-phosphate dehydrogenase [Microcystis aeruginosa]
 emb|CAO91151.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCI01989.1| Glyceraldehyde-3-phosphate dehydrogenase 2 [Microcystis aeruginosa 
PCC 9443]
 gb|ELP55638.1| glyceraldehyde-3-phosphate dehydrogenase, type I [Microcystis 
aeruginosa TAIHU98]
 gb|EPF21612.1| Glyceraldehyde-3-phosphate dehydrogenase 2 [Microcystis aeruginosa 
SPC777]
Length=338

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  112
            MVMG DMVKV+AWYDNEWGYSQRVVDLA +VASKW G
Sbjct  302  MVMGGDMVKVIAWYDNEWGYSQRVVDLAEVVASKWKG  338



>emb|CDY28536.1| BnaC02g36240D [Brassica napus]
Length=380

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  345  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  379



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  360  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  394



>ref|XP_002503470.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
 gb|ACO64728.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
Length=377

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDD++KVVAWYDNEWGYSQRVVDLA L A+KW
Sbjct  341  MVMGDDLIKVVAWYDNEWGYSQRVVDLAELTATKW  375



>gb|ABW89104.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
Length=195

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  160  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  194



>emb|CDX83635.1| BnaC07g23750D [Brassica napus]
Length=380

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  345  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  379



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  368  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>gb|ABG35250.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35251.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35252.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35253.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35256.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35257.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35258.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35259.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35260.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35261.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35262.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35263.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35264.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35265.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35266.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35268.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35269.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35270.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35271.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35272.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35273.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35274.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35275.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35276.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35277.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35278.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35279.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35280.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35281.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35282.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35283.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35284.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35285.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35286.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35287.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35288.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35289.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35290.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35291.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35292.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35293.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35294.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35295.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35296.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35297.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35298.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35299.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35300.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35301.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35302.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35303.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35304.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35305.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35306.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35307.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35308.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35309.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35310.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35311.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35312.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35313.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
Length=224

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  189  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  223



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  345  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  379



>gb|ABW89099.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89100.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89101.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89102.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89103.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89105.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89106.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89107.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89108.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89109.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89110.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89111.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89112.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89113.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89114.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89115.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89116.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABW89117.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
Length=206

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  171  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  205



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  368  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  368  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>ref|WP_023068106.1| glyceraldehyde-3-phosphate dehydrogenase, type I [Lyngbya aestuarii]
 gb|ERT05629.1| glyceraldehyde-3-phosphate dehydrogenase, type I [Lyngbya aestuarii 
BL J]
Length=290

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  109
            MVMG DMVKV+AWYDNEWGYSQRVVDLA LVA  WP
Sbjct  253  MVMGGDMVKVIAWYDNEWGYSQRVVDLAELVAKHWP  288



>gb|ABG35254.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
 gb|ABG35255.1| glyceraldehyde-3-phosphate dehydrogenase [Helianthus annuus]
Length=224

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  189  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  223



>dbj|BAK02737.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=306

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  271  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  305



>gb|AEO45783.1| glyceraldehyde-3-phosphate dehydrogenase A [Scoparia dulcis]
Length=398

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  363  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  397



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  368  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  368  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA++VA +W
Sbjct  367  MVMGDDMVKVVAWYDNEWGYSQRVVDLANIVAEQW  401



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA++VA +W
Sbjct  367  MVMGDDMVKVVAWYDNEWGYSQRVVDLANIVAEQW  401



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  365  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  399



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  365  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  399



>ref|XP_010660642.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Vitis vinifera]
Length=403

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  368  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>gb|ABQ53991.1| glyceraldehyde 3-phosphate dehydrogenase [Cicer arietinum]
Length=78

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDD+VKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  44   MVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNW  78



>sp|P09672.1|G3PA_SINAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A, partial [Sinapis alba]
 emb|CAA27845.1| chloroplast GAPDH (233aa) [Sinapis alba]
Length=233

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  198  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  232



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  366  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  400



>ref|XP_002278352.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Vitis vinifera]
Length=404

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  369  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  403



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  361  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  395



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  361  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  395



>ref|XP_010929533.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
A, chloroplastic [Elaeis guineensis]
Length=261

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  226  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  260



>dbj|BAA94304.1| NADP-glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas 
sp. W80]
Length=369

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA + A KW
Sbjct  334  MVMGDDMVKVVAWYDNEWGYSQRVVDLAEITAQKW  368



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  364  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>emb|CAN78872.1| hypothetical protein VITISV_021726 [Vitis vinifera]
Length=404

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  369  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  403



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  361  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  395



>ref|XP_009148557.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  282  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  316



>gb|ABC00187.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Dunaliella 
viridis]
 gb|ABC00188.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Dunaliella 
viridis]
Length=376

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA L A +W
Sbjct  340  MVMGDDMVKVVAWYDNEWGYSQRVVDLAELTAQRW  374



>ref|XP_010528120.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=280

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  245  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  279



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA++W
Sbjct  374  MVMGDDMVKVIAWYDNEWGYSQRVVDLANIVANQW  408



>gb|ABD37957.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Cladophora 
rupestris]
Length=376

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRV+DLA L A KW
Sbjct  341  MVMGDDMVKVVAWYDNEWGYSQRVLDLAELCAEKW  375



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  364  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>gb|ADU04755.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04760.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04761.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04762.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  103
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAH++A++
Sbjct  251  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMANQ  284



>gb|ABA01125.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlamydomonas incerta]
Length=369

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA + A KW
Sbjct  333  MVMGDDMVKVVAWYDNEWGYSQRVVDLAEITAKKW  367



>ref|WP_009787048.1| glyceraldehyde-3-phosphate dehydrogenase [Lyngbya sp. PCC 8106]
 gb|EAW34441.1| glyceraldehyde-3-phosphate dehydrogenase [Lyngbya sp. PCC 8106]
Length=340

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  109
            MVMG DMVKV+AWYDNEWGYSQRVVDLA LVA  WP
Sbjct  303  MVMGGDMVKVIAWYDNEWGYSQRVVDLAELVAKHWP  338



>ref|XP_003055659.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
 gb|EEH60911.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
Length=380

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMG+D+VK+VAWYDNEWGYSQRVVDLA L ASKW
Sbjct  343  MVMGEDLVKIVAWYDNEWGYSQRVVDLAELTASKW  377



>gb|ABK00067.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlorokybus atmophyticus]
Length=325

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA+ W
Sbjct  278  MVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNW  312



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA KW
Sbjct  366  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVADKW  400



>ref|WP_008231341.1| NADPH-dependent glyceraldehyde-3-phosphate dehydrogenase [Richelia 
intracellularis]
 emb|CCH66164.1| NADPH-dependent glyceraldehyde-3-phosphate dehydrogenase [Richelia 
intracellularis HH01]
Length=337

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMG DMVKV+AWYDNEWGYSQRVVDLA LVASKW
Sbjct  303  MVMGGDMVKVMAWYDNEWGYSQRVVDLAELVASKW  337



>gb|AAA33485.1| glyceraldehyde-3-phosphate dehydrogenase precursor, partial [Zea 
mays]
Length=103

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV++WYDNEWGYSQRVVDLA + A++W
Sbjct  68   MVMGDDMVKVISWYDNEWGYSQRVVDLADICANQW  102



>ref|XP_001689871.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 sp|P50362.1|G3PA_CHLRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAA86855.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP09609.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
Length=374

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA + A KW
Sbjct  338  MVMGDDMVKVVAWYDNEWGYSQRVVDLAEVTAKKW  372



>ref|XP_010476270.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  282  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  316



>gb|ADU04754.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  103
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAH++A +
Sbjct  251  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAKE  284



>ref|NP_001077529.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28945.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=317

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  282  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  316



>ref|XP_010494750.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  282  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  316



>ref|WP_035985041.1| glyceraldehyde-3-phosphate dehydrogenase [Leptolyngbya sp. KIOST-1]
Length=337

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMG DMVKVVAWYDNEWGYSQRVVDLA LVA+KW
Sbjct  302  MVMGGDMVKVVAWYDNEWGYSQRVVDLAELVAAKW  336



>ref|XP_002955293.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
 gb|EFJ43593.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
Length=374

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA + A KW
Sbjct  338  MVMGDDMVKVVAWYDNEWGYSQRVVDLAEVTAQKW  372



>gb|AAM94008.1| glyceraldehyde-3-phosphate dehydrogenase [Griffithsia japonica]
Length=107

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDD+VKVVAWYDNEWGYSQRVVDL  ++A+KW
Sbjct  72   MVMGDDLVKVVAWYDNEWGYSQRVVDLGEIMAAKW  106



>ref|XP_008449975.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Cucumis melo]
Length=403

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDD+VKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  368  MVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>ref|XP_008449974.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Cucumis melo]
Length=404

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDD+VKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  369  MVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNW  403



>gb|ADX97321.1| glyceraldehyde-3-phosphate dehydrogenase [Mangifera indica]
Length=401

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            +VMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  366  LVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  400



>gb|ACA35006.1| glyceraldehyde-3-phosphate dehydrogenase [Dunaliella salina]
Length=376

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA + A +W
Sbjct  340  MVMGDDMVKVVAWYDNEWGYSQRVVDLAEITAQRW  374



>emb|CDY48981.1| BnaA02g28150D [Brassica napus]
Length=368

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  333  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  367



>ref|WP_025781786.1| glyceraldehyde-3-phosphate dehydrogenase [Candidatus Synechococcus 
spongiarum]
Length=346

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW-PGVAVA  124
            M MGD+M+KVVAWYDNEWGYSQRVVDLA +VASKW P  A A
Sbjct  305  MAMGDNMIKVVAWYDNEWGYSQRVVDLAEVVASKWEPSPAAA  346



>ref|XP_005644071.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19527.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
Length=393

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/32 (97%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA  97
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA LVA
Sbjct  359  MVMGDDMVKVVAWYDNEWGYSQRVVDLAELVA  390



>ref|XP_009404713.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=404

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  369  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  403



>ref|XP_006652373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=401

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  366  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>ref|XP_011003600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Populus euphratica]
Length=404

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  369  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  403



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDL+ +VA+ W
Sbjct  364  MVMGDDMVKVIAWYDNEWGYSQRVVDLSDIVANNW  398



>ref|XP_006652372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=403

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  368  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  402



>dbj|BAJ90530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  366  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>ref|XP_003579898.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  368  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  402



>gb|AAM21776.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21777.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21778.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21779.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21780.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21781.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21782.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21783.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21784.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21785.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21786.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21787.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21788.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21789.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21790.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21791.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21793.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21794.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21795.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21796.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21797.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21798.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21799.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21800.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21801.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21802.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21803.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21804.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21805.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21806.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21807.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21808.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
 gb|AAM21809.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Zea mays]
Length=46

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  109
            MVMGDDMVKV++WYDNEWGYSQRVVDLA + A++W 
Sbjct  11   MVMGDDMVKVISWYDNEWGYSQRVVDLADICANQWK  46



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  364  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  398



>sp|P09043.1|G3PA_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34075.1| glyceraldehyde-3-phosphate dehydrogenase A-subunit precursor, 
partial [Nicotiana tabacum]
Length=392

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  357  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  391



>ref|XP_009420999.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=402

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  367  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  401



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  366  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>gb|ABD37959.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorokybus 
atmophyticus]
Length=347

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA+ W
Sbjct  300  MVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNW  334



>ref|XP_004236849.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Solanum lycopersicum]
Length=399

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  364  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  398



>ref|NP_001052984.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAD40906.1| OSJNBa0036B21.24 [Oryza sativa Japonica Group]
 emb|CAE01532.1| OSJNBa0072F16.1 [Oryza sativa Japonica Group]
 dbj|BAF14898.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAH67076.1| OSIGBa0097P08.6 [Oryza sativa Indica Group]
 emb|CAH67444.1| H0219H12.1 [Oryza sativa Indica Group]
 gb|EAY94393.1| hypothetical protein OsI_16160 [Oryza sativa Indica Group]
 gb|EAZ30968.1| hypothetical protein OsJ_15048 [Oryza sativa Japonica Group]
 dbj|BAG92628.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96321.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96327.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBW45779.1| ORW1943Ba0077G13.7 [Oryza rufipogon]
Length=402

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  367  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  401



>gb|ABK00056.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Mesostigma viride]
Length=310

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  103
            MVMGDDMVKVVAWYDNEWGYSQRVVDLAH++A +
Sbjct  277  MVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAKE  310



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  366  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>dbj|BAJ90885.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  366  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  106
            MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  366  MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508784459172