BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15666_g1_i1 len=151 path=[129:0-150]

Length=151
                                                                      Score     E

ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    100   1e-23   
ref|XP_002540513.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...  97.1    2e-23   Ricinus communis
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  99.4    3e-23   
gb|ACA52221.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  93.6    5e-23   Oenothera elata subsp. hookeri [Hooker's evening primrose]
dbj|BAK05515.1|  predicted protein                                    95.1    6e-23   
emb|CDP07271.1|  unnamed protein product                              98.6    9e-23   
gb|KDP36765.1|  hypothetical protein JCGZ_08056                       98.2    1e-22   
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...  98.2    1e-22   
gb|AES74101.2|  glyceraldehyde-3-phosphate dehydrogenase B            97.1    1e-22   
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B            97.8    1e-22   
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  98.2    1e-22   
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.8    1e-22   
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...  97.8    1e-22   
ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.8    1e-22   
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  97.8    1e-22   
gb|ACU20783.1|  unknown                                               97.8    1e-22   Glycine max [soybeans]
gb|ABS72003.1|  putative chloroplast glyceradehyde-3-phosphate de...  94.0    1e-22   Olea europaea
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.8    1e-22   
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...  97.8    1e-22   
ref|NP_001240080.1|  uncharacterized protein LOC100806482             97.8    2e-22   
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase              97.1    2e-22   
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...  97.8    2e-22   Ricinus communis
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g           97.8    2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase         97.4    2e-22   
gb|ACJ84309.1|  unknown                                               97.4    2e-22   Medicago truncatula
gb|EPS70760.1|  hypothetical protein M569_03997                       97.1    2e-22   
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase         97.8    2e-22   
emb|CAA33262.1|  unnamed protein product                              97.1    3e-22   Pisum sativum [garden pea]
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g           96.7    3e-22   
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...  97.1    3e-22   Pisum sativum [garden pea]
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...  96.7    4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  96.7    4e-22   
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  97.4    4e-22   
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  96.7    4e-22   
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...  96.3    4e-22   Nicotiana tabacum [American tobacco]
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.9    5e-22   
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  96.3    5e-22   
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  96.3    5e-22   
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g           96.3    5e-22   
gb|AAG23800.1|  chloroplast NADP-dependent glyceraldehyde 3-phosp...  93.2    5e-22   Cucurbita pepo
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg           96.3    5e-22   
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit    95.5    6e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.9    6e-22   
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...  95.9    6e-22   
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.9    7e-22   
gb|KGN49135.1|  hypothetical protein Csa_6G514950                     93.2    7e-22   
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B          95.9    7e-22   Arabidopsis thaliana [mouse-ear cress]
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B    94.7    7e-22   Spirogyra sp. SAG 170.80
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                 95.5    8e-22   
gb|ABF74607.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  92.4    9e-22   Agave tequilana
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.1    1e-21   
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B       97.8    1e-21   
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  95.1    1e-21   
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  95.1    1e-21   
ref|WP_033581593.1|  glyceraldehyde-3-phosphate dehydrogenase         89.7    1e-21   
dbj|BAJ87214.1|  predicted protein                                    95.1    1e-21   
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg           95.1    1e-21   
dbj|BAJ86633.1|  predicted protein                                    95.1    1e-21   
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.1    1e-21   
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.1    2e-21   
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.1    2e-21   
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  95.1    2e-21   
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  94.7    2e-21   
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B            94.7    2e-21   
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...  94.7    2e-21   
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  94.7    2e-21   
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  94.4    3e-21   
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190        94.0    3e-21   
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  94.0    3e-21   
ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  94.0    4e-21   
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  94.0    4e-21   
gb|ABK00067.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  92.8    4e-21   Chlorokybus atmophyticus
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517           93.6    4e-21   
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457           93.6    4e-21   
gb|ABF93789.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...  92.4    5e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CAN69459.1|  hypothetical protein VITISV_021576                   93.6    5e-21   Vitis vinifera
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.6    5e-21   
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.6    5e-21   Vitis vinifera
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.6    6e-21   
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.6    6e-21   
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.6    6e-21   
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.6    6e-21   
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    92.4    6e-21   Chlorokybus atmophyticus
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.2    8e-21   
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase             92.0    8e-21   Capsicum annuum
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.2    8e-21   
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B            93.2    8e-21   
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  93.2    8e-21   
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase             93.2    9e-21   
ref|NP_001048847.1|  Os03g0129300                                     92.8    1e-20   Oryza sativa Japonica Group [Japonica rice]
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase             91.7    1e-20   Sphagnum cuspidatum
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  92.8    1e-20   
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  92.4    1e-20   
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg           92.4    1e-20   
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  92.4    1e-20   
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  92.4    1e-20   
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg           91.3    3e-20   
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B            90.1    4e-20   
sp|P09672.1|G3PA_SINAL  RecName: Full=Glyceraldehyde-3-phosphate ...  89.4    4e-20   Sinapis alba [bai jie]
emb|CDY69523.1|  BnaC08g46180D                                        90.5    4e-20   
ref|NP_001077529.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2   89.7    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148557.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.7    5e-20   
ref|XP_010476270.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.7    5e-20   
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    89.4    5e-20   Chara vulgaris
ref|XP_010494750.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.4    5e-20   
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  90.9    6e-20   
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                  90.5    8e-20   
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...  89.0    1e-19   
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase             90.5    1e-19   Chara vulgaris
gb|ADU04755.1|  glyceraldehyde-3-phosphate dehydrogenase              88.6    1e-19   
gb|ABK00056.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  88.6    1e-19   Mesostigma viride
gb|ADU04754.1|  glyceraldehyde-3-phosphate dehydrogenase              88.2    1e-19   
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.4    1e-19   
dbj|BAH57068.1|  AT1G12900                                            88.6    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2   88.6    1e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase             88.2    1e-19   Spirogyra sp.
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...  89.0    1e-19   Nicotiana tabacum [American tobacco]
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A           89.0    1e-19   
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg           88.6    1e-19   
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.0    2e-19   
ref|XP_009118049.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  88.2    2e-19   
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...  89.4    2e-19   Spinacia oleracea
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    88.2    2e-19   Mesostigma viride
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.4    2e-19   
ref|XP_010430771.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  85.1    2e-19   
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  88.6    2e-19   
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase              87.8    2e-19   
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg           88.6    2e-19   
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  88.6    2e-19   
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  88.6    2e-19   
emb|CDY19412.1|  BnaC05g09210D                                        88.6    2e-19   
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg           88.6    2e-19   
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2      88.6    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892719.1|  GAPA-2                                           88.6    2e-19   
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B    89.4    2e-19   Chlorokybus atmophyticus
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  89.0    3e-19   
dbj|BAD93961.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit   85.1    4e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A            87.4    4e-19   
ref|XP_010507000.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  84.3    4e-19   
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  88.6    4e-19   
emb|CDX83635.1|  BnaC07g23750D                                        87.4    5e-19   
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                  87.4    5e-19   
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...  87.4    6e-19   
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  87.0    6e-19   Marchantia polymorpha
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg           87.4    6e-19   
dbj|BAJ34149.1|  unnamed protein product                              87.4    6e-19   
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  87.4    6e-19   
emb|CDY16038.1|  BnaC08g40850D                                        87.4    6e-19   
emb|CDY26599.1|  BnaA09g46780D                                        87.4    7e-19   
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...  86.3    8e-19
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...  86.3    8e-19   
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...  86.3    8e-19   
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...  86.3    8e-19   
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  87.4    9e-19   
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase             87.0    9e-19   Marchantia polymorpha
gb|ACN57670.1|  At3g26650-like protein                                83.6    1e-18   Capsella rubella
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...  85.9    1e-18   
gb|ABY20971.1|  glyceraldehyde-3-phosphate dehydrogenase A subunit    83.6    1e-18   Hypericum perforatum
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                  86.7    1e-18   
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...  86.7    1e-18   Spinacia oleracea
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...  85.9    1e-18   
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  86.3    1e-18   
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  86.3    2e-18   
gb|ACU21011.1|  unknown                                               86.3    2e-18   Glycine max [soybeans]
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561           86.3    2e-18   
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...  86.3    2e-18   
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  86.3    2e-18   
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  86.3    2e-18   
emb|CDY13649.1|  BnaA06g32740D                                        85.9    2e-18   
ref|XP_010425376.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  85.1    2e-18   
ref|XP_010502598.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  85.1    2e-18   
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase             85.1    2e-18   
emb|CDY28536.1|  BnaC02g36240D                                        85.5    2e-18   
gb|KDP41897.1|  hypothetical protein JCGZ_26915                       85.9    2e-18   
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  85.9    2e-18   
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  85.1    3e-18   
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...  85.9    3e-18   Ricinus communis
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...  84.7    3e-18   
gb|EPS59235.1|  hypothetical protein M569_15573                       85.5    3e-18   
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase             85.5    3e-18   
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...  85.1    3e-18   Micromonas commoda
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit    84.7    3e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase             84.3    4e-18   Capsicum annuum
gb|AAA33485.1|  glyceraldehyde-3-phosphate dehydrogenase precursor    81.3    4e-18   Zea mays [maize]
gb|ACN57671.1|  At3g26650-like protein                                82.0    4e-18   Capsella rubella
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase              85.1    4e-18   Bruguiera gymnorhiza [Burma mangrove]
emb|CDY48981.1|  BnaA02g28150D                                        84.7    4e-18   
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  85.1    5e-18   
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g           85.1    5e-18   
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825           85.1    5e-18   
ref|XP_002875330.1|  gapa                                             84.7    5e-18   
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  84.7    5e-18   
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  84.7    6e-18   
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit  84.7    6e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  84.7    6e-18   
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase              84.7    6e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase         84.7    6e-18   
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  84.7    6e-18   
emb|CDP18560.1|  unnamed protein product                              84.3    8e-18   
dbj|BAA94304.1|  NADP-glyceraldehyde-3-phosphate dehydrogenase        84.0    9e-18   Chlamydomonas sp. W80
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B       84.3    9e-18   Micromonas commoda
dbj|BAK02737.1|  predicted protein                                    83.2    1e-17   
ref|XP_001415434.1|  predicted protein                                84.0    1e-17   Ostreococcus lucimarinus CCE9901
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase         83.6    1e-17   Chlamydomonas reinhardtii
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  84.0    1e-17   
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  83.2    1e-17   Chlamydomonas incerta
gb|ABQ53991.1|  glyceraldehyde 3-phosphate dehydrogenase              79.3    1e-17   Cicer arietinum [garbanzo]
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  83.2    1e-17   Chlamydomonas incerta
gb|ADB81490.1|  glyceraldehyde-3-phosphate dehydrogenase              81.3    1e-17   
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg           83.6    1e-17   
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  83.6    1e-17   
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase             82.8    2e-17   Capsicum annuum
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A            83.6    2e-17   
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662            83.2    2e-17   
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase         83.2    2e-17   
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339           83.6    2e-17   
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  83.6    2e-17   
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  82.8    2e-17   
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...  82.8    3e-17   
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  82.8    3e-17   
dbj|BAJ90530.1|  predicted protein                                    82.8    3e-17   
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  82.8    3e-17   Ostreococcus tauri
dbj|BAJ90885.1|  predicted protein                                    82.8    3e-17   
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  83.2    3e-17   
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase              82.8    3e-17   
gb|ABD37956.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    81.3    3e-17   Spermatozopsis similis
gb|ABS86942.1|  glyceraldehyde-3-phosphate dehydrogenase              79.3    4e-17   Garcinia mangostana [mangosteen]
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...  82.8    4e-17   
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  82.4    5e-17   
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  82.4    5e-17   
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  82.0    5e-17   Mesostigma viride
gb|ADD54591.1|  putative glyceraldehyde-3-phosphate dehydrogenase     80.1    6e-17   Linum usitatissimum
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403           81.6    6e-17   
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B    82.0    7e-17   Mesostigma viride
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase             80.9    7e-17   Coleochaete scutata
gb|KHG21941.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  81.3    8e-17   
dbj|BAD94928.1|  glyceraldehyde 3-phosphate dehydrogenase A           77.0    8e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A       81.6    9e-17   
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  80.9    1e-16   
gb|ADB81482.1|  glyceraldehyde-3-phosphate dehydrogenase              79.0    1e-16   
gb|AFC88822.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...  80.1    1e-16   
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...  80.5    1e-16   
gb|ADB81480.1|  glyceraldehyde-3-phosphate dehydrogenase              78.6    1e-16   
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...  80.9    2e-16   
emb|CAA30152.1|  GADPH (383 AA)                                       80.9    2e-16   Zea mays [maize]
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...  80.9    2e-16   Zea mays [maize]
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  80.9    2e-16   
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1       80.9    2e-16   
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  80.9    2e-16   
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  80.9    2e-16   
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                  80.1    2e-16   
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  80.5    2e-16   
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...  80.9    2e-16   
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  80.9    2e-16   Ostreococcus tauri
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  80.1    3e-16   
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg           80.1    3e-16   
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase              79.7    3e-16   
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  80.1    3e-16   
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  80.1    3e-16   
gb|ADB81483.1|  glyceraldehyde-3-phosphate dehydrogenase              77.4    4e-16   
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    79.7    4e-16   Scherffelia dubia
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  80.1    4e-16   
gb|ABD37953.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    78.6    5e-16   Chlorella sp. JP-2005
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase  79.7    5e-16   Botryococcus braunii
gb|AAZ79661.1|  putative glyceraldehyde 3-phosphate dehydrogenase     76.3    6e-16   Fagus sylvatica
gb|ADB81486.1|  glyceraldehyde-3-phosphate dehydrogenase              77.8    8e-16   
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  79.0    1e-15   
gb|ADB81488.1|  glyceraldehyde-3-phosphate dehydrogenase              77.0    1e-15   
gb|ADB81485.1|  glyceraldehyde-3-phosphate dehydrogenase              77.0    2e-15   
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    77.8    2e-15   Cladophora rupestris
ref|NP_001052984.1|  Os04g0459500                                     77.8    2e-15   Oryza sativa Japonica Group [Japonica rice]
emb|CAA33264.1|  unnamed protein product                              77.8    2e-15   Pisum sativum [garden pea]
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...  77.8    2e-15   Pisum sativum [garden pea]
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase     77.4    3e-15   Medicago sativa [alfalfa]
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A       77.4    3e-15   
ref|XP_001779769.1|  predicted protein                                77.4    3e-15   
gb|ADB81495.1|  glyceraldehyde-3-phosphate dehydrogenase              75.1    3e-15   
ref|XP_001771209.1|  predicted protein                                77.4    4e-15   
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...  77.4    4e-15   
ref|XP_001779753.1|  predicted protein                                77.4    4e-15   
dbj|BAG90619.1|  unnamed protein product                              74.3    4e-15   
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1   76.6    4e-15   
ref|XP_001771246.1|  predicted protein                                77.0    4e-15   
ref|XP_001753934.1|  predicted protein                                77.0    5e-15   
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...  75.9    5e-15   
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2   75.5    6e-15   
ref|XP_001420043.1|  predicted protein                                75.5    1e-14   
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  75.9    1e-14   
gb|KFM26247.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  75.9    1e-14   
ref|XP_001766703.1|  predicted protein                                75.5    1e-14   
gb|ADB81481.1|  glyceraldehyde-3-phosphate dehydrogenase              73.6    1e-14   
gb|AEW46689.1|  glyceraldehyde-3-phosphate dehydrogenase              74.7    2e-14   
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  75.1    3e-14   
gb|ACN40006.1|  unknown                                               74.7    4e-14   
gb|ABK24645.1|  unknown                                               74.7    4e-14   
gb|ACN40526.1|  unknown                                               74.7    4e-14   
gb|ABK00066.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  72.4    5e-14   
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    73.6    8e-14   
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  72.4    1e-13   
ref|XP_010528120.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  71.6    1e-13   
gb|ADB81494.1|  glyceraldehyde-3-phosphate dehydrogenase              71.6    2e-13   
gb|EMT31122.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...  69.7    2e-13   
gb|ADB81489.1|  glyceraldehyde-3-phosphate dehydrogenase              71.2    3e-13   
gb|ABR08653.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  67.8    4e-13   
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  71.2    5e-13   
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase             71.6    5e-13   
gb|ABW89099.1|  glyceraldehyde-3-phosphate dehydrogenase              68.9    7e-13   
gb|ABW89104.1|  glyceraldehyde-3-phosphate dehydrogenase              68.9    8e-13   
emb|CAC80394.1|  glyceraldehyde-3-phosphate dehydrogenase             69.3    1e-12   
gb|ABG35254.1|  glyceraldehyde-3-phosphate dehydrogenase              68.6    1e-12   
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase         69.7    1e-12   
gb|ABD37960.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    69.3    2e-12   
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase         69.7    2e-12   
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  69.3    2e-12   
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase              68.9    3e-12   
gb|ABG35267.1|  glyceraldehyde-3-phosphate dehydrogenase              67.4    3e-12   
gb|ABG35250.1|  glyceraldehyde-3-phosphate dehydrogenase              67.0    3e-12   
dbj|BAN09110.1|  glyceraldehyde-3-phosphate dehydrogenase             67.0    4e-12   
gb|KDO63479.1|  hypothetical protein CISIN_1g013492mg                 67.4    5e-12   
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase              68.2    5e-12   
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  68.6    6e-12   
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  67.8    1e-11   
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg           67.8    1e-11   
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  67.8    1e-11   
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  67.8    1e-11   
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                 67.8    1e-11   
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  67.4    1e-11   
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                 67.4    1e-11   
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680        67.4    1e-11   
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                67.4    2e-11   
emb|CAC81001.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  66.2    2e-11   
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg              67.4    2e-11   
ref|WP_013781101.1|  glyceraldehyde-3-phosphate dehydrogenase         66.6    2e-11   
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase              67.0    2e-11   
emb|CAC85938.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  65.9    2e-11   
gb|AFK24459.1|  glyceraldehyde-3-phosphate dehydrogenase              63.2    3e-11   
gb|AAG23799.1|  chloroplast NADP-dependent glyceraldehyde 3-phosp...  64.3    3e-11   
ref|XP_010929533.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...  65.1    3e-11   
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [       65.9    4e-11   
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  66.2    4e-11   
gb|ACN39951.1|  unknown                                               65.5    4e-11   
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase  65.9    4e-11   
gb|ABK25233.1|  unknown                                               65.9    5e-11   
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A            65.9    5e-11   
gb|ACN40537.1|  unknown                                               65.9    5e-11   
gb|ACN40000.1|  unknown                                               65.9    5e-11   
gb|ABK24313.1|  unknown                                               65.9    5e-11   
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...  65.9    6e-11   
gb|AAM94008.1|  glyceraldehyde-3-phosphate dehydrogenase              62.8    6e-11   
gb|AGJ50596.1|  GAPDH                                                 65.1    8e-11   
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g           65.1    8e-11   
gb|ADB81484.1|  glyceraldehyde-3-phosphate dehydrogenase              63.9    8e-11   
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  65.1    8e-11   
gb|AAD10216.1|  glyceraldehyde-3-phosphate dehydrogenase              65.1    1e-10   
ref|WP_034142226.1|  glyceraldehyde-3-phosphate dehydrogenase         64.3    1e-10   
dbj|BAD72793.1|  glyceraldehyde-3-phosphate dehydrogenase             62.8    1e-10   
ref|WP_040484381.1|  glyceraldehyde-3-phosphate dehydrogenase         64.3    1e-10   
ref|WP_016876187.1|  glyceraldehyde-3-phosphate dehydrogenase         64.3    1e-10   
ref|WP_007556447.1|  glyceraldehyde-3-phosphate dehydrogenase         63.9    1e-10   
gb|ADB81493.1|  glyceraldehyde-3-phosphate dehydrogenase              62.4    1e-10   
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A           64.3    2e-10   
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  64.3    2e-10   
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  64.3    2e-10   
ref|WP_037218187.1|  glyceraldehyde-3-phosphate dehydrogenase         63.5    2e-10   
ref|WP_036744875.1|  glyceraldehyde-3-phosphate dehydrogenase         60.5    2e-10   
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  63.9    2e-10   
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g           63.9    2e-10   
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  63.9    2e-10   
gb|ABK94956.1|  unknown                                               63.9    2e-10   
gb|ABK96233.1|  unknown                                               63.9    2e-10   
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  63.9    2e-10   
dbj|BAC87930.1|  glyceraldehyde-3-phosphate dehydrogenase             63.2    2e-10   
ref|WP_022607378.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  63.2    3e-10   
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...  63.5    3e-10   
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase         63.2    3e-10   
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  63.2    3e-10   
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase         63.5    3e-10   
gb|ABK96725.1|  unknown                                               63.5    3e-10   
emb|CAB41845.1|  glyceraldehyde-3-phosphate dehydrogenase             62.8    3e-10   
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...  63.5    3e-10   
gb|EKE03609.1|  hypothetical protein ACD_20C00176G0004                63.2    4e-10   
gb|ERT05629.1|  glyceraldehyde-3-phosphate dehydrogenase, type I      62.4    4e-10   
emb|CAN78872.1|  hypothetical protein VITISV_021726                   63.2    4e-10   
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  63.2    4e-10   
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  63.2    4e-10   
ref|WP_016837142.1|  glyceraldehyde-3-phosphate dehydrogenase         62.8    4e-10   
ref|WP_012798152.1|  glyceraldehyde-3-phosphate dehydrogenase         62.8    5e-10   
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase         62.8    5e-10   
ref|WP_008180745.1|  glyceraldehyde-3-phosphate dehydrogenase         62.8    5e-10   
gb|EGL17068.1|  putative glyceraldehyde 3-phosphate dehydrogenase...  59.3    5e-10   
gb|AAM68969.1|AF406629_1  glyceraldehyde-3-phosphate dehydrogenase    60.5    7e-10   
ref|WP_007069457.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  62.0    7e-10   
ref|WP_040932844.1|  glyceraldehyde-3-phosphate dehydrogenase         62.4    7e-10   
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase         62.0    9e-10   
emb|CAC80391.2|  glyceraldehyde-3-phosphate dehydrogenase             61.6    1e-09   
gb|KEI65516.1|  Gap2                                                  61.6    1e-09   
ref|WP_038262010.1|  glyceraldehyde-3-phosphate dehydrogenase [       61.2    1e-09   
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  61.2    1e-09   
emb|CAC80999.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  61.2    1e-09   
ref|WP_007554130.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    1e-09   
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    1e-09   
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    2e-09   
ref|WP_033067378.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    2e-09   
ref|WP_008891366.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    2e-09   
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    2e-09   
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase         61.2    2e-09   
ref|WP_019504971.1|  glyceraldehyde-3-phosphate dehydrogenase         60.8    2e-09   
ref|WP_016423763.1|  glyceraldehyde-3-phosphate dehydrogenase         60.8    2e-09   
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase         60.8    2e-09   
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  60.8    2e-09   
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase         60.8    2e-09   
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  60.8    2e-09   
emb|CBI29293.3|  unnamed protein product                              60.5    2e-09   
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase         60.5    3e-09   
emb|CAN81495.1|  hypothetical protein VITISV_031969                   61.2    3e-09   
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  60.5    3e-09   
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase         60.5    3e-09   
ref|XP_005534792.1|  glyceraldehyde-3-phosphate dehydrogenase         60.8    3e-09   
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  60.5    3e-09   
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase         60.1    3e-09   
ref|WP_022483078.1|  glyceraldehyde-3-phosphate dehydrogenase type I  58.5    4e-09   
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...  60.1    4e-09   
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase              60.1    4e-09   
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  60.1    4e-09   
gb|EDZ94203.1|  glyceraldehyde-3-phosphate dehydrogenase, type I      60.1    4e-09   
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase         60.1    4e-09   
ref|WP_039933175.1|  glyceraldehyde-3-phosphate dehydrogenase         60.1    4e-09   
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  60.1    4e-09   
gb|AAM68968.1|AF406628_1  glyceraldehyde-3-phosphate dehydrogenase    60.5    4e-09   
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase         60.1    4e-09   
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase         60.1    4e-09   
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...  60.5    5e-09   
ref|WP_028555557.1|  glyceraldehyde-3-phosphate dehydrogenase         59.7    5e-09   
ref|WP_006625490.1|  glyceraldehyde-3-phosphate dehydrogenase         59.7    6e-09   
ref|WP_011319102.1|  glyceraldehyde-3-phosphate dehydrogenase         59.7    6e-09   
ref|WP_022730332.1|  glyceraldehyde-3-phosphate dehydrogenase         59.7    6e-09   
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase         59.7    6e-09   
gb|AAA21996.1|  glyceraldehyde-3-phosphate dehydrogenase              59.3    7e-09   
gb|AHJ31016.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...  58.5    7e-09   
ref|WP_028257313.1|  glyceraldehyde-3-phosphate dehydrogenase         59.3    7e-09   
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  59.3    7e-09   
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase         59.3    8e-09   
ref|WP_022382428.1|  glyceraldehyde-3-phosphate dehydrogenase type I  59.3    8e-09   
ref|WP_036532393.1|  glyceraldehyde-3-phosphate dehydrogenase         58.9    9e-09   
gb|ADI87681.1|  glyceraldehyde-3-phosphate dehydrogenase type I       58.9    9e-09   
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase         58.9    9e-09   
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...  58.9    1e-08   
ref|WP_009555393.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  58.9    1e-08   
ref|WP_009615623.1|  glyceraldehyde-3-phosphate dehydrogenase         58.9    1e-08   
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase         58.9    1e-08   
ref|WP_006207583.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  58.9    1e-08   
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...  58.9    1e-08   
dbj|GAK42869.1|  glyceraldehyde-3-phosphate dehydrogenase             58.9    1e-08   
ref|WP_008859280.1|  glyceraldehyde-3-phosphate dehydrogenase         58.9    1e-08   
ref|WP_007092441.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  58.9    1e-08   
ref|WP_040928709.1|  glyceraldehyde-3-phosphate dehydrogenase         58.9    1e-08   
gb|ADB81491.1|  glyceraldehyde-3-phosphate dehydrogenase              58.5    1e-08   
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase         58.9    1e-08   
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    1e-08   
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    1e-08   
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    1e-08   
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  58.5    1e-08   
ref|WP_009353531.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    1e-08   
ref|WP_011309104.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    1e-08   
dbj|BAC87938.1|  glyceraldehyde-3-phosphate dehydrogenase             58.2    1e-08   
ref|WP_032086619.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    2e-08   
ref|WP_035157424.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    2e-08   
ref|WP_010999188.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    2e-08   
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase         58.5    2e-08   
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  58.5    2e-08   
ref|WP_015203318.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  58.5    2e-08   
ref|WP_007133015.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  58.2    2e-08   
ref|WP_002789220.1|  glyceraldehyde-3-phosphate dehydrogenase         58.2    2e-08   
ref|WP_002752737.1|  glyceraldehyde-3-phosphate dehydrogenase         58.2    2e-08   
ref|WP_027714085.1|  glyceraldehyde-3-phosphate dehydrogenase         58.2    2e-08   
ref|WP_038046508.1|  glyceraldehyde-3-phosphate dehydrogenase         58.2    2e-08   
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...  58.2    2e-08   
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase         58.2    2e-08   
ref|WP_007286779.1|  glyceraldehyde-3-phosphate dehydrogenase         58.2    2e-08   
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase         58.2    2e-08   
ref|WP_028949102.1|  glyceraldehyde-3-phosphate dehydrogenase         58.2    2e-08   
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  58.2    2e-08   
ref|WP_015745187.1|  glyceraldehyde-3-phosphate dehydrogenase         58.2    2e-08   
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase         58.2    2e-08   
ref|WP_007913230.1|  glyceraldehyde-3-phosphate dehydrogenase         57.8    2e-08   
gb|ELS46726.1|  glyceraldehyde-3-phosphate dehydrogenase 2            57.4    2e-08   
ref|WP_022071170.1|  glyceraldehyde-3-phosphate dehydrogenase type I  57.8    2e-08   
ref|WP_024037572.1|  hypothetical protein                             57.8    3e-08   
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2       57.8    3e-08   
ref|WP_036198701.1|  glyceraldehyde-3-phosphate dehydrogenase         57.8    3e-08   
emb|CAC41001.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  57.8    3e-08   
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase         57.8    3e-08   
ref|WP_009455139.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  57.8    3e-08   
ref|WP_039728353.1|  glyceraldehyde-3-phosphate dehydrogenase         57.8    3e-08   
ref|WP_028320508.1|  glyceraldehyde-3-phosphate dehydrogenase         57.8    3e-08   
ref|WP_017756078.1|  glyceraldehyde-3-phosphate dehydrogenase         57.8    3e-08   
ref|WP_003803641.1|  glyceraldehyde-3-phosphate dehydrogenase         57.8    3e-08   
ref|WP_016738795.1|  glyceraldehyde-3-phosphate dehydrogenase         57.8    3e-08   
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  57.4    3e-08   
emb|CCI33980.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           57.4    4e-08   



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+LDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  344  VNAAFRKAADGPLKGILDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  393



>ref|XP_002540513.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF21870.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=193

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  86   VNAAFRKAAEGPLKGILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  135



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score = 99.4 bits (246),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDM
Sbjct  344  VNAAFRKAADGPLKGILDVCDAPLVSVDFRCSDVSATIDSSLTMVMGDDM  393



>gb|ACA52221.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase B, partial 
[Oenothera elata subsp. hookeri]
 gb|ACA52222.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase B, partial 
[Oenothera grandiflora]
Length=85

 Score = 93.6 bits (231),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA+DGPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  31   VNGAFRKAADGPLKGILSVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  80



>dbj|BAK05515.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=147

 Score = 95.1 bits (235),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+LDVCD PLVSVDFRCSDVS++ID+SLTMVMGDDM
Sbjct  84   VNAAFRKAADGPLKGILDVCDEPLVSVDFRCSDVSTSIDASLTMVMGDDM  133



>emb|CDP07271.1| unnamed protein product [Coffea canephora]
Length=458

 Score = 98.6 bits (244),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+LDVCDAPLVSVDF+C+DVSSTIDSSLTMVMGDDM
Sbjct  351  VNAAFRKAADGPLKGILDVCDAPLVSVDFKCTDVSSTIDSSLTMVMGDDM  400



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+LDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAADGPLKGILDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDM  394



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  394



>gb|AES74101.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=317

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  211  VNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDM  260



>gb|AES74103.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=415

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDM  394



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  348  VNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  397



>ref|XP_011034837.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Populus euphratica]
Length=450

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  394



>ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
 gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
Length=451

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAAEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDM  394



>ref|XP_011034836.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Populus euphratica]
Length=452

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  394



>gb|KHN20097.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=452

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDM
Sbjct  346  VNAAFRKAAEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDM  395



>gb|ACU20783.1| unknown [Glycine max]
Length=452

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDM
Sbjct  346  VNAAFRKAAEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDM  395



>gb|ABS72003.1| putative chloroplast glyceradehyde-3-phosphate dehydrogenase 
subunit B [Olea europaea]
Length=149

 Score = 94.0 bits (232),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKGVL VCD PLVSVDFRC+DVS+TIDSSLTMVMGDDM
Sbjct  42   VNAAFRKAADGPLKGVLAVCDVPLVSVDFRCTDVSATIDSSLTMVMGDDM  91



>ref|XP_006581071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B subunit 
isoform X1 [Glycine max]
Length=453

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDM
Sbjct  347  VNAAFRKAAEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDM  396



>ref|XP_006577850.1| PREDICTED: uncharacterized protein LOC100806482 isoform X1 [Glycine 
max]
Length=452

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDM
Sbjct  346  VNAAFRKAAEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDM  395



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAAEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDM  394



>gb|ADH43199.1| glyceraldehyde-3-phosphate dehydrogenase [Vicia sativa]
Length=380

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKG+LDVCD PLVSVDFRCSDVS+TIDSSLTMVMGDDM
Sbjct  323  VNAAFRKAAEGPLKGILDVCDVPLVSVDFRCSDVSTTIDSSLTMVMGDDM  372



>ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=458

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  351  VNAAFRKAAEGPLKGILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  400



>ref|XP_002300632.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
 gb|EEE79905.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
Length=474

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  367  VNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  416



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDM  394



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDM  394



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            +N+AFRKA++GPLKGVLDVCDAPLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  333  INSAFRKAAEGPLKGVLDVCDAPLVSVDFRCTDVSSTIDSSLTMVMGDDM  382



>ref|XP_003603850.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=490

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDM  394



>emb|CAA33262.1| unnamed protein product [Pisum sativum]
Length=447

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKG+LDVCD PLVSVDFRCSDVS+TIDSSLTMVMGDDM
Sbjct  341  VNAAFRKAAEGPLKGILDVCDVPLVSVDFRCSDVSTTIDSSLTMVMGDDM  390



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  314  VNGAFRKAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  363



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKG+LDVCD PLVSVDFRCSDVS+TIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAAEGPLKGILDVCDVPLVSVDFRCSDVSTTIDSSLTMVMGDDM  394



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  345  VNGAFRKAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  394



>ref|XP_011041188.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Populus euphratica]
Length=452

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  345  VNGAFRKAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  394



>ref|XP_004500847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  419  VNAAFRKAAEGPLKGVLDVCDLPLVSVDFRCTDVSSTIDSSLTMVMGDDM  468



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKGVL+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  347  VNAAFRKAAEGPLKGVLEVCDIPLVSVDFRCSDVSSTIDSSLTMVMGDDM  396



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKGVL VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  314  VNAAFRKAADGPLKGVLAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  363



>ref|XP_010478985.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X1 [Camelina sativa]
Length=402

 Score = 95.9 bits (237),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDM
Sbjct  296  VNEAFRKAANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDM  345



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKGVL VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  343  VNAAFRKAADGPLKGVLAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  392



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKGVL VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  343  VNAAFRKAADGPLKGVLAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  392



>ref|XP_007135965.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
 gb|ESW07959.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
Length=451

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDM
Sbjct  345  VNGAFRKAAEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDM  394



>gb|AAG23800.1| chloroplast NADP-dependent glyceraldehyde 3-phosphate dehydrogenase 
B subunit [Cucurbita pepo]
Length=171

 Score = 93.2 bits (230),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKGVL VCD PLVSVDF+C+DVSSTIDSSLTMVMGDDM
Sbjct  110  VNAAFRKAADGPLKGVLAVCDIPLVSVDFKCTDVSSTIDSSLTMVMGDDM  159



>ref|XP_006307502.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
 gb|EOA40400.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
Length=447

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDM
Sbjct  341  VNEAFRKAANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDM  390



>gb|AAD10210.1| glyceraldehyde 3-phosphate dehydrogenase B subunit [Arabidopsis 
thaliana]
Length=402

 Score = 95.5 bits (236),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDM
Sbjct  296  VNEAFRKAANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDM  345



>ref|XP_010478986.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X2 [Camelina sativa]
Length=445

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDM
Sbjct  339  VNEAFRKAANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDM  388



>ref|XP_002891244.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67503.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=447

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDM
Sbjct  341  VNEAFRKAANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDM  390



>ref|XP_010500213.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic-like 
[Camelina sativa]
Length=447

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDM
Sbjct  341  VNEAFRKAANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDM  390



>gb|KGN49135.1| hypothetical protein Csa_6G514950 [Cucumis sativus]
Length=191

 Score = 93.2 bits (230),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKGVL VCD PLVSVDF+C+DVSSTIDSSLTMVMGDDM
Sbjct  84   VNAAFRKAADGPLKGVLAVCDIPLVSVDFKCTDVSSTIDSSLTMVMGDDM  133



>ref|NP_174996.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
 sp|P25857.2|G3PB_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPB, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase B; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51517.1|AC068324_5 glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAA32795.1| glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAK62594.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAK64065.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAL85133.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAM19948.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAM98232.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72278.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 dbj|BAF02115.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AEE31933.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
Length=447

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDM
Sbjct  341  VNEAFRKAANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDM  390



>gb|ABD37966.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Spirogyra 
sp. SAG 170.80]
Length=321

 Score = 94.7 bits (234),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGP+KG+L VCD PLVS+DFRCSDVSSTIDSSLTMVMGDDM
Sbjct  259  VNAAFRKAADGPMKGILGVCDLPLVSIDFRCSDVSSTIDSSLTMVMGDDM  308



>gb|KDO85174.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=409

 Score = 95.5 bits (236),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  346  VNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  395



>gb|ABF74607.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase B subunit 
[Agave tequilana]
Length=174

 Score = 92.4 bits (228),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKG+L VCD PLVSVDFRC+DVSSTID+SLTMVMGDDM
Sbjct  65   VNAAFRKAANGPLKGILAVCDVPLVSVDFRCTDVSSTIDASLTMVMGDDM  114



>ref|XP_009362873.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=408

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDM  394



>ref|XP_010094540.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
 gb|EXB56294.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
Length=1333

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRK ++GPLKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  348  VNAAFRKEAEGPLKGILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  397



>gb|EMT30317.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Aegilops 
tauschii]
Length=442

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+LDVCD PLVSVDFRCSDVS++ID+SLTMVMGDDM
Sbjct  337  VNAAFRKAADGPLKGILDVCDEPLVSVDFRCSDVSTSIDASLTMVMGDDM  386



>gb|EMS49604.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Triticum 
urartu]
Length=444

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+LDVCD PLVSVDFRCSDVS++ID+SLTMVMGDDM
Sbjct  337  VNAAFRKAADGPLKGILDVCDEPLVSVDFRCSDVSTSIDASLTMVMGDDM  386



>ref|WP_033581593.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Dickeya zeae]
Length=82

 Score = 89.7 bits (221),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A+D  LKG+LDVCD PLVSVDFRCSDVSST+D+SLTMVMGDDM
Sbjct  22   VNAAFREAADKELKGILDVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDM  71



>dbj|BAJ87214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+LDVCD PLVSVDFRCSDVS++ID+SLTMVMGDDM
Sbjct  337  VNAAFRKAADGPLKGILDVCDEPLVSVDFRCSDVSTSIDASLTMVMGDDM  386



>ref|XP_006435406.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48646.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=453

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  346  VNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  395



>dbj|BAJ86633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+LDVCD PLVSVDFRCSDVS++ID+SLTMVMGDDM
Sbjct  337  VNAAFRKAADGPLKGILDVCDEPLVSVDFRCSDVSTSIDASLTMVMGDDM  386



>ref|XP_006473831.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85173.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=453

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  346  VNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  395



>ref|XP_009362872.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=450

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDM  394



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDM  394



>ref|XP_010270515.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nelumbo nucifera]
Length=452

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  394



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDM  394



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDM  394



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDM  394



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPL GVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAAEGPLAGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDM  394



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+ GPL G+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  346  VNAAFRKAASGPLNGILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  395



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRK+++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  307  VNAAFRKSAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  356



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPL G+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  343  VNAAFRKAADGPLNGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  392



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPL G+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  343  VNAAFRKAADGPLNGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  392



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA++GPLKG+LDVCD PLVSVDFRC+DVSSTID+SLTMVMGDDM
Sbjct  345  VNQAFRKAANGPLKGILDVCDVPLVSVDFRCTDVSSTIDASLTMVMGDDM  394



>gb|ABK00067.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlorokybus atmophyticus]
Length=325

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A++GPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  235  VNAAFREAANGPLKGILAVCDEPLVSVDFRCTDVSSTIDSSLTMVMGDDM  284



>ref|XP_002982608.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
 gb|EFJ16361.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
Length=431

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDM
Sbjct  324  VNAAFRKAADGPLKGILAVCDIPLVSVDFRCSDVSSTVDASLTMVMGDDM  373



>ref|XP_002981126.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
 gb|EFJ17827.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
Length=431

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDM
Sbjct  324  VNAAFRKAADGPLKGILAVCDIPLVSVDFRCSDVSSTVDASLTMVMGDDM  373



>gb|ABF93789.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG90581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score = 92.4 bits (228),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+ GPL G+LDVCD PLVSVDFRCSDVSSTID+SLTMVMGDDM
Sbjct  211  VNAAFRKAAAGPLSGILDVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDM  260



>emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera]
Length=453

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+L VCD PLVSVDF+CSDVSSTID+SLTMVMGDDM
Sbjct  346  VNAAFRKAADGPLKGILAVCDVPLVSVDFKCSDVSSTIDASLTMVMGDDM  395



>ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55522.1| hypothetical protein Csa_4G664300 [Cucumis sativus]
Length=451

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKGVL VCD PLVSVDF+C+DVSSTIDSSLTMVMGDDM
Sbjct  344  VNAAFRKAADGPLKGVLAVCDIPLVSVDFKCTDVSSTIDSSLTMVMGDDM  393



>ref|XP_002273754.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Vitis vinifera]
 emb|CBI40744.3| unnamed protein product [Vitis vinifera]
Length=453

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKG+L VCD PLVSVDF+CSDVSSTID+SLTMVMGDDM
Sbjct  346  VNAAFRKAADGPLKGILAVCDVPLVSVDFKCSDVSSTIDASLTMVMGDDM  395



>ref|XP_008452998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Cucumis melo]
Length=451

 Score = 93.6 bits (231),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKGVL VCD PLVSVDF+C+DVSSTIDSSLTMVMGDDM
Sbjct  344  VNAAFRKAADGPLKGVLAVCDIPLVSVDFKCTDVSSTIDSSLTMVMGDDM  393



>ref|XP_008452997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Cucumis melo]
Length=452

 Score = 93.6 bits (231),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPLKGVL VCD PLVSVDF+C+DVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAADGPLKGVLAVCDIPLVSVDFKCTDVSSTIDSSLTMVMGDDM  394



>ref|XP_004300121.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=452

 Score = 93.6 bits (231),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA+DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  345  VNGAFRKAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDM  394



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score = 93.6 bits (231),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+ GPL G+LDVCD PLVSVDFRCSDVSSTID+SLTMVMGDDM
Sbjct  337  VNAAFRKAASGPLNGILDVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDM  386



>gb|ABD37959.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorokybus 
atmophyticus]
Length=347

 Score = 92.4 bits (228),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A++GPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  257  VNAAFREAANGPLKGILAVCDEPLVSVDFRCTDVSSTIDSSLTMVMGDDM  306



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score = 93.2 bits (230),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+ GPL G+LDVCD PLVSVDFRCSDVSSTID+SLTMVMGDDM
Sbjct  340  VNAAFRKAAAGPLNGILDVCDEPLVSVDFRCSDVSSTIDASLTMVMGDDM  389



>emb|CAC80374.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=317

 Score = 92.0 bits (227),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRK++DGPL G+L VCD PLVSVDFRCSDVS+TIDSSLTMVMGDDM
Sbjct  256  VNAAFRKSADGPLNGILAVCDVPLVSVDFRCSDVSTTIDSSLTMVMGDDM  305



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score = 93.2 bits (230),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPL G+L VCD PLVSVDFRCSDVS+TIDSSLTMVMGDDM
Sbjct  344  VNAAFRKAADGPLNGILAVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDM  393



>gb|AEO45784.1| glyceraldehyde-3-phosphate dehydrogenase B [Scoparia dulcis]
Length=452

 Score = 93.2 bits (230),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN+AFRKA++GPL GVLDVCD PLVSVDFRCSDVSSTIDSSLTMV+GDDM
Sbjct  345  VNSAFRKAANGPLAGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVLGDDM  394



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score = 93.2 bits (230),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPL G+L VCD PLVSVDFRCSDVS+TIDSSLTMVMGDDM
Sbjct  344  VNAAFRKAADGPLNGILAVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDM  393



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score = 93.2 bits (230),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+DGPL G+L VCD PLVSVDFRCSDVS+TIDSSLTMVMGDDM
Sbjct  344  VNAAFRKAADGPLNGILAVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDM  393



>ref|NP_001048847.1| Os03g0129300 [Oryza sativa Japonica Group]
 dbj|BAA85402.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AAN17393.1| Putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 gb|ABF93788.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10761.1| Os03g0129300 [Oryza sativa Japonica Group]
 gb|EAY88378.1| hypothetical protein OsI_09835 [Oryza sativa Indica Group]
 gb|EAZ25455.1| hypothetical protein OsJ_09272 [Oryza sativa Japonica Group]
Length=444

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+ GPL G+LDVCD PLVSVDFRCSDVSSTID+SLTMVMGDDM
Sbjct  337  VNAAFRKAAAGPLSGILDVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDM  386



>emb|CAC80393.1| glyceraldehyde-3-phosphate dehydrogenase [Sphagnum cuspidatum]
Length=318

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR AS GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  256  VNAAFRDASAGPLKGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  305



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPL+G+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAAEGPLQGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDM  394



>ref|XP_009384599.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=449

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA+ GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  342  VNNAFRKAAQGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  391



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPL+G+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  345  VNAAFRKAAEGPLQGILAVCDIPLVSVDFRCTDVSSTIDSSLTMVMGDDM  394



>ref|XP_009384600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=447

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA+ GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  340  VNNAFRKAAQGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  389



>ref|XP_008786670.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Phoenix dactylifera]
Length=452

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA+DGPLKG+L VCD PLVSVDFRC+DVSSTID+SLTMVMGDDM
Sbjct  345  VNQAFRKAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDASLTMVMGDDM  394



>ref|XP_006395998.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
 dbj|BAJ34314.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33284.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
Length=447

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA+DGPLKGVL VCD PLVS DFRCSDVS+TIDSSLTMVMGDDM
Sbjct  341  VNEAFRKAADGPLKGVLAVCDIPLVSCDFRCSDVSTTIDSSLTMVMGDDM  390



>gb|AIU56855.1| glyceraldehyde-3-phosphate dehydrogenase B, partial [Brassica 
rapa subsp. chinensis]
Length=367

 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA+ GPLKGVL+VCD PLVS DFRCSDVS+TIDSSLTMVMGDDM
Sbjct  261  VNEAFRKAAAGPLKGVLEVCDTPLVSCDFRCSDVSTTIDSSLTMVMGDDM  310



>sp|P09672.1|G3PA_SINAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A, partial [Sinapis alba]
 emb|CAA27845.1| chloroplast GAPDH (233aa) [Sinapis alba]
Length=233

 Score = 89.4 bits (220),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  155  VNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  204



>emb|CDY69523.1| BnaC08g46180D, partial [Brassica napus]
Length=402

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA+ GPLKGVL+VCD PLVS DFRCSDVS+TIDSSLTMVMGDDM
Sbjct  295  VNEAFRKAAAGPLKGVLEVCDTPLVSCDFRCSDVSTTIDSSLTMVMGDDM  344



>ref|NP_001077529.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28945.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=317

 Score = 89.7 bits (221),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  239  VNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  288



>ref|XP_009148557.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score = 89.7 bits (221),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  239  VNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  288



>ref|XP_010476270.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score = 89.7 bits (221),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  239  VNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  288



>gb|ABD37958.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Chara vulgaris]
Length=318

 Score = 89.4 bits (220),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFR+++DGPLKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  256  VNNAFRESADGPLKGILAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  305



>ref|XP_010494750.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score = 89.4 bits (220),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  239  VNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  288



>ref|XP_009107645.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Brassica rapa]
 emb|CDY35800.1| BnaA08g04610D [Brassica napus]
Length=448

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA+ GPLKGVL+VCD PLVS DFRCSDVS+TIDSSLTMVMGDDM
Sbjct  341  VNEAFRKAAAGPLKGVLEVCDTPLVSCDFRCSDVSTTIDSSLTMVMGDDM  390



>gb|KFK29151.1| hypothetical protein AALP_AA7G095400 [Arabis alpina]
Length=448

 Score = 90.5 bits (223),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA+ GP+KG+LDVCD PLVS DFRCSDVS+TIDSSLTMVMGDDM
Sbjct  341  VNEAFRKAAAGPMKGILDVCDTPLVSCDFRCSDVSTTIDSSLTMVMGDDM  390



>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|Q Chain Q, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|T Chain T, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=368

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA+ GPLKGVLDVCD PLVSVDFRCSD SSTIDSSLTMVMG DM
Sbjct  261  VNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDM  310



>emb|CAC80378.2| glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=480

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA++GPLKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  371  VNDAFRKAANGPLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  420



>gb|ADU04755.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04760.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04761.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04762.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAA R+A++GP+KGVL VCD PLVSVDF+CSDVSSTID+SLTMVMGDDM
Sbjct  208  VNAALREAANGPMKGVLAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDM  257



>gb|ABK00056.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Mesostigma viride]
Length=310

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAA R+A++GP+KGVL VCD PLVSVDF+CSDVSSTID+SLTMVMGDDM
Sbjct  234  VNAALREAANGPMKGVLAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDM  283



>gb|ADU04754.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score = 88.2 bits (217),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAA R+A++GP+KGVL VCD PLVSVDF+CSDVSSTID+SLTMVMGDDM
Sbjct  208  VNAALREAANGPMKGVLAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDM  257



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A+D  LKG+LDVCD PLVSVDFRCSDVSST+D+SLTMVMGDDM
Sbjct  323  VNAAFREAADKELKGILDVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDM  372



>dbj|BAH57068.1| AT1G12900 [Arabidopsis thaliana]
Length=350

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  272  VNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  321



>ref|NP_001117276.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 ref|NP_001184977.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28946.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
 gb|AEE28947.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=350

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  272  VNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  321



>emb|CAC80392.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Spirogyra 
sp.]
Length=318

 Score = 88.2 bits (217),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A+ GP+KGVL VCD PLVS+DFRCSDVS TIDSSLTMVMGDDM
Sbjct  256  VNAAFREAAAGPMKGVLAVCDEPLVSIDFRCSDVSCTIDSSLTMVMGDDM  305



>sp|P09043.1|G3PA_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34075.1| glyceraldehyde-3-phosphate dehydrogenase A-subunit precursor, 
partial [Nicotiana tabacum]
Length=392

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A+D  LKG+LDVCD PLVSVDFRCSDVSST+D+SLTMVMGDDM
Sbjct  314  VNAAFREAADKELKGILDVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDM  363



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A+D  LKG+LDVCD PLVSVDFRCSDVSST+D+SLTMVMGDDM
Sbjct  323  VNAAFREAADKELKGILDVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDM  372



>ref|XP_006417176.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 ref|XP_006417178.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35529.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35531.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=350

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  272  VNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  321



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A+D  LKG+LDVCD PLVSVDFRCSDVSST+D+SLTMVMGDDM
Sbjct  323  VNAAFREAADKELKGILDVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDM  372



>ref|XP_009118049.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A+   LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  239  VNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  288



>sp|P12860.1|G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Spinacia oleracea]
 emb|CAA33263.1| unnamed protein product [Spinacia oleracea]
 gb|AAD10218.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
B [Spinacia oleracea]
Length=451

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA+ GPLKGVLDVCD PLVSVDFRCSD SSTIDSSLTMVMG DM
Sbjct  344  VNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDM  393



>gb|ABD37961.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Mesostigma 
viride]
Length=333

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAA R+A++GP+KGVL VCD PLVSVDF+CSDVSSTID+SLTMVMGDDM
Sbjct  255  VNAALREAANGPMKGVLAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDM  304



>ref|XP_010061201.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68119.1| hypothetical protein EUGRSUZ_F01793 [Eucalyptus grandis]
Length=454

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSL+MVMGDDM
Sbjct  346  VNAAFRDAAEGPLKGILAVCDDPLVSVDFRCSDVSSTIDSSLSMVMGDDM  395



>ref|XP_010430771.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like, 
partial [Camelina sativa]
Length=118

 Score = 85.1 bits (209),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDM
Sbjct  40   VNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDM  89



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  321  VNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  370



>gb|ADB81492.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=315

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAA R+A++GP+KGVL VCD PLVSVDF+CSDVSSTID+SLTMVMGDDM
Sbjct  255  VNAALREAANGPMKGVLAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDM  304



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  321  VNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  370



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  321  VNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  370



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  321  VNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  370



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  321  VNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  370



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  321  VNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  370



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  321  VNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  370



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  321  VNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  370



>gb|ABD37964.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Chlorokybus 
atmophyticus]
Length=458

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA++GPL GVL V D PLVS+DFRCSDVSSTIDSSLTMVMGDDM
Sbjct  348  VNAAFRKAAEGPLNGVLAVSDLPLVSIDFRCSDVSSTIDSSLTMVMGDDM  397



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA+ GP KGVL+VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDM
Sbjct  344  VNNAFRKAAAGPSKGVLEVCDIPLVSVDFRCTDVSSTIDSSLTMVMGDDM  393



>dbj|BAD93961.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=161

 Score = 85.1 bits (209),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDM
Sbjct  83   VNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDM  132



>gb|AIU56856.1| glyceraldehyde-3-phosphate dehydrogenase A, partial [Brassica 
rapa subsp. chinensis]
Length=336

 Score = 87.4 bits (215),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A+   LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  258  VNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  307



>ref|XP_010507000.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like, 
partial [Camelina sativa]
 ref|XP_010507006.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like, 
partial [Camelina sativa]
Length=120

 Score = 84.3 bits (207),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  LKG+L+VCD PLVSVDFRCSD S+TIDSSLTMVMGDDM
Sbjct  42   VNAAFRDSAEKELKGILEVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDM  91



>ref|XP_008650588.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Zea mays]
 gb|ACF78460.1| unknown [Zea mays]
 gb|ACF87738.1| unknown [Zea mays]
 gb|ACG28147.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACG29047.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACR36877.1| unknown [Zea mays]
 tpg|DAA43140.1| TPA: glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
Length=449

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRKA+ GPL+G+L+VCD PLVSVDFRCSDVS TID+SL+MVMGDDM
Sbjct  342  VNAAFRKAAAGPLQGILEVCDVPLVSVDFRCSDVSCTIDASLSMVMGDDM  391



>emb|CDX83635.1| BnaC07g23750D [Brassica napus]
Length=380

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR++++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  302  VNAAFRESAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  351



>gb|KFK33590.1| hypothetical protein AALP_AA5G033500 [Arabis alpina]
Length=400

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR++++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  322  VNAAFRESAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  371



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score = 87.4 bits (215),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR++++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  322  VNAAFRESAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  371



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A++G +KG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  279  VNAAFREAANGDMKGILAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  328



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score = 87.4 bits (215),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  322  VNAAFRDAAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  371



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score = 87.4 bits (215),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  322  VNAAFRDAAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  371



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score = 87.4 bits (215),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A+   LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  321  VNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  370



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score = 87.4 bits (215),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A+   LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  321  VNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  370



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score = 87.4 bits (215),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A+   LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  321  VNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  370



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score = 86.3 bits (212),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDM
Sbjct  258  VNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDM  307



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score = 86.3 bits (212),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDM
Sbjct  258  VNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDM  307



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score = 86.3 bits (212),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDM
Sbjct  258  VNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDM  307



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score = 86.3 bits (212),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDM
Sbjct  258  VNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDM  307



>ref|XP_009382077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=452

 Score = 87.4 bits (215),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFRKA++GP  GVL VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  345  VNDAFRKAANGPSNGVLAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDM  394



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score = 87.0 bits (214),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A++G +KG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  320  VNAAFREAANGDMKGILAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  369



>gb|ACN57670.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57672.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57673.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57674.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57675.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57676.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57678.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57679.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57682.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57683.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57684.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57685.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57686.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57687.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57688.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57689.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57690.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57691.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57692.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57693.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57694.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57695.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57696.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57697.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57698.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57699.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57700.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57701.1| At3g26650-like protein [Capsella grandiflora]
 gb|ACN57702.1| At3g26650-like protein [Capsella grandiflora]
Length=127

 Score = 83.6 bits (205),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  LKG+L+VCD PLVSVDFRCSD S+TIDSSLTMVMGDDM
Sbjct  69   VNAAFRDSAEKELKGILEVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDM  118



>pdb|1JN0|O Chain O, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|A Chain A, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|B Chain B, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
Length=335

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDM
Sbjct  256  VNAAFRESADQELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDM  305



>gb|ABY20971.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Hypericum 
perforatum]
Length=141

 Score = 83.6 bits (205),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVSVDFRCSDVSST+D+SLT VMGDDM
Sbjct  63   VNAAFRESADKELKGILAVCDEPLVSVDFRCSDVSSTVDASLTTVMGDDM  112



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A+   +KG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  321  VNAAFRDAAANEMKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  370



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDM
Sbjct  323  VNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDM  372



>pdb|2PKR|O Chain O, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|R Chain R, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|P Chain P, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|Q Chain Q, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|A Chain A, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|B Chain B, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|C Chain C, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|D Chain D, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|H Chain H, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|I Chain I, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|L Chain L, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|M Chain M, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
Length=365

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDM
Sbjct  258  VNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDM  307



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  323  VNAAFRESADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  372



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A+D  L G+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  321  VNAAFREAADKELNGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  370



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  325  VNAAFRESADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  374



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A+D  L G+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  324  VNAAFREAADKALNGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  373



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  325  VNAAFRESADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  374



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  325  VNAAFRESADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  374



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  325  VNAAFRESADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  374



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  302  VNAAFRDSAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  351



>ref|XP_010425376.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDM
Sbjct  239  VNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDM  288



>ref|XP_010502598.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=317

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDM
Sbjct  239  VNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDM  288



>dbj|BAG68209.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=328

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A+   LKG+LDVCD PLVSV FRCSDVSSTIDSSLTMVMGDDM
Sbjct  250  VNAAFRGAAANELKGILDVCDEPLVSVGFRCSDVSSTIDSSLTMVMGDDM  299



>emb|CDY28536.1| BnaC02g36240D [Brassica napus]
Length=380

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            +NAAFR +++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  302  INAAFRDSAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  351



>gb|KDP41897.1| hypothetical protein JCGZ_26915 [Jatropha curcas]
Length=411

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  333  VNAAFRESADKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  382



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDM
Sbjct  324  VNAAFRESADKELKGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDM  373



>gb|KHG29734.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=360

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR++++  LKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDM
Sbjct  282  VNAAFRESAEKELKGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDM  331



>ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=404

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  326  VNAAFRESADKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  375



>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=337

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDM
Sbjct  259  VNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDM  308



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  317  VNAAFRESADKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  366



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A+   LKG+LDVCD PLVSV FRCSDVSSTIDSSLTMVMGDDM
Sbjct  321  VNAAFRGAAANELKGILDVCDEPLVSVGFRCSDVSSTIDSSLTMVMGDDM  370



>ref|XP_002503470.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
 gb|ACO64728.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
Length=377

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            +NAAFR+A++GP+KG+L V D PLVS+DFRCSDVS+TID++LTMVMGDD+
Sbjct  298  INAAFREAAEGPMKGILAVADEPLVSIDFRCSDVSTTIDAALTMVMGDDL  347



>gb|AAD10209.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=350

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDM
Sbjct  272  VNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDM  321



>emb|CAC80372.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=314

 Score = 84.3 bits (207),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A+D  L G+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDM
Sbjct  254  VNAAFREAADKELNGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDM  303



>gb|AAA33485.1| glyceraldehyde-3-phosphate dehydrogenase precursor, partial [Zea 
mays]
Length=103

 Score = 81.3 bits (199),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFR A+   L G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDM
Sbjct  25   VNQAFRDAAANELTGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDM  74



>gb|ACN57671.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57677.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57680.1| At3g26650-like protein [Capsella rubella]
 gb|ACN57681.1| At3g26650-like protein [Capsella rubella]
Length=127

 Score = 82.0 bits (201),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNA FR +++  LKG+L+VCD PLVSVDFRCSD S+TIDSSLTMVMGDDM
Sbjct  69   VNATFRDSAEKELKGILEVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDM  118



>gb|ACT21568.1| glyceraldehyde-3-phosphate dehydrogenase [Bruguiera gymnorhiza]
Length=405

 Score = 85.1 bits (209),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  LKG+L VCD PLVSVDFRC DVSST+DSSLTMVMGDDM
Sbjct  327  VNAAFRESADKELKGILSVCDEPLVSVDFRCRDVSSTVDSSLTMVMGDDM  376



>emb|CDY48981.1| BnaA02g28150D [Brassica napus]
Length=368

 Score = 84.7 bits (208),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  LKG+L VCD PLVSVDF+CSDVSSTIDSSLTMVMGDDM
Sbjct  290  VNAAFRNSAEKELKGILKVCDEPLVSVDFKCSDVSSTIDSSLTMVMGDDM  339



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score = 85.1 bits (209),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  L+G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  325  VNAAFRESADNELQGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  374



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score = 85.1 bits (209),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR++++  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  325  VNAAFRESAEKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  374



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score = 85.1 bits (209),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  L G+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  324  VNAAFRESADKALNGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  373



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score = 84.7 bits (208),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDM
Sbjct  318  VNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDM  367



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score = 84.7 bits (208),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDM
Sbjct  322  VNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDM  371



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDM
Sbjct  322  VNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDM  371



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDM
Sbjct  318  VNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDM  367



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNA FR+++D  LKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDM
Sbjct  324  VNAGFRESADNELKGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDM  373



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDM
Sbjct  318  VNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDM  367



>ref|XP_007515295.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO14174.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=405

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A +GP+KGVL + D PLVSVDFRC+DVS+TID++LTMVMGDDM
Sbjct  300  VNAAFREAQNGPMKGVLAITDTPLVSVDFRCTDVSTTIDAALTMVMGDDM  349



>ref|XP_003579898.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR A+   LKG+LDVCD PLVSVDFRCSDVSSTID+SL+MVMGDDM
Sbjct  325  VNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDM  374



>emb|CDP18560.1| unnamed protein product [Coffea canephora]
Length=386

 Score = 84.3 bits (207),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A+D  L G+L VCD PLVSVDFRC+DVSST+D+SLTMVMGDDM
Sbjct  321  VNAAFREAADKELNGILSVCDEPLVSVDFRCTDVSSTVDASLTMVMGDDM  370



>dbj|BAA94304.1| NADP-glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas 
sp. W80]
Length=369

 Score = 84.0 bits (206),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A++G  KGVL V D PLVSVDFRCSDVSSTID+SLTMVMGDDM
Sbjct  291  VNAAFREAANGAQKGVLAVSDEPLVSVDFRCSDVSSTIDASLTMVMGDDM  340



>ref|XP_002507103.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
 gb|ACO68361.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
Length=405

 Score = 84.3 bits (207),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAF++A+DGP+KGVL + + PLVSVDFRCSDVS+TID++LTMVMGDDM
Sbjct  300  VNAAFKEAADGPMKGVLAITETPLVSVDFRCSDVSTTIDAALTMVMGDDM  349



>dbj|BAK02737.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=306

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFR A+   LKG+LDVCD PLVSVDFRCSDVSSTID+SL+MVMGDDM
Sbjct  228  VNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDM  277



>ref|XP_001415434.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABG85192.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
B [Ostreococcus 'lucimarinus']
 gb|ABO93726.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=406

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAF++A DGP+KGVL + D PLVSVDFRC+DVS+TID++LTMVMGDDM
Sbjct  301  VNAAFKEAQDGPMKGVLAITDVPLVSVDFRCTDVSTTIDAALTMVMGDDM  350



>ref|XP_001689871.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 sp|P50362.1|G3PA_CHLRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAA86855.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP09609.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
Length=374

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A++GP+KGVL V DAPLVS+DF+C+D S++ID+SLTMVMGDDM
Sbjct  295  VNAAFREAANGPMKGVLHVEDAPLVSIDFKCTDQSTSIDASLTMVMGDDM  344



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  L G+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDM
Sbjct  331  VNAAFRESADNELAGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDM  380



>gb|ABA01156.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas 
incerta]
Length=342

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A++GP+KGVL V DAPLVS+DF+C+D S++ID+SLTMVMGDDM
Sbjct  282  VNAAFREAANGPMKGVLHVEDAPLVSIDFKCTDQSTSIDASLTMVMGDDM  331



>gb|ABQ53991.1| glyceraldehyde 3-phosphate dehydrogenase [Cicer arietinum]
Length=78

 Score = 79.3 bits (194),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFR+++   L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDD+
Sbjct  1    VNEAFRESAANELNGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDL  50



>gb|ABA01125.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlamydomonas incerta]
Length=369

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A++GP+KGVL V DAPLVS+DF+C+D S++ID+SLTMVMGDDM
Sbjct  290  VNAAFREAANGPMKGVLHVEDAPLVSIDFKCTDQSTSIDASLTMVMGDDM  339



>gb|ADB81490.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Ignatius tetrasporus]
Length=168

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFR+A++GP+KG+L V D PLVS+DF+CSDVS+TIDS+LT+VMGDDM
Sbjct  108  VNNAFREAANGPMKGILAVADTPLVSMDFKCSDVSTTIDSALTLVMGDDM  157



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  LKG+L+VCD PLVSVDFRCSD S+TIDSSLTMVMGDDM
Sbjct  322  VNAAFRDSAEKELKGILEVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDM  371



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  LKG+L+VCD PLVSVDFRCSD S+TIDSSLTMVMGDDM
Sbjct  322  VNAAFRDSAEKELKGILEVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDM  371



>emb|CAC80373.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=312

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  L G+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDM
Sbjct  254  VNAAFRESADKELAGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDM  303



>gb|AHA84230.1| glyceraldehyde-3-phosphate dehydrogenase A [Phaseolus vulgaris]
Length=402

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR++++  LKG+L VCD P VSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  324  VNAAFRESAEKELKGILSVCDEPFVSVDFRCTDVSSTVDSSLTMVMGDDM  373



>ref|XP_002955293.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
 gb|EFJ43593.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
Length=374

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A+ GP+KGVL V DAPLVS+DF+C+D S++IDSSLTMVMGDDM
Sbjct  295  VNAAFREAAAGPMKGVLHVEDAPLVSIDFKCTDQSTSIDSSLTMVMGDDM  344



>ref|XP_007510189.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO18534.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=379

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFR+++ GPLKG+L VCD PLVSVDFRC+D S+TIDS+LTMV+GDDM
Sbjct  301  VNNAFRESAAGPLKGILSVCDEPLVSVDFRCTDQSTTIDSALTMVIGDDM  350



>ref|XP_003056194.1| hypothetical protein MICPUCDRAFT_25339 [Micromonas pusilla CCMP1545]
 gb|EEH59570.1| hypothetical protein MICPUCDRAFT_25339 [Micromonas pusilla CCMP1545]
Length=406

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAF++AS+GP+KG+L + + PLVSVDFRCSDVS+TID++LTMVMGDDM
Sbjct  300  VNAAFKEASEGPMKGILAITETPLVSVDFRCSDVSTTIDAALTMVMGDDM  349



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=404

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+++D  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  326  VNAAFRESADKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  375



>gb|EMS61784.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Triticum 
urartu]
Length=365

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFR A+   LKG+LDVCD PLVSVDFRCSDVSSTID+SL+MVMGDDM
Sbjct  287  VNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDM  336



>ref|XP_003081785.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC), partial [Ostreococcus 
tauri]
Length=378

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A++GPLKG+L V D PLVS DFRC+DVS TID++LTMVMGDDM
Sbjct  300  VNAAFREAANGPLKGILAVADEPLVSCDFRCTDVSCTIDAALTMVMGDDM  349



>gb|EMT31124.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Aegilops 
tauschii]
Length=402

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFR A+   LKG+LDVCD PLVSVDFRCSDVSSTID+SL+MVMGDDM
Sbjct  324  VNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDM  373



>dbj|BAJ90530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFR A+   LKG+LDVCD PLVSVDFRCSDVSSTID+SL+MVMGDDM
Sbjct  323  VNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDM  372



>gb|ABG85189.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus tauri]
 emb|CEF99493.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=380

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A++GPLKG+L V D PLVS DFRC+DVS TID++LTMVMGDDM
Sbjct  302  VNAAFREAANGPLKGILAVADEPLVSCDFRCTDVSCTIDAALTMVMGDDM  351



>dbj|BAJ90885.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFR A+   LKG+LDVCD PLVSVDFRCSDVSSTID+SL+MVMGDDM
Sbjct  323  VNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDM  372



>ref|XP_008797069.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008797070.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
Length=445

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR  ++  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  367  VNAAFRDTAEKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  416



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR++++  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  327  VNAAFRESAEKELNGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  376



>gb|ABD37956.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Spermatozopsis 
similis]
Length=263

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFR+A+ G +KGVL VCD PLVSVDFRC+DVS +IDSSLTMVMGDDM
Sbjct  185  VNNAFREAAAGEMKGVLAVCDEPLVSVDFRCTDVSVSIDSSLTMVMGDDM  234



>gb|ABS86942.1| glyceraldehyde-3-phosphate dehydrogenase [Garcinia mangostana]
Length=136

 Score = 79.3 bits (194),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR++++  L G+L VCD PLVSVD RC+DVSST+D+SLTMVMGDDM
Sbjct  85   VNAAFRESAEKELSGILSVCDEPLVSVDIRCTDVSSTVDASLTMVMGDDM  134



>emb|CEF96577.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=407

 Score = 82.8 bits (203),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAF++ +DGP+KGVL + D PLVSVDFRC+DVS+TID++LTMVMGDDM
Sbjct  301  VNAAFKEYADGPMKGVLAITDTPLVSVDFRCTDVSTTIDAALTMVMGDDM  350



>ref|XP_006652373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=401

 Score = 82.4 bits (202),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR ++   L+G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDM
Sbjct  323  VNAAFRDSAANELQGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDM  372



>ref|XP_006652372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=403

 Score = 82.4 bits (202),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR ++   L+G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDM
Sbjct  325  VNAAFRDSAANELQGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDM  374



>gb|ABK00057.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Mesostigma 
viride]
Length=384

 Score = 82.0 bits (201),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRK ++G +KG+L V D PLVS+DFRCSDVS TIDSSLTMVMGDDM
Sbjct  280  VNAAFRKEANGAMKGILAVSDLPLVSIDFRCSDVSCTIDSSLTMVMGDDM  329



>gb|ADD54591.1| putative glyceraldehyde-3-phosphate dehydrogenase [Linum usitatissimum]
Length=203

 Score = 80.1 bits (196),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMG  142
            VNAAFR+++D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMG
Sbjct  156  VNAAFRESADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMG  202



>ref|XP_003055659.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
 gb|EEH60911.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
Length=380

 Score = 81.6 bits (200),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+A+ GP+KG+L V D PLVS+DFRC+DVS++IDS+LTMVMG+D+
Sbjct  300  VNAAFREAAAGPMKGILQVVDEPLVSIDFRCTDVSTSIDSALTMVMGEDL  349



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score = 82.0 bits (201),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFRK ++G +KG+L V D PLVS+DFRCSDVS TIDSSLTMVMGDDM
Sbjct  308  VNAAFRKEANGAMKGILAVSDLPLVSIDFRCSDVSCTIDSSLTMVMGDDM  357



>emb|CAC80390.1| glyceraldehyde-3-phosphate dehydrogenase [Coleochaete scutata]
Length=317

 Score = 80.9 bits (198),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFR A++G LKG+L V D PLVS+DFRCSD SSTIDSSLTMVMGDDM
Sbjct  255  VNTAFRNAANGSLKGILGVSDLPLVSIDFRCSDESSTIDSSLTMVMGDDM  304



>gb|KHG21941.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=363

 Score = 81.3 bits (199),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAF+++++  L+G+L VC+ PLVSVDFRCSDVSST+D+SLTMVMGDDM
Sbjct  285  VNAAFKESAEKELQGILSVCEEPLVSVDFRCSDVSSTVDASLTMVMGDDM  334



>dbj|BAD94928.1| glyceraldehyde 3-phosphate dehydrogenase A [Arabidopsis thaliana]
Length=73

 Score = 77.0 bits (188),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  23   ASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM
Sbjct  2    AAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDM  44



>ref|XP_010090946.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
 gb|EXB41431.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
Length=404

 Score = 81.6 bits (200),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR++++  L G+L VCD PLVSVDFRC+DVSST+D+SLTMVMGDDM
Sbjct  326  VNAAFRESAEKELNGILSVCDEPLVSVDFRCTDVSSTVDASLTMVMGDDM  375



>ref|XP_009378072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=355

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  277  VNAAFRDSAEKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  326



>gb|ADB81482.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Bolbocoleon 
piliferum]
Length=164

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+ASDGP+KGVL V + PLVS+DF+ + VSST+D SLTMVMGDDM
Sbjct  108  VNAAFREASDGPMKGVLAVTNEPLVSIDFKGTFVSSTVDESLTMVMGDDM  157



>gb|AFC88822.1| glyceraldehyde-3-phosphate dehydrogenase-like protein, partial 
[Miscanthus sinensis]
Length=316

 Score = 80.1 bits (196),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFR A+   L G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDM
Sbjct  238  VNQAFRDAAANELIGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDM  287



>ref|XP_003548929.2| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde 3-phosphate dehydrogenase 
GAPA2, chloroplastic-like [Glycine max]
Length=346

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNA FR++++  LKG+L VCD PLVSVDFRCSDVSST+DS LTMV+GDDM
Sbjct  268  VNAVFRESTENELKGILSVCDEPLVSVDFRCSDVSSTVDSXLTMVVGDDM  317



>gb|ADB81480.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Ulvella repens]
Length=168

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR+ASDGP+KGVL V + PLVS+DF+ + VSST+D SLTMVMGDDM
Sbjct  108  VNAAFREASDGPMKGVLAVTNEPLVSIDFKGTFVSSTVDESLTMVMGDDM  157



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  L G+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDM
Sbjct  326  VNAAFRDSAEKELNGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDM  375



>emb|CAA30152.1| GADPH (383 AA) [Zea mays]
Length=383

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFR A+   L G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDM
Sbjct  305  VNQAFRDAAANELTGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDM  354



>ref|NP_001105414.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic precursor 
[Zea mays]
 sp|P09315.1|G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Zea mays]
 gb|AAA33464.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 emb|CAA33455.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=403

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFR A+   L G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDM
Sbjct  325  VNQAFRDAAANELTGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDM  374



>ref|XP_009378071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  325  VNAAFRDSAEKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  374



>tpg|DAA37469.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=403

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VN AFR A+   L G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDM
Sbjct  325  VNQAFRDAAANELTGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDM  374



>ref|XP_008379036.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  325  VNAAFRDSAEKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  374



>ref|XP_008362077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    VNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDM  151
            VNAAFR +++  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDM
Sbjct  325  VNAAFRDSAEKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDM  374



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 537280169283