BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15567_g2_i1 len=811 path=[1082:0-810]

Length=811
                                                                      Score     E

ref|XP_009615979.1|  PREDICTED: uncharacterized protein LOC104108607    120   1e-29   
ref|XP_006367278.1|  PREDICTED: adenylate cyclase, aggregation sp...    120   1e-29   
ref|XP_006469699.1|  PREDICTED: uncharacterized protein LOC102614...    117   3e-28   
ref|XP_006447536.1|  hypothetical protein CICLE_v10018295mg             117   4e-28   
emb|CBI28947.3|  unnamed protein product                                115   1e-27   
ref|XP_002279953.1|  PREDICTED: uncharacterized protein LOC100253364    115   1e-27   Vitis vinifera
ref|XP_009620975.1|  PREDICTED: uncharacterized protein LOC104112685    113   8e-27   
ref|XP_004243463.1|  PREDICTED: probable serine/threonine-protein...    112   3e-26   
ref|XP_006356921.1|  PREDICTED: uncharacterized protein LOC102588721    108   4e-25   
ref|XP_009765220.1|  PREDICTED: uncharacterized protein LOC104216786    107   1e-24   
gb|KDO59827.1|  hypothetical protein CISIN_1g041035mg                   106   4e-24   
emb|CDP11793.1|  unnamed protein product                                102   6e-23   
ref|XP_009772102.1|  PREDICTED: uncharacterized protein LOC104222558    102   7e-23   
ref|XP_006352039.1|  PREDICTED: transcription initiation factor T...    103   7e-23   
ref|XP_009794413.1|  PREDICTED: uncharacterized protein LOC104241195  97.8    4e-21   
ref|XP_008230080.1|  PREDICTED: uncharacterized protein LOC103329...  98.2    6e-21   
ref|XP_010313670.1|  PREDICTED: uncharacterized protein LOC101247...  97.1    9e-21   
ref|XP_011005117.1|  PREDICTED: uncharacterized protein LOC105111456  95.9    2e-20   
ref|XP_007215977.1|  hypothetical protein PRUPE_ppa011622mg           95.1    7e-20   
ref|XP_006367279.1|  PREDICTED: adenylate cyclase, aggregation sp...  93.2    1e-19   
ref|XP_010109518.1|  hypothetical protein L484_018253                 92.4    5e-19   
ref|XP_009602750.1|  PREDICTED: uncharacterized protein LOC104097836  89.7    7e-18   
ref|XP_002301629.1|  hypothetical protein POPTR_0002s23090g           86.7    5e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011079014.1|  PREDICTED: uncharacterized protein LOC105162633  86.3    6e-17   
ref|XP_010689672.1|  PREDICTED: uncharacterized protein LOC104903343  86.3    1e-16   
ref|XP_011042803.1|  PREDICTED: uncharacterized protein LOC105138...  85.5    1e-16   
ref|XP_008379625.1|  PREDICTED: uncharacterized protein LOC103442596  84.0    5e-16   
ref|XP_002321121.1|  hypothetical protein POPTR_0014s15000g           82.8    6e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002279003.1|  PREDICTED: uncharacterized protein LOC100258838  82.8    9e-16   Vitis vinifera
ref|XP_002524169.1|  conserved hypothetical protein                   82.8    1e-15   Ricinus communis
emb|CBI23945.3|  unnamed protein product                              83.2    1e-15   
gb|KDP25843.1|  hypothetical protein JCGZ_22873                       82.0    3e-15   
ref|XP_003540843.1|  PREDICTED: uncharacterized protein LOC100804712  81.3    4e-15   
ref|XP_003526319.1|  PREDICTED: uncharacterized protein LOC100786184  80.5    5e-15   
ref|XP_009353263.1|  PREDICTED: uncharacterized protein LOC103944521  80.9    6e-15   
ref|XP_008230081.1|  PREDICTED: uncharacterized protein LOC103329...  78.6    2e-14   
ref|XP_004289159.1|  PREDICTED: uncharacterized protein LOC101296524  78.6    3e-14   
ref|NP_001235571.1|  uncharacterized protein LOC100306218             77.4    6e-14   
ref|XP_010051082.1|  PREDICTED: uncharacterized protein LOC104439759  77.4    7e-14   
ref|XP_007132562.1|  hypothetical protein PHAVU_011G105200g           76.6    1e-13   
gb|KCW89418.1|  hypothetical protein EUGRSUZ_A01716                   77.0    1e-13   
gb|EYU43115.1|  hypothetical protein MIMGU_mgv1a022998mg              75.5    2e-13   
ref|XP_007045610.1|  Melanoma inhibitory activity protein 3, puta...  77.0    2e-13   
ref|XP_004251513.1|  PREDICTED: uncharacterized protein LOC101247...  73.6    1e-12   
ref|XP_006469700.1|  PREDICTED: uncharacterized protein LOC102614...  73.6    1e-12   
ref|XP_009135767.1|  PREDICTED: uncharacterized protein LOC103859921  74.3    1e-12   
ref|XP_006593347.1|  PREDICTED: uncharacterized protein LOC100306...  72.8    2e-12   
ref|XP_002883315.1|  hypothetical protein ARALYDRAFT_479695           73.6    2e-12   
emb|CDY24256.1|  BnaC03g42290D                                        72.4    6e-12   
ref|XP_010488191.1|  PREDICTED: uncharacterized protein LOC104766072  70.9    2e-11   
ref|XP_004515078.1|  PREDICTED: uncharacterized protein LOC101496631  70.5    2e-11   
ref|XP_008811226.1|  PREDICTED: uncharacterized protein LOC103722446  69.7    3e-11   
emb|CDY38633.1|  BnaA05g19540D                                        69.7    5e-11   
gb|KFK39489.1|  hypothetical protein AALP_AA3G250700                  69.7    5e-11   
ref|XP_006826517.1|  hypothetical protein AMTR_s00004p00268050        68.9    5e-11   
emb|CDY33133.1|  BnaCnng07040D                                        68.9    7e-11   
ref|XP_008355347.1|  PREDICTED: uncharacterized protein LOC103419...  68.6    9e-11   
ref|XP_009417237.1|  PREDICTED: uncharacterized protein LOC103997669  68.6    9e-11   
ref|XP_008244373.1|  PREDICTED: uncharacterized protein LOC103342...  68.2    1e-10   
ref|XP_011042804.1|  PREDICTED: uncharacterized protein LOC105138...  67.8    1e-10   
ref|XP_007149966.1|  hypothetical protein PHAVU_005G114400g           67.8    2e-10   
ref|XP_010510513.1|  PREDICTED: uncharacterized protein LOC104786761  68.2    2e-10   
ref|XP_009145460.1|  PREDICTED: uncharacterized protein LOC103869...  68.2    2e-10   
ref|XP_006298411.1|  hypothetical protein CARUB_v10014480mg           68.2    2e-10   
ref|NP_974350.1|  uncharacterized protein                             67.8    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532477.1|  PREDICTED: uncharacterized protein LOC104808493  67.4    3e-10   
gb|AFK37827.1|  unknown                                               67.4    3e-10   
ref|XP_009358123.1|  PREDICTED: uncharacterized protein LOC103948...  67.0    3e-10   
ref|XP_010466428.1|  PREDICTED: uncharacterized protein LOC104746605  67.4    3e-10   
ref|XP_009145461.1|  PREDICTED: uncharacterized protein LOC103869...  66.6    5e-10   
ref|XP_010930685.1|  PREDICTED: uncharacterized protein LOC105051782  66.2    5e-10   
ref|XP_008355348.1|  PREDICTED: uncharacterized protein LOC103419...  65.9    7e-10   
ref|XP_006657776.1|  PREDICTED: uncharacterized protein LOC102707981  66.2    1e-09   
emb|CDP05785.1|  unnamed protein product                              65.9    1e-09   
ref|XP_002522866.1|  conserved hypothetical protein                   65.9    1e-09   Ricinus communis
ref|XP_003540311.1|  PREDICTED: uncharacterized protein LOC100799390  64.7    2e-09   
ref|XP_010923959.1|  PREDICTED: uncharacterized protein LOC105046907  63.9    3e-09   
ref|XP_003563010.1|  PREDICTED: uncharacterized protein LOC100844346  63.9    5e-09   
ref|XP_006406240.1|  hypothetical protein EUTSA_v10021505mg           64.3    5e-09   
emb|CDY39496.1|  BnaA01g24920D                                        63.5    7e-09   
ref|XP_009109370.1|  PREDICTED: uncharacterized protein LOC103835026  63.5    8e-09   
ref|XP_009632060.1|  PREDICTED: uncharacterized protein LOC104121704  62.4    1e-08   
gb|KHN44881.1|  hypothetical protein glysoja_040810                   62.4    1e-08   
ref|XP_002460795.1|  hypothetical protein SORBIDRAFT_02g034990        62.8    2e-08   Sorghum bicolor [broomcorn]
ref|XP_010101186.1|  hypothetical protein L484_000795                 62.0    2e-08   
ref|XP_009792861.1|  PREDICTED: uncharacterized protein LOC104239834  62.0    2e-08   
ref|XP_009342588.1|  PREDICTED: uncharacterized protein LOC103934562  61.6    3e-08   
ref|XP_009407066.1|  PREDICTED: uncharacterized protein LOC103989845  61.2    3e-08   
gb|EAZ40058.1|  hypothetical protein OsJ_24504                        61.2    4e-08   Oryza sativa Japonica Group [Japonica rice]
gb|AFK37474.1|  unknown                                               60.8    5e-08   
ref|NP_001059820.1|  Os07g0524000                                     61.2    6e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ04110.1|  hypothetical protein OsI_26256                        61.2    6e-08   Oryza sativa Indica Group [Indian rice]
gb|EAZ04112.1|  hypothetical protein OsI_26258                        61.2    6e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_009358124.1|  PREDICTED: uncharacterized protein LOC103948...  60.1    7e-08   
ref|XP_004957890.1|  PREDICTED: uncharacterized protein LOC101769...  60.1    1e-07   
ref|NP_001143502.1|  uncharacterized protein LOC100276181             60.5    1e-07   Zea mays [maize]
gb|EMT30645.1|  hypothetical protein F775_09619                       59.7    1e-07   
gb|KDP39074.1|  hypothetical protein JCGZ_00831                       59.7    2e-07   
ref|XP_006370648.1|  hypothetical protein POPTR_0001s44530g           59.3    2e-07   
ref|XP_008455849.1|  PREDICTED: uncharacterized protein LOC103495948  58.9    2e-07   
ref|XP_011011271.1|  PREDICTED: uncharacterized protein LOC105115...  59.3    3e-07   
ref|NP_001167880.1|  hypothetical protein                             59.3    3e-07   Zea mays [maize]
gb|KHG28512.1|  hypothetical protein F383_12210                       58.2    4e-07   
ref|XP_008244374.1|  PREDICTED: uncharacterized protein LOC103342...  58.2    4e-07   
ref|XP_004487590.1|  PREDICTED: uncharacterized protein LOC101507...  58.2    4e-07   
ref|XP_008812145.1|  PREDICTED: uncharacterized protein LOC103723109  58.2    4e-07   
ref|XP_002317581.1|  hypothetical protein POPTR_0011s13900g           58.2    6e-07   Populus trichocarpa [western balsam poplar]
gb|EMS66211.1|  hypothetical protein TRIUR3_32218                     57.8    6e-07   
ref|XP_011030839.1|  PREDICTED: uncharacterized protein LOC105130164  57.4    1e-06   
ref|XP_004487591.1|  PREDICTED: uncharacterized protein LOC101507...  56.2    2e-06   
gb|KGN63264.1|  hypothetical protein Csa_2G420470                     55.8    3e-06   
ref|XP_010060422.1|  PREDICTED: uncharacterized protein LOC104448340  55.8    3e-06   
ref|XP_008455422.1|  PREDICTED: uncharacterized protein LOC103495585  54.3    1e-05   
ref|XP_008454531.1|  PREDICTED: uncharacterized protein LOC103494923  53.5    2e-05   
gb|KGN43534.1|  hypothetical protein Csa_7G044250                     53.5    2e-05   
ref|XP_007020978.1|  CTD small phosphatase-like protein 2, putative   52.8    4e-05   
ref|XP_003596661.1|  hypothetical protein MTR_2g083300                52.0    7e-05   
ref|XP_010544257.1|  PREDICTED: uncharacterized protein LOC104816923  51.2    1e-04   
ref|XP_004248387.1|  PREDICTED: glycosyltransferase-like protein ...  50.1    3e-04   
gb|KHN27962.1|  hypothetical protein glysoja_007694                   49.3    4e-04   
ref|XP_008341984.1|  PREDICTED: uncharacterized protein LOC103404801  49.3    4e-04   
ref|XP_009418774.1|  PREDICTED: uncharacterized protein LOC103998891  48.5    7e-04   
ref|XP_006592877.1|  PREDICTED: uncharacterized protein LOC102669408  48.5    8e-04   



>ref|XP_009615979.1| PREDICTED: uncharacterized protein LOC104108607 [Nicotiana tomentosiformis]
Length=177

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 123/192 (64%), Gaps = 23/192 (12%)
 Frame = -2

Query  732  GREQQEESGWTAYLQDFS-ENKMMGSSSSYSNQEDYDCS---IVSSPSLVSDaatyaarr  565
            G   QEESGWT YL+DFS EN         +N+E+  CS      SPSL+SDAA++A   
Sbjct  3    GSYVQEESGWTTYLEDFSMEN---------NNRENSSCSENDSFGSPSLLSDAASHAVNW  53

Query  564  kkksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRT  385
            K  +S++ + +  N+  S +GGS  L++LNLK P+ + K  DPDLEDTASSPVNSPK  +
Sbjct  54   KNCNSTNNQVL--NSYNSPMGGSPFLKKLNLKKPR-NKKISDPDLEDTASSPVNSPKVSS  110

Query  384  FKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRG  205
            FK Q++IN RR   N L  +  ESG    +EM      ER+S+ FDGK +    DLKK+G
Sbjct  111  FK-QMDINYRRADGNFLGNI--ESGSTQDEEM---QTVERNSVCFDGK-NNSYKDLKKKG  163

Query  204  LCLMPLSLLVNY  169
            LCL+PLS+LVNY
Sbjct  164  LCLVPLSMLVNY  175



>ref|XP_006367278.1| PREDICTED: adenylate cyclase, aggregation specific-like isoform 
X1 [Solanum tuberosum]
Length=178

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 113/186 (61%), Gaps = 24/186 (13%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksss  547
            + QEESGWT YL+DFS    M   ++ S    Y C    SPSL+SDAA++A      +++
Sbjct  15   DAQEESGWTTYLEDFS----MEQHNNNSENSTY-CDSFGSPSLLSDAASHAVWNNCNNNN  69

Query  546  dfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVE  367
                           GS  L+RLNLK P+ + K  DPDLEDTASSPVNSPK  +F +Q++
Sbjct  70   Y--------------GSPFLKRLNLKKPR-NKKISDPDLEDTASSPVNSPK-VSFNKQMD  113

Query  366  INPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPL  187
            IN RRT NN  N+LG E G    QEM     E  S++ FD K +   +DL+K+GLCL+PL
Sbjct  114  INYRRTDNNNGNFLGFEGGSRQQQEME--TIERNSTVCFDEK-NKSYMDLEKKGLCLVPL  170

Query  186  SLLVNY  169
            S+LVNY
Sbjct  171  SMLVNY  176



>ref|XP_006469699.1| PREDICTED: uncharacterized protein LOC102614405 isoform X1 [Citrus 
sinensis]
Length=198

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 111/187 (59%), Gaps = 25/187 (13%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYD-CSIVSSPSLVSDaatyaarrkkkss  550
            E +EESGWTAY +DFS + +        N+E+Y  CS   SPSLVSDAA+ AA +     
Sbjct  34   EPEEESGWTAYFEDFSNDNI--------NREEYSYCSSFGSPSLVSDAASCAAWKL----  81

Query  549  sdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQV  370
                   +N     +  S++ ++LN K P+      D  LEDTASSPVNSPK   F+   
Sbjct  82   -------SNKHRVDVATSKMPKKLNFKKPRARQICDDDSLEDTASSPVNSPKVSDFEPVD  134

Query  369  EINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMP  190
             +NPR+  +++ + LGK +  E + EM    ++E+ S+NF+   + +C DLK RGLCL+P
Sbjct  135  HVNPRKPDDHMYSSLGKGTASEHYSEM----QQEQRSMNFNVG-NNDCTDLKGRGLCLVP  189

Query  189  LSLLVNY  169
            LS+LVNY
Sbjct  190  LSMLVNY  196



>ref|XP_006447536.1| hypothetical protein CICLE_v10018295mg, partial [Citrus clementina]
 gb|ESR60776.1| hypothetical protein CICLE_v10018295mg, partial [Citrus clementina]
Length=206

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 111/187 (59%), Gaps = 25/187 (13%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYD-CSIVSSPSLVSDaatyaarrkkkss  550
            E +EESGWTAY +DFS + +        N+E+Y  CS   SPSLVSDAA+ AA +     
Sbjct  42   EPEEESGWTAYFEDFSNDNI--------NREEYSYCSSFGSPSLVSDAASCAAWKL----  89

Query  549  sdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQV  370
                   +N     +  S++ ++LN K P+      D  LEDTASSPVNSPK   F+   
Sbjct  90   -------SNKHRVDVATSKMPKKLNFKKPRARQICDDDSLEDTASSPVNSPKVSDFEPVD  142

Query  369  EINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMP  190
             +NPR+  +++ + LGK +  E + EM    ++E+ S+NF+   + +C DLK RGLCL+P
Sbjct  143  HVNPRKPDDHMYSSLGKGTASEHYSEM----QQEQRSMNFNVG-NNDCTDLKGRGLCLVP  197

Query  189  LSLLVNY  169
            LS+LVNY
Sbjct  198  LSMLVNY  204



>emb|CBI28947.3| unnamed protein product [Vitis vinifera]
Length=190

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 112/201 (56%), Gaps = 24/201 (12%)
 Frame = -2

Query  756  SLYEKSFV---GREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDa  586
            S  +K F      +  EESGWTAY +D S         S S     + S   + SLVSDA
Sbjct  7    SFVDKGFALKGAEDGPEESGWTAYFEDLS---------SISRGHGSNSSACDTSSLVSDA  57

Query  585  atyaarrkkksssdfrrvKNNTECSSLGGS-QVLRRLNLKNPKPSDKYYDPDLEDTASSP  409
            A+ AA +    +           CSS+ GS Q+ R+L+ K  +  +  YD  LEDTASSP
Sbjct  58   ASGAAWKATTGNHV-------VACSSIAGSPQIPRKLSFKKTRAREISYDDSLEDTASSP  110

Query  408  VNSPKDRTFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSIN-FDGKIST  232
            VNSPK  T  Q++E+NPR+T +++ N  GK  G       +     ER+ +N F+GK + 
Sbjct  111  VNSPKTSTL-QKMEMNPRKTDSHMENSQGKGDGSADHYSKLQA--NERNEMNDFNGKNNI  167

Query  231  ECIDLKKRGLCLMPLSLLVNY  169
            +C DLKKRGLCL+PLS+LV+Y
Sbjct  168  DCTDLKKRGLCLVPLSMLVSY  188



>ref|XP_002279953.1| PREDICTED: uncharacterized protein LOC100253364 [Vitis vinifera]
Length=191

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 112/201 (56%), Gaps = 24/201 (12%)
 Frame = -2

Query  756  SLYEKSFV---GREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDa  586
            S  +K F      +  EESGWTAY +D S         S S     + S   + SLVSDA
Sbjct  8    SFVDKGFALKGAEDGPEESGWTAYFEDLS---------SISRGHGSNSSACDTSSLVSDA  58

Query  585  atyaarrkkksssdfrrvKNNTECSSLGGS-QVLRRLNLKNPKPSDKYYDPDLEDTASSP  409
            A+ AA +    +           CSS+ GS Q+ R+L+ K  +  +  YD  LEDTASSP
Sbjct  59   ASGAAWKATTGNHV-------VACSSIAGSPQIPRKLSFKKTRAREISYDDSLEDTASSP  111

Query  408  VNSPKDRTFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSIN-FDGKIST  232
            VNSPK  T  Q++E+NPR+T +++ N  GK  G       +     ER+ +N F+GK + 
Sbjct  112  VNSPKTSTL-QKMEMNPRKTDSHMENSQGKGDGSADHYSKLQA--NERNEMNDFNGKNNI  168

Query  231  ECIDLKKRGLCLMPLSLLVNY  169
            +C DLKKRGLCL+PLS+LV+Y
Sbjct  169  DCTDLKKRGLCLVPLSMLVSY  189



>ref|XP_009620975.1| PREDICTED: uncharacterized protein LOC104112685 [Nicotiana tomentosiformis]
Length=187

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 117/185 (63%), Gaps = 15/185 (8%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdfr  538
            EESGWT YL+DFS  +   +SS  S+          SPSL+SDAA++AA +   ++++  
Sbjct  16   EESGWTTYLEDFSMKQRENNSSCNSDS-------FGSPSLLSDAASHAAWKINCNTNNTN  68

Query  537  rvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEINP  358
            ++ N      +GGS  L+RLNLKN K + K  DPDLEDTASSPVNSPK  +FK Q++ N 
Sbjct  69   QIPNACSPPPMGGSPFLKRLNLKN-KRNKKISDPDLEDTASSPVNSPKVSSFK-QMDTN-  125

Query  357  RRTQNNVLNYL-GKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPLSL  181
             RT+N+ + Y  G E G    QEM      E +S +FD K +   I+LKK+GLCL+P S+
Sbjct  126  YRTENSSIGYFQGNEGGSGQIQEM---QTVEINSTSFDEK-NNGYIELKKKGLCLVPWSM  181

Query  180  LVNYH  166
            +VN+H
Sbjct  182  IVNHH  186



>ref|XP_004243463.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Solanum lycopersicum]
Length=193

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 115/192 (60%), Gaps = 23/192 (12%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFS-ENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkkss  550
            ++QEESGWT YL+DFS E     S ++ +++    C    SPSL+SDAA++         
Sbjct  17   DEQEESGWTTYLEDFSMEQHNNNSINNNNSEISTYCDSFGSPSLLSDAASHVVWN-----  71

Query  549  sdfrrvKNNTEC---SSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFK  379
                   NN +    +S  GS  L+RLNLK P+ ++K  DPDL+DTASSPVNSPK  +F 
Sbjct  72   -------NNHQVMINTSNYGSPFLKRLNLKKPR-NNKISDPDLQDTASSPVNSPKVSSFN  123

Query  378  QQVEINPRRTQNNVLNYLGKESGFEGF--QEMVMGAEEERSSINFDGKISTECIDLKKRG  205
            +Q++IN RR  NN         GFEG   Q   M   E+ SS+ FD + +   +DLKK+G
Sbjct  124  KQMDINYRRGDNNNNGNF---QGFEGSSRQHQEMETIEKNSSMCFDER-NKSYMDLKKKG  179

Query  204  LCLMPLSLLVNY  169
            LCL+PLS+LVNY
Sbjct  180  LCLVPLSMLVNY  191



>ref|XP_006356921.1| PREDICTED: uncharacterized protein LOC102588721 [Solanum tuberosum]
Length=181

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 113/184 (61%), Gaps = 31/184 (17%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdfr  538
            EESGWT YL+DFS   M    ++YS+  D+D +   SPSL+SDAA++AA ++        
Sbjct  28   EESGWTTYLEDFS---MKQRENNYSSSSDHDNNSFGSPSLLSDAASHAAWKQNSQ-----  79

Query  537  rvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEINP  358
                    S + GS  L+RLNLK  K ++K  DPDLEDTASSP+NSPK   FK Q++IN 
Sbjct  80   --------SPMSGSPFLKRLNLKKQKRNNKISDPDLEDTASSPINSPKVSNFK-QMDIN-  129

Query  357  RRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPLSLL  178
             RT+N         SG   FQEM      ER++ +FDGK +   I+LKK+GLCL+P S++
Sbjct  130  YRTEN--------SSG--QFQEM---KRVERNNKSFDGKDNNGYIELKKKGLCLVPWSMI  176

Query  177  VNYH  166
            VN H
Sbjct  177  VNNH  180



>ref|XP_009765220.1| PREDICTED: uncharacterized protein LOC104216786 [Nicotiana sylvestris]
Length=161

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/202 (40%), Positives = 105/202 (52%), Gaps = 51/202 (25%)
 Frame = -2

Query  762  RMSLYEKSFVGREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaa  583
            R+S    +F     QEESGWT YL DFS   +M    + S+  + DC     PSL+SD  
Sbjct  5    RISSSMNNFEAATNQEESGWTTYLDDFS---LMNQRENRSSNSEDDC-----PSLLSD--  54

Query  582  tyaarrkkksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVN  403
                                        +  ++RLNLK  + + K  DPDLEDTASSPVN
Sbjct  55   ---------------------------AASHVKRLNLKKSR-NKKISDPDLEDTASSPVN  86

Query  402  SPKDRTFKQQVEINPRRTQNNVLNYLGKE-SGFEGFQEMVMGAEEERSSINFDGKISTE-  229
            SPK  +FK Q++IN RRT+NN  N+LG E S  +  QEM         ++     IS+E 
Sbjct  87   SPKVSSFK-QMDINYRRTENNSGNFLGNERSSRQIIQEM--------QNVERGHSISSEN  137

Query  228  --CIDLKKRGLCLMPLSLLVNY  169
                DLKK+GLCL+PLS+ VN+
Sbjct  138  NGYTDLKKKGLCLVPLSMFVNH  159



>gb|KDO59827.1| hypothetical protein CISIN_1g041035mg [Citrus sinensis]
Length=198

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 110/187 (59%), Gaps = 25/187 (13%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYD-CSIVSSPSLVSDaatyaarrkkkss  550
            E +EESGWTAY +DFS + +        N+E+Y  CS   SPSLVSDAA+ AA +     
Sbjct  34   EPEEESGWTAYFEDFSNDNI--------NREEYSYCSSFGSPSLVSDAASCAAWKL----  81

Query  549  sdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQV  370
                   +N     +  S++ ++L  K P+      D  LEDTASSPVNSPK   F+   
Sbjct  82   -------SNKHRVDVATSKMPKKLKFKKPRARQICDDDSLEDTASSPVNSPKVSDFEPVD  134

Query  369  EINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMP  190
             +NPR+  +++ + LGK +  E + EM    ++E+ S+NF+   + +C DLK RGLCL+P
Sbjct  135  HVNPRKPDDHMYSSLGKGTASEHYSEM----QQEQRSMNFNVG-NNDCTDLKGRGLCLVP  189

Query  189  LSLLVNY  169
            LS+LVNY
Sbjct  190  LSMLVNY  196



>emb|CDP11793.1| unnamed protein product [Coffea canephora]
Length=174

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 102/183 (56%), Gaps = 30/183 (16%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdfr  538
            EESGWT Y  DFS ++          + D       SPSLVSD             +   
Sbjct  20   EESGWTQYFDDFSSDQ---------KEHDSSSYSNGSPSLVSD-------------AASP  57

Query  537  rvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEINP  358
              K +  CS+    QV RRLN+K  + + KY   DLEDTASSPVNSPK  + K  ++   
Sbjct  58   NKKESGPCSAFSDQQVPRRLNVKKQR-TKKYSCDDLEDTASSPVNSPKVSSLK-PMDSTY  115

Query  357  RRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPLSLL  178
            R+T  ++ N+LGKES     + + +   +ERSSINFDGK +   ++LKK+GLCLMP S++
Sbjct  116  RKTDESIGNFLGKES-----RPVALHQSDERSSINFDGK-NNGYVELKKKGLCLMPFSMV  169

Query  177  VNY  169
            ++Y
Sbjct  170  LHY  172



>ref|XP_009772102.1| PREDICTED: uncharacterized protein LOC104222558 [Nicotiana sylvestris]
Length=185

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 117/185 (63%), Gaps = 19/185 (10%)
 Frame = -2

Query  720  QEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdf  541
            QEESGWT YL+DFS       ++S         S   SPSL+SDAA++A   K  ++++ 
Sbjct  17   QEESGWTTYLEDFSMENNNRENNS---------SCFGSPSLLSDAASHAVAWKNCNTNNQ  67

Query  540  rrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEIN  361
                 N+  S +GGS  L+RLNLK PK + K  DPDLEDTASSPVNSPK  +FK Q++IN
Sbjct  68   VL---NSYNSPMGGSPFLKRLNLKKPK-NKKISDPDLEDTASSPVNSPKVSSFK-QMDIN  122

Query  360  PRRTQNNVLNYLGK-ESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPLS  184
             +R  N+  N+LG  E G    QEM      ER+++ FDGK +   +DLKK+GLCL+PLS
Sbjct  123  YQRADNSSGNFLGNIEGGSMQHQEM---QTVERNNVCFDGK-NNSYMDLKKKGLCLVPLS  178

Query  183  LLVNY  169
            +LV Y
Sbjct  179  MLVKY  183



>ref|XP_006352039.1| PREDICTED: transcription initiation factor TFIID subunit 1-like 
[Solanum tuberosum]
Length=191

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 107/192 (56%), Gaps = 38/192 (20%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSP---SLVSDaatyaa--rrk  562
            EQQEESGWT YL+DFS   +M +      +E+YD     SP   SL+SDAA+  A     
Sbjct  32   EQQEESGWTTYLEDFS---LMNNQ-----RENYDDDDNFSPNNYSLLSDAASNIAPWNNN  83

Query  561  kksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTF  382
               + ++ ++  N E S        ++LNLK    + K  DPDLEDTASSPVNSPK    
Sbjct  84   NYCNINYNKLVMNDEYSP-------KKLNLKKLPRNKKINDPDLEDTASSPVNSPK----  132

Query  381  KQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGL  202
              ++EIN RRT+N+  N++G E     FQE+               K+     DLKK+GL
Sbjct  133  VSKMEINYRRTKNSTGNFMGNEGSSRQFQEV--------------HKVERGYTDLKKKGL  178

Query  201  CLMPLSLLVNYH  166
            CL+PLS+LVNYH
Sbjct  179  CLVPLSMLVNYH  190



>ref|XP_009794413.1| PREDICTED: uncharacterized protein LOC104241195 [Nicotiana sylvestris]
Length=180

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 110/184 (60%), Gaps = 20/184 (11%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdfr  538
            EESGWT YL+DFS  +   +SS  S+          SPSL+SDAA++AA     ++++  
Sbjct  16   EESGWTTYLEDFSMKQRENNSSCNSDS-------FGSPSLLSDAASHAAWNINCNTNNN-  67

Query  537  rvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEINP  358
                 +    +GGS    +      K + K  DPDLEDTASSPVNSPK  +FK Q++IN 
Sbjct  68   -----SCSPPMGGSP-FLKRLKMKKKRNKKISDPDLEDTASSPVNSPKVSSFK-QMDIN-  119

Query  357  RRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPLSLL  178
             RT+N+   +LG E G    QEM      ER+S +FDGK +   I+LKK+GLCL+P S++
Sbjct  120  YRTENSSGYFLGNEGGSRQIQEM---QTVERNSTSFDGK-NNGYIELKKKGLCLVPWSMI  175

Query  177  VNYH  166
            VN+H
Sbjct  176  VNHH  179



>ref|XP_008230080.1| PREDICTED: uncharacterized protein LOC103329395 isoform X1 [Prunus 
mume]
Length=205

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 106/190 (56%), Gaps = 17/190 (9%)
 Frame = -2

Query  720  QEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCS-IVSSPSLVSDaatyaarrkkksssd  544
            +EESGWTAY +DFS N         + +E   CS    + SLVSDAA+ AA +    ++ 
Sbjct  25   EEESGWTAYFEDFSNNNNNRREGEAAAEEQSLCSSFGCASSLVSDAASGAAWKLASQNNQ  84

Query  543  frrvKNNTECS-SLGGS--QVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQ  373
                 N   CS S+GGS     ++L  K  + + K    DLEDTASSPVNSPK     + 
Sbjct  85   -----NQHTCSNSIGGSPNNFPKKLTFKKTR-TKKISGDDLEDTASSPVNSPKIGDHLRP  138

Query  372  VEINPRRTQNNVLNY--LGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLC  199
            V INPR+  ++ +N   LGKE   E F E+    + E+++   D    T+  DLKKRGLC
Sbjct  139  VGINPRKIDDHHININSLGKEG--EHFAELEQADDHEKTN---DCCGKTDSTDLKKRGLC  193

Query  198  LMPLSLLVNY  169
            L+P+SLL NY
Sbjct  194  LVPMSLLANY  203



>ref|XP_010313670.1| PREDICTED: uncharacterized protein LOC101247402 isoform X1 [Solanum 
lycopersicum]
Length=174

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 106/189 (56%), Gaps = 32/189 (17%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaa--rrkkks  553
            EQQEESGWT YL+DFS   +M +   Y +  D      +S SL+SDAA+  A        
Sbjct  15   EQQEESGWTTYLEDFS---LMNNQRDYDDDNDDFSP--NSYSLLSDAASNIAPWNNNNYC  69

Query  552  ssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQ  373
            + ++ ++  N E S        ++LNLK    + K  DPDLEDTASSPVNSPK      +
Sbjct  70   NINYNKLVMNDEYSP-------KKLNLKKLPRNKKINDPDLEDTASSPVNSPK----VSK  118

Query  372  VEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLM  193
            +EIN RRT+N+  N++G E   + FQE+               K+     DLKK+GLCL+
Sbjct  119  MEINYRRTKNSTGNFMGNEGSSKQFQEV--------------HKVERGYTDLKKKGLCLV  164

Query  192  PLSLLVNYH  166
            PLS+LVNYH
Sbjct  165  PLSMLVNYH  173



>ref|XP_011005117.1| PREDICTED: uncharacterized protein LOC105111456 [Populus euphratica]
Length=185

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 101/193 (52%), Gaps = 28/193 (15%)
 Frame = -2

Query  735  VGREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYD-CS-IVSSPSLVSDaatyaarrk  562
            V     EESGWT+Y +DFS +K          +ED+  CS    S S+VSDAA++   + 
Sbjct  15   VSVSPAEESGWTSYFEDFSNHK----------EEDHSLCSSTFDSSSMVSDAASFPPWKS  64

Query  561  kksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTF  382
                           CSS+ G  + + L  K  +  +   D  LEDTASSPVNSPK R  
Sbjct  65   SHV----------VACSSINGG-LPKELTFKKTRAKEISLDDSLEDTASSPVNSPKVRDM  113

Query  381  KQQVEINPRRTQNNVLNY-LGKESGFEGFQEMVMGAE-EERSSINFDGKISTECIDLKKR  208
            +  +E NP +T +   N  LG + G  G ++   G E  ER  I F      +CIDLKKR
Sbjct  114  RPILE-NPTKTNDQYFNSSLGNKEG-SGLEQCAGGLETSERCEIIFSSG-RNDCIDLKKR  170

Query  207  GLCLMPLSLLVNY  169
            GLCL+PLS+LVNY
Sbjct  171  GLCLVPLSMLVNY  183



>ref|XP_007215977.1| hypothetical protein PRUPE_ppa011622mg [Prunus persica]
 gb|EMJ17176.1| hypothetical protein PRUPE_ppa011622mg [Prunus persica]
Length=203

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 106/190 (56%), Gaps = 18/190 (9%)
 Frame = -2

Query  720  QEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCS-IVSSPSLVSDaatyaarrkkksssd  544
            +EESGWTAY +DFS N         + +E   CS    + SLVSDAA+ AA +    ++ 
Sbjct  24   EEESGWTAYFEDFSNNNNNNREGEAAAEEQSLCSSFGCTSSLVSDAASGAAWKLASQNNQ  83

Query  543  frrvKNNTECS-SLGGS--QVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQ  373
                 N   CS S+GGS     ++L  K  + + K    DLEDTASSPVNSPK    +  
Sbjct  84   -----NQHACSNSIGGSPNNFPKKLTFKKTR-TKKISGDDLEDTASSPVNSPKIGDLRP-  136

Query  372  VEINPRRTQNNVLNY--LGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLC  199
            V INPR+  ++ +N   LGKE   E F E+    + E+++   D    T+  DLKKRGLC
Sbjct  137  VGINPRKIDDHHININSLGKEG--EHFAELEQADDHEKTN---DCCGKTDSTDLKKRGLC  191

Query  198  LMPLSLLVNY  169
            L+P+SLL NY
Sbjct  192  LVPMSLLANY  201



>ref|XP_006367279.1| PREDICTED: adenylate cyclase, aggregation specific-like isoform 
X2 [Solanum tuberosum]
Length=156

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 98/188 (52%), Gaps = 50/188 (27%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksss  547
            + QEESGWT YL+DFS    M   ++ S    Y C    SPSL+SDAA++A      +++
Sbjct  15   DAQEESGWTTYLEDFS----MEQHNNNSENSTY-CDSFGSPSLLSDAASHAVWNNCNNNN  69

Query  546  dfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVE  367
                           GS  L+RLNLK P+ + K  DPDLEDTASSPVNSPK         
Sbjct  70   Y--------------GSPFLKRLNLKKPR-NKKISDPDLEDTASSPVNSPK---------  105

Query  366  INPRRTQNNVLNYLGKESGFEGF--QEMVMGAEEERSSINFDGKISTECIDLKKRGLCLM  193
                              GFEG   Q+  M   E  S++ FD K +   +DL+K+GLCL+
Sbjct  106  ------------------GFEGGSRQQQEMETIERNSTVCFDEK-NKSYMDLEKKGLCLV  146

Query  192  PLSLLVNY  169
            PLS+LVNY
Sbjct  147  PLSMLVNY  154



>ref|XP_010109518.1| hypothetical protein L484_018253 [Morus notabilis]
 gb|EXC23122.1| hypothetical protein L484_018253 [Morus notabilis]
Length=194

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 110/190 (58%), Gaps = 22/190 (12%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMGSSSSYSNQ-------EDYDCSIVSSPSLVSDaatyaarrkk  559
            EESGWTAY QDFS N    ++++ ++        E+  C+ +SS SLVSDAA+YAA +  
Sbjct  18   EESGWTAYFQDFSNNINNDNNNNNADDDEDDNIVEESFCTNISS-SLVSDAASYAAWKLS  76

Query  558  ksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFK  379
             +        ++ E          ++L+ K  +  +   D  LEDTASSPVNSPK    K
Sbjct  77   PTRRKNSPQHHHHETP--------KKLSFKKTRAKEISQDDSLEDTASSPVNSPKVGDLK  128

Query  378  QQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLC  199
              V++  ++  + + + LGK    E + E+     EER +++F+G+   +C+DLKKRGLC
Sbjct  129  A-VDMKAKQRDDLIDDSLGKRGTSEYYSEL---QPEERRTVDFNGE--NDCLDLKKRGLC  182

Query  198  LMPLSLLVNY  169
            L+PLS+LVNY
Sbjct  183  LVPLSMLVNY  192



>ref|XP_009602750.1| PREDICTED: uncharacterized protein LOC104097836 [Nicotiana tomentosiformis]
Length=224

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 95/187 (51%), Gaps = 42/187 (22%)
 Frame = -2

Query  738  FVGREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkk  559
            F     QEESGWT YL DFS   +M    + S+  + D     +PSL+SD          
Sbjct  13   FEAATNQEESGWTTYLDDFS---LMNQRENRSSNSEDDS--FGNPSLLSD----------  57

Query  558  ksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFK  379
                                +  ++RLNLK P+ + K  DPDLEDTASSPVNSPK  +FK
Sbjct  58   -------------------AASHVKRLNLKKPR-NKKISDPDLEDTASSPVNSPKVSSFK  97

Query  378  QQVEINPRRTQNNVLNYLGKE-SGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGL  202
             Q++IN RRT+NN  N+LG E S  +  QEM     E   SI+F+    T   DLKK+G 
Sbjct  98   -QMDINYRRTENNSGNFLGNEGSSRQIIQEMQ--NVERGHSISFENNGYT---DLKKKGX  151

Query  201  CLMPLSL  181
             +  L L
Sbjct  152  FMAFLHL  158



>ref|XP_002301629.1| hypothetical protein POPTR_0002s23090g [Populus trichocarpa]
 gb|EEE80902.1| hypothetical protein POPTR_0002s23090g [Populus trichocarpa]
Length=192

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 96/201 (48%), Gaps = 31/201 (15%)
 Frame = -2

Query  744  KSFVGREQ------QEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSS-PSLVSDa  586
            K+ VG ++       EESGWT+Y +D S +K  G S   S       S  +S P   S  
Sbjct  12   KAVVGSKETTVSDPAEESGWTSYFEDLSNHKEEGQSLCSSFDSSSMVSDAASFPPWKSSQ  71

Query  585  atyaarrkkksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPV  406
              +                    CSS G   +  +L  K  +  +   D  LEDTASSPV
Sbjct  72   TNHV-----------------VACSSFGA--LPEKLTSKKTRAEEISLDDSLEDTASSPV  112

Query  405  NSPKDRTFKQQVEINPRRTQNNVLNY-LGKESGFEGFQEMVMGAE-EERSSINFDGKIST  232
            NSPK    +Q V +NPR+T +   N  LG      G ++   G E  ER  +NF   +  
Sbjct  113  NSPKVSDLRQIV-MNPRKTNDRYFNSSLGNIESI-GLEQHAEGLETSERCEMNF-STVKN  169

Query  231  ECIDLKKRGLCLMPLSLLVNY  169
            +CIDLKKRGLCL+P S+LVNY
Sbjct  170  DCIDLKKRGLCLVPSSMLVNY  190



>ref|XP_011079014.1| PREDICTED: uncharacterized protein LOC105162633 [Sesamum indicum]
Length=185

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 101/193 (52%), Gaps = 45/193 (23%)
 Frame = -2

Query  720  QEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdf  541
             EESGWTAYL+DFS           SN   +   I SSPSLVSDAA              
Sbjct  27   HEESGWTAYLEDFS----------CSNNGSF---ISSSPSLVSDAAW-------------  60

Query  540  rrvKNNTECSSLGGSQVLRRLNLKNPKPSDKY--------YDPDLEDTASSPVNSPKDRT  385
                N ++ ++   +  +RRLN KN K    +         + DLEDTASSPVNSPK  +
Sbjct  61   ----NGSDTTNNNVANHVRRLNFKNLKKGSNHKRYSCRDDDNDDLEDTASSPVNSPKVSS  116

Query  384  FKQQVEINPRRTQN-NVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKR  208
             K ++E+N RR  +    N+LGK   +    E+    E E+ ++      ST+ I+L+KR
Sbjct  117  LK-EMEVNYRRLDDVAAANFLGKGGRWNNMSEVGGVEENEKEAVE-----STKIIELRKR  170

Query  207  GLCLMPLSLLVNY  169
            GLCL+P+S L+NY
Sbjct  171  GLCLVPMSALMNY  183



>ref|XP_010689672.1| PREDICTED: uncharacterized protein LOC104903343 [Beta vulgaris 
subsp. vulgaris]
Length=233

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 103/189 (54%), Gaps = 14/189 (7%)
 Frame = -2

Query  717  EESGWTAYLQDFSE-NKMMGSSSSYSNQEDYDC--SIVSSPSLVSDaatyaarrkkksss  547
            EESGWT Y++DFS  NK  G  +   N     C  S VS+ S+VSDA +    +KK  ++
Sbjct  51   EESGWTQYVEDFSAYNKEGGVYTQQENHSYSGCCSSFVSTASMVSDAGSGPEWKKKNINN  110

Query  546  dfrrvKNNTECSSLGG-SQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQV  370
                      CSS+G    + +RLN KN +  +  +D  LEDTASSPVNSPK     +++
Sbjct  111  LASAAV----CSSIGVLPNMPKRLNFKNKRAQEIPFDDSLEDTASSPVNSPKITMCFKRM  166

Query  369  EINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKI--STECIDLKKRGLCL  196
            +IN R+  N+  +++  +   +   E     ++  S +N +       E IDLKKRGL L
Sbjct  167  DINSRKMDNDSGSHMANKISIDQHVEY----DDINSELNLNNSFHNHIEYIDLKKRGLRL  222

Query  195  MPLSLLVNY  169
            +P+S++ +Y
Sbjct  223  VPISMITSY  231



>ref|XP_011042803.1| PREDICTED: uncharacterized protein LOC105138435 isoform X1 [Populus 
euphratica]
Length=191

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 100/202 (50%), Gaps = 27/202 (13%)
 Frame = -2

Query  756  SLYEKSFVGREQ-----QEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVS  592
            S+Y K+ VG ++      EESGWT+Y +D S +K          +ED       S     
Sbjct  9    SIY-KAVVGSKETTVSPAEESGWTSYFEDLSNHK----------EED------QSLCSSF  51

Query  591  DaatyaarrkkksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASS  412
            D+++  +           +  +   CSS G   +  +L  K  +  +   D  LEDTASS
Sbjct  52   DSSSMVSDAASFPPWKSSQTNHVVACSSFGA--LPEKLTSKKTRAKEISLDDSLEDTASS  109

Query  411  PVNSPKDRTFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAE-EERSSINFDGKIS  235
            PVNSPK    +Q +++NPR+T +   N         G ++   G E  ER  +NF   + 
Sbjct  110  PVNSPKVSDLRQ-IDMNPRKTNDRYFNSSLGNIESSGLEQHAEGLETSERCEMNF-STVK  167

Query  234  TECIDLKKRGLCLMPLSLLVNY  169
             +CIDLKKRGLCL+P S+LVNY
Sbjct  168  NDCIDLKKRGLCLVPSSVLVNY  189



>ref|XP_008379625.1| PREDICTED: uncharacterized protein LOC103442596 [Malus domestica]
Length=194

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 73/198 (37%), Positives = 103/198 (52%), Gaps = 43/198 (22%)
 Frame = -2

Query  720  QEESGWTAYLQDFSEN---------KMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaar  568
            +EESGWTAY +DFS N         K  G + S+            + SLVSDAA+ AA 
Sbjct  24   EEESGWTAYFEDFSNNNNKRKEEEEKQGGGAQSFG----------YTSSLVSDAASGAAW  73

Query  567  rkkksssdfrrvKNNTECSSLG--GSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPK  394
            +    +       N +   S+G   +   R+L+ K  + + K    DLEDTASSPVNSPK
Sbjct  74   KLASHN-------NQSNEGSIGVPPNNFPRKLSFKKTR-TKKISGDDLEDTASSPVNSPK  125

Query  393  DRTFKQQVEINPRRTQNNVLNY--LGKE-SGFEGFQEMVMGAEEERSSINFDGKISTECI  223
                +  V+INPR+  ++ +N   LG E +  E F E+    +E+          S++C 
Sbjct  126  IGDLRP-VDINPRKIDDHHMNMNSLGNEGTXVEHFAEIEQAHDEK----------SSDCT  174

Query  222  DLKKRGLCLMPLSLLVNY  169
            DLK +GLCL+P+S LVNY
Sbjct  175  DLKNKGLCLVPMSWLVNY  192



>ref|XP_002321121.1| hypothetical protein POPTR_0014s15000g [Populus trichocarpa]
 gb|EEE99436.1| hypothetical protein POPTR_0014s15000g [Populus trichocarpa]
Length=162

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 94/193 (49%), Gaps = 51/193 (26%)
 Frame = -2

Query  735  VGREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYD-CSIV-SSPSLVSDaatyaarrk  562
            V     EESGWT+Y +DFS +K          +ED+  CSI   S S+VSDAA++   + 
Sbjct  15   VSVSPAEESGWTSYFEDFSNHK----------EEDHSLCSITFDSSSMVSDAASFPPWKS  64

Query  561  kksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTF  382
                       +   CSS+ G  + + L  K  +  +   D  LEDTASSPVNSPK    
Sbjct  65   S----------HAVACSSINGG-LPKELTFKKTRAKEISLDDSLEDTASSPVNSPK----  109

Query  381  KQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAE-EERSSINFD-GKISTECIDLKKR  208
                               G + G  G ++   G E  ER  I F  GK   +CIDLKKR
Sbjct  110  -------------------GNKEG-SGLEQYAEGLETSERCEIIFSSGK--NDCIDLKKR  147

Query  207  GLCLMPLSLLVNY  169
            GLCL+PLS+LVNY
Sbjct  148  GLCLVPLSMLVNY  160



>ref|XP_002279003.1| PREDICTED: uncharacterized protein LOC100258838 [Vitis vinifera]
Length=185

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 95/186 (51%), Gaps = 22/186 (12%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksss  547
            E  EESGWT Y +DF  NK   SS S  N         SS SLVSDAA+ A ++      
Sbjct  20   ESPEESGWTMYFEDFLANKEHSSSPSAGNYGRASYGYGSS-SLVSDAASSAGKKLV----  74

Query  546  dfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVE  367
                  +N   + L   +  ++L+ K  K      D  LEDTASSPV SPK    +Q ++
Sbjct  75   ------DNDHVAVLSLEKRCKKLSFKKRKTKGAVVDDALEDTASSPVTSPKVFDLRQ-LD  127

Query  366  INPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPL  187
            +NP+    ++     KE G    Q    G E     + F G+ S +C +LKKRGLCL+PL
Sbjct  128  MNPKEKAIDI----SKEKGSSYRQTNERGDE-----VGFIGRDS-DCTELKKRGLCLVPL  177

Query  186  SLLVNY  169
            S++V+Y
Sbjct  178  SMIVDY  183



>ref|XP_002524169.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38184.1| conserved hypothetical protein [Ricinus communis]
Length=198

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 93/183 (51%), Gaps = 15/183 (8%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdfr  538
            EESGWTAY +DFS  +        S           + S+VSDAA+  A  K  +S    
Sbjct  29   EESGWTAYFEDFSNQRRDDDDDGDS---------FGTSSMVSDAASIPAWNKSTTSPHHS  79

Query  537  rvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEINP  358
                  + SS       ++L  K  +  +  YD  LEDTASSPVNSPK   F    + NP
Sbjct  80   NHVVVADASSCS-PNFPKKLTFKKIRAKEISYDDSLEDTASSPVNSPKVSDF-GMADRNP  137

Query  357  RRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPLSLL  178
            R+T ++  + L K    E +  ++     ER  +++ G  + +  DLKKRGLCL+PLS+L
Sbjct  138  RKTNDHFNSSLRKGGRLEHYGGVL--ETNERCEMSYTG--NNDRTDLKKRGLCLVPLSML  193

Query  177  VNY  169
            VNY
Sbjct  194  VNY  196



>emb|CBI23945.3| unnamed protein product [Vitis vinifera]
Length=240

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 95/186 (51%), Gaps = 22/186 (12%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksss  547
            E  EESGWT Y +DF  NK   SS S  N         SS SLVSDAA+ A ++      
Sbjct  75   ESPEESGWTMYFEDFLANKEHSSSPSAGNYGRASYGYGSS-SLVSDAASSAGKKLV----  129

Query  546  dfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVE  367
                  +N   + L   +  ++L+ K  K      D  LEDTASSPV SPK    +Q ++
Sbjct  130  ------DNDHVAVLSLEKRCKKLSFKKRKTKGAVVDDALEDTASSPVTSPKVFDLRQ-LD  182

Query  366  INPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPL  187
            +NP+    ++     KE G    Q    G E     + F G+ S +C +LKKRGLCL+PL
Sbjct  183  MNPKEKAIDI----SKEKGSSYRQTNERGDE-----VGFIGRDS-DCTELKKRGLCLVPL  232

Query  186  SLLVNY  169
            S++V+Y
Sbjct  233  SMIVDY  238



>gb|KDP25843.1| hypothetical protein JCGZ_22873 [Jatropha curcas]
Length=219

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 90/201 (45%), Gaps = 28/201 (14%)
 Frame = -2

Query  720  QEESGWTAYLQDFSENK-------------MMGSSSSYSNQEDYDCSIVSSPSLVSDaat  580
            +EESGWTAY +DFS ++               GSSS  S+   +     SSPS       
Sbjct  28   EEESGWTAYFEDFSNHREEEGEEDSFCNSGFFGSSSMVSDAASFPAWKSSSPSNNQHHHH  87

Query  579  yaarrkkksssdfrrvKNNTECSSLGGSQVL-RRLNLKNPKPSD--KYYDPDLEDTASSP  409
                                 CSS+  S  L  +LN K    +     +D  LEDTASSP
Sbjct  88   NYNNHVVF-----------ASCSSIEPSPKLPNKLNFKKTSRAKGISLHDDSLEDTASSP  136

Query  408  VNSPKDRTFKQQVE-INPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKIST  232
            VNSPK   F    + INPR+  ++  + LGK    E +++ +    E           + 
Sbjct  137  VNSPKVSYFGPTSDHINPRKPNDHFNSSLGKGGILEHYEQELETENERCEMNCSSSSNNN  196

Query  231  ECIDLKKRGLCLMPLSLLVNY  169
               DLKKRGLCL+PLS+LVNY
Sbjct  197  HRTDLKKRGLCLVPLSMLVNY  217



>ref|XP_003540843.1| PREDICTED: uncharacterized protein LOC100804712 [Glycine max]
 gb|KHN21246.1| hypothetical protein glysoja_006725 [Glycine soja]
Length=185

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 95/185 (51%), Gaps = 28/185 (15%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdfr  538
            EESGWT+YL+DFS+    G   SY +  D    +  + S  +                ++
Sbjct  25   EESGWTSYLEDFSK----GIEPSYCSSLDGSSLLSDAASCAA----------------WK  64

Query  537  rvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEINP  358
                N + S+     + ++L+ K  +      D  LEDTASSPVNSPK R      E++ 
Sbjct  65   FSHQNFKVST--APNLPKKLSFKKARAKQISEDDPLEDTASSPVNSPKVRDL-NPAEMSS  121

Query  357  RRTQNNVLNYLGKE--SGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPLS  184
            R+  + +   LGKE  +  E + ++ M   E    + F+GK + +C DLKKRGLCL+PLS
Sbjct  122  RKVDDQLEASLGKEFITSSEHYSDLKMDDNEHE--LKFNGK-NIDCTDLKKRGLCLVPLS  178

Query  183  LLVNY  169
            LLVNY
Sbjct  179  LLVNY  183



>ref|XP_003526319.1| PREDICTED: uncharacterized protein LOC100786184 [Glycine max]
 gb|KHN41206.1| hypothetical protein glysoja_017250 [Glycine soja]
Length=185

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 95/185 (51%), Gaps = 28/185 (15%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdfr  538
            EESGWT+YL+DFS+    G   SY +  D    +  + S  +                ++
Sbjct  25   EESGWTSYLEDFSK----GIEPSYCSSLDGSSLLSDAASCAA----------------WK  64

Query  537  rvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEINP  358
                N + S+     + ++L+ K  +      D  LEDTASSPVNSPK R      E++ 
Sbjct  65   FSHQNFKVST--APNLPKKLSFKKARAKQISEDDPLEDTASSPVNSPKVRDL-NPAEMSS  121

Query  357  RRTQNNVLNYLGKE--SGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPLS  184
            R+  + +   +GKE  +  E + ++ M   E    + F+GK + +C DLKKRGLCL+PLS
Sbjct  122  RKVDDQLEGSMGKEFITSSEHYSDLKMDDNEHE--LKFNGK-NIDCTDLKKRGLCLVPLS  178

Query  183  LLVNY  169
            LLVNY
Sbjct  179  LLVNY  183



>ref|XP_009353263.1| PREDICTED: uncharacterized protein LOC103944521 [Pyrus x bretschneideri]
Length=200

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 102/194 (53%), Gaps = 29/194 (15%)
 Frame = -2

Query  720  QEESGWTAYLQDFSENKMMGSSSSYSNQEDYDC-----SIVSSPSLVSDaatyaarrkkk  556
            +EESGWTAY +DFS N           +++        S   + SLVSDAA+ AA +   
Sbjct  24   EEESGWTAYFEDFSNNNNKRKEEQEQEEQEEQEGGGAQSFGYTSSLVSDAASGAAWKLAS  83

Query  555  sssdfrrvKNNTECSSLG--GSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTF  382
             +       N +  +S+G   +   R+L+ K  + + K    DLEDTASSPVNSPK    
Sbjct  84   HN-------NQSNAASIGEPPNNFPRKLSFKKTR-TKKISGDDLEDTASSPVNSPKIGDL  135

Query  381  KQQVEINPRRTQNNVLNY--LGKE-SGFEGFQEMVMGAEEERSSINFDGKISTECIDLKK  211
            +  V+INPR+  ++ +N   LG E +  E F E+    +E+          S++C DLK 
Sbjct  136  RP-VDINPRKIDDHHMNMNSLGNEGTTVEHFAEIEQTHDEK----------SSDCTDLKN  184

Query  210  RGLCLMPLSLLVNY  169
            +G CL+P+S LVNY
Sbjct  185  KGFCLVPMSWLVNY  198



>ref|XP_008230081.1| PREDICTED: uncharacterized protein LOC103329395 isoform X2 [Prunus 
mume]
Length=180

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 94/187 (50%), Gaps = 36/187 (19%)
 Frame = -2

Query  720  QEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCS-IVSSPSLVSDaatyaarrkkksssd  544
            +EESGWTAY +DFS N         + +E   CS    + SLVSDAA+ AA +    ++ 
Sbjct  25   EEESGWTAYFEDFSNNNNNRREGEAAAEEQSLCSSFGCASSLVSDAASGAAWKLASQNNQ  84

Query  543  frrvKNNTECSSLGGS--QVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQV  370
             +   +N    S+GGS     ++L  K  + + K    DLEDTASSPVNSPK        
Sbjct  85   NQHTCSN----SIGGSPNNFPKKLTFKKTR-TKKISGDDLEDTASSPVNSPK--------  131

Query  369  EINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMP  190
                           GKE   E F E+    + E+++   D    T+  DLKKRGLCL+P
Sbjct  132  ---------------GKEG--EHFAELEQADDHEKTN---DCCGKTDSTDLKKRGLCLVP  171

Query  189  LSLLVNY  169
            +SLL NY
Sbjct  172  MSLLANY  178



>ref|XP_004289159.1| PREDICTED: uncharacterized protein LOC101296524 [Fragaria vesca 
subsp. vesca]
Length=173

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 90/194 (46%), Gaps = 58/194 (30%)
 Frame = -2

Query  723  QQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssd  544
            ++EESGWT Y +DFS N     +S         CS     SLVSD               
Sbjct  27   EEEESGWTKYFEDFSNNNRQEQASF--------CS-----SLVSD---------------  58

Query  543  frrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYY-------DPDLEDTASSPVNSPKDRT  385
                           S    R++  N  P            D DLEDTASSPVNSPK   
Sbjct  59   -------------ASSGAAWRVSHNNSVPKKLKKTRTKKIGDHDLEDTASSPVNSPKIGD  105

Query  384  FKQQVEINPRRTQNNVLNY--LGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKK  211
            F+    +NPR+ +++ +N   LGKE     F EM    + + +S +  GK + +  DLKK
Sbjct  106  FRPVDHMNPRKIEDHRININSLGKEH----FAEM---KQADENSSDCSGK-NGQNTDLKK  157

Query  210  RGLCLMPLSLLVNY  169
            +GLCL+PL+LLVNY
Sbjct  158  KGLCLVPLNLLVNY  171



>ref|NP_001235571.1| uncharacterized protein LOC100306218 [Glycine max]
 gb|ACU14292.1| unknown [Glycine max]
 gb|KHN36541.1| hypothetical protein glysoja_001272 [Glycine soja]
Length=178

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 96/191 (50%), Gaps = 27/191 (14%)
 Frame = -2

Query  735  VGREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkk  556
            V     EESGWT+Y ++FS+            Q+ Y CS +   SLVSDAA+ AA +   
Sbjct  13   VSGSANEESGWTSYFEEFSKGM---------EQQSY-CSNLGGSSLVSDAASCAAWKLSH  62

Query  555  sssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQ  376
             +       NN        + V ++L  K  +      D  LEDTASSPVNSPK    K 
Sbjct  63   HNHLVSHPSNN--------NVVSKKLRFKKTRTQQISDDDPLEDTASSPVNSPKVGVLKV  114

Query  375  QVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTEC-IDLKKRGLC  199
              +I+    Q +     GKE   E   ++    + +   INF+G  + EC  +LKK+GLC
Sbjct  115  SSKID---NQLDGCTSRGKEFNSEHHPKL----QADECDINFNGN-NIECNTNLKKKGLC  166

Query  198  LMPLSLLVNYH  166
            L+PLS+LVNY+
Sbjct  167  LVPLSMLVNYY  177



>ref|XP_010051082.1| PREDICTED: uncharacterized protein LOC104439759 [Eucalyptus grandis]
Length=185

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 97/191 (51%), Gaps = 35/191 (18%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdfr  538
            EESGWT YLQDFS N         ++ ED  CS   + SLVSDAA+YA  R   +++   
Sbjct  21   EESGWTTYLQDFSRN---------NDGEDSFCSGFGTSSLVSDAASYAIDRNAAAAAAE-  70

Query  537  rvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPD-LEDTASSPVNSPKDRTFKQQVEIN  361
                          +  RRL+      + +  D D L+DTA+SPVNSPK    K+   I 
Sbjct  71   -------------PKAPRRLSTIKRMRTREITDEDPLQDTATSPVNSPKISHLKRVEMIG  117

Query  360  PRRTQNNVLNYLGKESGFEGFQEMVMGA------EEERSSINFDGKISTECIDLKKRGLC  199
             R T +++   LG  SG  G  E  MG       E E+     DG+ + EC  L+KRGLC
Sbjct  118  TRMTDDSLNLSLG--SG--GASESCMGLKARESNENEKMMYGTDGQ-NYECSSLRKRGLC  172

Query  198  LMPLSLLVNYH  166
            L+PLS+ +NY 
Sbjct  173  LVPLSMFMNYQ  183



>ref|XP_007132562.1| hypothetical protein PHAVU_011G105200g [Phaseolus vulgaris]
 gb|ESW04556.1| hypothetical protein PHAVU_011G105200g [Phaseolus vulgaris]
Length=193

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 94/201 (47%), Gaps = 53/201 (26%)
 Frame = -2

Query  714  ESGWTAYLQDFSENKMMGSSSSYSNQ------------------EDYDCSIVSSPSLVSD  589
            ESGWT+Y +DFS+    G   SY +                     ++  ++SSPS    
Sbjct  25   ESGWTSYFEDFSK----GIEPSYCSSLDGSSLLSDAASSAAWKFSHHNHHLLSSPSF---  77

Query  588  aatyaarrkkksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSP  409
                                +NT   +L      ++L  K  +      D  LEDTASSP
Sbjct  78   ------------------KGSNTTAPNLP-----KKLTFKKARAKQISEDDPLEDTASSP  114

Query  408  VNSPKDRTFKQQVEINPRRTQNNVLNYLGKE-SGFEGFQEMVMGAEEERSSINFDGKIST  232
            VNSPK R      EI+ R+  + +   +GKE +  E + ++    E+ +  + F+GK + 
Sbjct  115  VNSPKVRDL-NPAEISSRKDDDQLEGSMGKEFTSSEHYSDLK--TEDNKHELKFNGK-NV  170

Query  231  ECIDLKKRGLCLMPLSLLVNY  169
            +C DLKKRGLCL+PLSLLVNY
Sbjct  171  DCSDLKKRGLCLVPLSLLVNY  191



>gb|KCW89418.1| hypothetical protein EUGRSUZ_A01716 [Eucalyptus grandis]
Length=228

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 96/191 (50%), Gaps = 35/191 (18%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdfr  538
            EESGWT YLQDFS N         ++ ED  CS   + SLVSDAA+YA            
Sbjct  64   EESGWTTYLQDFSRN---------NDGEDSFCSGFGTSSLVSDAASYAI-----------  103

Query  537  rvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPD-LEDTASSPVNSPKDRTFKQQVEIN  361
               +    ++    +  RRL+      + +  D D L+DTA+SPVNSPK    K+   I 
Sbjct  104  ---DRNAAAAAAEPKAPRRLSTIKRMRTREITDEDPLQDTATSPVNSPKISHLKRVEMIG  160

Query  360  PRRTQNNVLNYLGKESGFEGFQEMVMGA------EEERSSINFDGKISTECIDLKKRGLC  199
             R T +++   LG  SG  G  E  MG       E E+     DG+ + EC  L+KRGLC
Sbjct  161  TRMTDDSLNLSLG--SG--GASESCMGLKARESNENEKMMYGTDGQ-NYECSSLRKRGLC  215

Query  198  LMPLSLLVNYH  166
            L+PLS+ +NY 
Sbjct  216  LVPLSMFMNYQ  226



>gb|EYU43115.1| hypothetical protein MIMGU_mgv1a022998mg, partial [Erythranthe 
guttata]
Length=144

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 66/114 (58%), Gaps = 9/114 (8%)
 Frame = -2

Query  489  LRRLNLKNPKPSD----KYYDPDLEDTASSPVNSPKDRTFKQQVEINPRRTQN-NVLNYL  325
            LR LN KN K +      Y + D EDTASSPVNSPK  + K Q+E+N RR  +    N+L
Sbjct  27   LRILNFKNLKRNKYRKYSYAEDDYEDTASSPVNSPKVSSMK-QMEVNYRRLDDLAAANFL  85

Query  324  GKESGFEGFQEMVM---GAEEERSSINFDGKISTECIDLKKRGLCLMPLSLLVN  172
            GK++G   F E+         + ++I     I  + +DL+ RGLCLMP+S L+N
Sbjct  86   GKQTGASNFSEVATEEKNGNNKNNAIESKNNIDHQFVDLRTRGLCLMPISALMN  139



>ref|XP_007045610.1| Melanoma inhibitory activity protein 3, putative [Theobroma cacao]
 gb|EOY01442.1| Melanoma inhibitory activity protein 3, putative [Theobroma cacao]
Length=262

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = -2

Query  441  DPDLEDTASSPVNSPKDRTFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERS  262
            D  LEDTASSPVNSPK     +  ++N R+ ++ + + LGKE+  E + E+     E+ S
Sbjct  174  DDSLEDTASSPVNSPKVSDLMKSNDMNLRKREDQIHSSLGKETASENYSEI---QNEKES  230

Query  261  SINFD-GKISTECIDLKKRGLCLMPLSLLVNY  169
              NFD GK    C +LKKRGLCL+PLS LVNY
Sbjct  231  KTNFDHGK--NNCTELKKRGLCLVPLSTLVNY  260



>ref|XP_004251513.1| PREDICTED: uncharacterized protein LOC101247402 isoform X2 [Solanum 
lycopersicum]
Length=155

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 71/189 (38%), Positives = 92/189 (49%), Gaps = 51/189 (27%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaa--rrkkks  553
            EQQEESGWT YL+DFS   +M +   Y +  D      +S SL+SDAA+  A        
Sbjct  15   EQQEESGWTTYLEDFS---LMNNQRDYDDDNDDFSP--NSYSLLSDAASNIAPWNNNNYC  69

Query  552  ssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQ  373
            + ++ ++  N E S        ++LNLK    + K  DPDLEDTASSPVNSPK       
Sbjct  70   NINYNKLVMNDEYSP-------KKLNLKKLPRNKKINDPDLEDTASSPVNSPK-------  115

Query  372  VEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLM  193
                            G E   + FQE+               K+     DLKK+GLCL+
Sbjct  116  ----------------GNEGSSKQFQEV--------------HKVERGYTDLKKKGLCLV  145

Query  192  PLSLLVNYH  166
            PLS+LVNYH
Sbjct  146  PLSMLVNYH  154



>ref|XP_006469700.1| PREDICTED: uncharacterized protein LOC102614405 isoform X2 [Citrus 
sinensis]
Length=163

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 76/138 (55%), Gaps = 24/138 (17%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYD-CSIVSSPSLVSDaatyaarrkkkss  550
            E +EESGWTAY +DFS + +        N+E+Y  CS   SPSLVSDAA+ AA +     
Sbjct  34   EPEEESGWTAYFEDFSNDNI--------NREEYSYCSSFGSPSLVSDAASCAAWKL----  81

Query  549  sdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQV  370
                   +N     +  S++ ++LN K P+      D  LEDTASSPVNSPK   F+   
Sbjct  82   -------SNKHRVDVATSKMPKKLNFKKPRARQICDDDSLEDTASSPVNSPKVSDFEPVD  134

Query  369  EINPRRTQNNVLNYLGKE  316
             +NPR+      +++GKE
Sbjct  135  HVNPRKPD----DHMGKE  148



>ref|XP_009135767.1| PREDICTED: uncharacterized protein LOC103859921 [Brassica rapa]
 emb|CDX92918.1| BnaA03g36400D [Brassica napus]
Length=213

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 98/194 (51%), Gaps = 31/194 (16%)
 Frame = -2

Query  723  QQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIV-SSPSLVSDaatyaarrkkksss  547
            QQEESGWT YL+DFS N+         +Q+   CSI+ +SPSLVSDAA            
Sbjct  38   QQEESGWTTYLEDFS-NQYRTHPEDNDHQDKSSCSILDASPSLVSDAA------------  84

Query  546  dfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYY--DPDLEDTASSPVNSPKDRTFKQQ  373
                    T+  S     V   + LK  K   K    D  LEDTASSPVNSPK     + 
Sbjct  85   --------TDAFSGRSFPVNFPVKLKFGKARTKKICEDDSLEDTASSPVNSPKVSQI-EH  135

Query  372  VEINPRRTQNNVLN--YLGKESGFEGFQEMVMGAEEERSSINFD----GKISTECIDLKK  211
            ++  PR+ ++ V +   +G  SG    Q  +   +E++ ++  +       ++  +DL+ 
Sbjct  136  IQTPPRKHEDYVSSSFVMGNMSGMGDHQIQIQEGDEQKLTMMRNLREGNNSNSNNMDLRA  195

Query  210  RGLCLMPLSLLVNY  169
            RGLC++P+S+L N+
Sbjct  196  RGLCVVPISMLGNF  209



>ref|XP_006593347.1| PREDICTED: uncharacterized protein LOC100306218 isoform X1 [Glycine 
max]
Length=158

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 90/191 (47%), Gaps = 47/191 (25%)
 Frame = -2

Query  735  VGREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkk  556
            V     EESGWT+Y ++FS+            Q+ Y CS +   SLVSDAA+ AA +   
Sbjct  13   VSGSANEESGWTSYFEEFSKGM---------EQQSY-CSNLGGSSLVSDAASCAAWKLSH  62

Query  555  sssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQ  376
             +       NN        + V ++L  K  +      D  LEDTASSPVNSPK + F  
Sbjct  63   HNHLVSHPSNN--------NVVSKKLRFKKTRTQQISDDDPLEDTASSPVNSPKGKEFNS  114

Query  375  QVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTEC-IDLKKRGLC  199
              E +P+                          + +   INF+G  + EC  +LKK+GLC
Sbjct  115  --EHHPK-------------------------LQADECDINFNGN-NIECNTNLKKKGLC  146

Query  198  LMPLSLLVNYH  166
            L+PLS+LVNY+
Sbjct  147  LVPLSMLVNYY  157



>ref|XP_002883315.1| hypothetical protein ARALYDRAFT_479695 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59574.1| hypothetical protein ARALYDRAFT_479695 [Arabidopsis lyrata subsp. 
lyrata]
Length=214

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 94/202 (47%), Gaps = 35/202 (17%)
 Frame = -2

Query  732  GREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIV-SSPSLVSDaatyaarrkkk  556
            G + QEESGWT YL DFS            +QE   CS++ +S SLVSDAA         
Sbjct  30   GGDHQEESGWTTYLDDFSNQYRTTHHEESDHQEKSSCSLLGASTSLVSDAA---------  80

Query  555  sssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYY--DPDLEDTASSPVNSPKDRTF  382
                       T   S     V    NLK  +   K    D  LEDTASSPVNSPK   F
Sbjct  81   -----------THAFSGKSFPVNFPANLKFGRGRTKKICEDDSLEDTASSPVNSPKVSQF  129

Query  381  KQQVEINPRRTQNNVLN--YLGKESGFEGFQEMVMGAEEERSSI---------NFDGKIS  235
             + ++  PR+ ++ V +   +G   G    Q  +   +E++ ++         N +   +
Sbjct  130  -EHIQTPPRKIEDYVSSSFVMGNIRGMRDHQIQIQEGDEQKMTLMRNLIEENNNNNNNNN  188

Query  234  TECIDLKKRGLCLMPLSLLVNY  169
               +DL+ RGLC++P+S+L N+
Sbjct  189  NNNMDLRSRGLCVVPISMLANF  210



>emb|CDY24256.1| BnaC03g42290D [Brassica napus]
Length=213

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 97/194 (50%), Gaps = 31/194 (16%)
 Frame = -2

Query  723  QQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIV-SSPSLVSDaatyaarrkkksss  547
            QQEESGWT YL+DFS N+         +Q+   CSI+ +SPSLVSDAA            
Sbjct  38   QQEESGWTTYLEDFS-NQYRTHPEDNDHQDKSSCSILDASPSLVSDAA------------  84

Query  546  dfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYY--DPDLEDTASSPVNSPKDRTFKQQ  373
                    T+  S     V   + LK  K   K    D  LEDTASSPVNSPK     + 
Sbjct  85   --------TDAFSGRSFPVNFPVKLKFGKARTKKICEDDSLEDTASSPVNSPKVSQI-EH  135

Query  372  VEINPRRTQNNVLN--YLGKESGFEGFQEMVMGAEEERSSINFD----GKISTECIDLKK  211
            ++  PR+ ++ V +   +G   G    Q  +   +E++ ++  +       ++  +DL+ 
Sbjct  136  IQTPPRKHEDYVSSSFVMGNMRGMGDHQIQIQEGDEQKLTMMRNLREGNNSNSNNMDLRT  195

Query  210  RGLCLMPLSLLVNY  169
            RGLC++P+S+L N+
Sbjct  196  RGLCVVPISMLGNF  209



>ref|XP_010488191.1| PREDICTED: uncharacterized protein LOC104766072 [Camelina sativa]
Length=208

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 97/192 (51%), Gaps = 30/192 (16%)
 Frame = -2

Query  720  QEESGWTAYLQDFS-ENKMMGSSSSYSNQEDYDCSIVS-SPSLVSDaatyaarrkkksss  547
            QEESGWT YL+DFS + +      S  +Q+   CS+   SPSLVSDAA            
Sbjct  35   QEESGWTTYLEDFSNQYRTNQHEESDHHQDKSSCSLSGVSPSLVSDAA------------  82

Query  546  dfrrvKNNTECSSLGGSQVLR---RLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQ  376
                    T+  S G S  +    +L  +  +      D  LEDTASSPVNSPK   F +
Sbjct  83   --------TDAFS-GKSYPVNFPGKLKFERARTKKICEDDSLEDTASSPVNSPKVSQF-E  132

Query  375  QVEINPRRTQNNVLN--YLGKESGFEGFQEMVMGAEEERSSINFD-GKISTECIDLKKRG  205
             ++  PR+ ++ V +   +G   G    Q  +   +E + ++  + G+ +   +DL+ RG
Sbjct  133  HIQTPPRKLEDYVSSSFVMGNIRGMGDHQIHIQEGDEPKMTMMRNLGEGNNNNMDLRSRG  192

Query  204  LCLMPLSLLVNY  169
            LC++P+S+L N+
Sbjct  193  LCVVPISMLANF  204



>ref|XP_004515078.1| PREDICTED: uncharacterized protein LOC101496631 [Cicer arietinum]
Length=189

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 90/187 (48%), Gaps = 29/187 (16%)
 Frame = -2

Query  720  QEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdf  541
            QEESGWT Y +DFS+    G   SY       CS +   S +   A   A  K       
Sbjct  27   QEESGWTTYFEDFSK----GIEPSY-------CSSLGGGSSLLSDAASNAAWKFSHHH--  73

Query  540  rrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEIN  361
                     + L  S++ ++L  K  +      D  LEDTASSPVNSPK R      EI 
Sbjct  74   ---------NHLVASKLPKKLCFKKTRSKMISDDDPLEDTASSPVNSPKVRDLSPS-EIA  123

Query  360  PRRTQNNVLNYLGKESGF---EGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMP  190
             R+  + +   +GK  GF   E + E++   ++   +  +D K + +C +LKKRGLCL+P
Sbjct  124  SRKIDDQLQGSMGK--GFTSSENYSELLQMDDKHELNKFYDEK-NIDCTELKKRGLCLVP  180

Query  189  LSLLVNY  169
              LLVNY
Sbjct  181  FPLLVNY  187



>ref|XP_008811226.1| PREDICTED: uncharacterized protein LOC103722446 [Phoenix dactylifera]
Length=183

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 91/198 (46%), Gaps = 45/198 (23%)
 Frame = -2

Query  732  GREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCS--IVSSPSLVSDaatyaarrkk  559
            G    EESGWT Y +DF  ++          +E+  CS  +    S++SDA         
Sbjct  19   GAPSSEESGWTMYFEDFLASE---------KREEDGCSFSMGGGSSIISDA---------  60

Query  558  ksssdfrrvKNNTECSS---LGGSQV---LRRLNLKNPKPSDKYYDPDLEDTASSPVNSP  397
                          C++   L G++     ++L  K  K      D  LEDTASSPVNSP
Sbjct  61   ------------ASCAAWKPLAGTEATKSCKKLRFKKRKAGGTLDDDPLEDTASSPVNSP  108

Query  396  KDRTFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKI--STECI  223
            K  ++    ++ PR   ++    + +E           G E + + +N  G +  + EC 
Sbjct  109  K-VSYLNHSDVQPREKADDHNKGIPQEEAVGCGN----GLEIKSNIVNDLGFVEGTNECT  163

Query  222  DLKKRGLCLMPLSLLVNY  169
            +LKKRGLCL+PLS+LVNY
Sbjct  164  ELKKRGLCLVPLSMLVNY  181



>emb|CDY38633.1| BnaA05g19540D [Brassica napus]
Length=207

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 92/195 (47%), Gaps = 31/195 (16%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVS-SPSLVSDaatyaarrkkkss  550
            + QEESGWT YL+DFS+ +         +Q+   CS++  SPSLVSDAA           
Sbjct  31   DHQEESGWTTYLEDFSK-QYRNHREDSDHQDKSSCSLLGVSPSLVSDAA-----------  78

Query  549  sdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYY--DPDLEDTASSPVNSPKDRTFKQ  376
                     T+  S     V     LK  K   K    D  LEDTASSPVNSPK  +  +
Sbjct  79   ---------TDAFSGKSFSVKFSAKLKFGKARTKKICEDDSLEDTASSPVNSPK-VSQSE  128

Query  375  QVEINPRRTQNNVLN--YLGKESGFEGFQEMVMGAEEE----RSSINFDGKISTECIDLK  214
             ++  PR+    V +   +    G E  Q  +  A+ +    R ++     I+   +DL+
Sbjct  129  HIQTPPRKHDYYVSSSFVMRNTRGMEDHQIQIQEADGQNMSMRGNLREGNNINDNNMDLR  188

Query  213  KRGLCLMPLSLLVNY  169
             RGLC++P+S L N+
Sbjct  189  SRGLCVVPISTLANF  203



>gb|KFK39489.1| hypothetical protein AALP_AA3G250700 [Arabis alpina]
Length=212

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 90/190 (47%), Gaps = 28/190 (15%)
 Frame = -2

Query  720  QEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVS-SPSLVSDaatyaarrkkksssd  544
            QEESGWT YL DF             +Q+   CS++  SPSLVSD A             
Sbjct  41   QEESGWTTYLDDFQNQYRTTQHEDSDHQDKSSCSLLGVSPSLVSDGA-------------  87

Query  543  frrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYY--DPDLEDTASSPVNSPKDRTFKQQV  370
                   TE  S     V     LK  +   K    D  LEDTASSPVNSPK   F + +
Sbjct  88   -------TEAFSGRRFPVNFPAKLKFGRARTKMICEDDSLEDTASSPVNSPKVSQF-EHI  139

Query  369  EINPRRTQNNVLN--YLGKESGFEGFQEMVMGAEEERSSI-NFDGKISTECIDLKKRGLC  199
            +  PR+ ++ V +   +G   G  G  ++  G E++ + + N     +   +DL+ RGLC
Sbjct  140  QTPPRKIEDYVSSSFVMGNIRGM-GNHQIQEGDEQKMTMMRNLREGNNKSNMDLRSRGLC  198

Query  198  LMPLSLLVNY  169
            ++P+S+L N+
Sbjct  199  VVPISMLANF  208



>ref|XP_006826517.1| hypothetical protein AMTR_s00004p00268050 [Amborella trichopoda]
 gb|ERM93754.1| hypothetical protein AMTR_s00004p00268050 [Amborella trichopoda]
Length=165

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 84/187 (45%), Gaps = 31/187 (17%)
 Frame = -2

Query  723  QQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssd  544
            QQEESGWT Y +D  EN   G           DC+  SS + VS ++  +      +   
Sbjct  6    QQEESGWTMYFEDLCENNNHG-----------DCNYSSSMTGVSSSSLLSDAASGAAWKM  54

Query  543  frrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEI  364
              ++            +  + LN K  K +   +D  LEDTASSP NSPK  +       
Sbjct  55   KNQLI-------FPPQKPCKPLNFKKRKTAIPIHDDPLEDTASSPANSPKVSS-------  100

Query  363  NPRRTQNNVLNYLGKESGFEGFQEM--VMGAEEERSSINFDGKISTECIDLKKRGLCLMP  190
                T   +LN    E    G QE   V G   E  ++      + EC DLKKRGLCLMP
Sbjct  101  ----TTAIILNLKENEDHPNGSQEKDDVSGNFSEFRAVEKKEPQTEECTDLKKRGLCLMP  156

Query  189  LSLLVNY  169
            LS+LV+Y
Sbjct  157  LSMLVDY  163



>emb|CDY33133.1| BnaCnng07040D [Brassica napus]
Length=203

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 91/191 (48%), Gaps = 27/191 (14%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVS-SPSLVSDaatyaarrkkkss  550
            + QEESGWT YL+DFS+        S  +Q+   CS++  SPSLVSDAA           
Sbjct  31   DHQEESGWTTYLEDFSKQYRNHWEDS-DHQDKSSCSLLGVSPSLVSDAA-----------  78

Query  549  sdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYY--DPDLEDTASSPVNSPKDRTFKQ  376
                     T+  S     V     LK  K   K    D  LEDTASSPVNSPK  +  +
Sbjct  79   ---------TDAFSGKSFPVKFSAKLKFGKARTKKICEDDSLEDTASSPVNSPK-VSQSE  128

Query  375  QVEINPRRTQNNVLN--YLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGL  202
             ++  PR+    V +   +    G E  Q  +  A+ +  S+  + +      DL+ RGL
Sbjct  129  HIQTPPRKHDYYVSSSFVMRNTRGMEDHQIQIKEADGQNMSMMGNLREGNNINDLRSRGL  188

Query  201  CLMPLSLLVNY  169
            C++P+S+L N+
Sbjct  189  CVVPISMLANF  199



>ref|XP_008355347.1| PREDICTED: uncharacterized protein LOC103419004 isoform X1 [Malus 
domestica]
Length=193

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 91/196 (46%), Gaps = 34/196 (17%)
 Frame = -2

Query  729  REQQEESGWTAYLQDF------SENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaar  568
            +E  EES WT YLQDF       ++      SS+S+    +CSI+S  +           
Sbjct  23   QESPEESSWTMYLQDFMITNSQDDDDDDDDRSSFSSYGYENCSIISDAA-----------  71

Query  567  rkkksssdfrrvKNNTECSSLGGSQVLRRLNLK-NPKPSDKYYDPDLEDTASSPVNSPKD  391
                 SS  R+   N E    G      R ++    KP + + D  LEDTASSPVNSPK 
Sbjct  72   -----SSVTRKFTINGEVLGFGVVGGYNRSDVMIKRKPKEAFLDDALEDTASSPVNSPKV  126

Query  390  RTFKQQ-VEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLK  214
                Q  VE   ++   ++ N    E G         G  +ER+   F G+ S +C +LK
Sbjct  127  CNLSQSTVEPTIQKDYKDIPN---AEKG------SASGRVDERNESGFIGRES-DCTELK  176

Query  213  KRGLCLMPLSLLVNYH  166
            KRGLCL+P S++ NY 
Sbjct  177  KRGLCLVPFSMVANYF  192



>ref|XP_009417237.1| PREDICTED: uncharacterized protein LOC103997669 [Musa acuminata 
subsp. malaccensis]
Length=179

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 95/192 (49%), Gaps = 36/192 (19%)
 Frame = -2

Query  732  GREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkks  553
            G    EESGWT Y +DF  ++   ++  +S        +VS  S++SDAA+  A +    
Sbjct  18   GSASSEESGWTMYFEDFMASEERKAAGGFS------FGVVSGSSMISDAASCVAWKPSS-  70

Query  552  ssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQ  373
                         +SL  S+  R+L+LK  K     +D  LEDTASSPVNSPK       
Sbjct  71   -------------ASLQVSENYRKLSLKKRK--GLLHDDSLEDTASSPVNSPKVADLSYL  115

Query  372  VEINPRRTQN----NVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRG  205
            +  +P +  +       + +G  +G E  Q +        +  +F  K + EC +LKKRG
Sbjct  116  IG-DPNKNDDCRDTAQEDDVGNRNGLELNQTL--------NGFDFVEK-TDECRELKKRG  165

Query  204  LCLMPLSLLVNY  169
            LCL+PLS+LV+Y
Sbjct  166  LCLVPLSMLVDY  177



>ref|XP_008244373.1| PREDICTED: uncharacterized protein LOC103342517 isoform X1 [Prunus 
mume]
Length=190

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 67/206 (33%), Positives = 95/206 (46%), Gaps = 27/206 (13%)
 Frame = -2

Query  780  NQRIRKRMSLYEKSFVGREQQEESGWTAYLQDF-SENKMMGSSSSYSNQEDYDCSIVSSP  604
            N  +RK +S         E  EES WT YL+DF + N   G     S+   Y      + 
Sbjct  8    NSMMRKSLSSDNTRATSHESPEESSWTMYLEDFLTSNNDDGDDEERSSFSSYG---YENS  64

Query  603  SLVSDaatyaarrkkksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLED  424
            S++SDAA+   R+    + +     N +        +  RR      K  +   D  LED
Sbjct  65   SIISDAASAITRKLSAINGEVIGFDNRSSF------EFDRR------KTKEDLLDDALED  112

Query  423  TASSPVNSPKDRTFKQQVEINPRRTQNNV-LNYLGKESGFEGFQEMVMGAEEERSSINFD  247
            TASSPVNSPK     Q  ++ P +  NN  ++Y  K S          G  +ER+ + F 
Sbjct  113  TASSPVNSPKVFNLNQS-DVRPTQQNNNTDISYTEKGS--------TSGLVDERNELGFI  163

Query  246  GKISTECIDLKKRGLCLMPLSLLVNY  169
            G+   +  DLKKRGLCL+P S++ NY
Sbjct  164  GR-ENDSTDLKKRGLCLVPFSMVANY  188



>ref|XP_011042804.1| PREDICTED: uncharacterized protein LOC105138435 isoform X2 [Populus 
euphratica]
Length=168

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 89/201 (44%), Gaps = 48/201 (24%)
 Frame = -2

Query  756  SLYEKSFVGREQ-----QEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVS  592
            S+Y K+ VG ++      EESGWT+Y +D S +K          +ED       S     
Sbjct  9    SIY-KAVVGSKETTVSPAEESGWTSYFEDLSNHK----------EED------QSLCSSF  51

Query  591  DaatyaarrkkksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASS  412
            D+++  +           +  +   CSS G   +  +L  K  +  +   D  LEDTASS
Sbjct  52   DSSSMVSDAASFPPWKSSQTNHVVACSSFGA--LPEKLTSKKTRAKEISLDDSLEDTASS  109

Query  411  PVNSPKDRTFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKIST  232
            PVNSPK                   +   G E   EG +        ER  +NF   +  
Sbjct  110  PVNSPKGN-----------------IESSGLEQHAEGLET------SERCEMNF-STVKN  145

Query  231  ECIDLKKRGLCLMPLSLLVNY  169
            +CIDLKKRGLCL+P S+LVNY
Sbjct  146  DCIDLKKRGLCLVPSSVLVNY  166



>ref|XP_007149966.1| hypothetical protein PHAVU_005G114400g [Phaseolus vulgaris]
 gb|ESW21960.1| hypothetical protein PHAVU_005G114400g [Phaseolus vulgaris]
Length=184

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 99/191 (52%), Gaps = 21/191 (11%)
 Frame = -2

Query  735  VGREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkk  556
            V     EESGWT+Y +DFS++         + Q+ Y CS +   SLVSDAA+ AA +   
Sbjct  13   VSGSANEESGWTSYFEDFSKD---------TEQQSY-CSSLGGSSLVSDAASSAAWKLSH  62

Query  555  sssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQ  376
            S+            SS   S+ LR    +  + SD   D  LEDTASSPVNSPK    K 
Sbjct  63   SNHLLSYPSVRVRESSNNVSKKLRFKKTRTQQISD---DDPLEDTASSPVNSPKVGDLKI  119

Query  375  QVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECI-DLKKRGLC  199
              +I+    Q +     GK    E +  ++   + +   INF+G  + EC  DLKKRGLC
Sbjct  120  SSKID---DQLDGSTSRGKGFHSEHYPNLL---QTDECKINFNGN-NVECTEDLKKRGLC  172

Query  198  LMPLSLLVNYH  166
            L+P S+LVNY+
Sbjct  173  LVPWSMLVNYY  183



>ref|XP_010510513.1| PREDICTED: uncharacterized protein LOC104786761 [Camelina sativa]
Length=208

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 96/192 (50%), Gaps = 30/192 (16%)
 Frame = -2

Query  720  QEESGWTAYLQDFS-ENKMMGSSSSYSNQEDYDCSIVS-SPSLVSDaatyaarrkkksss  547
            QEESGWT YL+DFS + +      S  +Q+   CS+   SPSLVSDAA            
Sbjct  35   QEESGWTTYLEDFSNQYRTNHHEESDHHQDKSSCSLSGVSPSLVSDAA------------  82

Query  546  dfrrvKNNTECSSLGGSQVLR---RLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQ  376
                    T+  S G S  +    +L     +      D  LEDTASSPVNSPK   F +
Sbjct  83   --------TDAFS-GKSYPVNFPGKLKFGRGRTKKICEDDSLEDTASSPVNSPKVSQF-E  132

Query  375  QVEINPRRTQNNVLN--YLGKESGFEGFQEMVMGAEEERSSINFDGK-ISTECIDLKKRG  205
             ++  PR+ ++ V +   +G   G    Q  +   +E++ ++  + +  +   +DL+ RG
Sbjct  133  HIQTPPRKLEDYVSSSFVMGNIRGMGDHQIHIHEGDEQKMTMMRNLREGNNNNMDLRSRG  192

Query  204  LCLMPLSLLVNY  169
            LC++P+S+L N+
Sbjct  193  LCVVPISMLANF  204



>ref|XP_009145460.1| PREDICTED: uncharacterized protein LOC103869152 isoform X1 [Brassica 
rapa]
Length=219

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 92/195 (47%), Gaps = 31/195 (16%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVS-SPSLVSDaatyaarrkkkss  550
            + QEESGWT YL+DFS+        S  +Q+   CS++  SPSLVSDAA           
Sbjct  43   DHQEESGWTTYLEDFSKQYRNHREDS-DHQDKNSCSLLGVSPSLVSDAA-----------  90

Query  549  sdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYY--DPDLEDTASSPVNSPKDRTFKQ  376
                     T+  S     V     LK  K   K    D  LEDTASSPVNSPK  +  +
Sbjct  91   ---------TDAFSGKSFSVKFSAKLKFGKARTKKICEDDSLEDTASSPVNSPK-VSQSE  140

Query  375  QVEINPRRTQNNVLN--YLGKESGFEGFQEMVMGAEEERSSINFD----GKISTECIDLK  214
             ++  PR+    V +   +    G E  Q  +  A+ +  S+  +      I+   +DL+
Sbjct  141  HIQTPPRKHDYYVSSSFVMRNTRGMEDHQIQIQEADGQNMSMMGNLREGNNINDNNMDLR  200

Query  213  KRGLCLMPLSLLVNY  169
             RGLC++P+S L N+
Sbjct  201  SRGLCVVPISTLANF  215



>ref|XP_006298411.1| hypothetical protein CARUB_v10014480mg [Capsella rubella]
 gb|EOA31309.1| hypothetical protein CARUB_v10014480mg [Capsella rubella]
Length=247

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 93/198 (47%), Gaps = 35/198 (18%)
 Frame = -2

Query  732  GREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVS-SPSLVSDaatyaarrkkk  556
            G + QEESGWT YL DFS       ++ + +++   CS+   SPSLVSDAA         
Sbjct  71   GGDHQEESGWTTYLDDFSNQY---RTTQHHDEDKSSCSLSGVSPSLVSDAA---------  118

Query  555  sssdfrrvKNNTECSSLGGSQVLR---RLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRT  385
                       T+  S G S  +    +L     +      D  LEDTASSPVNSPK   
Sbjct  119  -----------TDAFS-GKSYPVNFPGKLKFGRARTKKICEDDSLEDTASSPVNSPKVSQ  166

Query  384  FKQQVEINPRRTQNNVLN--YLGKESGFEGFQEMVMGAEEERSSI----NFDGKISTECI  223
            F + ++  PR+ ++ V +   +G   G        +  +E   ++    N     +   +
Sbjct  167  F-EHIQTPPRKLEDYVSSSFVMGNIRGMGDHHHHQIQIQEGEQNMTMMRNLREGNNNNNM  225

Query  222  DLKKRGLCLMPLSLLVNY  169
            DL+ RGLC++P+S+L N+
Sbjct  226  DLRSRGLCVVPISMLANF  243



>ref|NP_974350.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB02833.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76543.1| uncharacterized protein AT3G21710 [Arabidopsis thaliana]
Length=211

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 93/196 (47%), Gaps = 27/196 (14%)
 Frame = -2

Query  732  GREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVS-SPSLVSDaatyaarrkkk  556
            G + QEESGWT YL DFS            +Q+    S+++ S SLVSDAAT+A   K  
Sbjct  31   GGDHQEESGWTTYLDDFSNQYRTTHHEENDHQDKSSYSLLATSTSLVSDAATHAFSGKSF  90

Query  555  sssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQ  376
                                    +L     +      D  LEDTASSPVNSPK   F +
Sbjct  91   PV------------------NFPAKLKFGRGRTKKICEDDSLEDTASSPVNSPKVSHF-E  131

Query  375  QVEINPRRTQNNVLN--YLGKESGFEGFQEMVM-GAEEE----RSSINFDGKISTECIDL  217
             ++  PR+ ++ V +   +G   G    Q  +  G E++    R+ I+ +   +   +DL
Sbjct  132  HIQTPPRKIEDYVSSSFVMGNIRGMGDHQIQIQEGGEQKVTLMRNLIDGNNNNNNNNMDL  191

Query  216  KKRGLCLMPLSLLVNY  169
            + RGLC++P+S+L N+
Sbjct  192  RSRGLCVVPISMLANF  207



>ref|XP_010532477.1| PREDICTED: uncharacterized protein LOC104808493 [Tarenaya hassleriana]
Length=193

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 90/198 (45%), Gaps = 50/198 (25%)
 Frame = -2

Query  720  QEESGWTAYLQDFSENKMMGSSSSYSNQEDYD-CSIV--SSPSLVSDaatyaarrkkkss  550
            QEESGWT YL+ FS +        Y+   D D CS V  SSPSLVSDA T  A +     
Sbjct  32   QEESGWTTYLEGFSNH--------YNVNGDGDSCSDVLGSSPSLVSDAGTGRAFQHVAG-  82

Query  549  sdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYY----DPDLEDTASSPVNSPKDRTF  382
                           GGS       LK  K +        D  LEDTASSPVNSPK   F
Sbjct  83   ---------------GGSPAGFPARLKFRKLARTKEICGEDESLEDTASSPVNSPKVSEF  127

Query  381  KQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGK------ISTECID  220
             +QV+  PR+    +       S F      VMG       I+ DG+      +     D
Sbjct  128  -EQVQTTPRKLHEYI------SSSF------VMGNGRIPDQIHGDGERNIKNNLKDAKND  174

Query  219  LKKRGLCLMPLSLLVNYH  166
            L+ +GLCL+P+S+L NY+
Sbjct  175  LRSKGLCLVPISMLANYN  192



>gb|AFK37827.1| unknown [Lotus japonicus]
Length=186

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 87/186 (47%), Gaps = 25/186 (13%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdfr  538
            EESGWTAY +DFS  K  G   SY +       I  + S  +                  
Sbjct  21   EESGWTAYFEDFS--KGGGIEPSYCSSLGGSSLISDAASYAA---------------WKF  63

Query  537  rvKNNTECSSLGGSQV--LRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEI  364
               ++ + S   G+Q+  L++L  K  +      D  LEDTASSPVNSPK R      E 
Sbjct  64   SHHHHNQLSDNKGAQINPLKKLCFKKARTKQISEDDPLEDTASSPVNSPKVRDL-SPTEF  122

Query  363  NPRRTQNNVLNYLGKE-SGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPL  187
              R+  + +   +G   +  E + ++ +  +    + N   + + +C DLKKRGLCL+PL
Sbjct  123  ISRKIDDQLEGSMGNRFTSSENYSDLQIEDKHIDEAFN---RNNMDCTDLKKRGLCLVPL  179

Query  186  SLLVNY  169
            S L+NY
Sbjct  180  S-LINY  184



>ref|XP_009358123.1| PREDICTED: uncharacterized protein LOC103948780 isoform X1 [Pyrus 
x bretschneideri]
Length=191

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 89/194 (46%), Gaps = 30/194 (15%)
 Frame = -2

Query  735  VGREQQEESGWTAYLQDF----SENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaar  568
            + +E  EES WT YLQDF    S++      SS+S+    +CSI+S              
Sbjct  21   IPQESPEESSWTMYLQDFMTTNSQDDNDDDRSSFSSYGYENCSIISDAG-----------  69

Query  567  rkkksssdfrrvKNNTECSSLGGSQVLRRLNLK-NPKPSDKYYDPDLEDTASSPVNSPKD  391
                 SS  R+   N E    G      R  +    +P +   D  LEDTA+SPVNSPK 
Sbjct  70   -----SSVTRKSTINGEVLGFGVVGGYNRSGVMFKRQPKEVLLDDALEDTATSPVNSPKI  124

Query  390  RTFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKK  211
            R   +   + P   Q + ++    E G         G  +ER+   F G+ S +C +LKK
Sbjct  125  RNLSRST-VEPT-LQKDYIDIPNAEKG------STSGRVDERNESGFIGRES-DCTELKK  175

Query  210  RGLCLMPLSLLVNY  169
            RGLCL+P S + NY
Sbjct  176  RGLCLVPFSTVANY  189



>ref|XP_010466428.1| PREDICTED: uncharacterized protein LOC104746605 [Camelina sativa]
Length=208

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 93/192 (48%), Gaps = 30/192 (16%)
 Frame = -2

Query  720  QEESGWTAYLQDFSENKMMGSSSSYSNQEDYD-CSIVS-SPSLVSDaatyaarrkkksss  547
            QEESGWT YL+DFS            +Q+D   CS+   SPSLVSDAA            
Sbjct  35   QEESGWTTYLEDFSNQYRTNQHEESDHQQDKSFCSLSGVSPSLVSDAA------------  82

Query  546  dfrrvKNNTECSSLGGSQVLR---RLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQ  376
                    T+  S G S  +    +L     +      D  LEDTASSPVNSPK   F +
Sbjct  83   --------TDAFS-GKSYPVNFPGKLKFGRGRTKKICEDDSLEDTASSPVNSPKVSQF-E  132

Query  375  QVEINPRRTQNNVLN--YLGKESGFEGFQEMVMGAEEERSSINFD-GKISTECIDLKKRG  205
             ++  PR+ ++ V +   +G        Q  +   +E + ++  + G+ +   +DL+ RG
Sbjct  133  HIQTPPRKLEDYVSSSFVMGNIRSMGDHQIHIQEGDEPKMTMMRNLGEGNNNNMDLRSRG  192

Query  204  LCLMPLSLLVNY  169
            LC++P+S+L N+
Sbjct  193  LCVVPISMLANF  204



>ref|XP_009145461.1| PREDICTED: uncharacterized protein LOC103869152 isoform X2 [Brassica 
rapa]
Length=195

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 86/192 (45%), Gaps = 49/192 (26%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVS-SPSLVSDaatyaarrkkkss  550
            + QEESGWT YL+DFS+ +         +Q+   CS++  SPSLVSDAA           
Sbjct  43   DHQEESGWTTYLEDFSK-QYRNHREDSDHQDKNSCSLLGVSPSLVSDAA-----------  90

Query  549  sdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYY--DPDLEDTASSPVNSPKDRTF--  382
                     T+  S     V     LK  K   K    D  LEDTASSPVNSPK  T   
Sbjct  91   ---------TDAFSGKSFSVKFSAKLKFGKARTKKICEDDSLEDTASSPVNSPKRNTRGM  141

Query  381  -KQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRG  205
               Q++I     QN  +                MG   E ++IN +       +DL+ RG
Sbjct  142  EDHQIQIQEADGQNMSM----------------MGNLREGNNINDNN------MDLRSRG  179

Query  204  LCLMPLSLLVNY  169
            LC++P+S L N+
Sbjct  180  LCVVPISTLANF  191



>ref|XP_010930685.1| PREDICTED: uncharacterized protein LOC105051782 [Elaeis guineensis]
Length=181

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 92/191 (48%), Gaps = 33/191 (17%)
 Frame = -2

Query  732  GREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSI-VSSPSLVSDaatyaarrkkk  556
            G    EESGWT Y +DF  ++          +E+  CS  ++  S +SDAA+  A +   
Sbjct  19   GTPSSEESGWTMYFEDFLASE---------RKEEDGCSFSIAGGSSISDAASCVAWKPSA  69

Query  555  sssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQ  376
             +                 ++  ++L+ K  K      D  LEDTASSPVNSPK     +
Sbjct  70   GAET---------------TKSCKKLSFKKRKAKGVLDDDSLEDTASSPVNSPKVSDLNR  114

Query  375  QVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKI--STECIDLKKRGL  202
              ++ P +  ++    + +E G     ++    E +R  +N  G I  + EC +LKKRGL
Sbjct  115  S-DVQPNKKDDD-HKGIPQEEGVGCGNDL----ELKRDVVNELGFIEGTNECTELKKRGL  168

Query  201  CLMPLSLLVNY  169
            CL+P S+LVNY
Sbjct  169  CLLPWSMLVNY  179



>ref|XP_008355348.1| PREDICTED: uncharacterized protein LOC103419004 isoform X2 [Malus 
domestica]
Length=170

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 84/195 (43%), Gaps = 55/195 (28%)
 Frame = -2

Query  729  REQQEESGWTAYLQDF------SENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaar  568
            +E  EES WT YLQDF       ++      SS+S+    +CSI+S  +           
Sbjct  23   QESPEESSWTMYLQDFMITNSQDDDDDDDDRSSFSSYGYENCSIISDAA-----------  71

Query  567  rkkksssdfrrvKNNTECSSLGGSQVLRRLNLK-NPKPSDKYYDPDLEDTASSPVNSPKD  391
                 SS  R+   N E    G      R ++    KP + + D  LEDTASSPVNSPK+
Sbjct  72   -----SSVTRKFTINGEVLGFGVVGGYNRSDVMIKRKPKEAFLDDALEDTASSPVNSPKE  126

Query  390  RTFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKK  211
            +        + R  + N   ++G+ES                           +C +LKK
Sbjct  127  KG-----SASGRVDERNESGFIGRES---------------------------DCTELKK  154

Query  210  RGLCLMPLSLLVNYH  166
            RGLCL+P S++ NY 
Sbjct  155  RGLCLVPFSMVANYF  169



>ref|XP_006657776.1| PREDICTED: uncharacterized protein LOC102707981 [Oryza brachyantha]
Length=222

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 64/117 (55%), Gaps = 19/117 (16%)
 Frame = -2

Query  489  LRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEINPRRTQN--------NVL  334
            LR+L  K  K  D  +D  LEDTASSPVNSPK      Q+E++P+R  N         V 
Sbjct  115  LRKLKKKVFKALD--HDDSLEDTASSPVNSPKVSAL-SQLELSPKRRCNIRDLTKGVAVC  171

Query  333  NYLGKESGF-EGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPLSLLVNYH  166
            +  G+E  + E   E V   ++ + SI       T C +LK +GLCL PLS+L++YH
Sbjct  172  DDHGREMDYGEAMVEGVGFVDQSQKSI-------TPCAELKDKGLCLFPLSMLLHYH  221



>emb|CDP05785.1| unnamed protein product [Coffea canephora]
Length=189

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 85/189 (45%), Gaps = 33/189 (17%)
 Frame = -2

Query  717  EESGWTAYLQDF----SENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkkss  550
            EES WT YLQDF      +     S SY++ E       S PSLVSDA + AAR      
Sbjct  26   EESSWTFYLQDFQCDHHHDHDNTGSVSYNSCE-------SCPSLVSDAFSSAARIAPDDI  78

Query  549  sdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQV  370
                     + C +L      +R   +  K S    D DLEDTASSP NSPK  +  Q  
Sbjct  79   EAAVFASARSNCKNLS----FKR---RKAKASAVLNDHDLEDTASSPANSPKVSSINQLN  131

Query  369  EINPRRTQNNV--LNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCL  196
                 +   NV   N   K S  E   E    A EE+++ +          +LKKRGLCL
Sbjct  132  HTRNDKDNINVSEANVCRKNSTAE---EAGSAAHEEKNNQS----------ELKKRGLCL  178

Query  195  MPLSLLVNY  169
            +P+S L NY
Sbjct  179  VPVSTLTNY  187



>ref|XP_002522866.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39564.1| conserved hypothetical protein [Ricinus communis]
Length=203

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 92/183 (50%), Gaps = 20/183 (11%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdfr  538
            EESGWT YL D  +N    + SS+   ++      ++ SLVSDAA+   ++         
Sbjct  39   EESGWTMYLDDSFDNNGDENHSSFPFDDE-----TAASSLVSDAASLIFKKSDGDLEKSG  93

Query  537  rvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEINP  358
               +N +  S        RL+ K  K      D  LEDTASSPVNSPK   +    + N 
Sbjct  94   LPIDNNKSYS--------RLSFKKRKTKGALVDDSLEDTASSPVNSPK--VYDIMNQFNK  143

Query  357  RRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPLSLL  178
               Q ++     K +      +++    ++RS++ F G+  ++  +LKKRGLCL+P+S++
Sbjct  144  SIKQRDMDVSQDKGNNITSSDQLL----DDRSNLGFLGR-ESDNTELKKRGLCLVPVSMV  198

Query  177  VNY  169
            VNY
Sbjct  199  VNY  201



>ref|XP_003540311.1| PREDICTED: uncharacterized protein LOC100799390 [Glycine max]
Length=177

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 93/191 (49%), Gaps = 28/191 (15%)
 Frame = -2

Query  735  VGREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkk  556
            V     EESGWT+Y ++FS+            Q+ Y CS +   SLVSDAA+ AA +   
Sbjct  13   VSGSANEESGWTSYFEEFSKGM---------EQQSY-CSSLGGSSLVSDAASCAAWKLSH  62

Query  555  sssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQ  376
             +       NN          V ++L  K  +      D  L+DTASSPVNSPK    K 
Sbjct  63   HNHLVSYPSNNV---------VSKKLRFKKTRTQQISDDDPLDDTASSPVNSPKVGDLKV  113

Query  375  QVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTEC-IDLKKRGLC  199
                   +  + +  +  +  GF       + A+E    INF+G  + EC  +LKK+GLC
Sbjct  114  S-----GKNDDQLNGFTSRGKGFNSQHYPKLQADE--CDINFNGN-NVECNTNLKKKGLC  165

Query  198  LMPLSLLVNYH  166
            L+PLS+LVNY+
Sbjct  166  LVPLSMLVNYY  176



>ref|XP_010923959.1| PREDICTED: uncharacterized protein LOC105046907 [Elaeis guineensis]
Length=182

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 91/193 (47%), Gaps = 36/193 (19%)
 Frame = -2

Query  732  GREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkks  553
            G    EESGWT Y +DF        +S    ++    SI    S++SDAA+  A +    
Sbjct  19   GPPSSEESGWTMYFEDFL-------ASEKREEDGCSFSIEGGSSIISDAASCVAWK----  67

Query  552  ssdfrrvKNNTECSSLGGSQV---LRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTF  382
                           L G++V    ++L+ K  K      +  LEDTASSPVNSPK   +
Sbjct  68   --------------PLAGTKVTKSCKKLSFKKRKAGGTLDEDPLEDTASSPVNSPKVSDW  113

Query  381  KQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKI--STECIDLKKR  208
                ++ PR   ++      +E+   G      G E + + +N  G +  + EC +LKKR
Sbjct  114  NHS-DVQPREKADDNKGIPQEEAVGCG-----NGLEPKSNIVNDLGFVEGTNECTELKKR  167

Query  207  GLCLMPLSLLVNY  169
            GL L+PLS+LVNY
Sbjct  168  GLGLVPLSMLVNY  180



>ref|XP_003563010.1| PREDICTED: uncharacterized protein LOC100844346 [Brachypodium 
distachyon]
Length=193

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 94/195 (48%), Gaps = 33/195 (17%)
 Frame = -2

Query  723  QQEESGWTAYLQDF--SENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkkss  550
            Q EES WT Y  DF  SE +     +SY + +D +  +    S++SDAA+ A        
Sbjct  22   QPEESSWTGYFVDFMMSEEEKKRQDASYCSYDDEEEEV--DGSMISDAASLAPAAFPDKY  79

Query  549  sdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQV  370
                              + L++L  K  K  D  +D  LEDTASSPVNSPK      Q+
Sbjct  80   ------------------KGLKQLKKKVFKALD--HDDSLEDTASSPVNSPKVSAL-SQM  118

Query  369  EINPRRTQNNVLNY-----LGKESGFEG--FQEMVMGAEEERSSINFDGKISTECIDLKK  211
            E +P+R + NV +      +G + G EG   +E      E    ++   +  T C +LK 
Sbjct  119  EFSPKR-RCNVSDLAKGAGIGNDHGREGTDCEEHADAIMEGVRFLDQSQRGITPCAELKD  177

Query  210  RGLCLMPLSLLVNYH  166
            +GLCL+PLS+L+NY 
Sbjct  178  KGLCLVPLSMLLNYQ  192



>ref|XP_006406240.1| hypothetical protein EUTSA_v10021505mg [Eutrema salsugineum]
 gb|ESQ47693.1| hypothetical protein EUTSA_v10021505mg [Eutrema salsugineum]
Length=214

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 94/201 (47%), Gaps = 42/201 (21%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVS-SPSLVSDaatyaarrkkkss  550
            + QEESGWT YL+DFS N+         +Q+   CS++  SPSL+SDAA           
Sbjct  37   DHQEESGWTTYLEDFS-NQNRTHYEKGDHQDKSSCSLLGGSPSLISDAA-----------  84

Query  549  sdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYY--DPDLEDTASSPVNSPKDRTFKQ  376
                     T+  S     V     LK  K   K    D  LEDTASSPVNSPK     +
Sbjct  85   ---------TDAFSGRSFPVKFPAKLKFGKARTKKICEDDSLEDTASSPVNSPKVSQV-E  134

Query  375  QVEINPRRTQNNVLN--YLGKESGFEG----FQE------MVMGAEEERSSINFDGKIST  232
             V+  PR+ ++ V +   +G           FQE      M+M    ER +       ++
Sbjct  135  HVQTPPRKIEDYVSSSFVMGNMRSMGDNQIQFQEGDEQKMMMMRNLRERKN-----NNNS  189

Query  231  ECIDLKKRGLCLMPLSLLVNY  169
              +DL+ RGLC++P+S+L N+
Sbjct  190  NNMDLRSRGLCVVPISMLANF  210



>emb|CDY39496.1| BnaA01g24920D [Brassica napus]
Length=213

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 93/201 (46%), Gaps = 44/201 (22%)
 Frame = -2

Query  720  QEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVS-SPSLVSDaatyaarrkkksssd  544
            +EESGWT YL DFS N+         +Q+   CS++  SPSL+SDAA             
Sbjct  38   EEESGWTTYLDDFS-NQYRTHCEDSDHQDKSSCSLLGVSPSLISDAA-------------  83

Query  543  frrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPD--LEDTASSPVNSPKDRTFKQQV  370
                   T+  S     V     LK  K   K    D  LEDTASSPVNSPK     + +
Sbjct  84   -------TDAFSGRNFPVNFPAKLKFGKARTKKISEDDSLEDTASSPVNSPKVSQV-EHI  135

Query  369  EINPRRTQNNVL-------------NYLGKESGFEGFQEMVMGAEEERSSINFDGKISTE  229
            +  PR+T++ V              N +  + G+E  Q M M     R+    +   +  
Sbjct  136  QTLPRKTEDYVSSSFVMRTTRGMVDNQIQIQEGYE--QSMTM----TRNLGEGNINNNNN  189

Query  228  CIDLKKRGLCLMPLSLLVNYH  166
             +DL+ RGLC++P+S+L N++
Sbjct  190  NMDLRSRGLCVVPISMLANFN  210



>ref|XP_009109370.1| PREDICTED: uncharacterized protein LOC103835026 [Brassica rapa]
Length=213

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 93/201 (46%), Gaps = 44/201 (22%)
 Frame = -2

Query  720  QEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVS-SPSLVSDaatyaarrkkksssd  544
            +EESGWT YL DFS N+         +Q+   CS++  SPSL+SDAA             
Sbjct  38   EEESGWTTYLDDFS-NQYRTHCEDSDHQDKSSCSLLGVSPSLISDAA-------------  83

Query  543  frrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPD--LEDTASSPVNSPKDRTFKQQV  370
                   T+  S     V     LK  K   K    D  LEDTASSPVNSPK     + +
Sbjct  84   -------TDAFSGRNFPVNFPAKLKFGKARTKKISEDDSLEDTASSPVNSPKVSQV-EHI  135

Query  369  EINPRRTQNNVL-------------NYLGKESGFEGFQEMVMGAEEERSSINFDGKISTE  229
            +  PR+T++ V              N +  + G+E  Q M M     R+    +   +  
Sbjct  136  QTLPRKTEDYVSSSFVMRTTRGMVDNQIQIQEGYE--QSMTM----TRNLGEGNINNNNN  189

Query  228  CIDLKKRGLCLMPLSLLVNYH  166
             +DL+ RGLC++P+S+L N++
Sbjct  190  NMDLRSRGLCVVPISMLANFN  210



>ref|XP_009632060.1| PREDICTED: uncharacterized protein LOC104121704 [Nicotiana tomentosiformis]
Length=179

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 87/187 (47%), Gaps = 29/187 (16%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksss  547
            E  EES WT YLQDF  N     +SSYS  E+         SL SDAA+ A      + +
Sbjct  20   ENPEESSWTFYLQDFMSNNNEQITSSYSGFEN--------NSLSSDAASLAPYELTNNRN  71

Query  546  dfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVE  367
                +  N   ++ G  +  R++     K +    D DLEDTASSPVNSPK     Q   
Sbjct  72   GAIDITENN--TNFGSKK--RKM-----KRAAAAVDDDLEDTASSPVNSPKVSYMDQLCI  122

Query  366  INPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPL  187
                ++  ++    G  +G    Q M  G       +N   K   +C +LKK+GLCL+P+
Sbjct  123  SQKGKSTASIFEGKGNATG----QMMTSG-------LNVSTK-ENDCTELKKKGLCLVPV  170

Query  186  SLLVNYH  166
            S+   Y+
Sbjct  171  SMFTKYN  177



>gb|KHN44881.1| hypothetical protein glysoja_040810 [Glycine soja]
Length=177

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 67/192 (35%), Positives = 95/192 (49%), Gaps = 30/192 (16%)
 Frame = -2

Query  735  VGREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkk  556
            V     EESGWT+Y ++FS+            Q+ Y CS +   SLVSDAA+ AA +   
Sbjct  13   VSGSANEESGWTSYFEEFSKGM---------EQQSY-CSSLGGSSLVSDAASCAAWKLSH  62

Query  555  sssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQ  376
             +       NN          + ++L  K  +      D  L+DTASSPVNSPK    K 
Sbjct  63   HNHLVSYPSNNV---------ISKKLRFKKTRTQQISDDDPLDDTASSPVNSPKVGDLKV  113

Query  375  QVEINPRRTQNNVLNYLGKESGFEGFQ-EMVMGAEEERSSINFDGKISTEC-IDLKKRGL  202
              +       ++ LN  G  S  +GF  +     + +   INF+G  + EC  +LKK+GL
Sbjct  114  SGK------NDDQLN--GSTSRGKGFNSQHYPKLQADECDINFNGN-NVECKTNLKKKGL  164

Query  201  CLMPLSLLVNYH  166
            CL+PLS+LVNY+
Sbjct  165  CLVPLSMLVNYY  176



>ref|XP_002460795.1| hypothetical protein SORBIDRAFT_02g034990 [Sorghum bicolor]
 gb|EER97316.1| hypothetical protein SORBIDRAFT_02g034990 [Sorghum bicolor]
Length=211

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 56/98 (57%), Gaps = 8/98 (8%)
 Frame = -2

Query  444  YDPDLEDTASSPVNSPKDRTFKQQVEINPRRTQNNVLNY-----LGKESGFEGFQEMVMG  280
            +D  LEDTASSPVNSPK  +   Q+E++P+R + N+ +      +G + G EG       
Sbjct  114  HDGSLEDTASSPVNSPK-VSVVSQLELSPKR-RCNIRDLTKEVGIGDDHGGEGMDCTDAA  171

Query  279  AEEERSSINFDGKISTECIDLKKRGLCLMPLSLLVNYH  166
             E  R        I+  C DLK +G+CL P+S+L++YH
Sbjct  172  MEGARFGDQSQTSIAP-CADLKDKGICLFPISVLLHYH  208



>ref|XP_010101186.1| hypothetical protein L484_000795 [Morus notabilis]
 gb|EXB87687.1| hypothetical protein L484_000795 [Morus notabilis]
Length=167

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 57/108 (53%), Gaps = 10/108 (9%)
 Frame = -2

Query  480  LNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEINPRR----TQNNVLNYLGKES  313
            L+ K  K  D  +D  LEDTASSP+NSPK      Q+   P+       N   N LG  S
Sbjct  64   LSFKKRKTKDVLHDVALEDTASSPLNSPKVLNLVSQLGDKPKEKDYVMSNTFENKLGSAS  123

Query  312  GFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPLSLLVNY  169
                 +       +E+  +   GK  ++C +LKKRGLCL+PLS+LVNY
Sbjct  124  SSRRDER-----RDEQLLVYSHGK-ESDCTNLKKRGLCLVPLSMLVNY  165



>ref|XP_009792861.1| PREDICTED: uncharacterized protein LOC104239834 [Nicotiana sylvestris]
Length=177

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 85/186 (46%), Gaps = 30/186 (16%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksss  547
            E  EES WT YLQDF  N     +SSYS  E+         SL SDAA+ A+     + +
Sbjct  20   ENPEESSWTFYLQDFMSNNNEQITSSYSGFEN--------NSLFSDAASLASYEFTNNRN  71

Query  546  dfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVE  367
                +  N +  + G     ++  +K         D DLEDTASSPVNSPK     Q   
Sbjct  72   SAIDINENNK--NFGS----KKRKMKRTAA----VDDDLEDTASSPVNSPKVSYMDQLCI  121

Query  366  INPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPL  187
                ++  ++    G  SG    Q M  G       +N   K   +C +LKK+GLCL+P+
Sbjct  122  SQKGKSTASIFEGKGNTSG----QMMTSG-------LNVSTK-ENDCTELKKKGLCLVPV  169

Query  186  SLLVNY  169
            S+   Y
Sbjct  170  SMFTKY  175



>ref|XP_009342588.1| PREDICTED: uncharacterized protein LOC103934562 [Pyrus x bretschneideri]
Length=191

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 87/192 (45%), Gaps = 30/192 (16%)
 Frame = -2

Query  729  REQQEESGWTAYLQDF----SENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrk  562
            +E  EES WT YLQDF    S++      SS+S+    +CSI+S                
Sbjct  23   QESPEESSWTMYLQDFMTTNSQDDNDDDRSSFSSYGYENCSIISDAG-------------  69

Query  561  kksssdfrrvKNNTECSSLGGSQVLRRLNLK-NPKPSDKYYDPDLEDTASSPVNSPKDRT  385
               SS  R+   N E    G      R  +    +P +   D  LEDTA+SP+NSPK   
Sbjct  70   ---SSVTRKFTINGEVLGFGVVGGYNRSGVMFKRQPKEVLLDDALEDTATSPLNSPKICN  126

Query  384  FKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRG  205
              +   + P   Q + ++    E G         G  +ER+   F G+ S +C +LKKRG
Sbjct  127  LSRST-VEPT-LQKDYIDIPNAEKG------STSGRVDERNESGFIGRES-DCTELKKRG  177

Query  204  LCLMPLSLLVNY  169
            LCL+P S + NY
Sbjct  178  LCLVPFSTVANY  189



>ref|XP_009407066.1| PREDICTED: uncharacterized protein LOC103989845 [Musa acuminata 
subsp. malaccensis]
Length=165

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 85/197 (43%), Gaps = 55/197 (28%)
 Frame = -2

Query  741  SFVGREQQEESGWTAYLQDF--SENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaar  568
            S VG    EESGWT YL+DF  SE K             +  S V+ PS +SDA      
Sbjct  16   SKVGSASSEESGWTMYLEDFMASEEKQEAGG--------FYSSAVNGPSAISDA------  61

Query  567  rkkksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDR  388
                             C +         L+LK  K      D  LEDTA SP +S K  
Sbjct  62   ---------------ASCVAW------TPLSLKKRKRKGLLEDDSLEDTAISPASSSK-V  99

Query  387  TFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTE----CID  220
            T    + +NP +          K+   E  QE V+G+   RSS   +G  STE    C +
Sbjct  100  TDLNYLTMNPTK----------KDDHRETPQEGVVGS---RSSQELNGLSSTERKNECTE  146

Query  219  LKKRGLCLMPLSLLVNY  169
             KK G+CL+PLS+LV+Y
Sbjct  147  QKKNGVCLVPLSMLVHY  163



>gb|EAZ40058.1| hypothetical protein OsJ_24504 [Oryza sativa Japonica Group]
Length=174

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 55/100 (55%), Gaps = 12/100 (12%)
 Frame = -2

Query  444  YDPDLEDTASSPVNSPKDRTFKQQVEINPRRTQNN----VLNYLGKESGFEGFQ---EMV  286
            +D  LEDTASSPVNSPK     Q +E++P+R  N         +G + G EG      MV
Sbjct  79   HDDSLEDTASSPVNSPKVSALTQ-LELSPKRRCNTRDLTKEVGIGDDRGREGMDYADAMV  137

Query  285  MGAEEERSSINFDGKISTECIDLKKRGLCLMPLSLLVNYH  166
             G       ++   K  T C +LK +GLCL PLS+L++YH
Sbjct  138  EGVR----FVDQSQKSVTPCGELKDKGLCLFPLSMLLHYH  173



>gb|AFK37474.1| unknown [Lotus japonicus]
Length=187

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 92/184 (50%), Gaps = 22/184 (12%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdfr  538
            EESGWT+Y +D SE    GS          D S +   SLVSDAA+ AA +    + +  
Sbjct  25   EESGWTSYFEDLSE----GS----------DYSSLGGSSLVSDAASCAAWKFSHQNQNRV  70

Query  537  rvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEINP  358
                + +      S   ++L  K  +      D  LEDTASSPV+SPK R     +E+  
Sbjct  71   ASSYSPDNKGRDSSNHFKKLCFKKTRTKQISEDDPLEDTASSPVSSPKVRDL-NPMEMIS  129

Query  357  RRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPLSLL  178
            R+  +  L+    +S      E     +     +NF+GK   EC +LKKRGLCL+P+S+L
Sbjct  130  RKIDDYQLDDYRVDS------EHHPKLKTNDCDLNFNGK-KIECTNLKKRGLCLVPMSVL  182

Query  177  VNYH  166
            VN++
Sbjct  183  VNHY  186



>ref|NP_001059820.1| Os07g0524000 [Oryza sativa Japonica Group]
 dbj|BAC79617.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD30857.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21734.1| Os07g0524000 [Oryza sativa Japonica Group]
Length=212

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 55/100 (55%), Gaps = 12/100 (12%)
 Frame = -2

Query  444  YDPDLEDTASSPVNSPKDRTFKQQVEINPRRTQNN----VLNYLGKESGFEGFQ---EMV  286
            +D  LEDTASSPVNSPK     Q +E++P+R  N         +G + G EG      MV
Sbjct  117  HDDSLEDTASSPVNSPKVSALTQ-LELSPKRRCNTRDLTKEVGIGDDRGREGMDYADAMV  175

Query  285  MGAEEERSSINFDGKISTECIDLKKRGLCLMPLSLLVNYH  166
             G       ++   K  T C +LK +GLCL PLS+L++YH
Sbjct  176  EGVR----FVDQSQKSVTPCGELKDKGLCLFPLSMLLHYH  211



>gb|EAZ04110.1| hypothetical protein OsI_26256 [Oryza sativa Indica Group]
Length=223

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 55/100 (55%), Gaps = 12/100 (12%)
 Frame = -2

Query  444  YDPDLEDTASSPVNSPKDRTFKQQVEINP-RRTQNNVLNY---LGKESGFEGFQ---EMV  286
            +D  LEDTASSPVNSPK     Q +E++P RR     L     +G + G EG      MV
Sbjct  128  HDDSLEDTASSPVNSPKVSALTQ-LELSPKRRCNTRDLTKEVGIGDDRGREGMDYADAMV  186

Query  285  MGAEEERSSINFDGKISTECIDLKKRGLCLMPLSLLVNYH  166
             G       ++   K  T C +LK +GLCL PLS+L++YH
Sbjct  187  EGVR----FVDQSQKSVTPCGELKDKGLCLFPLSMLLHYH  222



>gb|EAZ04112.1| hypothetical protein OsI_26258 [Oryza sativa Indica Group]
Length=223

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 55/100 (55%), Gaps = 12/100 (12%)
 Frame = -2

Query  444  YDPDLEDTASSPVNSPKDRTFKQQVEINPRRTQNN----VLNYLGKESGFEGFQ---EMV  286
            +D  LEDTASSPVNSPK     Q +E++P+R  N         +G + G EG      MV
Sbjct  128  HDDSLEDTASSPVNSPKVSALTQ-LELSPKRRCNTRDLTKEVGIGDDRGREGMDYADAMV  186

Query  285  MGAEEERSSINFDGKISTECIDLKKRGLCLMPLSLLVNYH  166
             G       ++   K  T C +LK +GLCL PLS+L++YH
Sbjct  187  EGVR----FVDQSQKSVTPCGELKDKGLCLFPLSMLLHYH  222



>ref|XP_009358124.1| PREDICTED: uncharacterized protein LOC103948780 isoform X2 [Pyrus 
x bretschneideri]
Length=168

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 81/192 (42%), Gaps = 53/192 (28%)
 Frame = -2

Query  729  REQQEESGWTAYLQDF----SENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrk  562
            +E  EES WT YLQDF    S++      SS+S+    +CSI+S                
Sbjct  23   QESPEESSWTMYLQDFMTTNSQDDNDDDRSSFSSYGYENCSIISDAG-------------  69

Query  561  kksssdfrrvKNNTECSSLGGSQVLRRLNLK-NPKPSDKYYDPDLEDTASSPVNSPKDRT  385
               SS  R+   N E    G      R  +    +P +   D  LEDTA+SPVNSPK++ 
Sbjct  70   ---SSVTRKSTINGEVLGFGVVGGYNRSGVMFKRQPKEVLLDDALEDTATSPVNSPKEKG  126

Query  384  FKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRG  205
                   + R  + N   ++G+ES                           +C +LKKRG
Sbjct  127  -----STSGRVDERNESGFIGRES---------------------------DCTELKKRG  154

Query  204  LCLMPLSLLVNY  169
            LCL+P S + NY
Sbjct  155  LCLVPFSTVANY  166



>ref|XP_004957890.1| PREDICTED: uncharacterized protein LOC101769552 isoform X1 [Setaria 
italica]
Length=211

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (59%), Gaps = 9/102 (9%)
 Frame = -2

Query  444  YDPDLEDTASSPVNSPKDRTFKQQVEINPRRTQNNVLNYLGKES---GFEGFQEMVMGAE  274
            +D  LEDTASSPVNSPK  +   Q+E++P+R  N  +  L KE+   G +  +E +   +
Sbjct  112  HDDSLEDTASSPVNSPK-VSAVSQLELSPKRRCN--IRDLTKEAAGIGDDHGREGMDCTD  168

Query  273  EERSSINFDGKISTE---CIDLKKRGLCLMPLSLLVNYHKQS  157
                 + F  +  T    C +LK +G+CL PLS+L++YH ++
Sbjct  169  AAMDGVRFGDQSQTSIAPCAELKDKGICLFPLSVLLHYHGRT  210



>ref|NP_001143502.1| uncharacterized protein LOC100276181 [Zea mays]
 gb|ACG32627.1| hypothetical protein [Zea mays]
Length=223

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 54/100 (54%), Gaps = 9/100 (9%)
 Frame = -2

Query  444  YDPDLEDTASSPVNSPKDRTFKQQVEINPRRTQN------NVLNYLGKESGFEGFQEMVM  283
            +D  LEDTASSPVNSPK  +   Q+E++P+R  N       V+  +G + G EG      
Sbjct  123  HDGSLEDTASSPVNSPK-VSVVSQLELSPKRRCNIRDLTKGVVG-IGDDHGGEGMDVCTD  180

Query  282  GAEEERSSINFDGKISTE-CIDLKKRGLCLMPLSLLVNYH  166
                E + +      S   C +LK +G+CL P S+L++YH
Sbjct  181  ATTTEGARLGDQYHTSIAPCAELKDKGICLFPFSVLLHYH  220



>gb|EMT30645.1| hypothetical protein F775_09619 [Aegilops tauschii]
Length=194

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (58%), Gaps = 8/99 (8%)
 Frame = -2

Query  444  YDPDLEDTASSPVNSPKDRTFKQQVEINPRRTQNNVLNY-----LGKESGFEGFQ-EMVM  283
            +D  LEDTASSPVNSPK     Q +E +P+R + NV +      +G + G +G   E   
Sbjct  97   HDDSLEDTASSPVNSPKVSALSQ-LEFSPKR-RCNVTDLAKGAGIGNDYGRDGMDCEDAD  154

Query  282  GAEEERSSINFDGKISTECIDLKKRGLCLMPLSLLVNYH  166
               E  S ++   +  T C +LK +GLCL+PLS+L+NY 
Sbjct  155  AVMEGVSFLDQSQRGITPCAELKDKGLCLVPLSMLLNYQ  193



>gb|KDP39074.1| hypothetical protein JCGZ_00831 [Jatropha curcas]
Length=202

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 96/197 (49%), Gaps = 29/197 (15%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIV-----SSPSLVSDaatyaarrkkks  553
            EESGWT YL+DF       ++ +  N +  +C        +S SLVSDAA+ A ++   +
Sbjct  10   EESGWTMYLEDFFAKDNKNNNDNDVNLDHQNCCFSFDDYETSSSLVSDAASLALKKNPDN  69

Query  552  ssdfrrvKNNTECSSLG-----GSQVLRRLNLKNPK----PSDKYYDPD-LEDTASSPVN  403
                     N E  S+G      ++   +L+ K  K     ++   D D LEDTASSPVN
Sbjct  70   CKY------NCEQESVGLSLSIANKCYSKLSFKKRKSKGIANNSLVDDDALEDTASSPVN  123

Query  402  SPKDRTFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKIS--TE  229
            SPK      Q   + ++  NN+   L +  G      ++ G  ++ S  +  G I    E
Sbjct  124  SPKVYDMMNQFNKSTKQRHNNMDISLSQAKG------IISGIADDESRSDHLGFIGRERE  177

Query  228  CIDLKKRGLCLMPLSLL  178
              +L+KRGLCL+PLS++
Sbjct  178  STELRKRGLCLVPLSMV  194



>ref|XP_006370648.1| hypothetical protein POPTR_0001s44530g [Populus trichocarpa]
 gb|ERP67217.1| hypothetical protein POPTR_0001s44530g [Populus trichocarpa]
Length=199

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 81/193 (42%), Gaps = 31/193 (16%)
 Frame = -2

Query  717  EESGWTAYLQDF-------SENKMMGSSSSYSNQEDYDCSIVS-SPSLVSDaatyaarrk  562
            EESGWT Y +DF         N       S+S   D   S+VS + SLV       +   
Sbjct  26   EESGWTMYFEDFFAQNNEEDHNHDRYEHGSFSYDHDRSSSLVSDAASLV----VKKSAGD  81

Query  561  kksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPK--DR  388
                       NN              L+ K  +      D  LEDTASSPVNSPK  D 
Sbjct  82   HLGEQVVGLPINNNRSFKYS-------LSFKKKRTKGALVDDALEDTASSPVNSPKVYDD  134

Query  387  TFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKR  208
                Q + N ++  N  ++   ++ G    Q       ++RS   F G  S     LKKR
Sbjct  135  MMINQYKRNTKQKDNKEIS---QDEGSASRQV------DKRSDFGFIGGGSDNTA-LKKR  184

Query  207  GLCLMPLSLLVNY  169
            GLCL+PLS++VNY
Sbjct  185  GLCLVPLSMVVNY  197



>ref|XP_008455849.1| PREDICTED: uncharacterized protein LOC103495948 [Cucumis melo]
Length=167

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 82/188 (44%), Gaps = 53/188 (28%)
 Frame = -2

Query  714  ESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdfrr  535
            ESGWTAYL                N  D D +   + SL+SDAA++A             
Sbjct  25   ESGWTAYLD---------------NPSDDDTNTFPTSSLLSDAASHAVAAAHPP------  63

Query  534  vKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEINPR  355
                T  + L   ++  +L LK PK    + D  LEDTASSP NSPK             
Sbjct  64   ---TTLTNHL---KIPTKLILK-PKQPHFFVDTSLEDTASSPDNSPK-------------  103

Query  354  RTQNNVLNYLGKESGFEGFQEMVMG------AEEERSSINFDGKISTECIDLKKRGLCLM  193
                 V ++LG   G    ++  +G        E R  I F  K S E  DLKKRGLCL+
Sbjct  104  -----VGDHLGPFDGNHYRRKSSLGNGEKYRDHERRLEIGFKRKAS-EYTDLKKRGLCLV  157

Query  192  PLSLLVNY  169
            PLS+L NY
Sbjct  158  PLSMLTNY  165



>ref|XP_011011271.1| PREDICTED: uncharacterized protein LOC105115900 isoform X1 [Populus 
euphratica]
Length=199

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 87/201 (43%), Gaps = 47/201 (23%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVS-----SPSLVSDaatyaarrkkks  553
            EESGWT Y +DF       ++    N + Y+    S     S SLVSDAA+   ++    
Sbjct  26   EESGWTMYFEDF----FAQNNEEVHNHDRYEHGSFSYDDDRSSSLVSDAASLVVKKSAGD  81

Query  552  ssdfrrvKNNTECSSLGGSQVL-----------RRLNLKNPKPSDKYYDPDLEDTASSPV  406
                             G QV+             L+ K  +      D  LEDTASSPV
Sbjct  82   HH---------------GEQVVGLPLNNNRSFKYSLSFKKKRTKGALVDDALEDTASSPV  126

Query  405  NSPK--DRTFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKIST  232
            NSPK  D     Q + N ++  N  ++   ++ G    Q       ++RS   F G  S 
Sbjct  127  NSPKVYDDMMINQYKRNTKQKDNMEIS---QDEGSASRQV------DKRSDFGFIGGGSD  177

Query  231  ECIDLKKRGLCLMPLSLLVNY  169
                LKKRGLCL+PLS++VNY
Sbjct  178  NTA-LKKRGLCLVPLSMVVNY  197



>ref|NP_001167880.1| hypothetical protein [Zea mays]
 gb|ACN26386.1| unknown [Zea mays]
 tpg|DAA62952.1| TPA: hypothetical protein ZEAMMB73_127731 [Zea mays]
Length=224

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 85/204 (42%), Gaps = 17/204 (8%)
 Frame = -2

Query  732  GREQQEESGWTAYLQDF----SENKMMGSSSSYS--NQEDYDCSIVSSPSLVSDaatyaa  571
            G+ Q  ES WT Y  DF     E K    +SSYS    ED   S         D      
Sbjct  20   GQAQSGESSWTDYFVDFMLSEEERKRQADASSYSYCATEDEGGSKYGGDGSNRDEEEEEE  79

Query  570  rrkkksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPD--LEDTASSPVNSP  397
              +   S            ++L  +   + L     KP  K  D D  LEDTASSPVNSP
Sbjct  80   EEESMVSDAASHAPTTAGATALIPAGRYKELKKLKKKPFGKALDHDGSLEDTASSPVNSP  139

Query  396  KDRTFKQQVEINPRRTQN------NVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKIS  235
            K  +   Q+E++ +R  N       V+  +G + G EG          E + +      S
Sbjct  140  K-VSVVSQLELSAKRRCNIRDLTKGVVG-IGDDHGGEGMDVCTDATTTEGARLGDQYHTS  197

Query  234  TE-CIDLKKRGLCLMPLSLLVNYH  166
               C +LK +G+CL P S+L++YH
Sbjct  198  IAPCAELKDKGICLFPFSVLLHYH  221



>gb|KHG28512.1| hypothetical protein F383_12210 [Gossypium arboreum]
Length=176

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 87/201 (43%), Gaps = 53/201 (26%)
 Frame = -2

Query  735  VGREQQEESGWTAYLQDFSEN-KMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkk  559
            VG E  EES WT Y QDFS + +M G+SSS       +     + SL+SD          
Sbjct  15   VGDETPEESSWTMYFQDFSNDIQMDGNSSSCYCSSYIN---YQTSSLLSD----------  61

Query  558  ksssdfrrvKNNTECSSLGGSQVL-------RRLNLK----NPKPSDKYYDPDLEDTASS  412
                          CS+  G  VL        RL+ K    N   +  + D DLEDTASS
Sbjct  62   ------------AACSA-AGPHVLDQKSCKKNRLSFKKRKNNGSSAAGFVDDDLEDTASS  108

Query  411  PVNSPKDRTFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKIST  232
            PVNSPK      + + +      + ++   K  G         G  +ER+          
Sbjct  109  PVNSPKICNTNMENQFDKNLKMKDAMDKSQKNKG-----SGSSGQTDERN----------  153

Query  231  ECIDLKKRGLCLMPLSLLVNY  169
            +  +LKK+GLCL+PLS++V Y
Sbjct  154  DETELKKKGLCLVPLSMVVQY  174



>ref|XP_008244374.1| PREDICTED: uncharacterized protein LOC103342517 isoform X2 [Prunus 
mume]
Length=167

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 87/205 (42%), Gaps = 48/205 (23%)
 Frame = -2

Query  780  NQRIRKRMSLYEKSFVGREQQEESGWTAYLQDF-SENKMMGSSSSYSNQEDYDCSIVSSP  604
            N  +RK +S         E  EES WT YL+DF + N   G     S+   Y      + 
Sbjct  8    NSMMRKSLSSDNTRATSHESPEESSWTMYLEDFLTSNNDDGDDEERSSFSSYG---YENS  64

Query  603  SLVSDaatyaarrkkksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLED  424
            S++SDAA+   R+    + +     N +        +  RR      K  +   D  LED
Sbjct  65   SIISDAASAITRKLSAINGEVIGFDNRSSF------EFDRR------KTKEDLLDDALED  112

Query  423  TASSPVNSPKDRTFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDG  244
            TASSPVNSPK++                     G  SG            +ER+ + F G
Sbjct  113  TASSPVNSPKEK---------------------GSTSGL----------VDERNELGFIG  141

Query  243  KISTECIDLKKRGLCLMPLSLLVNY  169
            +   +  DLKKRGLCL+P S++ NY
Sbjct  142  R-ENDSTDLKKRGLCLVPFSMVANY  165



>ref|XP_004487590.1| PREDICTED: uncharacterized protein LOC101507125 isoform X1 [Cicer 
arietinum]
Length=172

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 85/188 (45%), Gaps = 49/188 (26%)
 Frame = -2

Query  705  WTAYLQDFSENKMMGS--------SSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkkss  550
            WT Y +DF  N             S S+S+ +D       S SL+SDAA           
Sbjct  23   WTKYFEDFFNNHNNIDINHDDEKCSVSFSDFDD------GSSSLISDAAAKKL-------  69

Query  549  sdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQV  370
                      +C+  G    +R    K  K   +  D DLEDTASSP+NSPK++ +K + 
Sbjct  70   ---------ADCAQDG----MRLSFKKRKKIKTRLVDDDLEDTASSPINSPKNQIYKAK-  115

Query  369  EINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINF-DGKISTECIDLKKRGLCLM  193
                   +   +++L +E G        +G  +E   + F +   S +  +L K+GLCL+
Sbjct  116  -------EKEEIDHLYQEKG------NTLGERDEMKEVGFNEMDTSRDHTELNKKGLCLV  162

Query  192  PLSLLVNY  169
            PLS+++NY
Sbjct  163  PLSMVMNY  170



>ref|XP_008812145.1| PREDICTED: uncharacterized protein LOC103723109 [Phoenix dactylifera]
Length=177

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 92/198 (46%), Gaps = 41/198 (21%)
 Frame = -2

Query  756  SLYEKSFVGREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaaty  577
            +LY K   G    EESGWT Y +DF        +S    ++    SI    S++SDAA+ 
Sbjct  13   ALYSKE--GTPSSEESGWTMYFEDFL-------ASEKKEEDGCSFSIGGGSSVISDAASC  63

Query  576  aarrkkksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSP  397
             A +    +                 ++  ++L+ K  K      D  LEDTASSPVNSP
Sbjct  64   VAWKPSAGAET---------------TKSCKKLSFKKRKGKGILDDDSLEDTASSPVNSP  108

Query  396  KDRTFKQQVEINPRRTQNNVLNYLGKESGFEGF-QEMVMGAE---EERSSINFDGKI--S  235
            K  ++  + ++ P +          K+  ++G  QE  +G     E +  +N  G I  +
Sbjct  109  K-VSYLNRSDVQPNK----------KDDDYKGIPQEEGVGYGNDLELKRDVNELGFIEGT  157

Query  234  TECIDLKKRGLCLMPLSL  181
             EC +LKKRGLCL+P S+
Sbjct  158  NECTELKKRGLCLLPWSI  175



>ref|XP_002317581.1| hypothetical protein POPTR_0011s13900g [Populus trichocarpa]
 gb|EEE98193.1| hypothetical protein POPTR_0011s13900g [Populus trichocarpa]
Length=196

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 88/186 (47%), Gaps = 18/186 (10%)
 Frame = -2

Query  717  EESGWTAYLQD-FSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdf  541
            EESGWT Y +D F++N        ++    +      S S+VSDAA+ A ++        
Sbjct  24   EESGWTMYFEDFFAQNNREDRDHDFNEHSSFSFDHDGSSSMVSDAASLAVKKSAGDHHGE  83

Query  540  rrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPK--DRTFKQQVE  367
            + V       S   +  L++   K         D  LEDTASSPVNSPK  D T   Q +
Sbjct  84   KVVGLPINNKSFKYNSSLKKRRTKGA-----LLDDVLEDTASSPVNSPKVNDDTMISQYK  138

Query  366  INPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLCLMPL  187
               R T+      + ++ G    Q       + RS + F  + S +  +LKKRGLCL+PL
Sbjct  139  ---RNTKQKDKMEISQDKGSASSQ------IDMRSDLGFILRES-DSTELKKRGLCLVPL  188

Query  186  SLLVNY  169
            S++VNY
Sbjct  189  SMVVNY  194



>gb|EMS66211.1| hypothetical protein TRIUR3_32218 [Triticum urartu]
Length=190

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 56/99 (57%), Gaps = 8/99 (8%)
 Frame = -2

Query  444  YDPDLEDTASSPVNSPKDRTFKQQVEINPRRTQNNVLNY-----LGKESGFEGFQ-EMVM  283
            +D  LEDTASSPVNSPK     Q +E +P+R + NV +      +G + G +G   E   
Sbjct  93   HDDSLEDTASSPVNSPKVSALSQ-LEFSPKR-RCNVTDLAKGAGIGNDYGRDGMDCEDAD  150

Query  282  GAEEERSSINFDGKISTECIDLKKRGLCLMPLSLLVNYH  166
               E    ++   +  T C +LK +GLCL+PLS+L+NY 
Sbjct  151  AVMEGVRFLDQSQRGITPCAELKDKGLCLVPLSMLLNYQ  189



>ref|XP_011030839.1| PREDICTED: uncharacterized protein LOC105130164 [Populus euphratica]
Length=196

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 85/192 (44%), Gaps = 30/192 (16%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdfr  538
            EESGWT Y +DF          + +N+ED D       S   D    ++     +S    
Sbjct  24   EESGWTMYFEDFF---------AQNNREDRDHDFSEHSSFSFDHDGSSSMLSDAASLAVM  74

Query  537  rvKNNTECSSLGGSQVLRR-----LNLKNPKPSDKYYDPDLEDTASSPVNSPK--DRTFK  379
            +   +     + G  +  +     L+LK  +      D  LEDTASSPVNSP+  D T  
Sbjct  75   KSAGDHHGEKVVGLPINNKSFKYNLSLKKRRTKGALLDDALEDTASSPVNSPRVNDDTMI  134

Query  378  QQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAE--EERSSINFDGKISTECIDLKKRG  205
               + N +           ++   E  Q+    +   + RS + F  + S +  +LKKRG
Sbjct  135  SHYKRNTK-----------QKDKMEISQDKASASNQIDMRSDLGFILRES-DNTELKKRG  182

Query  204  LCLMPLSLLVNY  169
            LCL+PLS++VNY
Sbjct  183  LCLVPLSMVVNY  194



>ref|XP_004487591.1| PREDICTED: uncharacterized protein LOC101507125 isoform X2 [Cicer 
arietinum]
Length=170

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 83/188 (44%), Gaps = 51/188 (27%)
 Frame = -2

Query  705  WTAYLQDFSENKMMGS--------SSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkkss  550
            WT Y +DF  N             S S+S+ +D       S SL+SDAA           
Sbjct  23   WTKYFEDFFNNHNNIDINHDDEKCSVSFSDFDD------GSSSLISDAAAKKL-------  69

Query  549  sdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQV  370
                      +C+  G    +R    K  K   +  D DLEDTASSP+NSPK    K++ 
Sbjct  70   ---------ADCAQDG----MRLSFKKRKKIKTRLVDDDLEDTASSPINSPKIYKAKEKE  116

Query  369  EINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINF-DGKISTECIDLKKRGLCLM  193
            EI          ++L +E G        +G  +E   + F +   S +  +L K+GLCL+
Sbjct  117  EI----------DHLYQEKG------NTLGERDEMKEVGFNEMDTSRDHTELNKKGLCLV  160

Query  192  PLSLLVNY  169
            PLS+++NY
Sbjct  161  PLSMVMNY  168



>gb|KGN63264.1| hypothetical protein Csa_2G420470 [Cucumis sativus]
Length=167

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 83/188 (44%), Gaps = 53/188 (28%)
 Frame = -2

Query  714  ESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdfrr  535
            ESGWTAYL   S++               D +   + SL+SDAA++A       +     
Sbjct  25   ESGWTAYLDSPSDD---------------DTNTFPTSSLLSDAASHAVAAALPPTPLTNH  69

Query  534  vKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEINPR  355
            ++  T            +L LK PK    + D  LEDTASSP NSPK             
Sbjct  70   LRFPT------------KLILK-PKQPHLFVDTSLEDTASSPDNSPK-------------  103

Query  354  RTQNNVLNYLGKESGFEGFQEMVMG------AEEERSSINFDGKISTECIDLKKRGLCLM  193
                 V ++LG   G    ++  +G        E R  I+F  K S E  DLKKRGLCL+
Sbjct  104  -----VGDHLGPFDGNHYRRKSSLGNGEKYRDHERRLEISFKRKAS-EYTDLKKRGLCLV  157

Query  192  PLSLLVNY  169
            PLS+L NY
Sbjct  158  PLSMLTNY  165



>ref|XP_010060422.1| PREDICTED: uncharacterized protein LOC104448340 [Eucalyptus grandis]
 gb|KCW67183.1| hypothetical protein EUGRSUZ_F00971 [Eucalyptus grandis]
Length=173

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 81/186 (44%), Gaps = 39/186 (21%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdfr  538
            +ES WT Y  DF  N    + SS  +    D S+V S +  S                  
Sbjct  24   QESSWTPYFVDFLMNGQEKNDSSTGHD---DSSLVVSDAATS------------------  62

Query  537  rvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEINP  358
             VK + E    G     +RL+ K  +      D  LEDTASSPVNSPK    ++ ++   
Sbjct  63   AVKKSVEIDQAGSR---KRLSFKKRRKG--PIDDALEDTASSPVNSPKVLGLQKTMD---  114

Query  357  RRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFD--GKISTECIDLKKRGLCLMPLS  184
                    +Y G+E       +     + ++ SI+ D  G+      +LKKRGLCL+PLS
Sbjct  115  --------SYPGQEEDKLSKDDATTSGQRDKISIDLDFAGRGGGNFSELKKRGLCLVPLS  166

Query  183  LLVNYH  166
            ++V Y 
Sbjct  167  MMVKYQ  172



>ref|XP_008455422.1| PREDICTED: uncharacterized protein LOC103495585 [Cucumis melo]
Length=192

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 86/194 (44%), Gaps = 28/194 (14%)
 Frame = -2

Query  741  SFVGREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrk  562
            S  G E+QEESGWT YL+D+  ++++   SS+       CS + S S   D    +    
Sbjct  24   SAAGAEEQEESGWTDYLEDYFNSELVERESSFL------CSSIGSCSNWDDLNNISYPNY  77

Query  561  kksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPD-LEDTASSPVNSPKDRT  385
              + +      N  +            L  K  +    + D D L+DTA+SP++SPK   
Sbjct  78   DINYNINVGNVNYDDFPKS------NNLTFKKTRTQKIFEDDDSLQDTATSPIHSPKVVD  131

Query  384  FKQQV-EINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKR  208
             K +  + NPR   +  +      +G  G Q     + +E+S               +K+
Sbjct  132  LKVRTSQENPRFDDH--ITIFANSTG-SGRQMGKYYSNKEKS-----------VYSAEKK  177

Query  207  GLCLMPLSLLVNYH  166
            GLCL+P S+L+NYH
Sbjct  178  GLCLLPFSMLLNYH  191



>ref|XP_008454531.1| PREDICTED: uncharacterized protein LOC103494923 [Cucumis melo]
Length=181

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 89/198 (45%), Gaps = 33/198 (17%)
 Frame = -2

Query  741  SFVGREQQEESGWTAYLQDFSENKMMGSS----SSYSNQEDYDCSIVSSPSLVSDaatya  574
            ++ G E  E+SGWT Y +DF  +    S     +S+S+   +   +  + S ++      
Sbjct  13   NYHGDESPEDSGWTIYFEDFLNSNNSNSHNQSLTSFSSSH-FSLDVNDAASSIAHHKLPH  71

Query  573  arrkkksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPK  394
                + +       K++   +     ++++ L +K         D  LEDTASSPVNSPK
Sbjct  72   DHNDQVAVQPEFGYKDDDHINVFKKRKMIKELFVK---------DEALEDTASSPVNSPK  122

Query  393  DRTFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLK  214
                   V  +   ++N            +    +++   EER  +    +I  +  +LK
Sbjct  123  -------VSCSTYFSKN------------QDKDNLIVPEVEERKEMGDLIEIGNKYTELK  163

Query  213  KRGLCLMPLSLLVNYHKQ  160
            KRGLCL+PLS+++NY  Q
Sbjct  164  KRGLCLVPLSMVLNYLPQ  181



>gb|KGN43534.1| hypothetical protein Csa_7G044250 [Cucumis sativus]
Length=188

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 83/197 (42%), Gaps = 34/197 (17%)
 Frame = -2

Query  741  SFVGREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrk  562
            S V  E+QEESGWT YL+D+  ++ +   SS+       CS + S S   D    +    
Sbjct  20   SAVRDEEQEESGWTDYLEDYFNSEFVERESSFL------CSSIGSCSNWDDRNNISYPSY  73

Query  561  kksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPD-LEDTASSPVNSPKDRT  385
              + +      N  +            L  K  +    + D D L+DTA+SP++SPK   
Sbjct  74   DINYNINIGNVNYDDFPKS------NNLTFKKTRTQKIFEDDDSLQDTATSPIHSPK---  124

Query  384  FKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTE----CIDL  217
                V++  R +Q N           +GF + +        S    GK  +         
Sbjct  125  ---VVDLKVRTSQEN-----------QGFDDHITIFANSTGSGRQMGKYYSNKEKGVYSA  170

Query  216  KKRGLCLMPLSLLVNYH  166
            +K+GLCL P S+L+NYH
Sbjct  171  EKKGLCLFPFSMLLNYH  187



>ref|XP_007020978.1| CTD small phosphatase-like protein 2, putative [Theobroma cacao]
 gb|EOY12503.1| CTD small phosphatase-like protein 2, putative [Theobroma cacao]
Length=181

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 89/196 (45%), Gaps = 46/196 (23%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSE--NKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkks  553
            E  EES WT Y +  S   + M   +SS+S+  +Y      S SLVSD            
Sbjct  20   EYPEESSWTMYFESLSNKNSDMDVENSSFSSDINY-----QSSSLVSD------------  62

Query  552  ssdfrrvKNNTECSSLG----GSQVLR---RLNLKNPKPS-DKYYDPDLEDTASSPVNSP  397
                        CS+ G    G+ + +   RL+ K  K +  +  D DLEDTASSP NSP
Sbjct  63   ----------AACSAAGRHDFGAPLGKSCNRLSFKKRKCNKGRLVDDDLEDTASSPANSP  112

Query  396  KDRTFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDL  217
            K        + N +  Q +V++   +E G    Q      +E    +   G+   +  +L
Sbjct  113  KVCNLINHFDKNLK--QKDVMDK-SQEKGSASGQ-----IDERNDELGLIGR-EDDGTEL  163

Query  216  KKRGLCLMPLSLLVNY  169
            KK GLCL+PLS++V+Y
Sbjct  164  KKMGLCLVPLSMVVHY  179



>ref|XP_003596661.1| hypothetical protein MTR_2g083300 [Medicago truncatula]
 gb|AES66912.1| hypothetical protein MTR_2g083300 [Medicago truncatula]
Length=173

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 83/183 (45%), Gaps = 39/183 (21%)
 Frame = -2

Query  705  WTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSP--SLVSDaatyaarrkkksssdfrrv  532
            WT Y +DF  N    S +S+S+ +D   S+VS    SLV +                   
Sbjct  24   WTKYFEDFFNNDQKCSINSFSDFDDGSSSLVSDAANSLVGEKKL----------------  67

Query  531  KNNTECSSLGGSQ-VLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVEINPR  355
                + S+ GG + + +    K  K      D DLEDTASSP+NSPK    K++ EI   
Sbjct  68   ---ADQSAQGGMEYIKKLSFKKRKKIITSLVDHDLEDTASSPINSPKVFKAKEKEEI---  121

Query  354  RTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGK-ISTECIDLKKRGLCLMPLSLL  178
                   ++  +E G           ++ER  +  + +  S +  +L K+GLCL+P S++
Sbjct  122  -------DHFYQEKG------NTPREKDERKEVGLNERDTSRDHTELNKKGLCLVPRSMV  168

Query  177  VNY  169
            +NY
Sbjct  169  LNY  171



>ref|XP_010544257.1| PREDICTED: uncharacterized protein LOC104816923 [Tarenaya hassleriana]
Length=190

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 45/89 (51%), Gaps = 12/89 (13%)
 Frame = -2

Query  435  DLEDTASSPVNSPKDRTFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSI  256
            DLEDTASSP NSPK      ++E + R+     +    KE   E    +   A EE S  
Sbjct  112  DLEDTASSPSNSPKICNMLNEMENDTRQESTKDITTKEKECAAEARSTIEGVAHEELS--  169

Query  255  NFDGKISTECIDLKKRGLCLMPLSLLVNY  169
                      ++LKKRGLCL+P+S+L  Y
Sbjct  170  ----------MELKKRGLCLVPMSMLSIY  188



>ref|XP_004248387.1| PREDICTED: glycosyltransferase-like protein gnt13 [Solanum lycopersicum]
Length=180

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 47/89 (53%), Gaps = 9/89 (10%)
 Frame = -2

Query  441  DPDLEDTASSPVNSPKDRTFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERS  262
            D DLEDTASSPVNSPK  ++  ++  N ++ +++   + GK +   G Q M  G      
Sbjct  100  DDDLEDTASSPVNSPK-VSYMNELCNNSQKGKSSASIFEGKGNNISGQQMMTSGLNNSTK  158

Query  261  SINFDGKISTECIDLKKRGLCLMPLSLLV  175
                      +   LKK+GLCL+P+S+  
Sbjct  159  --------ENDSTQLKKKGLCLVPISMFT  179



>gb|KHN27962.1| hypothetical protein glysoja_007694 [Glycine soja]
Length=158

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 79/193 (41%), Gaps = 61/193 (32%)
 Frame = -2

Query  726  EQQEESGWTAYLQDFSENKMMG-------SSSSYSNQEDYDCSIVSSPSLVSDaatyaar  568
            +  EESGWT Y +DF +N  +        S SS+S  + Y      S S VSD       
Sbjct  19   DSSEESGWTKYFEDFFDNHNIDDDDDQKCSMSSFSGVDSY-----YSTSFVSD-------  66

Query  567  rkkksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDR  388
                  S  +++ +NT+ +       L+    K  K      D  LEDTASSP+   K++
Sbjct  67   ------SATKKLTDNTQAAEYDHQSSLK----KRKKIKTALVDDALEDTASSPIKGSKEK  116

Query  387  TFKQQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKR  208
                      R T                     +G  +ER  + F+ +   +   LK +
Sbjct  117  ----------RNT---------------------LGERDERKEMGFN-EGDNDHTKLKNK  144

Query  207  GLCLMPLSLLVNY  169
            GLCL+PLS++V Y
Sbjct  145  GLCLVPLSMIVKY  157



>ref|XP_008341984.1| PREDICTED: uncharacterized protein LOC103404801 [Malus domestica]
 ref|XP_008341985.1| PREDICTED: uncharacterized protein LOC103404801 [Malus domestica]
Length=141

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 57/125 (46%), Gaps = 11/125 (9%)
 Frame = -2

Query  720  QEESGWTAYLQDFSENKMMGSSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkkksssdf  541
            +EESGWTAY +DFS N                 S   + SLVSD           ++   
Sbjct  24   EEESGWTAYFEDFSNNNNNRREEEGXGGRGGAQSFGCTSSLVSD-------AASGAAWKL  76

Query  540  rrvKNNTECSSLG--GSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFKQQVE  367
                N     S+G   + + ++L+ K  + + K    DLEDTASSPVNSPK     + V 
Sbjct  77   VSHNNQNHAGSIGVPPNNISKKLSFKKTR-TKKISGDDLEDTASSPVNSPKIGD-SRPVG  134

Query  366  INPRR  352
            INP R
Sbjct  135  INPDR  139



>ref|XP_009418774.1| PREDICTED: uncharacterized protein LOC103998891 [Musa acuminata 
subsp. malaccensis]
Length=141

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 70/165 (42%), Gaps = 40/165 (24%)
 Frame = -2

Query  804  PLQPKLWENQRIRKRMSLYEKSFVGREQQEESGWTAYLQDFSENKMMGSSSSYSNQEDYD  625
            PL PK+ E+  I   M     S VG    EESGWT Y +DF       +   +S+     
Sbjct  8    PL-PKMEES--INSSMDSAFLSKVGSASSEESGWTMYFEDFMATAAEKAGGVFSS-----  59

Query  624  CSIVSSPSLVSDaatyaarrkkksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKY  445
               VS PS+VSDAA+  A +                 +S   ++  R L+LK  K     
Sbjct  60   -GAVSEPSVVSDAASSVAWKL---------------SASFEVTEDYRELSLKKTKGKRLV  103

Query  444  YDPDLEDTASSPVNSPKDRTFKQQVEINPRRTQNNVLNYLGKESG  310
             D  LEDTASSPV+SPK   F                NYL K +G
Sbjct  104  DDDSLEDTASSPVSSPKVTDF----------------NYLTKNTG  132



>ref|XP_006592877.1| PREDICTED: uncharacterized protein LOC102669408 [Glycine max]
Length=158

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 77/190 (41%), Gaps = 61/190 (32%)
 Frame = -2

Query  717  EESGWTAYLQDFSENKMMG-------SSSSYSNQEDYDCSIVSSPSLVSDaatyaarrkk  559
            EESGWT Y +DF +N  +        S SS+S  + Y      S S VSD          
Sbjct  22   EESGWTKYFEDFFDNHNIDDDDDQKCSMSSFSGVDSY-----YSTSFVSD----------  66

Query  558  ksssdfrrvKNNTECSSLGGSQVLRRLNLKNPKPSDKYYDPDLEDTASSPVNSPKDRTFK  379
               S  +++ +NT+         L+    K  K      D  LEDTASSP+   K++   
Sbjct  67   ---SATKKLTDNTQAEEYDHQSSLK----KRKKIKTALVDDALEDTASSPIKGSKEK---  116

Query  378  QQVEINPRRTQNNVLNYLGKESGFEGFQEMVMGAEEERSSINFDGKISTECIDLKKRGLC  199
                   R T                     +G  +ER  + F+ +   +   LK +GLC
Sbjct  117  -------RNT---------------------LGERDERKEMGFN-EGDNDHTKLKNKGLC  147

Query  198  LMPLSLLVNY  169
            L+PLS++V Y
Sbjct  148  LVPLSMIVKY  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1524425518816