BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15548_g2_i2 len=1296 path=[307:0-765 1072:766-1295]

Length=1296
                                                                      Score     E

ref|XP_009608718.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...    249   2e-75   
ref|XP_009786469.1|  PREDICTED: uncharacterized protein LOC104234...    246   1e-74   
ref|XP_009608719.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...    246   3e-74   
ref|XP_009786470.1|  PREDICTED: uncharacterized protein LOC104234...    243   2e-73   
ref|XP_006359023.1|  PREDICTED: UPF0544 protein C5orf45 homolog         211   4e-60   
ref|XP_004253268.1|  PREDICTED: UPF0544 protein C5orf45 isoform X1      208   4e-59   
ref|XP_010062069.1|  PREDICTED: UPF0544 protein C5orf45 homolog         198   2e-56   
ref|XP_011100708.1|  PREDICTED: uncharacterized protein LOC105178849    200   2e-56   
ref|XP_010314906.1|  PREDICTED: UPF0544 protein C5orf45 isoform X2      197   5e-55   
ref|XP_002302155.2|  hypothetical protein POPTR_0002s06350g             175   1e-47   Populus trichocarpa [western balsam poplar]
ref|XP_011026321.1|  PREDICTED: UPF0544 protein C5orf45 homolog         172   2e-46   
ref|XP_002527094.1|  conserved hypothetical protein                     170   1e-45   Ricinus communis
ref|XP_010261056.1|  PREDICTED: UPF0544 protein C5orf45 homolog         168   4e-45   
ref|XP_004489908.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...    166   4e-44   
ref|XP_004489909.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...    163   3e-43   
emb|CDP01132.1|  unnamed protein product                                160   6e-43   
ref|XP_009335161.1|  PREDICTED: UPF0544 protein C5orf45 isoform X1      162   1e-42   
ref|XP_007151942.1|  hypothetical protein PHAVU_004G088900g             161   2e-42   
ref|XP_010534119.1|  PREDICTED: uncharacterized protein LOC104809747    160   5e-42   
ref|XP_010428008.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...    160   1e-41   
ref|XP_007201598.1|  hypothetical protein PRUPE_ppa019256mg             159   2e-41   
ref|NP_001077810.1|  uncharacterized protein                            159   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010471185.1|  PREDICTED: UPF0544 protein C5orf45 homolog         157   9e-41   
ref|XP_010415885.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...    157   1e-40   
ref|XP_006302709.1|  hypothetical protein CARUB_v10020821mg             156   2e-40   
ref|XP_009786471.1|  PREDICTED: UPF0544 protein C5orf45 isoform X3      155   2e-40   
gb|KFK41597.1|  hypothetical protein AALP_AA2G149200                    156   2e-40   
ref|XP_010415884.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...    155   4e-40   
ref|NP_177321.1|  uncharacterized protein                               154   7e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72825.1|  BnaC06g32730D                                          154   8e-40   
ref|XP_006574775.1|  PREDICTED: uncharacterized protein LOC100799...    153   1e-39   
ref|XP_006574776.1|  PREDICTED: uncharacterized protein LOC100799...    151   7e-39   
ref|XP_010428007.1|  PREDICTED: uncharacterized protein LOC104712...    151   5e-38   
ref|XP_002887386.1|  hypothetical protein ARALYDRAFT_316144             149   5e-38   
ref|XP_009335162.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...    145   2e-37   
ref|XP_006390746.1|  hypothetical protein EUTSA_v10019840mg             144   4e-37   
ref|XP_009105834.1|  PREDICTED: uncharacterized protein LOC103831685    146   4e-37   
ref|XP_010681430.1|  PREDICTED: UPF0544 protein C5orf45                 145   4e-36   
gb|KHN00719.1|  hypothetical protein glysoja_000387                     139   3e-34   
ref|XP_008456719.1|  PREDICTED: UPF0544 protein C5orf45 homolog         136   5e-33   
ref|XP_004141004.1|  PREDICTED: uncharacterized protein LOC101212383    135   2e-32   
ref|XP_004159474.1|  PREDICTED: uncharacterized protein LOC101224695    134   5e-32   
ref|XP_009385626.1|  PREDICTED: uncharacterized protein LOC103972937    129   4e-31   
ref|XP_010645821.1|  PREDICTED: UPF0544 protein C5orf45 homolog         127   2e-30   
gb|AAU44427.1|  hypothetical protein AT1G71760                          124   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004292507.1|  PREDICTED: uncharacterized protein LOC101306884    122   9e-30   
ref|XP_006473876.1|  PREDICTED: UPF0544 protein C5orf45 homolog         127   2e-29   
ref|XP_003637172.1|  hypothetical protein MTR_076s0004                  124   4e-29   
ref|XP_004969752.1|  PREDICTED: uncharacterized protein LOC101760574    122   1e-28   
ref|XP_002458408.1|  hypothetical protein SORBIDRAFT_03g032910          120   1e-27   Sorghum bicolor [broomcorn]
ref|XP_008654723.1|  PREDICTED: uncharacterized protein LOC100277...    119   2e-27   
ref|XP_008654731.1|  PREDICTED: uncharacterized protein LOC100277...    119   3e-27   
ref|NP_001144200.1|  uncharacterized protein LOC100277060               117   5e-27   Zea mays [maize]
ref|XP_006842172.1|  hypothetical protein AMTR_s00078p00151820          117   9e-27   
ref|XP_006434547.1|  hypothetical protein CICLE_v10001857mg             119   1e-26   
ref|XP_010929935.1|  PREDICTED: uncharacterized protein LOC105051257    115   1e-26   
ref|XP_008237537.1|  PREDICTED: UPF0544 protein C5orf45 homolog         109   8e-26   
gb|KEH15389.1|  UPF0544 C5orf45-like protein, putative                  111   1e-25   
ref|XP_010232239.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...    112   1e-25   
ref|XP_010232238.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...    113   2e-25   
emb|CDM83612.1|  unnamed protein product                                111   6e-25   
gb|EPS71719.1|  hypothetical protein M569_03040                         107   1e-24   
dbj|BAJ99096.1|  predicted protein                                      109   4e-24   
gb|KDP36030.1|  hypothetical protein JCGZ_09996                         108   5e-24   
dbj|BAD87382.1|  hypothetical protein                                   108   8e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EEE55299.1|  hypothetical protein OsJ_03253                          108   9e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71390.1|  hypothetical protein OsI_03514                          107   1e-23   Oryza sativa Indica Group [Indian rice]
ref|NP_001044069.2|  Os01g0716300                                       107   2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|KHG28108.1|  Lipoyl synthase, mitochondrial                          106   6e-23   
emb|CBI29361.3|  unnamed protein product                                100   1e-21   
ref|XP_006644621.1|  PREDICTED: uncharacterized protein LOC102713135    101   4e-21   
ref|XP_008381906.1|  PREDICTED: UPF0544 protein C5orf45               95.5    8e-21   
gb|KEH15761.1|  hypothetical protein MTR_0571s0030                    89.7    4e-18   
gb|KDO83839.1|  hypothetical protein CISIN_1g038280mg                 86.7    5e-16   
ref|XP_010092786.1|  hypothetical protein L484_002099                 80.5    1e-14   
ref|XP_002988691.1|  hypothetical protein SELMODRAFT_128442           74.7    1e-12   
ref|XP_002986378.1|  hypothetical protein SELMODRAFT_123957           74.7    1e-12   
gb|EKC23336.1|  UPF0544 protein C5orf45-like protein                  78.6    1e-12   
ref|XP_005830260.1|  hypothetical protein GUITHDRAFT_110694           77.0    3e-12   
ref|XP_003217508.2|  PREDICTED: UPF0544 protein C5orf45 homolog i...  63.2    2e-07   
ref|XP_008103053.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...  59.3    4e-07   
ref|XP_002154173.2|  PREDICTED: UPF0544 protein C5orf45-like          60.1    6e-07   
ref|XP_008471703.1|  PREDICTED: UPF0544 protein C5orf45 homolog       61.2    8e-07   
gb|EFA83305.1|  hypothetical protein PPL_04095                        61.2    9e-07   Polysphondylium pallidum PN500
dbj|GAM17608.1|  hypothetical protein SAMD00019534_007830             60.5    1e-06   
gb|EHJ69538.1|  hypothetical protein KGM_19336                        57.0    5e-06   
ref|XP_005295889.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...  58.5    5e-06   
ref|XP_005295890.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...  58.2    6e-06   
emb|CBN74166.1|  conserved unknown protein                            58.2    8e-06   
ref|XP_004357399.1|  hypothetical protein DFA_02677                   58.2    8e-06   
ref|XP_006681119.1|  hypothetical protein BATDEDRAFT_27013            55.5    8e-06   
ref|XP_006613954.1|  PREDICTED: UPF0544 protein C5orf45 homolog       55.1    2e-05   
ref|XP_006818635.1|  PREDICTED: uncharacterized protein LOC102801830  56.6    3e-05   
ref|XP_009010168.1|  hypothetical protein HELRODRAFT_166695           55.5    3e-05   
ref|XP_004412740.1|  PREDICTED: UPF0544 protein C5orf45 homolog       55.8    3e-05   
gb|EDL33723.1|  RIKEN cDNA 3010026O09, isoform CRA_d                  53.1    4e-05   
ref|XP_004924696.1|  PREDICTED: UPF0544 protein C5orf45 homolog       55.1    4e-05   
ref|XP_002593187.1|  hypothetical protein BRAFLDRAFT_72734            55.5    5e-05   Branchiostoma floridae
ref|XP_009465138.1|  PREDICTED: UPF0544 protein C5orf45 homolog       55.1    5e-05   
gb|AFZ78530.1|  aminotransferase                                      53.1    6e-05   
ref|XP_006923422.1|  PREDICTED: UPF0544 protein C5orf45 homolog       53.1    6e-05   
ref|XP_005096819.1|  PREDICTED: uncharacterized protein LOC101846282  55.1    8e-05   
gb|EDM04253.1|  similar to RIKEN cDNA 3010026O09 (predicted), iso...  52.0    1e-04   
ref|XP_002674783.1|  predicted protein                                53.5    1e-04   Naegleria gruberi strain NEG-M
ref|XP_646242.1|  hypothetical protein DDB_G0269744                   54.7    1e-04   Dictyostelium discoideum AX4
ref|XP_007951625.1|  PREDICTED: UPF0544 protein C5orf45 homolog       51.6    2e-04   
ref|XP_009559915.1|  PREDICTED: UPF0544 protein C5orf45 homolog       53.9    2e-04   
ref|XP_008500478.1|  PREDICTED: UPF0544 protein C5orf45 homolog       53.5    2e-04   
dbj|BAB31698.1|  unnamed protein product                              53.5    2e-04   Mus musculus [mouse]
gb|KFM60606.1|  hypothetical protein X975_15856                       52.8    2e-04   
ref|NP_080819.2|  UPF0544 protein C5orf45 homolog                     53.5    2e-04   Mus musculus [mouse]
ref|XP_010177500.1|  PREDICTED: UPF0544 protein C5orf45 homolog       53.5    2e-04   
ref|XP_008707766.1|  PREDICTED: UPF0544 protein C5orf45 homolog       53.1    2e-04   
ref|XP_009063210.1|  hypothetical protein LOTGIDRAFT_69762            50.1    2e-04   
ref|XP_010899412.1|  PREDICTED: UPF0544 protein C5orf45 homolog       53.1    2e-04   
ref|NP_001246788.1|  CG43295                                          51.2    2e-04   
ref|XP_008850465.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...  53.1    3e-04   
ref|XP_004945012.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...  52.8    3e-04   
ref|XP_007542873.1|  PREDICTED: UPF0544 protein C5orf45 homolog       52.0    3e-04   
ref|XP_005350214.1|  PREDICTED: LOW QUALITY PROTEIN: UPF0544 prot...  52.8    3e-04   
ref|XP_007906321.1|  PREDICTED: UPF0544 protein C5orf45 homolog       53.1    3e-04   
ref|XP_007629821.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...  52.8    3e-04   
ref|XP_006987155.1|  PREDICTED: UPF0544 protein C5orf45 homolog       52.8    3e-04   
ref|XP_007671294.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...  52.8    3e-04   
ref|XP_005147395.1|  PREDICTED: UPF0544 protein C5orf45 homolog       52.8    3e-04   
ref|NP_001102500.2|  UPF0544 protein C5orf45 homolog                  52.8    4e-04   Rattus norvegicus [brown rat]
ref|XP_414603.2|  PREDICTED: UPF0544 protein C5orf45 homolog isof...  52.4    4e-04   Gallus gallus [bantam]
ref|XP_005893497.1|  PREDICTED: UPF0544 protein C5orf45 homolog       52.0    6e-04   
ref|XP_010828979.1|  PREDICTED: UPF0544 protein C5orf45 homolog       51.6    8e-04   
ref|XP_004759061.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...  51.6    8e-04   
ref|XP_005072028.1|  PREDICTED: UPF0544 protein C5orf45 homolog       51.2    8e-04   
ref|XP_010591537.1|  PREDICTED: UPF0544 protein C5orf45 homolog i...  49.3    8e-04   
ref|XP_005339397.1|  PREDICTED: UPF0544 protein C5orf45 homolog       51.2    8e-04   
ref|XP_004008432.1|  PREDICTED: UPF0544 protein C5orf45 homolog       51.2    0.001   
ref|XP_004387241.1|  PREDICTED: UPF0544 protein C5orf45 homolog       51.2    0.001   
ref|XP_011069012.1|  PREDICTED: UPF0544 protein C5orf45 homolog       50.1    0.001   



>ref|XP_009608718.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=299

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 144/307 (47%), Positives = 182/307 (59%), Gaps = 46/307 (15%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  VF+AVQCCQCSTMQVKQ+KKSSNKW CVVCNQKQSVR+VFAQG+ AKDVR+FVQNFN
Sbjct  1     MPTVFVAVQCCQCSTMQVKQQKKSSNKWTCVVCNQKQSVRKVFAQGYKAKDVRLFVQNFN  60

Query  1086  MSRQFSD---LAQHEEPQTLE-GPAEEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGDGL  919
             MSRQF+D   +   EE +TLE G   +     KRTDWTEYLD E+ ++E  ++   GD +
Sbjct  61    MSRQFTDQLPVVGREETETLEIGEQNQSHRSYKRTDWTEYLDPEENAIENNEDSVQGDVM  120

Query  918   ETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIGMMAKEG  739
             E +IVTELPK +F++PKL+ YSA      +  FRP F+KR+ RKQST QG +        
Sbjct  121   EPKIVTELPKELFRKPKLNKYSA-----VEGHFRPVFSKRNARKQSTSQGME--------  167

Query  738   PDREDFTVASQDVPSWSRNR---------------------------DAKANDKKLVSKE  640
             P +   T+ S  V  W  N+                           D   N++ L   +
Sbjct  168   PSKRQATMTSM-VSKWGDNKRVPPDMSVQPATDSLCKLDDSINLYGNDNSMNERNLGYGK  226

Query  639   PTEGSLLTTAKWMSKWSEYITADADDDNLELESGGWLTSGKDRWNNIALENPIKDHKV-D  463
              TE S   TA  +SKW+EYI  D DD  L   SG   TS  ++W+N      +KD K+ D
Sbjct  227   STERSQPKTANKVSKWTEYINVDEDDCQLRFASGRGFTSDVNKWSNDTFGTSLKDQKLDD  286

Query  462   EDIHPDF  442
             E+IHP F
Sbjct  287   EEIHPHF  293



>ref|XP_009786469.1| PREDICTED: uncharacterized protein LOC104234576 isoform X1 [Nicotiana 
sylvestris]
Length=293

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 140/299 (47%), Positives = 183/299 (61%), Gaps = 31/299 (10%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  VF+AVQCCQCSTMQVKQ+KKSS KW CVVCNQKQSVR+VFAQG+ AKDVR+FVQNFN
Sbjct  1     MPTVFVAVQCCQCSTMQVKQQKKSSCKWTCVVCNQKQSVRKVFAQGYKAKDVRLFVQNFN  60

Query  1086  MSRQFSDL--AQHEEPQTLE-GPAEEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGDGLE  916
             MSRQF+D      EE +TLE G   +     KRTDWTEYLD E+ ++E  ++   GD +E
Sbjct  61    MSRQFTDRLPVVREETETLEIGEQSQSHGSYKRTDWTEYLDPEENAIENNEDSVQGDVME  120

Query  915   TRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKD--------I  760
              +IVTE+P  +F++PKL+NYSA      +  FRP F+KR+ RKQST QG +        +
Sbjct  121   PKIVTEMPNELFRKPKLNNYSA-----VEGHFRPVFSKRNARKQSTSQGMEPSKRQATMV  175

Query  759   GMMAKEG------------PDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLT  616
              +++K G            P    F      +  +    D   N++ L   + TE +   
Sbjct  176   SVVSKWGDNKQVPPDMPVQPATNSFCKLDDSINLYG--NDNSMNERNLGYGKSTERTQPK  233

Query  615   TAKWMSKWSEYITADADDDNLELESGGWLTSGKDRWNNIALENPIKDHKV-DEDIHPDF  442
             TA  +SKW+EYI  D DD  L   SG   TS  ++W+N   E  ++D K+ DE+IHPDF
Sbjct  234   TANKVSKWTEYINVDEDDCQLRFASGRGFTSDVNKWSNDTFETSLQDQKLDDEEIHPDF  292



>ref|XP_009608719.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=297

 Score =   246 bits (628),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 144/307 (47%), Positives = 183/307 (60%), Gaps = 48/307 (16%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  VF+AVQCCQCSTMQVKQ+KKSSNKW CVVCNQKQSVR+VFAQG+ AKDVR+FVQNFN
Sbjct  1     MPTVFVAVQCCQCSTMQVKQQKKSSNKWTCVVCNQKQSVRKVFAQGYKAKDVRLFVQNFN  60

Query  1086  MSRQFSD---LAQHEEPQTLE-GPAEEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGDGL  919
             MSRQF+D   +   EE +TLE G   +     KRTDWTEYLD E+ ++E  ++  +GD +
Sbjct  61    MSRQFTDQLPVVGREETETLEIGEQNQSHRSYKRTDWTEYLDPEENAIENNED--SGDVM  118

Query  918   ETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIGMMAKEG  739
             E +IVTELPK +F++PKL+ YSA      +  FRP F+KR+ RKQST QG +        
Sbjct  119   EPKIVTELPKELFRKPKLNKYSA-----VEGHFRPVFSKRNARKQSTSQGME--------  165

Query  738   PDREDFTVASQDVPSWSRNR---------------------------DAKANDKKLVSKE  640
             P +   T+ S  V  W  N+                           D   N++ L   +
Sbjct  166   PSKRQATMTSM-VSKWGDNKRVPPDMSVQPATDSLCKLDDSINLYGNDNSMNERNLGYGK  224

Query  639   PTEGSLLTTAKWMSKWSEYITADADDDNLELESGGWLTSGKDRWNNIALENPIKDHKV-D  463
              TE S   TA  +SKW+EYI  D DD  L   SG   TS  ++W+N      +KD K+ D
Sbjct  225   STERSQPKTANKVSKWTEYINVDEDDCQLRFASGRGFTSDVNKWSNDTFGTSLKDQKLDD  284

Query  462   EDIHPDF  442
             E+IHP F
Sbjct  285   EEIHPHF  291



>ref|XP_009786470.1| PREDICTED: uncharacterized protein LOC104234576 isoform X2 [Nicotiana 
sylvestris]
Length=291

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/299 (47%), Positives = 184/299 (62%), Gaps = 33/299 (11%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  VF+AVQCCQCSTMQVKQ+KKSS KW CVVCNQKQSVR+VFAQG+ AKDVR+FVQNFN
Sbjct  1     MPTVFVAVQCCQCSTMQVKQQKKSSCKWTCVVCNQKQSVRKVFAQGYKAKDVRLFVQNFN  60

Query  1086  MSRQFSDL--AQHEEPQTLE-GPAEEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGDGLE  916
             MSRQF+D      EE +TLE G   +     KRTDWTEYLD E+ ++E  ++  +GD +E
Sbjct  61    MSRQFTDRLPVVREETETLEIGEQSQSHGSYKRTDWTEYLDPEENAIENNED--SGDVME  118

Query  915   TRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKD--------I  760
              +IVTE+P  +F++PKL+NYSA      +  FRP F+KR+ RKQST QG +        +
Sbjct  119   PKIVTEMPNELFRKPKLNNYSA-----VEGHFRPVFSKRNARKQSTSQGMEPSKRQATMV  173

Query  759   GMMAKEG------------PDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLT  616
              +++K G            P    F      +  +    D   N++ L   + TE +   
Sbjct  174   SVVSKWGDNKQVPPDMPVQPATNSFCKLDDSINLYG--NDNSMNERNLGYGKSTERTQPK  231

Query  615   TAKWMSKWSEYITADADDDNLELESGGWLTSGKDRWNNIALENPIKDHKV-DEDIHPDF  442
             TA  +SKW+EYI  D DD  L   SG   TS  ++W+N   E  ++D K+ DE+IHPDF
Sbjct  232   TANKVSKWTEYINVDEDDCQLRFASGRGFTSDVNKWSNDTFETSLQDQKLDDEEIHPDF  290



>ref|XP_006359023.1| PREDICTED: UPF0544 protein C5orf45 homolog [Solanum tuberosum]
Length=361

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 178/309 (58%), Gaps = 43/309 (14%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  VFIAVQCC+CSTMQVKQ+KKS NKW CVVCNQKQSVR+VFAQG+ AK++R+FVQ+FN
Sbjct  1     MPTVFIAVQCCECSTMQVKQQKKSFNKWTCVVCNQKQSVRKVFAQGYKAKEIRLFVQSFN  60

Query  1086  MSRQFSD---LAQHEEPQTLEGPAEEDRFPS-KRTDWTEYLDFEDESVEKEDEQSTGDGL  919
             MSRQF+D   +   EE +TL+   +     S KR DWTEYLD E++++E  +++ +GD +
Sbjct  61    MSRQFTDQLPVIDREEIETLDIEEQNQSHGSLKRKDWTEYLDPEEDAIE--NDEISGDVM  118

Query  918   ETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIGMMAKEG  739
             E +IVTELPK +F+RP+L+NYSA         F+P F+KR+ RKQS  QG          
Sbjct  119   EPKIVTELPKELFRRPRLNNYSA-----VAGNFKPVFSKRNARKQSISQGYRNAQNTDVE  173

Query  738   PDREDFTVASQDVPSWSRNR---------------------------DAKANDKKLVSKE  640
             P +   T+AS  +  W  NR                           D   N+  L  ++
Sbjct  174   PSKHQATMASV-ISKWGDNRTAPLDMSVQPATDSVCKLNEGINLYDNDNYRNEGDLGYRQ  232

Query  639   PTEGSLLTTAKWMSKWSEYITADADDDNLELESGGWLTSGKD----RWNNIALENPIKDH  472
               + S   TA  +SKW+EYIT D DD   +  SG   TS  +    R+++   E  +   
Sbjct  233   SVQRSQPKTANKVSKWTEYITEDEDDCLSQFASGRGFTSELNEDIIRYDHDNCEGNLGYS  292

Query  471   KVDEDIHPD  445
             K ++  HP+
Sbjct  293   KSEQRSHPN  301


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -1

Query  615  TAKWMSKWSEYITADADDDNLELESGGWLTSGKDRWNNIALENPIKDHKV-DEDIHPDF  442
            TA   SKW+EYIT D DD + +  SG   TS  ++W+    E  +KD ++ DE+IHPDF
Sbjct  302  TANKASKWTEYITEDEDDCHSQFASGRGSTSDVNKWSGNTFETSLKDQRLDDEEIHPDF  360



>ref|XP_004253268.1| PREDICTED: UPF0544 protein C5orf45 isoform X1 [Solanum lycopersicum]
Length=364

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 164/281 (58%), Gaps = 43/281 (15%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  VFIAVQCC+CSTMQVKQ+KKSSNKW CVVCNQKQSVR+VFAQG+ AK++R+FVQ+FN
Sbjct  1     MPTVFIAVQCCECSTMQVKQQKKSSNKWTCVVCNQKQSVRKVFAQGYKAKEIRLFVQSFN  60

Query  1086  MSRQFSD---LAQHEEPQTLEGPAEEDRFPS---KRTDWTEYLDFEDESVEKEDEQSTGD  925
             MSRQF+D   +   EE +TL+   EE        KR DWTEYLD E++++    ++ +GD
Sbjct  61    MSRQFTDQLPVIDREEIETLD--IEEQNLSHGSLKRKDWTEYLDPEEDAIGT--DEVSGD  116

Query  924   GLETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIGMMAK  745
              +E +IVTELPK +F+RP+L+NYSA         F+P F+KR+ RKQST QG       +
Sbjct  117   VVEPKIVTELPKELFRRPRLNNYSA-----VAGNFKPVFSKRNARKQSTSQGYRNAQNTE  171

Query  744   EGPDREDFTVASQDVPSWSRNR---------------------------DAKANDKKLVS  646
               P +   T+AS  +  W  NR                           D   N+ +L  
Sbjct  172   VEPSKHQATMASV-ISKWGDNRTTPLDVSAQPAANSVCKLNEGINLYDNDNYRNEGELGY  230

Query  645   KEPTEGSLLTTAKWMSKWSEYITADADDDNLELESGGWLTS  523
                   S   TA  +SKW+EYIT D DD   +  SG   TS
Sbjct  231   GMSVHRSQPKTANKVSKWAEYITEDEDDCLSQFASGRGFTS  271



>ref|XP_010062069.1| PREDICTED: UPF0544 protein C5orf45 homolog [Eucalyptus grandis]
 gb|KCW69138.1| hypothetical protein EUGRSUZ_F02675 [Eucalyptus grandis]
Length=265

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 130/280 (46%), Positives = 164/280 (59%), Gaps = 37/280 (13%)
 Frame = -1

Query  1254  FIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSRQ  1075
             FIA+QCCQCSTMQVKQ+KKSSNKW CVVCNQKQSVR+VFA+ FMAKDVR FVQ+FNMSR 
Sbjct  13    FIALQCCQCSTMQVKQQKKSSNKWTCVVCNQKQSVRKVFARAFMAKDVRKFVQSFNMSRL  72

Query  1074  FSDLAQHEEPQTLEGPAEEDRFPS------KRTDWTEYLDFEDESVEKEDEQSTGDGLET  913
              SDL   + P    G A  DR         KR+DW+E+LD E    EK DE+   DG   
Sbjct  73    SSDLEAPDPPPEGRGGAVHDRAGGSDGRKLKRSDWSEFLDVEQ---EKRDEEEGDDG-GM  128

Query  912   RIVTELPKAVFKRPKL---SNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIGMMAKE  742
             +IVTELPK +FK+ KL   S+ SAGS+ D  K F P F KR  RKQ+TF  ++     K+
Sbjct  129   KIVTELPKEIFKKSKLRDSSHQSAGSKGD--KLFTPLFAKRSIRKQTTFPDEE----PKK  182

Query  741   GPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYITADADD  562
               +   FT +     +W+ ++     D  +             A   SKWS Y+      
Sbjct  183   NQNGLAFTTS-----NWTNSKRESDIDPVITPS--------AAATRNSKWSNYMPQ----  225

Query  561   DNLELESGGWLTSGKDRWNNIALENPIKDHKVDEDIHPDF  442
             D + L+S  +   G DR+ N  LE+   D +V+EDIHPDF
Sbjct  226   DEVTLQSHVYEDDG-DRFGNGVLESKTNDQEVEEDIHPDF  264



>ref|XP_011100708.1| PREDICTED: uncharacterized protein LOC105178849 [Sesamum indicum]
Length=324

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 129/325 (40%), Positives = 178/325 (55%), Gaps = 52/325 (16%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M A FIAVQC QCSTMQVKQ KKSS +W CVVC++KQSVR+VFAQG MAKDVR FVQNFN
Sbjct  1     MPATFIAVQCFQCSTMQVKQEKKSSKRWSCVVCDEKQSVRKVFAQGSMAKDVRHFVQNFN  60

Query  1086  MSRQFSDLAQH--EEPQTLEGPAEEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGDGLET  913
             MSR+ SD  Q   EE +T+  P ++ +   KR DWTEY+D ++E   K DE  T   +E 
Sbjct  61    MSRELSDQKQFLLEETETINSPIDDQKRTKKRNDWTEYVDDQEEHCTKYDEDRTLSEVEE  120

Query  912   RIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQ-----------STFQGK  766
              +VTE+PKA+FK+PKL  YS+  +   +KRF+P F  R+  K+           +  Q  
Sbjct  121   IVVTEMPKALFKKPKLKGYSSSGDG-AEKRFKPLFLNRNNAKRHQNDHSQGIQYTEIQQT  179

Query  765   DIGMMAKEG-----PDREDFTV-ASQDVPSWSRNR---------DAKANDKKLVSKEPTE  631
               G  +K+      PD +  T+  S+    W++ R          A  + ++   ++P +
Sbjct  180   SCGRTSKKRHQDIFPDDQAITLHTSEKALKWNQLRAQIQENNSNAANMDMEEPCLQQPVK  239

Query  630   GSLLTTAKW----------------------MSKWSEYITADADDDNLELESGGWLTSGK  517
             G+  + +KW                      +SKWS +IT + DD  LE    G    G 
Sbjct  240   GAKRSISKWNGYIAQDDNNYANGTPTAEKGPVSKWSSFIT-EEDDYLLETRGRGDSWDGV  298

Query  516   DRWNNIALENPIKDHKVDEDIHPDF  442
                NN   E+ + D +V++DIHPDF
Sbjct  299   SEQNNDLFESILNDERVEDDIHPDF  323



>ref|XP_010314906.1| PREDICTED: UPF0544 protein C5orf45 isoform X2 [Solanum lycopersicum]
Length=361

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 161/279 (58%), Gaps = 42/279 (15%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  VFIAVQCC+CSTMQ   +KKSSNKW CVVCNQKQSVR+VFAQG+ AK++R+FVQ+FN
Sbjct  1     MPTVFIAVQCCECSTMQ---QKKSSNKWTCVVCNQKQSVRKVFAQGYKAKEIRLFVQSFN  57

Query  1086  MSRQFSD---LAQHEEPQTLEGPAEEDRFPS-KRTDWTEYLDFEDESVEKEDEQSTGDGL  919
             MSRQF+D   +   EE +TL+   +     S KR DWTEYLD E++++    ++ +GD +
Sbjct  58    MSRQFTDQLPVIDREEIETLDIEEQNLSHGSLKRKDWTEYLDPEEDAIGT--DEVSGDVV  115

Query  918   ETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIGMMAKEG  739
             E +IVTELPK +F+RP+L+NYSA         F+P F+KR+ RKQST QG       +  
Sbjct  116   EPKIVTELPKELFRRPRLNNYSA-----VAGNFKPVFSKRNARKQSTSQGYRNAQNTEVE  170

Query  738   PDREDFTVASQDVPSWSRNR---------------------------DAKANDKKLVSKE  640
             P +   T+AS  +  W  NR                           D   N+ +L    
Sbjct  171   PSKHQATMASV-ISKWGDNRTTPLDVSAQPAANSVCKLNEGINLYDNDNYRNEGELGYGM  229

Query  639   PTEGSLLTTAKWMSKWSEYITADADDDNLELESGGWLTS  523
                 S   TA  +SKW+EYIT D DD   +  SG   TS
Sbjct  230   SVHRSQPKTANKVSKWAEYITEDEDDCLSQFASGRGFTS  268



>ref|XP_002302155.2| hypothetical protein POPTR_0002s06350g [Populus trichocarpa]
 gb|EEE81428.2| hypothetical protein POPTR_0002s06350g [Populus trichocarpa]
Length=265

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 120/287 (42%), Positives = 165/287 (57%), Gaps = 35/287 (12%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             MQ +FIA+QC QCSTMQVKQ+KKSSNKW CVVCNQKQSVR+VFAQG +AKD+R FVQ+FN
Sbjct  1     MQTIFIALQCYQCSTMQVKQKKKSSNKWTCVVCNQKQSVRKVFAQGCLAKDLRKFVQSFN  60

Query  1086  MSRQFSDLAQHEEPQTLEGPA--------EEDRFPSKRTDWTEYLDFEDESVEKEDEQST  931
             MSR+ +D     +   +  P          ED    +R+DWTEYLD E+E   K++++  
Sbjct  61    MSRKIADEQDSLDQDAVLIPTSETDHIGLNEDCQRKRRSDWTEYLDAEEEYNIKQEDEGE  120

Query  930   GDGLETRIVTELPKAVFKRPKLSN---YSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDI  760
               GL   +VTELPK +FK+P+L N    ++G   D    ++P F+KR+  K         
Sbjct  121   EPGL--MVVTELPKEMFKKPRLKNDFGQNSGDHGD-GNLYKPVFSKRNASKIP-------  170

Query  759   GMMAKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYI  580
               M+++   R+  +        WS +   +A +++ +S +PT G   T A   SKW +YI
Sbjct  171   --MSRDKESRKYQSTKPAGNSKWS-DCMTQAEEEERIS-QPTTGK--TKA---SKWKDYI  221

Query  579   TADADDDNLELESGGWLTSGKDRWNNIALENPI-KDHKVDEDIHPDF  442
             T D D  N    SG     G    N    EN +  D KV++D+HPDF
Sbjct  222   TQDEDGFN----SGRGRNVGAHHQNCGDWENILDDDQKVEDDVHPDF  264



>ref|XP_011026321.1| PREDICTED: UPF0544 protein C5orf45 homolog [Populus euphratica]
 ref|XP_011042915.1| PREDICTED: UPF0544 protein C5orf45 homolog [Populus euphratica]
Length=264

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 119/288 (41%), Positives = 159/288 (55%), Gaps = 38/288 (13%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             MQ +FIA+QC QCSTMQVKQ+KKSSNKW C VCNQKQSVR+VFAQG MAKD+R FVQ+FN
Sbjct  1     MQMIFIALQCYQCSTMQVKQKKKSSNKWTCAVCNQKQSVRKVFAQGCMAKDLRKFVQSFN  60

Query  1086  MSRQFS--------DLAQHEEPQTLEGPAEEDRFPSKRTDWTEYLDF-EDESVEKEDEQS  934
             MSR+ +        D A     +T      ED    +R+DWT+YLD  ED ++++EDE  
Sbjct  61    MSRKIADEQDSFDQDAALIPTSETDHTGLNEDCQRKRRSDWTDYLDAEEDYNIKQEDE--  118

Query  933   TGDGLETRIVTELPKAVFKRPKLSN---YSAGSESDCKKRFRPTFTKRDTRKQSTFQGKD  763
              G+     +VTE PK +FK+P+L N    ++G   D    ++P F+KRD  K    +GK+
Sbjct  119   -GEEPGPMVVTEFPKEMFKKPRLKNDFGQNSGDHGDGNP-YKPVFSKRDASKIPMSRGKE  176

Query  762   IGMMAKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEY  583
                       R+  +  +     WS   D+    ++    +PT G         SKW +Y
Sbjct  177   ---------SRKYQSTKAAGNSKWS---DSMTQVEEERISQPTTGKTKA-----SKWKDY  219

Query  582   ITADADDDNLELESGGWLTSGKDRWNNIALENPI-KDHKVDEDIHPDF  442
             IT D D  N    SG     G    N    EN +  D KV++D+HPDF
Sbjct  220   ITQDEDGFN----SGRGRNVGAHHQNCGDWENILDDDQKVEDDVHPDF  263



>ref|XP_002527094.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35257.1| conserved hypothetical protein [Ricinus communis]
Length=269

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 118/286 (41%), Positives = 159/286 (56%), Gaps = 34/286 (12%)
 Frame = -1

Query  1260  AVFIAVQCCQCSTMQ---------VKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVR  1108
              VFIAVQCCQCSTMQ         VKQRKKS+NKW C VCNQKQSV +VFAQGF+AKD+R
Sbjct  4     TVFIAVQCCQCSTMQAIFFFSLRHVKQRKKSNNKWTCAVCNQKQSVIKVFAQGFVAKDLR  63

Query  1107  IFVQNFNMSRQFS-DLAQHEEPQTLEGPAEEDRFPSKRTDWTEYLDFEDESVE---KEDE  940
              FVQ+FN+SR FS +L Q E   +    + ED    +R+DW+EYLD E ++     K+  
Sbjct  64    KFVQSFNLSRSFSENLGQLETLNSFTPLSSEDCQRKRRSDWSEYLDHEGDANNDKFKQQN  123

Query  939   QSTGDGLETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDI  760
             Q   D    +IVTEL K +FK+PKL NY +  +S+    ++  F+K +T  Q        
Sbjct  124   QEEEDDFGPKIVTELTKEMFKKPKL-NYDSWFDSN--NSYKAVFSKMNTTNQHLLS----  176

Query  759   GMMAKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYI  580
                 KEG  +++          WS     K  +++ V  +PT   L T A   SKW+ YI
Sbjct  177   --QGKEG--KKNVFAKVTSTSKWSDCTTGKYKEQRTV--QPT---LATKA---SKWNAYI  224

Query  579   TADADDDNLELESGGWLTSGKDRWNNIALENPIKDHKVDEDIHPDF  442
             T   DD+++ + SG          ++   E+   D KV +DIHPDF
Sbjct  225   T--HDDNDMGVRSGINFPDDMGPCSHHVWESISDDQKVKDDIHPDF  268



>ref|XP_010261056.1| PREDICTED: UPF0544 protein C5orf45 homolog [Nelumbo nucifera]
Length=240

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 108/283 (38%), Positives = 147/283 (52%), Gaps = 50/283 (18%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  +FIAVQCCQCSTMQVKQ+KKSSNKW CV+CNQKQSV +VFA+G+ AKD+R FVQ FN
Sbjct  1     MSTIFIAVQCCQCSTMQVKQQKKSSNKWNCVICNQKQSVWKVFARGYAAKDIRKFVQGFN  60

Query  1086  MSRQFSDLAQHEEPQTLEGPAEEDRFPS-----KRTDWTEYLDFEDESVEKEDEQSTGDG  922
             MSRQF +       QTLE   + +   S     +R DWTEYLD ED++  K  E+  G+ 
Sbjct  61    MSRQFIENRDESLIQTLEEIDDPNSSNSSCSRKRRNDWTEYLDTEDDADAK--EELDGNA  118

Query  921   LETRIVTELPKAVFKRPKLSNYSAGSESDCK--KRFRPTFTKRDTRKQSTFQGKDIGMMA  748
              E +IVTELP+   K+PKL     G     +  K  +P F+  +T+ +            
Sbjct  119   FEPKIVTELPEEHLKKPKLKKTYPGEFHTIQGSKPLKPVFSNTNTKPKF-----------  167

Query  747   KEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYITADA  568
                P R+D               D K   +    +E             SKWS Y+T + 
Sbjct  168   ---PHRDD--------------EDEKGKRQLATGRE-------------SKWSCYLTEEE  197

Query  567   DDDNLELESGGWLTSGKDRWNNIALENPIKDHKVDEDIHPDFT  439
              D+ +            + W++  LEN     +V++++HPDFT
Sbjct  198   SDNGILFGREREPLVDLNPWSHAGLENEFNGERVEDEVHPDFT  240



>ref|XP_004489908.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X1 [Cicer 
arietinum]
Length=263

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 119/292 (41%), Positives = 154/292 (53%), Gaps = 47/292 (16%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  +FIA+QCCQCSTMQVKQ+KKSSNKW C +CN+ QS+R+VFAQG+ AKD+RIFVQ+FN
Sbjct  1     MSTLFIALQCCQCSTMQVKQKKKSSNKWTCALCNKNQSLRKVFAQGYQAKDIRIFVQSFN  60

Query  1086  MSR---QFSDLAQHEEPQTLEGPAEEDRFPS------KRTDWTEYLDFEDESVEKEDEQS  934
              SR   Q   L       T E    + +FP+      KRTDWT YLD +D       EQ 
Sbjct  61    ASRNSLQQQWLLAGTLNSTPEHALGDSKFPTDLNHNNKRTDWTAYLDNDDHHAANIAEQH  120

Query  933   TGDGLETRIVTELPKAVFKRPKL-SNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIG  757
               D  E  +VTELPK +FK+ +L  N  +GS+   +K   PTF             +D G
Sbjct  121   -DDDFEPLVVTELPKDMFKKRRLVDNSKSGSDRHFEK---PTFQN----------SQDAG  166

Query  756   MMAKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYIT  577
                K   D+   TV+   + S S  R+ K           T+    T     SKW++Y+T
Sbjct  167   EPEK---DQRRITVS---IESNSERRNIKV----------TQKCKQTVNSSASKWNDYLT  210

Query  576   AD-----ADDDNLEL--ESGGWLTSGKDRWNNIALENPIKDHKVDEDIHPDF  442
              D      D DNLEL  + G         WNN  LE    + +V++DIHPDF
Sbjct  211   EDNDYLTEDSDNLELGCKRGFNFKDPSVSWNNDILEAITCEQRVEDDIHPDF  262



>ref|XP_004489909.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X2 [Cicer 
arietinum]
Length=261

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 150/292 (51%), Gaps = 49/292 (17%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  +FIA+QCCQCSTMQVKQ+KKSSNKW C +CN+ QS+R+VFAQG+ AKD+RIFVQ+FN
Sbjct  1     MSTLFIALQCCQCSTMQVKQKKKSSNKWTCALCNKNQSLRKVFAQGYQAKDIRIFVQSFN  60

Query  1086  MSR---QFSDLAQHEEPQTLEGPAEEDRFPS------KRTDWTEYLDFEDESVEKEDEQS  934
              SR   Q   L       T E    + +FP+      KRTDWT YLD +D       EQ 
Sbjct  61    ASRNSLQQQWLLAGTLNSTPEHALGDSKFPTDLNHNNKRTDWTAYLDNDDHHAANIAEQH  120

Query  933   TGDGLETRIVTELPKAVFKRPKL-SNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIG  757
               D  E  +VTELPK +FK+ +L  N  +GS+   +K   PTF                 
Sbjct  121   -DDDFEPLVVTELPKDMFKKRRLVDNSKSGSDRHFEK---PTFQN---------------  161

Query  756   MMAKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYIT  577
                 +G   +D    +  + S S  R+ K           T+    T     SKW++Y+T
Sbjct  162   ---SQGEPEKDQRRITVSIESNSERRNIKV----------TQKCKQTVNSSASKWNDYLT  208

Query  576   AD-----ADDDNLEL--ESGGWLTSGKDRWNNIALENPIKDHKVDEDIHPDF  442
              D      D DNLEL  + G         WNN  LE    + +V++DIHPDF
Sbjct  209   EDNDYLTEDSDNLELGCKRGFNFKDPSVSWNNDILEAITCEQRVEDDIHPDF  260



>emb|CDP01132.1| unnamed protein product [Coffea canephora]
Length=173

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 107/152 (70%), Gaps = 12/152 (8%)
 Frame = -1

Query  1269  PMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNF  1090
             P   VF A+QCCQCSTMQVKQRKKSSNKW CVVCNQKQSV +VFAQG+MAKDVR FVQ+F
Sbjct  2     PPSTVFFALQCCQCSTMQVKQRKKSSNKWTCVVCNQKQSVCKVFAQGYMAKDVRKFVQSF  61

Query  1089  NMSRQFSD---LAQHEEPQTLEGPAEEDRFPS----KRTDWTEYLDFEDESVEKEDEQST  931
             NMSRQF++   +   ++  TLE    ED+ P     KRTDWTEY+D E++  E  +    
Sbjct  62    NMSRQFAEQNVIPADDDKATLEI---EDKIPPNGKLKRTDWTEYIDPEEDDSEIPN-IGE  117

Query  930   GDGLETRIVTELPKAVFKRPKLSNYSAGSESD  835
               GL  +IVTE+PK VFK+PKL +Y    + +
Sbjct  118   NPGL-LKIVTEMPKPVFKKPKLKSYHVAKDCE  148



>ref|XP_009335161.1| PREDICTED: UPF0544 protein C5orf45 isoform X1 [Pyrus x bretschneideri]
Length=278

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 120/295 (41%), Positives = 155/295 (53%), Gaps = 38/295 (13%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  VFIAVQCCQCSTMQVKQR KS NKW C VCNQKQSVRQVFAQG MA+D+R+FVQ+ N
Sbjct  1     MPTVFIAVQCCQCSTMQVKQRNKS-NKWTCAVCNQKQSVRQVFAQGPMARDLRLFVQSSN  59

Query  1086  MSRQFSDLAQHEEPQT--------LEGPAEEDRFPSKRTDWTEYLDFEDE----SVEKED  943
             MSRQF+     ++ Q         +           +R DWT+YLD ED     +V+ ED
Sbjct  60    MSRQFAQQTNDQQQQQQRQEQDTLISSDCSYKTEKRRRNDWTQYLDPEDSDRGANVKPED  119

Query  942   EQSTGDGLETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKD  763
             E   G G E  IVTE P  ++K+PKLS Y      D     +P F+KR+  K      +D
Sbjct  120   E--AGSGFEPEIVTEFPAELWKKPKLSKYGV----DELHSRKPVFSKRNFSKHVISLPQD  173

Query  762   IGMMAKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEY  583
                +  E  +    T  S  V      RD +   +   + + T    LT A   SKWS+Y
Sbjct  174   TEQVKCELTN----TKESSQVQRHFIARDEQEPRRTCQATKAT----LTGA---SKWSDY  222

Query  582   ITADADDD-NLEL-------ESGGWLTSGKDRWNNIALENPIKDHKVDEDIHPDF  442
             +T D DDD +L L       ++ G  ++  D+           D  V++DIHPDF
Sbjct  223   VTEDEDDDCSLRLITRRKHADNAGQCSNEIDKTTTNYGTVLANDGTVEDDIHPDF  277



>ref|XP_007151942.1| hypothetical protein PHAVU_004G088900g [Phaseolus vulgaris]
 gb|ESW23936.1| hypothetical protein PHAVU_004G088900g [Phaseolus vulgaris]
Length=248

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 115/281 (41%), Positives = 148/281 (53%), Gaps = 40/281 (14%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  +FIA+QCCQCSTMQVKQ+KKSSNKW C VCNQKQSVR+VFAQGFMAKDVR FVQ+FN
Sbjct  1     MSTLFIALQCCQCSTMQVKQKKKSSNKWNCAVCNQKQSVRRVFAQGFMAKDVRKFVQDFN  60

Query  1086  MSRQ-FSD----LAQHEEPQTLEGPAEEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGDG  922
             MSR+ F D    LA   +P       E +R   +R DW+ YLD ED      +EQ   D 
Sbjct  61    MSRKSFDDGEWPLAGTLDPVPEISNGEVNR-QKRRNDWSAYLDQED--YHTLEEQQLDDD  117

Query  921   LETRIVTELPKAVFKRPKLS-NYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIGMMAK  745
              E  IVTEL K + K+ +++ N  AGS+                     F  K +   ++
Sbjct  118   CERLIVTELEKGMLKKSRVTKNTGAGSDK--------------------FLKKTLFYNSQ  157

Query  744   EGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYITADAD  565
             E P R         V S   N+  + ND     K  T+    +  +  SKW+ Y+T   D
Sbjct  158   EDPVR---------VTSLIENKPKRKNDLTAYDK-MTQKCKQSRTEIASKWNVYLTEYDD  207

Query  564   DDNLELESGGWLTSGKDRWNNIALENPIKDHKVDEDIHPDF  442
             + + EL  G  L       +   LE  I   +V++DIHPDF
Sbjct  208   NLDFELNKGFDLDKNAAPCDKSVLET-IASERVEDDIHPDF  247



>ref|XP_010534119.1| PREDICTED: uncharacterized protein LOC104809747 [Tarenaya hassleriana]
Length=252

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 101/287 (35%), Positives = 150/287 (52%), Gaps = 55/287 (19%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             +FIA+QCCQCSTMQVKQ+KKSSNKW+CV+CNQKQSVR++FAQG+ AK++R FVQ+FNMSR
Sbjct  5     LFIALQCCQCSTMQVKQQKKSSNKWVCVICNQKQSVRKIFAQGYKAKELRFFVQSFNMSR  64

Query  1077  QFSDLAQHEEPQTLEGPAEEDR--FPSKRTDWTEYLDFE--DESVEKEDEQSTGDGLETR  910
             +    +  EE     G   E    +  +RTDWTEYLD +  +      ++    +G++  
Sbjct  65    K----SLEEEDTAAGGTLSEIHVDWKKRRTDWTEYLDLDPPNRCRRSPEDGEAKEGMDAE  120

Query  909   IVTELPKAVFKRPKLSNYSAGSES------DCKKRFRPTFTKRDTRKQSTFQGKDIGMMA  748
             IVTE+PK +FK+P+L+ YS+G         D  + + P F+++   +Q    GK      
Sbjct  121   IVTEMPKDMFKKPRLNTYSSGGGGSSMDAEDGNEPYNPIFSRKSIIEQRQCSGK------  174

Query  747   KEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYITADA  568
                                     A   + +L  +    G +  +A   SKW+ Y+T   
Sbjct  175   ------------------------ASKREHELKQRNLVRGGVANSA---SKWNAYLTQGE  207

Query  567   DDDNLELESGGWLTSGKDR-----WNNIALENPIKDHKVDEDIHPDF  442
             ++       G     G D      W+ + L   + D  VD+++HPDF
Sbjct  208   EE---RAPPGLGRREGLDHDDAREWSRVILGISMGDQTVDDEVHPDF  251



>ref|XP_010428008.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X2 [Camelina 
sativa]
Length=300

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 118/306 (39%), Positives = 162/306 (53%), Gaps = 41/306 (13%)
 Frame = -1

Query  1260  AVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMS  1081
              VFIA+QC +CSTMQVKQ+KKSSNKW+CV+CNQKQSV++VFAQGF AKD+R FVQ+FNMS
Sbjct  4     TVFIALQCFECSTMQVKQKKKSSNKWVCVICNQKQSVKKVFAQGFKAKDLRFFVQSFNMS  63

Query  1080  RQFSD-----LAQHEEPQTLEGPAEE--DRFPSKRTDWTEYLDFEDES----VEKEDEQS  934
             R+ SD     +   E    +E   EE  D    KR+DW+EYLD +  +    +  E+E+ 
Sbjct  64    RKVSDEEALGIVDSEVDVKVEVDDEEVLDVREKKRSDWSEYLDCDSSNGCSRLTGEEEED  123

Query  933   TGDGLETRIVTELPKAVFKRPKLSNY-----SAGSESDCKKR-----FRPTFTKRDTRKQ  784
                  + +IVTE+PK +FKRPKL+ Y     S+      KKR     F+P   +R  +K 
Sbjct  124   -----DVKIVTEMPKDMFKRPKLNKYSSPGGSSSVTGGGKKRDGYGLFKPPLPRRSVKKP  178

Query  783   STFQGKDIGMMAKEGPDREDFTVASQDVPSWSRNRDAKAND--------KKLVSKEPTEG  628
                   D  MM KE  ++      S+ V   +   DA   D        K+ + +E  E 
Sbjct  179   DFCS--DGVMMRKEDKEQRKLESESERVIKPASKWDAYLIDGEDAVRMRKEDIEQENLES  236

Query  627   SLLTTAKWMSKWSEYITADADDDNLELESGGWLTSGKD---RWNNIALENPIKDHKVDED  457
               +T  K +SKW  Y+  D  +       GG      D    W+   +E   +   VDE+
Sbjct  237   ERVT--KPVSKWDAYLIDDEGEHQAPPRFGGKKGLKDDDVEEWDKAVMEMSTECQIVDEE  294

Query  456   IHPDFT  439
             +HPDF 
Sbjct  295   VHPDFM  300



>ref|XP_007201598.1| hypothetical protein PRUPE_ppa019256mg [Prunus persica]
 gb|EMJ02797.1| hypothetical protein PRUPE_ppa019256mg [Prunus persica]
Length=284

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 116/293 (40%), Positives = 150/293 (51%), Gaps = 33/293 (11%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSS--NKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQN  1093
             M A+FIAVQCCQCSTMQVKQRK+SS  NKW CVVCNQKQSVRQVFAQG MAKD+R+FVQ+
Sbjct  1     MSAIFIAVQCCQCSTMQVKQRKQSSKSNKWTCVVCNQKQSVRQVFAQGPMAKDLRLFVQS  60

Query  1092  FNMSRQFSDLAQHEEPQTLEGPAEEDRFPSKRTDWTEYLDFEDESVE--KEDEQSTGDGL  919
              NM RQ     Q ++P      +       +RTDWTEYLD +D+ V   K++E   G G 
Sbjct  61    SNMPRQ-QQQQQQQQPALASSTSPYKTQKKRRTDWTEYLDSKDDQVTNLKQEEDEGGVGF  119

Query  918   ETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIGMMAKEG  739
             E  IVTE P  + K+ KL+ Y   S++      R     +    +S F  ++        
Sbjct  120   EHEIVTEFPAELPKKRKLNKYGCWSDT------RKGDADKHHNHKSVFSKRNFNKHVVSP  173

Query  738   PDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEG----SLLTTAKWMSKWSEYITAD  571
              D E            S+ RD    D+     EP  G    ++L+ A   SKW++Y+T D
Sbjct  174   ADEEQMKCELAITKETSKWRDFVMRDE----LEPRAGQETKTILSGA---SKWNDYVTPD  226

Query  570   ADDDNLEL----------ESGGWLTSGKDRWNNIALENPIKDHKVDEDIHPDF  442
               DD  +L           +G W         N        D  V++DIHPDF
Sbjct  227   ESDD-YDLPRISRREDADTAGQWSNEINKTVTNYETVFANDDETVEDDIHPDF  278



>ref|NP_001077810.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAX23799.1| hypothetical protein At1g71760 [Arabidopsis thaliana]
 gb|AEE35229.1| uncharacterized protein AT1G71760 [Arabidopsis thaliana]
Length=276

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 156/290 (54%), Gaps = 37/290 (13%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             +FIA+QC +CSTMQVKQ+KKSSNKW+CV+CNQKQSV++VFAQG+ AK++R FVQ+FNMSR
Sbjct  5     LFIALQCYECSTMQVKQKKKSSNKWVCVICNQKQSVKKVFAQGYKAKELRFFVQSFNMSR  64

Query  1077  QFSDLAQHEE----PQT-LEGPA-EEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGDGLE  916
             + +D   H      P+  +EG   EE     KR+DW++YLDF+  +   +  +  G+  +
Sbjct  65    KVADEEAHAVGDSFPEVYVEGEVNEEVNGTKKRSDWSQYLDFDSVN---DRRRLAGEEDD  121

Query  915   TRIVTELPKAVFKRPKL---------SNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKD  763
              +IVTE+P  +FKRPKL         S+ + G   D  + F+P+F++R  +K     GK 
Sbjct  122   VKIVTEMPSNMFKRPKLNKESNAGGSSSNTGGENKDSNEIFKPSFSRRSIKKPDFRSGK-  180

Query  762   IGMMAKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEY  583
                       R   T     + ++S N       KK + +   E   +T  K  SKW  Y
Sbjct  181   ----------RSSATYVGH-ISAFSSNE--VVTRKKDMEERNLESERVT--KPASKWDAY  225

Query  582   ITADADDDNLELESGGWLTSGKDR---WNNIALENPIKDHKVDEDIHPDF  442
             +  D  +       G       D    W+   +E   +   VD+++HPDF
Sbjct  226   LIDDEGEHQAPPRFGVKKALKDDEVGGWDRAVMEINTEYQIVDDEVHPDF  275



>ref|XP_010471185.1| PREDICTED: UPF0544 protein C5orf45 homolog [Camelina sativa]
Length=269

 Score =   157 bits (396),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 115/296 (39%), Positives = 154/296 (52%), Gaps = 56/296 (19%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             VFIA+QC +CSTMQVKQ+KKSSNKW+CVVCNQKQSV++VFAQG+ AKD+R FVQ+FNMSR
Sbjct  5     VFIALQCFECSTMQVKQKKKSSNKWVCVVCNQKQSVKKVFAQGYKAKDLRFFVQSFNMSR  64

Query  1077  QFSD-------LAQHEEPQTLEGPAEE--DRFPSKRTDWTEYLDFEDESVEKEDEQSTGD  925
             + SD        +  E    +E   EE  D    KR+DW+EYLD +   +  +  + TG 
Sbjct  65    KVSDDEALGIVDSCSEVDVKVEVDDEEVLDVREKKRSDWSEYLDCD---LSNDCSRLTGG  121

Query  924   GLE--TRIVTELPKAVFKRPKLSNYSA--GSES-----DCKKRFRPTFTKRDTRKQ---S  781
               E   +IVTE+PK +FKRPKL  YS+  GS +     D    F+P  ++R  +K    S
Sbjct  122   EEEDDVKIVTEMPKDMFKRPKLIKYSSPGGSSAVTGGGDGYGLFKPPLSRRTVKKPDFCS  181

Query  780   TFQGKDIGMMAKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWM  601
               +G D  MM KE  ++ D    S+        RD K                       
Sbjct  182   GKRGSDEVMMRKEDIEQRDLEAESE--------RDTKP---------------------A  212

Query  600   SKWSEYITADADDDNLELESGGWLTSGKD---RWNNIALENPIKDHKVDEDIHPDF  442
             SKW  Y+  D  +       GG      D    W+   +E   +   V+E++HPDF
Sbjct  213   SKWDAYLIDDEGEHQAPPRFGGKKGLKDDDVGEWDKAVMEMSTECQMVEEEVHPDF  268



>ref|XP_010415885.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X2 [Camelina 
sativa]
Length=272

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 149/299 (50%), Gaps = 59/299 (20%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             VFIA+QC +CSTMQVKQ+KKSSNKW+CVVCNQKQSV++VFAQGF AKD+R FVQ+FNMSR
Sbjct  5     VFIALQCFECSTMQVKQKKKSSNKWVCVVCNQKQSVKKVFAQGFKAKDLRFFVQSFNMSR  64

Query  1077  QFSD---------LAQHEEPQTLEGPAEEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGD  925
             + SD          ++ +    ++G    D    KR+DW+EYLD +   +  +  + TG+
Sbjct  65    KVSDDEALAIVDSCSEVDVKGEVDGEEVLDVREKKRSDWSEYLDCD---LSNDCRRLTGE  121

Query  924   GLE-TRIVTELPKAVFKRPKLSNY-----------SAGSESDCKKRFRPTFTKRDTRKQS  781
               +  +IVTE+P  +FKRPKL  Y             G + D    F+P  ++R  +K  
Sbjct  122   EEDDVKIVTEMPNDMFKRPKLIKYSSPGGSSPSVTGGGKKRDGSGLFKPPLSRRSVKKPD  181

Query  780   TFQGK---DIGMMAKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTA  610
                GK   D  MM KE  ++ +    S+ V                              
Sbjct  182   FCSGKRDSDEVMMRKEDIEQRNLESESERV-----------------------------T  212

Query  609   KWMSKWSEYITADADDDNLELESGGWLTSGKD---RWNNIALENPIKDHKVDEDIHPDF  442
             K  SKW  Y+  D  +       GG      D    W+   +E   +   VDE++HPDF
Sbjct  213   KPASKWEAYLIDDEGERQAPPRFGGQKGLKDDDVGEWDKAVMEMSTECQIVDEEVHPDF  271



>ref|XP_006302709.1| hypothetical protein CARUB_v10020821mg [Capsella rubella]
 gb|EOA35607.1| hypothetical protein CARUB_v10020821mg [Capsella rubella]
Length=260

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 150/289 (52%), Gaps = 51/289 (18%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             +FIA+QC +CSTMQVKQ+KKSSNKW+CV+CNQKQSV++VFAQG+ AKD+R FVQ+FNMSR
Sbjct  5     LFIALQCFECSTMQVKQKKKSSNKWVCVICNQKQSVKKVFAQGYKAKDLRRFVQSFNMSR  64

Query  1077  QFSD---------LAQHEEPQTLEGPAEEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGD  925
             + SD          ++ +  + ++     D    KR+DW+EYLDF+   +  +D + +G 
Sbjct  65    KASDDKALSFVDSCSEVDVREEVDEEEVSDACGKKRSDWSEYLDFD---LPNDDRRLSGV  121

Query  924   GLETRIVTELPKAVFKRPKLSNYSA-GSES----DCKKRFRPTFTKRDTRKQSTFQGKDI  760
               + +IVTE+P  +FKRPKL+ YS  G+ S    D    F+P F+ R+  K         
Sbjct  122   EDDVKIVTEMPTNMFKRPKLNKYSTPGAPSSETGDGDGIFKPAFSIRNIEK---------  172

Query  759   GMMAKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYI  580
                        DF              DA    K+ + +   E  L    K  SKW  Y+
Sbjct  173   ----------PDFC------------SDAVVMRKENIEQRSLESELERVTKPASKWDAYL  210

Query  579   TADADDDNLELESGG---WLTSGKDRWNNIALENPIKDHKVDEDIHPDF  442
               D  +       GG         + W++   E   +   VDE++HPDF
Sbjct  211   INDKIEHQAPPRFGGKKALKDVDVEDWDSAITEMSSEHQIVDEEVHPDF  259



>ref|XP_009786471.1| PREDICTED: UPF0544 protein C5orf45 isoform X3 [Nicotiana sylvestris]
Length=243

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 109/288 (38%), Positives = 146/288 (51%), Gaps = 59/288 (20%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  VF+AVQCCQCSTMQVKQ+KKSS KW CVVCNQKQSVR+VFAQG+ AKDVR+FVQNFN
Sbjct  1     MPTVFVAVQCCQCSTMQVKQQKKSSCKWTCVVCNQKQSVRKVFAQGYKAKDVRLFVQNFN  60

Query  1086  MSRQFSDLAQHEEPQTLEGPAEEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGDGLETRI  907
             MSRQF+                 DR P  R + TE L+  ++S      QS G       
Sbjct  61    MSRQFT-----------------DRLPVVREE-TETLEIGEQS------QSHGS------  90

Query  906   VTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIGMMAKEG----  739
                     +KR   + Y    E+  +           +++Q+T     + +++K G    
Sbjct  91    --------YKRTDWTEYLDPEENAIENNEDSGM--EPSKRQATM----VSVVSKWGDNKQ  136

Query  738   --------PDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEY  583
                     P    F      +  +    D   N++ L   + TE +   TA  +SKW+EY
Sbjct  137   VPPDMPVQPATNSFCKLDDSINLYGN--DNSMNERNLGYGKSTERTQPKTANKVSKWTEY  194

Query  582   ITADADDDNLELESGGWLTSGKDRWNNIALENPIKDHKV-DEDIHPDF  442
             I  D DD  L   SG   TS  ++W+N   E  ++D K+ DE+IHPDF
Sbjct  195   INVDEDDCQLRFASGRGFTSDVNKWSNDTFETSLQDQKLDDEEIHPDF  242



>gb|KFK41597.1| hypothetical protein AALP_AA2G149200 [Arabis alpina]
Length=298

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/300 (35%), Positives = 162/300 (54%), Gaps = 35/300 (12%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             VF+A+QCC C TMQVKQRKKSSNKW+CV+CNQKQSV++VFAQG+ AK++R FVQ FNM+R
Sbjct  5     VFVALQCCDCLTMQVKQRKKSSNKWVCVICNQKQSVKKVFAQGYKAKELRFFVQEFNMAR  64

Query  1077  QFSDLAQHEEPQT-----LEGPAEEDRF-PSKRTDWTEYLDFEDESVEKEDEQSTGDGLE  916
             + +D  +     +      +G  +ED     KR+DW+EYLD +  +VE++ E+    G +
Sbjct  65    KVADEKEQSIVDSFSEVDFDGGIDEDVCGKKKRSDWSEYLDSDSVNVEEDCEE----GND  120

Query  915   TRIVTELPKAVFKRPKLSNYSAG----------SESDCKKRFRPTFTKRDTRKQSTFQGK  766
              +IVTE+P+A+FK+PKL+ Y              + D  + F+P+F+ R + K+  F+  
Sbjct  121   VKIVTEMPRAMFKKPKLNRYGNASGSSSVTGGGGKKDGDELFKPSFSSRRSAKEPDFRSD  180

Query  765   DIGMMAKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEP---------TEGSLLTT  613
               G+M ++  D E   + S+ V       DA   D +  ++ P            ++   
Sbjct  181   --GVMVRK-KDTEQKYLESERVTKPVSKWDAFLIDDEGENRAPPRFGQSEFLQNDAVERV  237

Query  612   AKWMSKWSEYITADADDDNLELESGGWLTSGKD---RWNNIALENPIKDHKVDEDIHPDF  442
              K  SKW  ++  D   +      G       D    W+   +E   +   VDE++HPDF
Sbjct  238   TKPASKWDVFLIDDEGGNRAPSRFGQREVLKDDDVGEWDKTIMEINSEYQIVDEEVHPDF  297



>ref|XP_010415884.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X1 [Camelina 
sativa]
Length=276

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 108/303 (36%), Positives = 149/303 (49%), Gaps = 63/303 (21%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             VFIA+QC +CSTMQVKQ+KKSSNKW+CVVCNQKQSV++VFAQGF AKD+R FVQ+FNMSR
Sbjct  5     VFIALQCFECSTMQVKQKKKSSNKWVCVVCNQKQSVKKVFAQGFKAKDLRFFVQSFNMSR  64

Query  1077  QFSD---------LAQHEEPQTLEGPAEEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGD  925
             + SD          ++ +    ++G    D    KR+DW+EYLD +   +  +  + TG+
Sbjct  65    KVSDDEALAIVDSCSEVDVKGEVDGEEVLDVREKKRSDWSEYLDCD---LSNDCRRLTGE  121

Query  924   GL-ETRIVTELPKAVFKRPKLSNY-----------SAGSESDCKKRFRPTFTKRDTRKQS  781
                + +IVTE+P  +FKRPKL  Y             G + D    F+P  ++R  +K  
Sbjct  122   EEDDVKIVTEMPNDMFKRPKLIKYSSPGGSSPSVTGGGKKRDGSGLFKPPLSRRSVKKPD  181

Query  780   TFQGK-------DIGMMAKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSL  622
                GK       D  MM KE  ++ +    S+ V                          
Sbjct  182   FCSGKRDSECVADEVMMRKEDIEQRNLESESERV--------------------------  215

Query  621   LTTAKWMSKWSEYITADADDDNLELESGGWLTSGKD---RWNNIALENPIKDHKVDEDIH  451
                 K  SKW  Y+  D  +       GG      D    W+   +E   +   VDE++H
Sbjct  216   ---TKPASKWEAYLIDDEGERQAPPRFGGQKGLKDDDVGEWDKAVMEMSTECQIVDEEVH  272

Query  450   PDF  442
             PDF
Sbjct  273   PDF  275



>ref|NP_177321.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF43229.1|AC012654_13 F14O23.14 [Arabidopsis thaliana]
 gb|AAU44426.1| hypothetical protein AT1G71760 [Arabidopsis thaliana]
 gb|AEE35228.1| uncharacterized protein AT1G71760 [Arabidopsis thaliana]
Length=259

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 106/291 (36%), Positives = 156/291 (54%), Gaps = 56/291 (19%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             +FIA+QC +CSTMQVKQ+KKSSNKW+CV+CNQKQSV++VFAQG+ AK++R FVQ+FNMSR
Sbjct  5     LFIALQCYECSTMQVKQKKKSSNKWVCVICNQKQSVKKVFAQGYKAKELRFFVQSFNMSR  64

Query  1077  QFSDLAQHEE----PQT-LEGPA-EEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGDGLE  916
             + +D   H      P+  +EG   EE     KR+DW++YLDF+  +   +  +  G+  +
Sbjct  65    KVADEEAHAVGDSFPEVYVEGEVNEEVNGTKKRSDWSQYLDFDSVN---DRRRLAGEEDD  121

Query  915   TRIVTELPKAVFKRPKL---------SNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKD  763
              +IVTE+P  +FKRPKL         S+ + G   D  + F+P+F++R  +K        
Sbjct  122   VKIVTEMPSNMFKRPKLNKESNAGGSSSNTGGENKDSNEIFKPSFSRRSIKK--------  173

Query  762   IGMMAKEGPD-REDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSE  586
                     PD R D  V        +R +D +  ++ L S+  T        K  SKW  
Sbjct  174   --------PDFRSDEVV--------TRKKDME--ERNLESERVT--------KPASKWDA  207

Query  585   YITADADDDNLELESGGWLTSGKDR---WNNIALENPIKDHKVDEDIHPDF  442
             Y+  D  +       G       D    W+   +E   +   VD+++HPDF
Sbjct  208   YLIDDEGEHQAPPRFGVKKALKDDEVGGWDRAVMEINTEYQIVDDEVHPDF  258



>emb|CDX72825.1| BnaC06g32730D [Brassica napus]
Length=257

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 103/287 (36%), Positives = 152/287 (53%), Gaps = 50/287 (17%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             +F+A+QCC+CSTMQVKQ+KKSSN W+CV+CNQKQSVR+VFAQG+ AKD+R++VQ+FNMSR
Sbjct  5     LFLALQCCECSTMQVKQKKKSSNNWVCVICNQKQSVRKVFAQGYKAKDLRLYVQSFNMSR  64

Query  1077  QFSDLAQHEEPQTLEGPAEEDRFPS----KRTDWTEYLDFE--DESVEKEDEQSTGDGLE  916
             +  D  + E   T     +++        KR+DW+EYLD +  ++ +    E + G+  +
Sbjct  65    KVVDEEKQEVADTFPEVEDDEEAEEIRGKKRSDWSEYLDSDPPNKRLRLTVEDADGEEED  124

Query  915   TRIVTELPKAVFKRPKLSNYS---------AGSESDCKKRFRPTFTKRDTRKQSTFQGKD  763
              +IVTE+PK +FKRPKL+ YS          G + + K+ F+P+F++    KQ       
Sbjct  125   VKIVTEIPKEMFKRPKLNRYSNDGGPSSAKEGVKRNDKEPFKPSFSRSSIPKQRFSSD--  182

Query  762   IGMMAKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEY  583
              G+M K   D E  T   + V     N+ A                        SKW  Y
Sbjct  183   -GVM-KRKKDTEQRTFEPERV-----NKPA------------------------SKWDAY  211

Query  582   ITADADDDNLELESGGWLTSGKDRWNNIALENPIKDHKVDEDIHPDF  442
             +  D  +   +  SG         W+    +   +   VD+D+HPDF
Sbjct  212   LIDDEGEH--QAASGALKDDSVGEWDRGVTDACSEYQVVDDDVHPDF  256



>ref|XP_006574775.1| PREDICTED: uncharacterized protein LOC100799512 isoform X1 [Glycine 
max]
Length=252

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 106/288 (37%), Positives = 150/288 (52%), Gaps = 50/288 (17%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  +FIA+QCCQCSTMQVKQ+KKSSNKW C VCNQKQSV +VFAQGFMAK++R FVQ+FN
Sbjct  1     MSTLFIALQCCQCSTMQVKQKKKSSNKWNCAVCNQKQSVCRVFAQGFMAKELRKFVQDFN  60

Query  1086  MSRQFSDLAQHEEPQTLEGPA-------EEDRFPSKRTDWTEYLDFEDESVEKEDEQSTG  928
             MSR+  D  ++    TL  P         E     KR DW+ YL       E++ +    
Sbjct  61    MSRKSFDDGEYPLAGTLNPPLPATEHGDAELNLKKKRNDWSAYL-----HQEQQPDHDAD  115

Query  927   DGLETRIVTELPKAVFKRPK-LSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIGMM  751
             D  E  +VTEL K +FK+ + + + +AGS+   KK         +++++       +  +
Sbjct  116   DDFEPLVVTELQKGMFKKRRVVEDSTAGSDRLFKKSLF-----HNSQEELRIDQPRVTSL  170

Query  750   AKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYITAD  571
              +  P R ++       P+  R +  K                 T+++  SKW+ Y+T  
Sbjct  171   TESNPKRNNYV-----TPTNQRTQKCKP----------------TSSRAASKWNNYLT--  207

Query  570   ADDDNLELESGGWLTS-----GKDRWNNIALENPIKDHKVDEDIHPDF  442
              D++NLEL   GW  S          NN  LE  +    V++DIHPDF
Sbjct  208   EDNENLEL---GWKKSFNFEDHSGPRNNTVLET-MTSEIVEDDIHPDF  251



>ref|XP_006574776.1| PREDICTED: uncharacterized protein LOC100799512 isoform X2 [Glycine 
max]
Length=251

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 106/288 (37%), Positives = 150/288 (52%), Gaps = 51/288 (18%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  +FIA+QCCQCSTMQVKQ+KKSSNKW C VCNQKQSV +VFAQGFMAK++R FVQ+FN
Sbjct  1     MSTLFIALQCCQCSTMQVKQKKKSSNKWNCAVCNQKQSVCRVFAQGFMAKELRKFVQDFN  60

Query  1086  MSRQFSDLAQHEEPQTLEGPA-------EEDRFPSKRTDWTEYLDFEDESVEKEDEQSTG  928
             MSR+  D  ++    TL  P         E     KR DW+ YL  E +    +D+    
Sbjct  61    MSRKSFDDGEYPLAGTLNPPLPATEHGDAELNLKKKRNDWSAYLHQEQQPDHDDDD----  116

Query  927   DGLETRIVTELPKAVFKRPK-LSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIGMM  751
                E  +VTEL K +FK+ + + + +AGS+   KK         +++++       +  +
Sbjct  117   --FEPLVVTELQKGMFKKRRVVEDSTAGSDRLFKKSLF-----HNSQEELRIDQPRVTSL  169

Query  750   AKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYITAD  571
              +  P R ++       P+  R +  K                 T+++  SKW+ Y+T  
Sbjct  170   TESNPKRNNYV-----TPTNQRTQKCKP----------------TSSRAASKWNNYLT--  206

Query  570   ADDDNLELESGGWLTS-----GKDRWNNIALENPIKDHKVDEDIHPDF  442
              D++NLEL   GW  S          NN  LE  +    V++DIHPDF
Sbjct  207   EDNENLEL---GWKKSFNFEDHSGPRNNTVLET-MTSEIVEDDIHPDF  250



>ref|XP_010428007.1| PREDICTED: uncharacterized protein LOC104712742 isoform X1 [Camelina 
sativa]
Length=333

 Score =   151 bits (382),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 120/337 (36%), Positives = 166/337 (49%), Gaps = 74/337 (22%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             VFIA+QC +CSTMQVKQ+KKSSNKW+CV+CNQKQSV++VFAQGF AKD+R FVQ+FNMSR
Sbjct  5     VFIALQCFECSTMQVKQKKKSSNKWVCVICNQKQSVKKVFAQGFKAKDLRFFVQSFNMSR  64

Query  1077  QFSD-----LAQHEEPQTLEGPAEE--DRFPSKRTDWTEYLDFEDES----VEKEDEQST  931
             + SD     +   E    +E   EE  D    KR+DW+EYLD +  +    +  E+E+  
Sbjct  65    KVSDEEALGIVDSEVDVKVEVDDEEVLDVREKKRSDWSEYLDCDSSNGCSRLTGEEEED-  123

Query  930   GDGLETRIVTELPKAVFKRPKLSNY-----SAGSESDCKKR-----FRPTFTKRDTRKQS  781
                 + +IVTE+PK +FKRPKL+ Y     S+      KKR     F+P   +R  +K  
Sbjct  124   ----DVKIVTEMPKDMFKRPKLNKYSSPGGSSSVTGGGKKRDGYGLFKPPLPRRSVKKPD  179

Query  780   TFQGKDIGMMAKEGPDREDFTVASQDV--------------------PSWSRNR------  679
                  D  MM KE  ++      S+ V                    PS+S ++      
Sbjct  180   FCS--DGVMMRKEDKEQRKLESESERVIKPASKWDAYLIDGEGEHQAPSFSLSKATTNVV  237

Query  678   ---------------DAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYITADADDDNLELE  544
                            DA    K+ + +E  E   +T  K +SKW  Y+  D  +      
Sbjct  238   KCVIFSVSVPFECVADAVRMRKEDIEQENLESERVT--KPVSKWDAYLIDDEGEHQAPPR  295

Query  543   SGGWLTSGKD---RWNNIALENPIKDHKVDEDIHPDF  442
              GG      D    W+   +E   +   VDE++HPDF
Sbjct  296   FGGKKGLKDDDVEEWDKAVMEMSTECQIVDEEVHPDF  332



>ref|XP_002887386.1| hypothetical protein ARALYDRAFT_316144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63645.1| hypothetical protein ARALYDRAFT_316144 [Arabidopsis lyrata subsp. 
lyrata]
Length=256

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 100/287 (35%), Positives = 149/287 (52%), Gaps = 51/287 (18%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             +FIA+QC +CSTMQVKQ+KKSSNKW+CV+CNQKQSV++VFAQG+ AK++R FVQ+FNMSR
Sbjct  5     LFIALQCYECSTMQVKQKKKSSNKWVCVICNQKQSVKKVFAQGYKAKELRFFVQSFNMSR  64

Query  1077  QFSD-LAQHEEPQTLEGPAEEDRFP-SKRTDWTEYLDFEDESVEKEDEQSTGDGLETRIV  904
             + +D +A       +EG    D     KR+DW+EYLDF+  +   +  +  G+  + +IV
Sbjct  65    KVADEVADSFSEVDVEGEEVLDVIGMKKRSDWSEYLDFDSPN---DRRRLVGEEDDVKIV  121

Query  903   TELPKAVFKRPKLSNYSAG---------SESDCKKRFRPTFTKRDTRKQSTFQGKDIGMM  751
             TE+PK +FKRPKL+  S            + D    F+P+F+ R  +             
Sbjct  122   TEMPKDMFKRPKLNKDSNAGGSSSITGGGKKDGNALFKPSFSTRSIK-------------  168

Query  750   AKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYITAD  571
                             +P++    D     KK + +   E   +   K  SKW  Y+  +
Sbjct  169   ----------------MPNFC--SDGVMTRKKDIEERNLESERII--KPASKWDAYLIDE  208

Query  570   ADDDNLELESGGWLTSGKD----RWNNIALENPIKDHKVDEDIHPDF  442
               +     + GG  T   D     W+   +E   +   VD+++HPDF
Sbjct  209   EGEHQAPPQIGGNKTLKDDANVGEWDRAIMEINTEYQIVDDEVHPDF  255



>ref|XP_009335162.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X2 [Pyrus 
x bretschneideri]
Length=201

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 105/173 (61%), Gaps = 19/173 (11%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  VFIAVQCCQCSTMQVKQR KS NKW C VCNQKQSVRQVFAQG MA+D+R+FVQ+ N
Sbjct  1     MPTVFIAVQCCQCSTMQVKQRNKS-NKWTCAVCNQKQSVRQVFAQGPMARDLRLFVQSSN  59

Query  1086  MSRQFSDLAQHEEPQT--------LEGPAEEDRFPSKRTDWTEYLDFEDE----SVEKED  943
             MSRQF+     ++ Q         +           +R DWT+YLD ED     +V+ ED
Sbjct  60    MSRQFAQQTNDQQQQQQRQEQDTLISSDCSYKTEKRRRNDWTQYLDPEDSDRGANVKPED  119

Query  942   EQSTGDGLETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQ  784
             E   G G E  IVTE P  ++K+PKLS Y      D     +P F+KR+  K 
Sbjct  120   E--AGSGFEPEIVTEFPAELWKKPKLSKYGV----DELHSRKPVFSKRNFSKH  166



>ref|XP_006390746.1| hypothetical protein EUTSA_v10019840mg, partial [Eutrema salsugineum]
 gb|ESQ28032.1| hypothetical protein EUTSA_v10019840mg, partial [Eutrema salsugineum]
Length=181

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 114/173 (66%), Gaps = 17/173 (10%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             VF+A+QC +CSTMQVKQ+KKSSNKW+CV+CNQKQSVR+VFAQG+ AK++R FVQ+FNMSR
Sbjct  5     VFLALQCFECSTMQVKQKKKSSNKWVCVICNQKQSVRKVFAQGYKAKELRFFVQSFNMSR  64

Query  1077  QFSD-----LAQHEEPQTLEGPAEEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGDGLE-  916
             + +D     +A     + +EG    D    KR+DWTEYLD     +++       DG E 
Sbjct  65    KAADEEALAVADKYLEEDVEGEEVSDIRGKKRSDWTEYLD-SGSPIDRRRLPGEDDGEED  123

Query  915   TRIVTELPKAVFKRPKLSNYSAGSES----------DCKKRFRPTFTKRDTRK  787
              +IVTE+P  +FKR KLS +S+   S          D ++ F+P+F++R  +K
Sbjct  124   LKIVTEMPNNMFKRAKLSKHSSAGGSSSSVTGGGGEDRRECFKPSFSRRSIKK  176



>ref|XP_009105834.1| PREDICTED: uncharacterized protein LOC103831685 [Brassica rapa]
 emb|CDX96343.1| BnaA07g29540D [Brassica napus]
Length=254

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 112/174 (64%), Gaps = 16/174 (9%)
 Frame = -1

Query  1260  AVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMS  1081
              +F+A+QCC+CSTMQVKQ+KKSSN W+CV+CNQKQSVR+VFAQG+ AKD+R+FVQ+FNMS
Sbjct  4     VLFLALQCCECSTMQVKQKKKSSNNWVCVICNQKQSVRRVFAQGYKAKDLRLFVQSFNMS  63

Query  1080  RQFSDLAQHEEPQTLEGPAEEDRFPS----KRTDWTEYLDFEDESVEKEDEQSTGDGLE-  916
             R+ +D  + E   T      ++        KR+DW+EYLD  D   E+       DG E 
Sbjct  64    RKVADEEKQEVADTFPEVEADEEVEEIRGKKRSDWSEYLD-SDPPNERRRLIVEEDGEEE  122

Query  915   -TRIVTELPKAVFKRPKLSNYSA---------GSESDCKKRFRPTFTKRDTRKQ  784
               +IVTE+P  +FKRPKL+ YS          G + + K+  +P+F++    KQ
Sbjct  123   DLKIVTEIPNEMFKRPKLNRYSNDGGYSSAKDGVQRNDKEPLKPSFSRSCIPKQ  176



>ref|XP_010681430.1| PREDICTED: UPF0544 protein C5orf45 [Beta vulgaris subsp. vulgaris]
 ref|XP_010681434.1| PREDICTED: UPF0544 protein C5orf45 [Beta vulgaris subsp. vulgaris]
 ref|XP_010681437.1| PREDICTED: UPF0544 protein C5orf45 [Beta vulgaris subsp. vulgaris]
Length=298

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 109/298 (37%), Positives = 157/298 (53%), Gaps = 30/298 (10%)
 Frame = -1

Query  1260  AVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMS  1081
              +FIAVQCC CSTMQVKQ+KKSSNKW CVVCNQKQSV + +AQG+ AK++R  VQ+FNMS
Sbjct  5     TLFIAVQCCHCSTMQVKQQKKSSNKWNCVVCNQKQSVTKFYAQGYQAKEIRNIVQSFNMS  64

Query  1080  RQFSDLAQHEEP--------QTLEGPAEE-DRFPSKRTDWTEYLDFE------DESVEKE  946
             R+  D  Q ++         + LE   E+ ++   +RTDW EYL+ E      + +  K 
Sbjct  65    RKTVDDNQLQQGDPSLRRFVENLESDQEKVEKKAKQRTDWNEYLEDETNVNVLEPAYLKY  124

Query  945   DEQSTGDGLETRIVTELPK-AVFKRPKLSNYSAGSESDCKKR--FRPTFTKRDTRKQSTF  775
              +     G+E ++VTE  +  VFK+PKL      S  +  +   ++P F+KR T   S+ 
Sbjct  125   KQNGEEMGVEPKVVTEFSEDLVFKKPKLMGKFGSSSLEWGENLTYKPNFSKRGT-GSSSL  183

Query  774   QGKDIGMM----AKEGPDRED-FTVASQDVPSWSR--NRDAKANDKKLVSKEPTEGSLLT  616
             +  D  ++    + +   R+   T  +     WS+   +D    D     ++  +   L 
Sbjct  184   KVDDTDLIRDVRSSDQLQRDKVLTTQTTSNSKWSQYMAKDDFPGDTGRHFQKQQQKDQLL  243

Query  615   TAKWMSKWSEYITADADDDNLELESGGWLTSGKDRWNNIALENPIKDHKVDEDIHPDF  442
                  SKWSEYIT D D  +  +++        D      LEN   DH V+EDIHPDF
Sbjct  244   KKAGASKWSEYITQDGDGGDEGMKAA----FADDLRLMSTLENDGVDHLVEEDIHPDF  297



>gb|KHN00719.1| hypothetical protein glysoja_000387 [Glycine soja]
Length=277

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 106/313 (34%), Positives = 150/313 (48%), Gaps = 75/313 (24%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQ-------------------------VKQRKKSSNKWICVVCNQ  1162
             M  +FIA+QCCQCSTMQ                         VKQ+KKSSNKW C VCNQ
Sbjct  1     MSTLFIALQCCQCSTMQALSLSLSLSLIFCVHSNPIDCNYVQVKQKKKSSNKWNCAVCNQ  60

Query  1161  KQSVRQVFAQGFMAKDVRIFVQNFNMSRQFSDLAQHEEPQTLEGPA-------EEDRFPS  1003
             KQSV +VFAQGFMAK++R FVQ+FNMSR+  D  ++    TL  P         E     
Sbjct  61    KQSVCRVFAQGFMAKELRKFVQDFNMSRKSFDDGEYPLAGTLNPPLPATEHGDAELNLKK  120

Query  1002  KRTDWTEYLDFEDESVEKEDEQSTGDGLETRIVTELPKAVFKRPK-LSNYSAGSESDCKK  826
             KR DW+ YL       E++ +    D  E  +VTEL K +FK+ + + + +AGS+   KK
Sbjct  121   KRNDWSAYL-----HQEQQPDHDADDDFEPLVVTELQKGMFKKRRVVEDSTAGSDRLFKK  175

Query  825   RFRPTFTKRDTRKQSTFQGKDIGMMAKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVS  646
                      +++++       +  + +  P R ++       P+  R +  K        
Sbjct  176   SLF-----HNSQEELRIDQPRVTSLTESNPKRNNYV-----TPTNQRTQKCKP-------  218

Query  645   KEPTEGSLLTTAKWMSKWSEYITADADDDNLELESGGWLTS-----GKDRWNNIALENPI  481
                      T+++  SKW+ Y+T   D++NLEL   GW  S          NN  LE  +
Sbjct  219   ---------TSSRAASKWNNYLT--EDNENLEL---GWKKSFNFEDHSGPRNNTVLET-M  263

Query  480   KDHKVDEDIHPDF  442
                 V++DIHPDF
Sbjct  264   TSEIVEDDIHPDF  276



>ref|XP_008456719.1| PREDICTED: UPF0544 protein C5orf45 homolog [Cucumis melo]
Length=305

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 103/315 (33%), Positives = 154/315 (49%), Gaps = 51/315 (16%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  +FIAVQC QCSTMQVKQ++KS NKWIC VCN+KQSV++VFA+  MAKDVR FVQ+FN
Sbjct  1     MATIFIAVQCFQCSTMQVKQQRKSGNKWICAVCNEKQSVQKVFARAPMAKDVRKFVQSFN  60

Query  1086  MSRQFSDLAQHEEPQTLEGPAEEDRFP-----SKRTDWTEYLDFEDESVEKEDEQSTGDG  922
             MSR++++   + +     G  ++D+        +R DW+EYLD E++      E      
Sbjct  61    MSRKYANEQANVDDLIHGGIVDDDKLDCSGRRKRRNDWSEYLDPEEDRSHSGRENEGELE  120

Query  921   LETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDI------  760
              + +I TELP     +    + S+ SE +    +RP F+KR    ++     +I      
Sbjct  121   SDLKIATELPDIKTWKSGSRSCSSWSEGEGDGLYRPLFSKRKHIAKNLSSQDEIQNWESP  180

Query  759   ----GMMAKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVS-----KEPTEGSLLTTAK  607
                      +G D + F+ A   + +  +++    N  K+ S     + P+E   +  +K
Sbjct  181   SAIHTSKLSKGDDEQTFSTAKY-LSAPFQDKKMSKNSHKVESEIQNWELPSE---IEASK  236

Query  606   WM--------------------SKWSEYITADADDDNLELESGGWLTSGKDRWNNIALEN  487
             W                     SKWSEYIT + +        GG       R   + +  
Sbjct  237   WTKDDENSRTKSCILGKVRGASSKWSEYITEEEN-------CGGRNEENMAREQGMDILK  289

Query  486   PIKDHKVDEDIHPDF  442
              I D  V++DIHPDF
Sbjct  290   MINDEIVEDDIHPDF  304



>ref|XP_004141004.1| PREDICTED: uncharacterized protein LOC101212383 [Cucumis sativus]
 gb|KGN46102.1| hypothetical protein Csa_6G052770 [Cucumis sativus]
Length=307

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 114/326 (35%), Positives = 160/326 (49%), Gaps = 71/326 (22%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  +FIAVQC QCSTMQVKQ++KS NKWIC VCNQKQSV++VFA+  MAKDVR FVQ+FN
Sbjct  1     MATIFIAVQCFQCSTMQVKQQRKSGNKWICAVCNQKQSVQKVFARAPMAKDVRKFVQSFN  60

Query  1086  MSRQFSDLAQHEEPQTLEGPAEEDRFP-----SKRTDWTEYLD-FEDESVE-KEDEQSTG  928
             MSR++++   + +     G  ++D+         R+DW++YLD  ED S   +E+E    
Sbjct  61    MSRKYANEQANVDELIDGGIVDDDKLVCSGRRKSRSDWSDYLDPVEDRSHSGRENEVELE  120

Query  927   DGLETRIVTELPKA-VFKRPKLSNYSAGSESDCKKRFRPTFTKR----------------  799
               L  +IVTELP    +K    S  S   E +    +RP F+KR                
Sbjct  121   SDL--KIVTELPDIKTWKSGSRSCSSWSEEGEGDGLYRPLFSKRKHIANNLSSQDEIRNW  178

Query  798   ---------------DTRKQST-------FQGKDIGMMAKEGPDREDFTVASQDVPSWSR  685
                            D +  ST       FQ K +G   K G   ED  + + ++PS   
Sbjct  179   ESPSAIHASKLSKGDDEQTLSTAKYLSAPFQDKKMG---KNGHKVED-EIQNWELPSEIE  234

Query  684   NRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYITADA-----DDDNLELESGGWLTSG  520
                   +D+ L +K    G +   +   SKWSEYIT +      +++N+  E G      
Sbjct  235   ASKWSKDDENLRTKSCILGKVRGAS---SKWSEYITEEENCGGRNEENMAREEG------  285

Query  519   KDRWNNIALENPIKDHKVDEDIHPDF  442
                     L+  I +  V++DIHPDF
Sbjct  286   -----MDVLKMMINEEIVEDDIHPDF  306



>ref|XP_004159474.1| PREDICTED: uncharacterized protein LOC101224695 [Cucumis sativus]
Length=307

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 113/326 (35%), Positives = 160/326 (49%), Gaps = 71/326 (22%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  +FIAVQC QCSTMQVKQ++KS NKWIC VCNQKQSV++VFA+  MAKDVR FVQ+FN
Sbjct  1     MATIFIAVQCFQCSTMQVKQQRKSGNKWICAVCNQKQSVQKVFARAPMAKDVRKFVQSFN  60

Query  1086  MSRQFSDLAQHEEPQTLEGPAEEDRFP-----SKRTDWTEYLD-FEDESVE-KEDEQSTG  928
             MSR++++   + +     G  ++D+         R+DW++YLD  ED S   +E+E    
Sbjct  61    MSRKYANEQANVDELIDGGIVDDDKLVCSGRRKSRSDWSDYLDPVEDRSHSGRENEVELE  120

Query  927   DGLETRIVTELPKA-VFKRPKLSNYSAGSESDCKKRFRPTFTKR----------------  799
               L  +IVTELP    +K    S  S   E +    +RP F+KR                
Sbjct  121   SDL--KIVTELPDIKTWKSGSRSCSSWSEEGEGDGLYRPLFSKRKHIANNLSSQDEIRNW  178

Query  798   ---------------DTRKQST-------FQGKDIGMMAKEGPDREDFTVASQDVPSWSR  685
                            D +  ST       FQ K +G   K G   ED  + + ++PS   
Sbjct  179   ESPSAIHASKLSKGDDEQTLSTAKYLSAPFQDKKMG---KNGHKVED-EIQNWELPSEIE  234

Query  684   NRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYITADA-----DDDNLELESGGWLTSG  520
                   +D+ L +K    G +   +   SKWSEYI+ +      +++N+  E G      
Sbjct  235   ASKWSKDDENLRTKSCILGKVRGAS---SKWSEYISEEENCGGRNEENMAREEG------  285

Query  519   KDRWNNIALENPIKDHKVDEDIHPDF  442
                     L+  I +  V++DIHPDF
Sbjct  286   -----MDVLKMMINEEIVEDDIHPDF  306



>ref|XP_009385626.1| PREDICTED: uncharacterized protein LOC103972937 [Musa acuminata 
subsp. malaccensis]
Length=241

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 101/184 (55%), Gaps = 31/184 (17%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  +FIAVQCC+CSTMQVKQ+KKS N W+C VCNQ+QSVR++ A+G +A D+R FVQ FN
Sbjct  1     MATLFIAVQCCRCSTMQVKQQKKSGNNWVCSVCNQRQSVRRIHARGHVASDLRSFVQAFN  60

Query  1086  MSRQFSDLAQHEE---PQTLEGPAEEDRFP---------------SKRTDWTEYLDFEDE  961
             M+R  +D+  H     P   +GP      P                KRTDW++YLD   E
Sbjct  61    MAR--ADIGSHGSDPVPPRSDGPRALSAAPDAREAVAHGSPFSTAKKRTDWSKYLDPTHE  118

Query  960   SVEKEDEQSTGD----GLETRIVTELPKAVFKRPKLSN------YSAGSESDCKKRFRPT  811
               + +D +  G+     LE+ + TELP    +R  + N       SA    +C   F+P+
Sbjct  119   ETDDDDAKGGGEQRVVPLESALATELPPEKSRRSSIPNCTRRAQLSAAGTDNCFG-FKPS  177

Query  810   FTKR  799
               KR
Sbjct  178   LAKR  181



>ref|XP_010645821.1| PREDICTED: UPF0544 protein C5orf45 homolog [Vitis vinifera]
Length=225

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 105/175 (60%), Gaps = 18/175 (10%)
 Frame = -1

Query  1269  PMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNF  1090
             P  A FIA+QC QCSTMQVKQ+KK+SNKW CVVCN+KQSVR+V+AQG MAKDVR FVQ+F
Sbjct  2     PPTASFIALQCFQCSTMQVKQQKKNSNKWTCVVCNEKQSVRKVYAQGSMAKDVRKFVQSF  61

Query  1089  NMSRQFSDLAQHEEPQTLEGPAEE------DRFPSKRTDWTEYLDFEDESVEKEDEQSTG  928
             NMSR+  D  + E    +    EE           +R+DW+EYLD E+E  E+      G
Sbjct  62    NMSRKSID--EEENLTVMVADGEEVGGSCSGNGKKRRSDWSEYLDPEEEEEER------G  113

Query  927   DGLETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKD  763
               +E  IVTE+ K   +   L +   G     K+  +P F KR+T  + T   +D
Sbjct  114   ADMEGEIVTEMLKNQNQSTGLQSRDRGG----KEPLKPLFPKRNTTNRPTISLED  164



>gb|AAU44427.1| hypothetical protein AT1G71760 [Arabidopsis thaliana]
Length=135

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 80/103 (78%), Gaps = 6/103 (6%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             +FIA+QC +CSTMQVKQ+KKSSNKW+CV+CNQKQSV++VFAQG+ AK++R FVQ+FNMSR
Sbjct  5     LFIALQCYECSTMQVKQKKKSSNKWVCVICNQKQSVKKVFAQGYKAKELRFFVQSFNMSR  64

Query  1077  QFSDLAQHEE----PQT-LEGPA-EEDRFPSKRTDWTEYLDFE  967
             + +D   H      P+  +EG   EE     KR+DW++YLDF+
Sbjct  65    KVADEEAHAVGDSFPEVYVEGEVNEEVNGTKKRSDWSQYLDFD  107



>ref|XP_004292507.1| PREDICTED: uncharacterized protein LOC101306884 [Fragaria vesca 
subsp. vesca]
Length=116

 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSS--NKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQN  1093
             M  +F AVQCCQCSTMQVKQRK+SS  NKW CVVCNQKQS R+VFA+  MA+D+R FVQ+
Sbjct  1     MSTIFYAVQCCQCSTMQVKQRKQSSKNNKWTCVVCNQKQSARKVFAESTMARDLRPFVQS  60

Query  1092  FNMSRQFS-DLAQHEEPQTLEGPAEEDRFPSKRTDWTEYLDFE  967
              NMSRQF+ +  QH E   +    E      +RTDWT+YLD E
Sbjct  61    SNMSRQFTQNQQQHHEHALVSDVHECHTQKKRRTDWTQYLDAE  103



>ref|XP_006473876.1| PREDICTED: UPF0544 protein C5orf45 homolog [Citrus sinensis]
Length=327

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 86/132 (65%), Gaps = 26/132 (20%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             +FIAVQCC+C  MQVKQ+KKS NKW CVVCNQKQSVR+VFA+G+MAKD+R FVQ+FNMS 
Sbjct  5     MFIAVQCCECWMMQVKQQKKSGNKWTCVVCNQKQSVRKVFAKGYMAKDLRQFVQSFNMS-  63

Query  1077  QFSDLAQHEEPQTLEGPAEEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGDGLETRIVTE  898
                   Q ++PQTL    EE                E +  + +D    GDGLE+RI TE
Sbjct  64    ------QSQKPQTLSHQLEE----------------EQQQDKTKDTICVGDGLESRIGTE  101

Query  897   LPKAVFKRPKLS  862
             +P    K+PKLS
Sbjct  102   MPN---KKPKLS  110



>ref|XP_003637172.1| hypothetical protein MTR_076s0004 [Medicago truncatula]
Length=266

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 96/281 (34%), Positives = 141/281 (50%), Gaps = 39/281 (14%)
 Frame = -1

Query  1221  MQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSRQFSD--------  1066
             + VKQ+KKSSNKW CVVCNQKQSVR++FAQG+ AKD+R FVQ+ NMSR+  +        
Sbjct  3     VAVKQKKKSSNKWNCVVCNQKQSVRKIFAQGYKAKDIRSFVQSVNMSRKSIEEDDQQQWL  62

Query  1065  LAQHEEPQTLEGPAEEDRFPSK-------RTDWTEYLDFEDE-SVEKEDEQSTGDGLETR  910
             LA    P   E    E  FP+         TDW+ YLD +D  + E++++Q   D  E  
Sbjct  63    LAGTLNPTPEEHVRGEYEFPADFNNKKNCTTDWSVYLDNDDHRATERDEQQQHEDDFEPL  122

Query  909   IVTELPKAVFKRPKLSNYSAGSESDCKKRFR-PTFTKRDTRKQSTFQGKDIGMMAKEGPD  733
             +VTELP  + K+ K  +    S   C +RF+ P F   + +++      D G   K   D
Sbjct  123   VVTELPNGMLKKRKSVD---NSTPRCGRRFKSPLFQNSEAQERCILIHTDAGEPVK---D  176

Query  732   REDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYITADADDDNL  553
             +   TV ++         +++ N     + + T+          SKW++Y+     +DNL
Sbjct  177   QRRITVLTES--------NSQRNSIVTSANQRTQKCKQAINTSTSKWNDYLA----EDNL  224

Query  552   EL---ESGGWLTSGKDRWN-NIALENPIKDHKVDEDIHPDF  442
             E    + G         WN N  LE    + +V++DIHPDF
Sbjct  225   EHGYNKRGFNFKDTSGSWNSNDILEAITGEQRVEDDIHPDF  265



>ref|XP_004969752.1| PREDICTED: uncharacterized protein LOC101760574 [Setaria italica]
Length=237

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 106/175 (61%), Gaps = 19/175 (11%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             +F+A+QC QC TMQVKQ+KKSSNKW+CVVCNQ+QSV +V A+G+ A D+R FVQ+ N++R
Sbjct  5     LFLALQCVQCDTMQVKQQKKSSNKWVCVVCNQRQSVLRVHARGYRAADLRRFVQDANLAR  64

Query  1077  QFSDLAQHEEPQTLEGPA----EEDRFPS--KRTDWTEYLDFEDE------SVEKEDEQS  934
                + A   EP+    P     + D FP+  KRTDW+EYLD E          +  D +S
Sbjct  65    GRREFAPLAEPEAGWDPVQVEEQGDEFPTEKKRTDWSEYLDDEHRDGCGGVGADASDGES  124

Query  933   TGDGLETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQG  769
              G+G+E  + TELP+   +RPK+    A S     KR +P      +++Q   QG
Sbjct  125   -GEGIE--VTTELPQ---ERPKVRPRKAQS-GVVGKRPKPLTHPTSSKRQQIEQG  172



>ref|XP_002458408.1| hypothetical protein SORBIDRAFT_03g032910 [Sorghum bicolor]
 gb|EES03528.1| hypothetical protein SORBIDRAFT_03g032910 [Sorghum bicolor]
Length=236

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 105/179 (59%), Gaps = 22/179 (12%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             +F+A+QC QC+TMQVKQ+KKSSNKW+CVVCNQ+QSV  V A+G+ A D+R FVQ+ N++R
Sbjct  5     LFLALQCVQCATMQVKQQKKSSNKWVCVVCNQRQSVLHVHARGYRAADLRRFVQDANLAR  64

Query  1077  QFSDLAQHEEPQTLEGPA----EEDRFP----SKRTDWTEYLDFEDE--------SVEKE  946
                + A   EP     PA    E D FP     ++T+W+EYLD   E          +  
Sbjct  65    GRREFAPLAEPDVDWDPAAVEEEGDVFPFPIEKRQTEWSEYLDDAGEPGNGCGGLGADAS  124

Query  945   DEQSTGDGLETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQG  769
             D +S G+G+E  ++TELP+   KRPK+    A S+   K+    T      ++Q   QG
Sbjct  125   DGES-GEGIE--VITELPQ---KRPKVRPLKAQSDVVGKRTKLSTHPTLYNKRQQIKQG  177



>ref|XP_008654723.1| PREDICTED: uncharacterized protein LOC100277060 isoform X2 [Zea 
mays]
 ref|XP_008654724.1| PREDICTED: uncharacterized protein LOC100277060 isoform X2 [Zea 
mays]
 ref|XP_008654725.1| PREDICTED: uncharacterized protein LOC100277060 isoform X2 [Zea 
mays]
 ref|XP_008654726.1| PREDICTED: uncharacterized protein LOC100277060 isoform X2 [Zea 
mays]
 ref|XP_008654727.1| PREDICTED: uncharacterized protein LOC100277060 isoform X2 [Zea 
mays]
 ref|XP_008654728.1| PREDICTED: uncharacterized protein LOC100277060 isoform X2 [Zea 
mays]
 ref|XP_008654729.1| PREDICTED: uncharacterized protein LOC100277060 isoform X2 [Zea 
mays]
 ref|XP_008654730.1| PREDICTED: uncharacterized protein LOC100277060 isoform X2 [Zea 
mays]
 gb|AFW83746.1| hypothetical protein ZEAMMB73_093125 [Zea mays]
Length=246

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 109/178 (61%), Gaps = 19/178 (11%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMS-  1081
             +FIA+QC QC+TMQVKQ+KKSSNKW+CVVCNQ+QSV  V A+G+ A D+R FVQ+ N++ 
Sbjct  5     LFIALQCVQCATMQVKQQKKSSNKWVCVVCNQRQSVLHVHARGYRAADLRRFVQDTNLAR  64

Query  1080  --RQFSDLAQHEEPQTLEGPAEEDRFPSKR--TDWTEYLDFEDES--------VEKEDEQ  937
               R+F+ LA+ +  + L    E D FP ++  T+W+EYLD   E+         +  D +
Sbjct  65    GRREFAPLAEPDVDRDLAAVEEGDVFPIEKSQTEWSEYLDDPGETGKGCGGLGADASDGE  124

Query  936   STGDGLETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKD  763
             S  +G+E  ++TELP+   KRPK+    A S+   K+    T      ++Q   QG +
Sbjct  125   SD-EGIE--VITELPQ---KRPKVRPRKAQSDVVGKRTKLSTHPTLCNKRQQIKQGSN  176



>ref|XP_008654731.1| PREDICTED: uncharacterized protein LOC100277060 isoform X1 [Zea 
mays]
 ref|XP_008654732.1| PREDICTED: uncharacterized protein LOC100277060 isoform X1 [Zea 
mays]
 ref|XP_008654733.1| PREDICTED: uncharacterized protein LOC100277060 isoform X1 [Zea 
mays]
 ref|XP_008654734.1| PREDICTED: uncharacterized protein LOC100277060 isoform X1 [Zea 
mays]
 gb|ACF81222.1| unknown [Zea mays]
 gb|ACF86803.1| unknown [Zea mays]
 gb|ACN26969.1| unknown [Zea mays]
 gb|ACN28189.1| unknown [Zea mays]
 gb|AFW83743.1| hypothetical protein ZEAMMB73_093125 [Zea mays]
 gb|AFW83744.1| hypothetical protein ZEAMMB73_093125 [Zea mays]
 gb|AFW83745.1| hypothetical protein ZEAMMB73_093125 [Zea mays]
Length=239

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 109/178 (61%), Gaps = 19/178 (11%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMS-  1081
             +FIA+QC QC+TMQVKQ+KKSSNKW+CVVCNQ+QSV  V A+G+ A D+R FVQ+ N++ 
Sbjct  5     LFIALQCVQCATMQVKQQKKSSNKWVCVVCNQRQSVLHVHARGYRAADLRRFVQDTNLAR  64

Query  1080  --RQFSDLAQHEEPQTLEGPAEEDRFPSKR--TDWTEYLDFEDES--------VEKEDEQ  937
               R+F+ LA+ +  + L    E D FP ++  T+W+EYLD   E+         +  D +
Sbjct  65    GRREFAPLAEPDVDRDLAAVEEGDVFPIEKSQTEWSEYLDDPGETGKGCGGLGADASDGE  124

Query  936   STGDGLETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKD  763
             S  +G+E  ++TELP+   KRPK+    A S+   K+    T      ++Q   QG +
Sbjct  125   SD-EGIE--VITELPQ---KRPKVRPRKAQSDVVGKRTKLSTHPTLCNKRQQIKQGSN  176



>ref|NP_001144200.1| uncharacterized protein LOC100277060 [Zea mays]
 gb|ACG38625.1| hypothetical protein [Zea mays]
Length=239

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 108/176 (61%), Gaps = 19/176 (11%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMS-  1081
             +FIA+QC QC+TMQVKQ+K+SSNKW+CVVCNQ+QSV  V A+G+ A D+R FVQ+ N++ 
Sbjct  5     LFIALQCVQCATMQVKQQKRSSNKWVCVVCNQRQSVLHVHARGYRAADLRRFVQDTNLAR  64

Query  1080  --RQFSDLAQHEEPQTLEGPAEEDRFPSKR--TDWTEYLDFEDES--------VEKEDEQ  937
               R+F+ LA+ +  + L    E D FP ++  T+W+EYLD   E+         +  D +
Sbjct  65    GRREFAPLAEPDVDRDLAAVEEGDVFPIEKSQTEWSEYLDDPGETGKGCGGLGADASDGE  124

Query  936   STGDGLETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQG  769
             S  +G+E  ++TELP+   KRPK+    A S+   K+    T      ++Q   QG
Sbjct  125   SD-EGIE--VITELPQ---KRPKVRPRKAQSDVVGKRTKLSTHPTLCNKRQQIKQG  174



>ref|XP_006842172.1| hypothetical protein AMTR_s00078p00151820 [Amborella trichopoda]
 gb|ERN03847.1| hypothetical protein AMTR_s00078p00151820 [Amborella trichopoda]
Length=264

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 100/270 (37%), Positives = 133/270 (49%), Gaps = 63/270 (23%)
 Frame = -1

Query  1218  QVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSRQFSD---LAQHEE  1048
             +VKQ+KKSSNKW+CVVCNQKQS+ +VFA+ FMAKDVR FVQ+ NM+R F+D   ++   E
Sbjct  46    KVKQQKKSSNKWVCVVCNQKQSILKVFARSFMAKDVRKFVQSCNMTRSFTDQALISLGNE  105

Query  1047  PQTLEGPAE--EDRFPS---KRTDWTEYLDFED-ESVEKEDEQSTGDGLET-RIVTELPK  889
              Q  E   +  ED+F      ++ W+EYLD ED +  E E+E+  GD  ET RIVTE  K
Sbjct  106   NQVPENGFQVMEDQFSGDIYSQSKWSEYLDEEDIKKTEVEEEEDRGD--ETPRIVTEYRK  163

Query  888   AVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIGMMAKEGPDREDFTVAS  709
              +FKR K          + +  F+P F+KR  R  ST QG     MA E           
Sbjct  164   ELFKRSKQRTSMNLQSKETRSNFKPVFSKRKER--STAQGS----MASE-----------  206

Query  708   QDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYITADADD-DNLELESGGW  532
                P  S            + K P             KWS+Y+  +        +ES   
Sbjct  207   ---PQNS------------LRKRPC------------KWSDYLEENGSQIGEFTIESEAQ  239

Query  531   LTSGKDRWNNIALENPIKDHKVDEDIHPDF  442
               SG +   +      + D   +EDIHPDF
Sbjct  240   DCSGANVMTH------LHDEVFEEDIHPDF  263



>ref|XP_006434547.1| hypothetical protein CICLE_v10001857mg [Citrus clementina]
 gb|ESR47787.1| hypothetical protein CICLE_v10001857mg [Citrus clementina]
Length=322

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 83/132 (63%), Gaps = 31/132 (23%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             +FIAVQCC+C  MQVKQ+KKS NKW CVVCNQKQSVR+VFA+G+MAKD+R FVQ+FNMS 
Sbjct  5     MFIAVQCCECWMMQVKQQKKSGNKWTCVVCNQKQSVRKVFAKGYMAKDLRQFVQSFNMS-  63

Query  1077  QFSDLAQHEEPQTLEGPAEEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGDGLETRIVTE  898
                   Q ++PQTL                           E++ +   GDGLE+RI TE
Sbjct  64    ------QSQKPQTLS---------------------HQLEEEEQQQVCVGDGLESRIGTE  96

Query  897   LPKAVFKRPKLS  862
             +P    K+PKLS
Sbjct  97    MPN---KKPKLS  105



>ref|XP_010929935.1| PREDICTED: uncharacterized protein LOC105051257 [Elaeis guineensis]
Length=182

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 73/114 (64%), Gaps = 20/114 (18%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  +FIAVQC QCSTMQVKQ+KK SNKW+CVVCNQ+QSVR++ AQG +A+D+R FVQ FN
Sbjct  1     MPTLFIAVQCFQCSTMQVKQQKKRSNKWVCVVCNQRQSVRRIHAQGPLARDLRHFVQAFN  60

Query  1086  MSRQFSDLAQHEEPQTLEGPAEEDRFP-------------SKRTDWTEYLDFED  964
              SR        + P  +  P+E  R P              +R DWTEYLD ++
Sbjct  61    TSRS-------DGPHPIPPPSEGSRSPMAAAEHRGGANRGKRRMDWTEYLDLQE  107



>ref|XP_008237537.1| PREDICTED: UPF0544 protein C5orf45 homolog, partial [Prunus mume]
Length=78

 Score =   109 bits (273),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 2/65 (3%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSS--NKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQN  1093
             M A+FIAVQCCQCSTMQVKQRK+SS  NKW CVVCNQKQSVRQVFAQG MAKD+R+FVQ+
Sbjct  1     MSAIFIAVQCCQCSTMQVKQRKQSSKSNKWTCVVCNQKQSVRQVFAQGPMAKDLRLFVQS  60

Query  1092  FNMSR  1078
              NMSR
Sbjct  61    SNMSR  65



>gb|KEH15389.1| UPF0544 C5orf45-like protein, putative [Medicago truncatula]
Length=149

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 86/135 (64%), Gaps = 20/135 (15%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             +FIA+QC  CSTMQVKQ+KKSSNKW CVVCNQKQS+R+VFAQG+ AKD+R FVQ+ NMSR
Sbjct  6     LFIALQCFNCSTMQVKQKKKSSNKWNCVVCNQKQSLRKVFAQGYKAKDIRTFVQSVNMSR  65

Query  1077  QFSDLAQHEEPQTL----EGPAEEDRFPSK-------------RTDWTEYLDFE-DESVE  952
             +   + Q ++ Q L      PA+E+  P               +TDW+ YLD +   + E
Sbjct  66    K--SIEQDDQQQWLLTGTLNPAQEEYVPGDSDFPADLSNKKKCKTDWSLYLDNDVHRATE  123

Query  951   KEDEQSTGDGLETRI  907
             ++ +Q  G  L T +
Sbjct  124   RDGQQQHGYLLFTLL  138



>ref|XP_010232239.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X2 [Brachypodium 
distachyon]
Length=202

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 87/138 (63%), Gaps = 21/138 (15%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  +F+A+QC QCSTMQVKQ+KKSSNKW+CVVCNQ+QSV +V A+G+ A D+R FVQ+ N
Sbjct  1     MTTLFLALQCVQCSTMQVKQQKKSSNKWVCVVCNQRQSVLRVHARGYRAADLRRFVQDAN  60

Query  1086  MSRQFSDLAQHEEPQTLEGPA--EEDRFPS----KRTDWTEYLDFEDES------VEKED  943
             +SR          P+   GPA  E+ ++ S    +R DWTEYLD   E       V   D
Sbjct  61    LSRGRGAPV----PEADSGPAADEDQQYESPREKRRMDWTEYLDDAGERDGGCGVVGARD  116

Query  942   EQSTGDGLETRIVTELPK  889
             E   G G+E  + TELP+
Sbjct  117   E---GIGIE--VTTELPQ  129



>ref|XP_010232238.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X1 [Brachypodium 
distachyon]
Length=234

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 88/142 (62%), Gaps = 21/142 (15%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  +F+A+QC QCSTMQVKQ+KKSSNKW+CVVCNQ+QSV +V A+G+ A D+R FVQ+ N
Sbjct  1     MTTLFLALQCVQCSTMQVKQQKKSSNKWVCVVCNQRQSVLRVHARGYRAADLRRFVQDAN  60

Query  1086  MSRQFSDLAQHEEPQTLEGPA--EEDRFPS----KRTDWTEYLDFEDES------VEKED  943
             +SR          P+   GPA  E+ ++ S    +R DWTEYLD   E       V   D
Sbjct  61    LSRGRGAPV----PEADSGPAADEDQQYESPREKRRMDWTEYLDDAGERDGGCGVVGARD  116

Query  942   EQSTGDGLETRIVTELPKAVFK  877
             E   G G+E  + TELP+   K
Sbjct  117   E---GIGIE--VTTELPQERHK  133



>emb|CDM83612.1| unnamed protein product [Triticum aestivum]
Length=217

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 71/189 (38%), Positives = 98/189 (52%), Gaps = 5/189 (3%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  +F+A+QC +CSTMQVKQ+KKSSNKW CVVCN++QSV +V A+G+ A D+R FVQ+ N
Sbjct  1     MATLFLALQCVECSTMQVKQQKKSSNKWACVVCNRRQSVLRVHARGYRAADLRRFVQDAN  60

Query  1086  MSRQFSDLAQHE--EPQTLEGPAEEDRFPSKRTDWTEYLDFEDE-SVEKEDEQSTGDGLE  916
             ++R      +    +P       +E     KR DW+EYLD   E    +    S  DG+E
Sbjct  61    LARGRGAPVREADWDPPVAGDQQDEPPREKKRMDWSEYLDDTGERHAGRGFADSRDDGIE  120

Query  915   TRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIGMMAKEGP  736
               + TELP+   K P L            KR +P      ++ Q   QG     +     
Sbjct  121   --VTTELPQERPKAPSLKRPRKAQLGVAGKRPKPPINPSLSKMQQMEQGPTCSTVCSATS  178

Query  735   DREDFTVAS  709
               ED + AS
Sbjct  179   TAEDQSSAS  187



>gb|EPS71719.1| hypothetical protein M569_03040, partial [Genlisea aurea]
Length=116

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 71/109 (65%), Gaps = 14/109 (13%)
 Frame = -1

Query  1254  FIAVQCCQCSTMQ---------VKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIF  1102
             FIAVQC QCSTMQ         VKQ+KKSSNKW CVVCN+KQSV +VF    MAK+VR F
Sbjct  6     FIAVQCFQCSTMQAACLFHYCIVKQQKKSSNKWTCVVCNEKQSVCKVFFNALMAKEVRDF  65

Query  1101  VQNFNMSRQFSDLAQHEEPQTLEGPAEEDRFPS---KRTDWTEYLDFED  964
             VQNFNMSR  SD  Q +  Q  E  +  D       KRTDWTEY+D E+
Sbjct  66    VQNFNMSRMLSD--QKDLQQVGEESSYSDEIRGKRKKRTDWTEYIDDEE  112



>dbj|BAJ99096.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=217

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 90/154 (58%), Gaps = 5/154 (3%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  +F+A+QC +CSTMQVKQ+KKSSNKW+CVVCN++QSV +V A+G+ A D+R FVQ+ N
Sbjct  1     MATLFLALQCVECSTMQVKQQKKSSNKWVCVVCNRRQSVLRVHARGYRAADLRRFVQDAN  60

Query  1086  MSRQFSDLAQHEEPQ-TLEGPAEEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGDGLE--  916
             ++R     A   EP      P ++   P +   W ++ ++ D++ E+   +   D L+  
Sbjct  61    LARGRG--APVREPDWDQPAPGDQQDEPPREKKWMDWSEYLDDTGERHAGRGFADSLDDG  118

Query  915   TRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRP  814
               + TELP+   K P L     G      KR +P
Sbjct  119   IEVSTELPQERPKAPSLKRPPKGQLVVAGKRPKP  152



>gb|KDP36030.1| hypothetical protein JCGZ_09996 [Jatropha curcas]
Length=229

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 86/247 (35%), Positives = 130/247 (53%), Gaps = 34/247 (14%)
 Frame = -1

Query  1143  VFAQGFMAKDVRIFVQNFNMSRQFSDLAQHEEPQTLEGPAE-----EDRFPSKRTDWTEY  979
             VF  G+ AKD+R FVQ+FNMSR  +D   H+    +  P +     E +   +R DW+EY
Sbjct  5     VFIAGYKAKDIRKFVQSFNMSR--NDGGDHQSLTEIASPVDSGSLLEHQQKKRRCDWSEY  62

Query  978   LDFEDE----SVEKEDEQSTGDGLETRIVTELPKAVFKRPKLSNYSAGSESDCKKR---F  820
             LD E++    +V++EDE+  GDGL  +IVTELP+ +F + KL  + +GS +        +
Sbjct  63    LDVEEDGNKDNVKEEDEE--GDGLRLKIVTELPQEMFMKSKLRKHCSGSGTGGGGSDDLY  120

Query  819   RPTFTKRDTRKQSTFQGKDIGMMAKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKE  640
             RP F+KR+ ++    Q K+    AKE          ++ +   +RN     N K+   + 
Sbjct  121   RPAFSKRNIKRPIVSQEKE----AKENQ-------PAKVIGYSNRNGYMTRNFKE--QQN  167

Query  639   PTEGSLLTTAKWMSKWSEYITADADDDNLELESGGWLTSGKDRWNNIALENPIKDHKVDE  460
             PT+   LT A   SKW+ YI    D+D  +  SG       D  +NI  E  + + KV++
Sbjct  168   PTQ---LTMATKASKWNAYIA--HDEDEFKAGSGTNFVDEMDHCSNIVWEAILDNQKVED  222

Query  459   DIHPDFT  439
             DIHPDF 
Sbjct  223   DIHPDFI  229



>dbj|BAD87382.1| hypothetical protein [Oryza sativa Japonica Group]
Length=219

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 131/280 (47%), Gaps = 70/280 (25%)
 Frame = -1

Query  1260  AVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMS  1081
             ++F+A+QC QCSTMQVK +KKSSNKW+CVVCNQ+QSV +V A+G  A D+R FVQ  N+S
Sbjct  4     SLFLALQCVQCSTMQVKPQKKSSNKWVCVVCNQRQSVMRVHARGHRAADLRRFVQEANLS  63

Query  1080  R-QFSDLAQHEEPQTLEGPAEE-DRFP---SKRTDWTEYLDFEDE-SVEKEDEQSTGDGL  919
             R + + +   EE      P E+ D FP    +R DW++YL+   E       E++  +G+
Sbjct  64    RGRAAHVPVPEEDWVPAVPGEQRDEFPKERKRRMDWSDYLEDPGEYDGGGHHEEARDEGI  123

Query  918   ETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIGMMAKEG  739
             +  + TELP+   KRPK+                 T  KR  + Q    GK         
Sbjct  124   Q--VTTELPE---KRPKV-----------------TSLKRAPKAQLGLGGK---------  152

Query  738   PDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYITADADDD  559
               R    V S                  L  ++P E +        SKWS Y+       
Sbjct  153   --RPKTPVTS-----------------TLPKRQPIEEA------QRSKWSNYL-------  180

Query  558   NLELESGGWLTSGKDRWNNIALENPIKDHKVDEDIHPDFT  439
             +     GG      +R +   LE  I D  VD+++HPDF 
Sbjct  181   DTSFSEGGSGFEDSER-HCSELECSITDVVVDDEVHPDFV  219



>gb|EEE55299.1| hypothetical protein OsJ_03253 [Oryza sativa Japonica Group]
Length=221

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 92/280 (33%), Positives = 130/280 (46%), Gaps = 68/280 (24%)
 Frame = -1

Query  1260  AVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMS  1081
             ++F+A+QC QCSTMQVK +KKSSNKW+CVVCNQ+QSV +V A+G  A D+R FVQ  N+S
Sbjct  4     SLFLALQCVQCSTMQVKPQKKSSNKWVCVVCNQRQSVMRVHARGHRAADLRRFVQEANLS  63

Query  1080  R-QFSDLAQHEEPQTLEGPAEE-DRFP---SKRTDWTEYLDFEDE-SVEKEDEQSTGDGL  919
             R + + +   EE      P E+ D FP    +R DW++YL+   E       E++  + +
Sbjct  64    RGRAAHVPVPEEDWVPAVPGEQRDEFPKERKRRMDWSDYLEDPGEYDGGGHHEEARDEDV  123

Query  918   ETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIGMMAKEG  739
               ++ TELP+   KRPK+                 T  KR  + Q    GK         
Sbjct  124   GIQVTTELPE---KRPKV-----------------TSLKRAPKAQLGLGGK---------  154

Query  738   PDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYITADADDD  559
               R    V S                  L  ++P E +        SKWS Y+       
Sbjct  155   --RPKTPVTS-----------------TLPKRQPIEEA------QRSKWSNYL-------  182

Query  558   NLELESGGWLTSGKDRWNNIALENPIKDHKVDEDIHPDFT  439
             +     GG      +R +   LE  I D  VD+++HPDF 
Sbjct  183   DTSFSEGGSGFEDSER-HCSELECSITDVVVDDEVHPDFV  221



>gb|EEC71390.1| hypothetical protein OsI_03514 [Oryza sativa Indica Group]
Length=221

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 92/280 (33%), Positives = 129/280 (46%), Gaps = 68/280 (24%)
 Frame = -1

Query  1260  AVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMS  1081
             ++F+A+QC QCSTMQVK +KKSSNKW+CVVCNQ+QSV +V A+G  A D+R FVQ  N+S
Sbjct  4     SLFLALQCVQCSTMQVKPQKKSSNKWVCVVCNQRQSVMRVHARGHRAADLRRFVQEANLS  63

Query  1080  R-QFSDLAQHEEPQTLEGPAEE-DRFP---SKRTDWTEYLDFEDE-SVEKEDEQSTGDGL  919
             R + + +   EE      P E+ D FP    +R DW++YL+   E       E++  + +
Sbjct  64    RGRAAHVPVPEEDWVPAVPGEQRDEFPKERKRRMDWSDYLEDPGEYDGGGHHEEARDEDV  123

Query  918   ETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIGMMAKEG  739
               ++ TELP+   KRPK+                 T  KR  + Q    GK         
Sbjct  124   GIQVTTELPE---KRPKV-----------------TSLKRAPKAQLGLGGK---------  154

Query  738   PDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYITADADDD  559
               R    V S                  L  ++P E +        SKWS Y+      D
Sbjct  155   --RPKTPVTS-----------------TLPKRQPIEEA------QRSKWSNYL------D  183

Query  558   NLELESGGWLTSGKDRWNNIALENPIKDHKVDEDIHPDFT  439
                 E G      +   +   LE  I D  VD+++HPDF 
Sbjct  184   TSFSEGGSGFEDSEQHCSE--LECSITDVVVDDEVHPDFV  221



>ref|NP_001044069.2| Os01g0716300 [Oryza sativa Japonica Group]
 dbj|BAF05983.2| Os01g0716300 [Oryza sativa Japonica Group]
Length=243

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 92/141 (65%), Gaps = 11/141 (8%)
 Frame = -1

Query  1260  AVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMS  1081
             ++F+A+QC QCSTMQVK +KKSSNKW+CVVCNQ+QSV +V A+G  A D+R FVQ  N+S
Sbjct  4     SLFLALQCVQCSTMQVKPQKKSSNKWVCVVCNQRQSVMRVHARGHRAADLRRFVQEANLS  63

Query  1080  R-QFSDLAQHEEPQTLEGPAEE-DRFP---SKRTDWTEYLDFEDE-SVEKEDEQSTGDGL  919
             R + + +   EE      P E+ D FP    +R DW++YL+   E       E++  +G+
Sbjct  64    RGRAAHVPVPEEDWVPAVPGEQRDEFPKERKRRMDWSDYLEDPGEYDGGGHHEEARDEGI  123

Query  918   ETRIVTELPKAVFKRPKLSNY  856
             +  + TELP+   KRPK+++ 
Sbjct  124   Q--VTTELPE---KRPKVTSL  139



>gb|KHG28108.1| Lipoyl synthase, mitochondrial [Gossypium arboreum]
Length=234

 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 90/244 (37%), Positives = 124/244 (51%), Gaps = 27/244 (11%)
 Frame = -1

Query  1125  MAKDVRIFVQNFNMSRQFSDLAQHEEPQT------LEGPAEEDRFPSK-RTDWTEYLDFE  967
             MAKDVR FVQ+FNM+R+F+D  Q  +P +       +    +   P K RTDWTEYLD E
Sbjct  1     MAKDVRKFVQSFNMTRKFTDQNQLFDPTSEYDIDLEDDDGGDLENPKKRRTDWTEYLDSE  60

Query  966   DES----VEKEDEQSTGDGLETRIVTELP-KAVFKRPKLSNYSAGSESDCKKRFRPTFTK  802
             D      V +E+EQ   D LE  IVTELP K  FKRPKL N   G E    + ++P   K
Sbjct  61    DHHEHKLVLQEEEQGRVD-LEPEIVTELPAKEKFKRPKLRNSDTGEEGVGHQLYKPLLYK  119

Query  801   RDTRKQSTFQGKDIGMMAKEGPDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSL  622
             R+ RK +    +D+        DR+    A  D+ S  R+        K++  E    S 
Sbjct  120   RNCRKATMLFSQDV------KADRQ--QQADGDIGSKKRSDLTIRKVGKIL--ESMRNSK  169

Query  621   LTTAKWMSKWSEYITADADDDNLELESGGWLTSGKDRWNN----IALENPIKDHKVDEDI  454
               T+K  SKW +YIT + + D+L+        +  D+W N    +   + IK   V++DI
Sbjct  170   PATSKGNSKWKDYITEEDEGDSLKQCCPRNSANYMDKWGNADDAVLKTDSIKYQIVEDDI  229

Query  453   HPDF  442
             HPDF
Sbjct  230   HPDF  233



>emb|CBI29361.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 88/148 (59%), Gaps = 18/148 (12%)
 Frame = -1

Query  1218  QVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSRQFSDLAQHEEPQT  1039
             QVKQ+KK+SNKW CVVCN+KQSVR+V+AQG MAKDVR FVQ+FNMSR+  D  + E    
Sbjct  13    QVKQQKKNSNKWTCVVCNEKQSVRKVYAQGSMAKDVRKFVQSFNMSRKSID--EEENLTV  70

Query  1038  LEGPAEE------DRFPSKRTDWTEYLDFEDESVEKEDEQSTGDGLETRIVTELPKAVFK  877
             +    EE           +R+DW+EYLD E+E  E+      G  +E  IVTE+ K   +
Sbjct  71    MVADGEEVGGSCSGNGKKRRSDWSEYLDPEEEEEER------GADMEGEIVTEMLKNQNQ  124

Query  876   RPKLSNYSAGSESDCKKRFRPTFTKRDT  793
                L +   G     K+  +P F KR+T
Sbjct  125   STGLQSRDRGG----KEPLKPLFPKRNT  148



>ref|XP_006644621.1| PREDICTED: uncharacterized protein LOC102713135 [Oryza brachyantha]
Length=252

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 90/142 (63%), Gaps = 11/142 (8%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             +F+A+QC QCSTMQVK +KKSSNKW+CVVCNQ+QSV +V A+G  A D+R FVQ+ N+SR
Sbjct  5     LFLALQCVQCSTMQVKPQKKSSNKWVCVVCNQRQSVMRVHARGCRAADLRRFVQDANLSR  64

Query  1077  QFSDLAQHEEPQTLEGPA----EEDRFP---SKRTDWTEYL-DFEDESVEKEDEQSTGDG  922
               +       P     PA    ++D FP    +R DW+EYL D  +       ++ T DG
Sbjct  65    GRAAHVPLPVPGEDWTPAVSGEQQDDFPRGRKRRMDWSEYLDDPGECDGGGGGDEGTEDG  124

Query  921   LETRIVTELPKAVFKRPKLSNY  856
             +  ++ TELP+   KRPK+++ 
Sbjct  125   VRIQVTTELPE---KRPKVTSL  143



>ref|XP_008381906.1| PREDICTED: UPF0544 protein C5orf45 [Malus domestica]
Length=62

 Score = 95.5 bits (236),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  VFIAVQCCQCSTMQVKQR KS NKW CVVCNQKQ VRQVFAQG +  D+R+FVQ+ N
Sbjct  1     MPTVFIAVQCCQCSTMQVKQRNKS-NKWTCVVCNQKQFVRQVFAQGPVVGDLRLFVQSSN  59

Query  1086  MSR  1078
             MSR
Sbjct  60    MSR  62



>gb|KEH15761.1| hypothetical protein MTR_0571s0030, partial [Medicago truncatula]
Length=111

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 65/108 (60%), Gaps = 15/108 (14%)
 Frame = -1

Query  1215  VKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSRQFSD--------LA  1060
             VKQ+KK SNKW CVVCNQKQSVR++FAQG+ AKD+R FVQ+ NMSR+  +        LA
Sbjct  1     VKQKKKCSNKWNCVVCNQKQSVRKIFAQGYKAKDIRSFVQSVNMSRKSIEEDDQQQWLLA  60

Query  1059  QHEEPQTLEGPAEEDRFPSK-------RTDWTEYLDFEDESVEKEDEQ  937
                 P   E    E  FP+        +TDW+ YLD +D    + DEQ
Sbjct  61    GTLNPTPEEHVRGEYEFPADLTDKKKCKTDWSLYLDNDDHRATERDEQ  108



>gb|KDO83839.1| hypothetical protein CISIN_1g038280mg, partial [Citrus sinensis]
Length=233

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 64/103 (62%), Gaps = 16/103 (16%)
 Frame = -1

Query  1221  MQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSRQFSDLAQHEEPQ  1042
             MQVKQ+KKS NKW CVVCNQKQSVR+VFA+G+MAKD+R FVQ+FNMS+            
Sbjct  1     MQVKQQKKSGNKWTCVVCNQKQSVRKVFAKGYMAKDLRQFVQSFNMSQD----------S  50

Query  1041  TLEGPAEEDRFPSKRTDWTEYL---DFEDESVEKEDEQSTGDG  922
             T+  P+      SK   W++YL   D E E+ ++    S   G
Sbjct  51    TICWPSMTKAVVSK---WSKYLSEDDMEPETCQRAKVNSGSKG  90



>ref|XP_010092786.1| hypothetical protein L484_002099 [Morus notabilis]
 gb|EXB52312.1| hypothetical protein L484_002099 [Morus notabilis]
Length=123

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 75/127 (59%), Gaps = 13/127 (10%)
 Frame = -1

Query  1125  MAKDVRIFVQNFNMSRQFSDLAQHE-EPQTLEGPAEEDRFPS----KRTDWTEYLDFED-  964
             MA+D+R+FVQ+FNMSRQF + +    +P   + P  +   PS     RTDWTE+LD +  
Sbjct  1     MAQDLRLFVQSFNMSRQFQNHSSSSYDPPLEDDPPLQHLSPSDCKRPRTDWTEFLDPDHE  60

Query  963   --ESVEKEDEQSTGDGLETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTR  790
               E +E+   +    G E  IVTELP+ ++++ KL+  + G E      ++P F+KR++ 
Sbjct  61    ICEDIEQGGVEPAECGFEPEIVTELPEGLYQKAKLNRSADGDE-----LYKPVFSKRNSN  115

Query  789   KQSTFQG  769
             K+  FQG
Sbjct  116   KRVLFQG  122



>ref|XP_002988691.1| hypothetical protein SELMODRAFT_128442 [Selaginella moellendorffii]
 gb|EFJ10202.1| hypothetical protein SELMODRAFT_128442 [Selaginella moellendorffii]
Length=113

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 55/109 (50%), Gaps = 11/109 (10%)
 Frame = -1

Query  1260  AVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMS  1081
             A F+A++C  C   QVK RKKSS+KW C VCN+KQSV +V+     AK +R  VQ  N S
Sbjct  2     AEFLALRCYACKMFQVKPRKKSSSKWCCSVCNEKQSVTKVYGSSGAAKKIRELVQTLNYS  61

Query  1080  -----------RQFSDLAQHEEPQTLEGPAEEDRFPSKRTDWTEYLDFE  967
                            DL   E  Q+  G      + +K + W EYL+ E
Sbjct  62    TLAQQQDHFEPNDVGDLTTQENGQSEVGEKNVHGYETKPSKWAEYLETE  110



>ref|XP_002986378.1| hypothetical protein SELMODRAFT_123957 [Selaginella moellendorffii]
 gb|EFJ12587.1| hypothetical protein SELMODRAFT_123957 [Selaginella moellendorffii]
Length=113

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 55/109 (50%), Gaps = 11/109 (10%)
 Frame = -1

Query  1260  AVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMS  1081
             A F+A++C  C   QVK RKKSS+KW C VCN+KQSV +V+     AK +R  VQ  N S
Sbjct  2     AEFLALRCYACKMFQVKPRKKSSSKWCCSVCNEKQSVTKVYGSSGAAKKIRELVQTLNYS  61

Query  1080  -----------RQFSDLAQHEEPQTLEGPAEEDRFPSKRTDWTEYLDFE  967
                            DL   E  Q+  G      + +K + W EYL+ E
Sbjct  62    PLAQEQDHFEPNDVGDLTTQENGQSEVGEKNVHGYETKPSKWAEYLETE  110



>gb|EKC23336.1| UPF0544 protein C5orf45-like protein [Crassostrea gigas]
Length=343

 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 95/209 (45%), Gaps = 47/209 (22%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M   F  +QC  C T QV Q KKSSNKW C +C +KQS+++V+++G  A D R  VQN N
Sbjct  1     MPQEFHVLQCYSCFTFQVHQVKKSSNKWNCKLCGEKQSIKKVYSRGSGA-DCRRHVQNLN  59

Query  1086  MSRQFSDLAQ-----HEEPQTLEG--------PAEEDRFPS-KRTDWTEYL-----DFED  964
               RQ +D  Q     H +   LE         P  ++R P+   + W +Y+     +  D
Sbjct  60    SLRQEADKIQTLSVCHYDNPELENKEQGLTTVPENQNRLPTYTESRWNQYIEEAPSEIHD  119

Query  963   ESVEKEDEQSTGDGLETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQ  784
             E  + ED+  T DG           +VF R K            +KR   +F+++ TR Q
Sbjct  120   EFPQPEDDMYTTDG-----------SVFHRSKK-----------RKRNTSSFSRKYTRHQ  157

Query  783   STFQGKDIGMMAKEGPDREDFTVASQDVP  697
             +     DIG  +   P   D  +   D P
Sbjct  158   N-----DIGADSTSYPSSYDKDLQGNDQP  181



>ref|XP_005830260.1| hypothetical protein GUITHDRAFT_110694 [Guillardia theta CCMP2712]
 gb|EKX43280.1| hypothetical protein GUITHDRAFT_110694 [Guillardia theta CCMP2712]
Length=300

 Score = 77.0 bits (188),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
              +I VQC QC   QV Q KKS+NK++C VCN+KQSVR++FAQ  +A+D R   Q  NM+R
Sbjct  3     AYIVVQCYQCGLFQVTQEKKSTNKFVCPVCNEKQSVRKIFAQSEIARDCRQVTQELNMTR  62



>ref|XP_003217508.2| PREDICTED: UPF0544 protein C5orf45 homolog isoform X1 [Anolis 
carolinensis]
Length=353

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 55/116 (47%), Gaps = 23/116 (20%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M   F  ++CC C   QV+Q KKS  KW C VCN+KQSV +VF QG    D R  VQ  N
Sbjct  1     MAQQFQVLRCCFCRVFQVQQVKKS-KKWNCKVCNEKQSVLKVFGQG-SGSDCRHHVQKLN  58

Query  1086  MSRQFSDLAQHEEPQTLEGPA------------------EEDRFPSKRTDWTEYLD  973
             M +  S  A    P+ +E P                   E+   PS+   WT+YLD
Sbjct  59    MLQGESQQAAMNIPRDIEEPIEMSDENTANIREELGQQEEKKETPSR---WTKYLD  111



>ref|XP_008103053.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X2 [Anolis 
carolinensis]
Length=132

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 55/116 (47%), Gaps = 23/116 (20%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M   F  ++CC C   QV+Q KKS  KW C VCN+KQSV +VF QG    D R  VQ  N
Sbjct  1     MAQQFQVLRCCFCRVFQVQQVKKSK-KWNCKVCNEKQSVLKVFGQG-SGSDCRHHVQKLN  58

Query  1086  MSRQFSDLAQHEEPQTLEGPA------------------EEDRFPSKRTDWTEYLD  973
             M +  S  A    P+ +E P                   E+   PS+   WT+YLD
Sbjct  59    MLQGESQQAAMNIPRDIEEPIEMSDENTANIREELGQQEEKKETPSR---WTKYLD  111



>ref|XP_002154173.2| PREDICTED: UPF0544 protein C5orf45-like [Hydra vulgaris]
Length=240

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M   F  +QC +C+T QV Q KKS+NKW C +CN+KQSVR V   G +AKD R   Q  N
Sbjct  1     MTQEFQVLQCYKCNTFQVNQVKKSTNKWQCKICNEKQSVRVVHFVG-IAKDCRQHCQEVN  59

Query  1086  MSR  1078
             + +
Sbjct  60    LKK  62



>ref|XP_008471703.1| PREDICTED: UPF0544 protein C5orf45 homolog [Diaphorina citri]
Length=433

 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 58/129 (45%), Gaps = 21/129 (16%)
 Frame = -1

Query  1248  AVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR---  1078
              ++CC CST QV   KK+  KW C +CNQKQSV++VF +G   KD R+  Q  N  R   
Sbjct  7     VLKCCSCSTFQVHIVKKAK-KWDCKICNQKQSVKEVFGRG-SGKDCRVHAQKLNALRAAR  64

Query  1077  --------QFSDLAQ------HEEPQTLEGPAEEDRFPSKRTDWTEYLD--FEDESVEKE  946
                     QFS+         H    T      +    +    W +YLD   ED    +E
Sbjct  65    DGSSLTDEQFSEFQSAAASIPHHSDHTDHSIPTQQACANVSNKWDKYLDQEIEDNESPEE  124

Query  945   DEQSTGDGL  919
             D +   +G+
Sbjct  125   DNRHLLEGV  133



>gb|EFA83305.1| hypothetical protein PPL_04095 [Polysphondylium pallidum PN500]
Length=463

 Score = 61.2 bits (147),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -1

Query  1254  FIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNM  1084
             +I +QC  CS  QVKQ+ K  N + CV+C++KQS++++F   + AKD+R  V+ +N+
Sbjct  4     YILIQCFSCSMFQVKQKAKV-NTFKCVICSEKQSIKKIFGISYQAKDLRELVKKYNL  59



>dbj|GAM17608.1| hypothetical protein SAMD00019534_007830, partial [Acytostelium 
subglobosum LB1]
Length=379

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M   +I +QC  CS  QVKQ+ K  N + CV+C++KQS+ +++   + AKD+R  V+ +N
Sbjct  1     MALEYILIQCYSCSMFQVKQKTKV-NSFTCVICHEKQSIMRIYGISYQAKDLRDLVKKYN  59

Query  1086  M  1084
             +
Sbjct  60    L  60



>gb|EHJ69538.1| hypothetical protein KGM_19336 [Danaus plexippus]
Length=237

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 62/122 (51%), Gaps = 14/122 (11%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  +F  ++C +C   QV   KKS NK++C +CN+KQS+++ ++ G +AKD R+ VQ  N
Sbjct  1     MSQLFQVLRCYKCLAFQVHHTKKS-NKFLCKICNEKQSIKRHYSIG-IAKDCRMHVQKLN  58

Query  1086  MSRQFSDLAQHEEPQ-------TLEGPAEEDRFPS----KRTDWTEYLDFE-DESVEKED  943
               R   D    EE         T E   E   + +     R+ W  Y+D +  ++VE + 
Sbjct  59    KLRGEKDETILEESSEECRDVDTSENSCENISYNTDISKNRSKWLAYVDIDKSDTVENQS  118

Query  942   EQ  937
              Q
Sbjct  119   HQ  120



>ref|XP_005295889.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X1 [Chrysemys 
picta bellii]
Length=390

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 55/126 (44%), Gaps = 21/126 (17%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M   F  ++CC C T QV Q KKS  KW C VC +KQ + + + QG    D R  VQ  N
Sbjct  1     MGQRFQVLRCCSCGTFQVHQVKKS-KKWSCKVCGEKQMLLKAYGQG-SGSDCRRHVQKLN  58

Query  1086  MSRQFSDLAQHEEPQTLEGPAEEDR-------------------FPSKRTDWTEYLDFED  964
             + R  +++A       +E P   D+                   F    + W +YLD + 
Sbjct  59    LLRAGTEVAAEGTSWYIEEPVNNDKENTGVPQEENVGWQEEDVEFSPLVSRWNKYLDKDS  118

Query  963   ESVEKE  946
             E  E+E
Sbjct  119   EDQEEE  124



>ref|XP_005295890.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X2 [Chrysemys 
picta bellii]
Length=375

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 55/126 (44%), Gaps = 21/126 (17%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M   F  ++CC C T QV Q KKS  KW C VC +KQ + + + QG    D R  VQ  N
Sbjct  1     MGQRFQVLRCCSCGTFQVHQVKKS-KKWSCKVCGEKQMLLKAYGQG-SGSDCRRHVQKLN  58

Query  1086  MSRQFSDLAQHEEPQTLEGPAEEDR-------------------FPSKRTDWTEYLDFED  964
             + R  +++A       +E P   D+                   F    + W +YLD + 
Sbjct  59    LLRAGTEVAAEGTSWYIEEPVNNDKENTGVPQEENVGWQEEDVEFSPLVSRWNKYLDKDS  118

Query  963   ESVEKE  946
             E  E+E
Sbjct  119   EDQEEE  124



>emb|CBN74166.1| conserved unknown protein [Ectocarpus siliculosus]
Length=460

 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = -1

Query  1257  VFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMS  1081
             VF+A++C  C   QV QR KS  KW C +C + QS+ +V+ +G  AKDVR  V   N +
Sbjct  7     VFLALRCFSCQCFQVNQRTKS-GKWKCRMCGEGQSIVKVWGRGGHAKDVRGLVMALNAA  64



>ref|XP_004357399.1| hypothetical protein DFA_02677 [Dictyostelium fasciculatum]
 gb|EGG18937.1| hypothetical protein DFA_02677 [Dictyostelium fasciculatum]
Length=466

 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -1

Query  1254  FIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNM  1084
             +I +QC  C T Q+ Q+ K S K+ C +CN+KQSV++++A     KD+R  VQ +N+
Sbjct  4     YILLQCYSCHTFQINQKTKVS-KFQCKICNEKQSVKKIYAISNQPKDLRPLVQKYNL  59



>ref|XP_006681119.1| hypothetical protein BATDEDRAFT_27013 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF78208.1| hypothetical protein BATDEDRAFT_27013 [Batrachochytrium dendrobatidis 
JAM81]
Length=165

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (58%), Gaps = 9/85 (11%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M   F+ V+C QC+ +Q++Q KK S KW C VC+++QS+++V+ +   AKD R  +Q+ +
Sbjct  1     MPRTFLVVKCYQCNQIQIQQSKKVS-KWTCQVCHERQSLQRVYFESTCAKDCRSALQSIS  59

Query  1086  MSRQFSDL--------AQHEEPQTL  1036
              +   S          A H+ P TL
Sbjct  60    TTLHHSSTITDQAVLNAIHKSPDTL  84



>ref|XP_006613954.1| PREDICTED: UPF0544 protein C5orf45 homolog [Apis dorsata]
Length=191

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/199 (27%), Positives = 83/199 (42%), Gaps = 39/199 (20%)
 Frame = -1

Query  1245  VQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNM------  1084
             ++C  C T QV   KK+  KW C +CN KQ+ +QV+ +G   KD R+FVQ  N+      
Sbjct  8     LRCSSCKTYQVHIIKKAK-KWQCKICNFKQTFKQVYFKG-SGKDCRVFVQKLNLMKEHEV  65

Query  1083  ---SRQFSDLAQHEEPQTLEGPAEEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGDGLET  913
                ++ F +     +  T   P E+ +       W +YLD  +E      + ST   +  
Sbjct  66    EKIAKSFDECNNINDNYTSTYP-EQLKLKVTENKWAKYLDSTEEIESNIFKASTSKNINK  124

Query  912   RIVTELPKAVFKRPKLSNYSAGSESDCKKRF---------RPTFTKRDTRKQSTFQGKDI  760
              I ++L                 ESDC + F              + D+ K + F  K+I
Sbjct  125   SIKSDL---------------SDESDCTQNFVNDNEEDYDNSISKEIDSSKNNDFHSKNI  169

Query  759   G-MMAKEG--PDREDFTVA  712
               +  KE    D EDF ++
Sbjct  170   TEIKCKENIFDDNEDFDIS  188



>ref|XP_006818635.1| PREDICTED: uncharacterized protein LOC102801830 [Saccoglossus 
kowalevskii]
Length=696

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 60/124 (48%), Gaps = 13/124 (10%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M   FI V+C  C+  QV+Q KK+  KW C +C  KQS+++++ QG  A D R  VQ  N
Sbjct  309   MGQEFIVVKCFSCTVFQVQQVKKAK-KWNCKMCGSKQSLKKIYGQGSGA-DCRKHVQKLN  366

Query  1086  MSR----------QFSDLAQHEEPQTLEGPAEEDRFPSKRTDWTEYLDFEDESVEKEDEQ  937
             M R          +F D         ++   +ED      + W++++D +DE    +   
Sbjct  367   MMRGEMENEEDREEFVDGNTLNADVQIQNNKDEDELSYDDSKWSQFVD-DDEDKNGQKNG  425

Query  936   STGD  925
             + GD
Sbjct  426   NHGD  429



>ref|XP_009010168.1| hypothetical protein HELRODRAFT_166695 [Helobdella robusta]
 gb|ESO11680.1| hypothetical protein HELRODRAFT_166695 [Helobdella robusta]
Length=299

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M +VF  ++C +C T QV+Q+KK+  +W C VC +KQSV+Q++  G    + R+ VQ  N
Sbjct  1     MASVFNVLRCYKCETFQVQQQKKTG-RWSCKVCEEKQSVKQIYGSG-AGYECRMHVQKLN  58



>ref|XP_004412740.1| PREDICTED: UPF0544 protein C5orf45 homolog [Odobenus rosmarus 
divergens]
Length=333

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 57/114 (50%), Gaps = 16/114 (14%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP Q V + ++CC+C   Q  Q KKS  KW C  C +KQS  + + +G  A D R  VQ
Sbjct  1     MAPSQGVRV-LRCCRCRLFQAHQEKKSL-KWTCKACGEKQSFLRTYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSDLAQH--EEPQTLE----GPAEEDRFP------SKRTDWTEYLD  973
               N+ + Q S+++    EEP   E    GP + +R        S    W +YL+
Sbjct  58    KLNLLQGQISEMSLRSLEEPGNDEEENAGPGQAERGSVQEKPQSSENRWLKYLE  111



>gb|EDL33723.1| RIKEN cDNA 3010026O09, isoform CRA_d [Mus musculus]
Length=130

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 62/125 (50%), Gaps = 19/125 (15%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP Q   + ++CC C   Q  Q KKS  KW C  C +KQS  + + +G  A D R  VQ
Sbjct  1     MAPAQQSRV-LRCCSCHIFQAHQVKKSL-KWTCKACGEKQSFVRAYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSDLAQHEEPQTLEGPAEED-----------RFPSK--RTDWTEYLD--FED  964
               N+ + Q S+L+     + + G  EE+           + PSK   + W +YLD   ED
Sbjct  58    KLNLLQGQVSELSLRSVEEAVNGSEEENAGPLQAEAGSQQAPSKPLESRWLKYLDKGCED  117

Query  963   ESVEK  949
             + +++
Sbjct  118   QELDR  122



>ref|XP_004924696.1| PREDICTED: UPF0544 protein C5orf45 homolog [Bombyx mori]
Length=283

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M  +F  ++C +CS  QV Q KKS NKW C +C +KQS+++ +  G  +KD RI VQ  N
Sbjct  1     MPQLFQVLRCYKCSVFQVHQGKKS-NKWKCKLCGEKQSIKRHYGLG-TSKDCRIHVQKLN  58

Query  1086  MSRQFSD  1066
               R   D
Sbjct  59    GIRGVID  65



>ref|XP_002593187.1| hypothetical protein BRAFLDRAFT_72734 [Branchiostoma floridae]
 gb|EEN49198.1| hypothetical protein BRAFLDRAFT_72734 [Branchiostoma floridae]
Length=344

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 41/78 (53%), Gaps = 6/78 (8%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M   F  ++C  C T QV Q KKS NKW C +C  KQSVR+ + +G  A D R  VQ  N
Sbjct  1     MVQEFHVLRCFSCETFQVHQVKKS-NKWNCKLCGAKQSVRKEYGRGSGA-DCRRHVQKLN  58

Query  1086  MSRQFSDLAQHEEPQTLE  1033
             M R   D A    P T E
Sbjct  59    MLRATMDSA----PSTCE  72



>ref|XP_009465138.1| PREDICTED: UPF0544 protein C5orf45 homolog [Nipponia nippon]
Length=335

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 66/139 (47%), Gaps = 33/139 (24%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP    F A++CC C   QV+Q K+S  KW C VC Q+Q+V++++ QG    D R  VQ
Sbjct  1     MAPW---FWALRCCSCRLFQVQQAKRS-GKWSCSVCGQRQAVQKIYGQG-SGLDCRHHVQ  55

Query  1095  NFNM------------SRQFSD--------LAQHEEPQT-LEGPAEEDRFPSKRTDWTEY  979
               N+            SR   +         AQ E+     EG AE  R       W++Y
Sbjct  56    KLNLLQGEAEEAIGWASRCVEESVNDSKNVAAQCEDSSVQQEGRAEVSR-------WSKY  108

Query  978   LDFEDESVEKEDEQSTGDG  922
             LD + E  E  +E++  +G
Sbjct  109   LDKDSEDQEDGEEEAGTEG  127



>gb|AFZ78530.1| aminotransferase [Populus tomentosa]
Length=184

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 79/160 (49%), Gaps = 25/160 (16%)
 Frame = -1

Query  909  IVTELPKAVFKRPKLSN---YSAGSESDCKKRFRPTFTKRDTRKQSTFQGKDIGMMAKEG  739
            +VTELPK +FK+P+L N    ++G   D    ++P F+KR+  K           M+++ 
Sbjct  45   VVTELPKEMFKKPRLKNDFGQNSGDHGDG-NLYKPVFSKRNASKIP---------MSRDK  94

Query  738  PDREDFTVASQDVPSWSRNRDAKANDKKLVSKEPTEGSLLTTAKWMSKWSEYITADADDD  559
              R+  +        WS +   +A +++ +S +PT G   T A   SKW +YIT D D  
Sbjct  95   ESRKYQSTKPAGNSKWS-DCMTQAEEEERIS-QPTTGK--TKA---SKWKDYITQDEDGF  147

Query  558  NLELESGGWLTSGKDRWNNIALENPI-KDHKVDEDIHPDF  442
            N    SG     G    N    EN +  D KV++D+HPDF
Sbjct  148  N----SGRGRNVGAHHQNCGDWENILDDDQKVEDDVHPDF  183



>ref|XP_006923422.1| PREDICTED: UPF0544 protein C5orf45 homolog [Pteropus alecto]
Length=179

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 84/188 (45%), Gaps = 36/188 (19%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP   + + ++CC C   Q  Q KKS +KW C  C +KQS  + + +G  A D R  VQ
Sbjct  1     MAPPPQIRV-LRCCSCRLFQAHQVKKS-HKWTCKACGEKQSFLRTYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSDLAQH--EEP-----QTLEGPAE------EDRFPSKRTDWTEYLDFEDES  958
               N+ + Q S+++    EEP     +   GP +      +++ P     W +YL+   E 
Sbjct  58    KLNLLQGQVSEMSLRSLEEPINANDEKNAGPGQAKHTCLQEKSPPSENRWLKYLERSSEK  117

Query  957   VEKEDEQSTGDGLETRIV-TELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQS  781
             V          GL+  +  +  P +  K+P    YS  +    K+R    +++   R   
Sbjct  118   V----------GLKEGVCFSRQPSSATKKP----YSPNTSLPRKRR----WSQSTARPPC  159

Query  780   TFQGKDIG  757
                G+D+G
Sbjct  160   IPSGQDLG  167



>ref|XP_005096819.1| PREDICTED: uncharacterized protein LOC101846282 [Aplysia californica]
Length=499

 Score = 55.1 bits (131),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = -1

Query  1254  FIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSRQ  1075
             F  +QC  C+T QV Q  K+ NKW C +C  KQSVR+V+ +G  A D R  VQ  N  R 
Sbjct  4     FHVLQCADCNTFQVLQVTKT-NKWKCKLCGSKQSVRKVYGRGTGA-DCRRHVQKLNTVRG  61

Query  1074  FSD  1066
               D
Sbjct  62    HVD  64



>gb|EDM04253.1| similar to RIKEN cDNA 3010026O09 (predicted), isoform CRA_a [Rattus 
norvegicus]
Length=130

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 56/122 (46%), Gaps = 17/122 (14%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP Q   + ++CC C   Q  Q KKS  KW C  C +KQS  + + +G  A D R  VQ
Sbjct  1     MAPAQQSRV-LRCCSCHIFQAHQVKKSL-KWTCKACGEKQSFVRAYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSDLAQHEEPQTLEGPAEEDRFPSKRTD-------------WTEYLDFEDES  958
               N+ + Q S+L+     + +    EE+  P +  D             W +YLD + E 
Sbjct  58    KLNLLQGQASELSLRSVEEAVNASEEENAGPQQAKDGSQQALSEPLESRWLKYLDQDCEG  117

Query  957   VE  952
              E
Sbjct  118   QE  119



>ref|XP_002674783.1| predicted protein [Naegleria gruberi]
 gb|EFC42039.1| predicted protein [Naegleria gruberi]
Length=237

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 35/64 (55%), Gaps = 4/64 (6%)
 Frame = -1

Query  1269  PMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNF  1090
             P  A+F   QC  C+   + Q  K+  KW C +C  +QS+R+VFA     KD+R  VQ  
Sbjct  2     PEHAIF---QCFNCTAFSINQVTKNR-KWKCKLCGSQQSIRKVFANSNQPKDLRPIVQEL  57

Query  1089  NMSR  1078
             NM R
Sbjct  58    NMKR  61



>ref|XP_646242.1| hypothetical protein DDB_G0269744 [Dictyostelium discoideum AX4]
 gb|EAL72222.1| hypothetical protein DDB_G0269744 [Dictyostelium discoideum AX4]
Length=459

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = -1

Query  1254  FIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSRQ  1075
             ++ VQC  C+  QV Q+KK  + + C +CN+KQS+R+V+   FM KD+   V+ +N+ ++
Sbjct  4     YLLVQCYSCTMFQVSQKKKKKD-FQCKICNEKQSIRKVYGISFMGKDLTTLVKKYNIEKK  62



>ref|XP_007951625.1| PREDICTED: UPF0544 protein C5orf45 homolog [Orycteropus afer 
afer]
Length=172

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 62/126 (49%), Gaps = 18/126 (14%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP Q V + ++CC C   Q  Q KKS  KW C  C +KQS  + + +G  A D R  VQ
Sbjct  1     MAPPQPVRV-LRCCSCRLFQAHQVKKSL-KWTCKACGEKQSFLRAYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSD--LAQHEEP-----------QTLEGPAEEDRFPSKRTDWTEYLDFEDES  958
               N+ + Q S+  L+  EEP           QT     +E  +P + + W +YL+   + 
Sbjct  58    KLNLLQGQVSEMLLSSLEEPVNASKEESAGHQTDGMNLQEKSWP-RESRWLKYLEKSSKE  116

Query  957   VEKEDE  940
             +E E E
Sbjct  117   LELEGE  122



>ref|XP_009559915.1| PREDICTED: UPF0544 protein C5orf45 homolog [Cuculus canorus]
Length=369

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 60/126 (48%), Gaps = 30/126 (24%)
 Frame = -1

Query  1248  AVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSRQFS  1069
              ++CC C   QV+Q K+S  KW C VC Q+Q+V++++ QG    D R  VQ  N+ +  +
Sbjct  7     VLRCCSCLRFQVQQAKRS-GKWSCSVCGQRQTVQKIYGQG-SGLDCRRHVQKLNLLQGEA  64

Query  1068  D--------------------LAQHEEPQT-LEGPAEEDRFPSKRTDWTEYLDFEDESVE  952
             +                     AQHE+     EG AE  R       W++YLD E E+ E
Sbjct  65    EEAIGWTFRYIEESINDSKNTGAQHEDSLVQQEGRAEVSR-------WSKYLDKESENQE  117

Query  951   KEDEQS  934
               +E +
Sbjct  118   DGEEAA  123



>ref|XP_008500478.1| PREDICTED: UPF0544 protein C5orf45 homolog [Calypte anna]
Length=331

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 2/61 (3%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M   F  ++CC C   QV+Q K+S  KW C VC Q+Q+V++V+ QG    D R  VQ  N
Sbjct  1     MAQRFWVLRCCSCRLFQVQQAKRS-GKWSCSVCGQRQAVQKVYGQG-SGLDCRHHVQKLN  58

Query  1086  M  1084
             +
Sbjct  59    L  59



>dbj|BAB31698.1| unnamed protein product [Mus musculus]
Length=335

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 62/125 (50%), Gaps = 19/125 (15%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP Q   + ++CC C   Q  Q KKS  KW C  C +KQS  + + +G  A D R  VQ
Sbjct  1     MAPAQQSRV-LRCCSCHIFQAHQVKKSL-KWTCKACGEKQSFVRAYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSDLAQHEEPQTLEGPAEED-----------RFPSKRTD--WTEYLD--FED  964
               N+ + Q S+L+     + + G  EE+           + PSK  +  W +YLD   ED
Sbjct  58    KLNLLQGQVSELSLRSVEEAVNGSEEENAGPLQAEAGSQQAPSKPLESRWLKYLDKGCED  117

Query  963   ESVEK  949
             + +++
Sbjct  118   QELDR  122



>gb|KFM60606.1| hypothetical protein X975_15856, partial [Stegodyphus mimosarum]
Length=232

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = -1

Query  1254  FIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             F  + C  C   QV Q KKS  KW C +CN+KQS+++VF  G  A+D R  VQ  N+S+
Sbjct  5     FQVLSCFNCEMFQVHQVKKSK-KWSCKICNEKQSLKKVFGIG-SARDCRSLVQQLNLSK  61



>ref|NP_080819.2| UPF0544 protein C5orf45 homolog [Mus musculus]
 sp|Q9D1F5.1|CE045_MOUSE RecName: Full=UPF0544 protein C5orf45 homolog [Mus musculus]
 dbj|BAB22904.1| unnamed protein product [Mus musculus]
 gb|AAH28428.1| RIKEN cDNA 3010026O09 gene [Mus musculus]
 gb|EDL33722.1| RIKEN cDNA 3010026O09, isoform CRA_c [Mus musculus]
Length=335

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 62/125 (50%), Gaps = 19/125 (15%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP Q   + ++CC C   Q  Q KKS  KW C  C +KQS  + + +G  A D R  VQ
Sbjct  1     MAPAQQSRV-LRCCSCHIFQAHQVKKSL-KWTCKACGEKQSFVRAYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSDLAQHEEPQTLEGPAEED-----------RFPSKRTD--WTEYLD--FED  964
               N+ + Q S+L+     + + G  EE+           + PSK  +  W +YLD   ED
Sbjct  58    KLNLLQGQVSELSLRSVEEAVNGSEEENAGPLQAEAGSQQAPSKPLESRWLKYLDKGCED  117

Query  963   ESVEK  949
             + +++
Sbjct  118   QELDR  122



>ref|XP_010177500.1| PREDICTED: UPF0544 protein C5orf45 homolog [Mesitornis unicolor]
Length=372

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 62/132 (47%), Gaps = 30/132 (23%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M A F  ++CC C   QV+Q K+S  KW C VC Q+Q+ ++V+ QG    + R  VQ  N
Sbjct  1     MAARFWVLRCCSCRLFQVQQAKRS-GKWSCSVCGQRQAGQKVYGQG-SGLECRHHVQKLN  58

Query  1086  MSRQFSD--------------------LAQHEEPQTLE-GPAEEDRFPSKRTDWTEYLDF  970
             + +  ++                     AQHE+    + G AE  R       W++YLD 
Sbjct  59    LLQGEAEEAIRWTSWCVEESVNDSKNVAAQHEDSSVQQKGRAEVSR-------WSKYLDK  111

Query  969   EDESVEKEDEQS  934
             + E  E  +E++
Sbjct  112   DSEDQEHGEEEA  123



>ref|XP_008707766.1| PREDICTED: UPF0544 protein C5orf45 homolog [Ursus maritimus]
Length=324

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 55/115 (48%), Gaps = 17/115 (15%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP Q  F  ++CC C   Q  Q KKS  KW C  C +KQS  + + +G  A D R  VQ
Sbjct  1     MAPPQR-FRVLRCCSCRLFQAHQEKKSL-KWTCKACGEKQSFLRTYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSDLAQH--EEPQTL-----EGPAEEDR------FPSKRTDWTEYLD  973
               N+ + Q S+++    EEP  L      GP + +R        S  + W  YL+
Sbjct  58    KLNLLQGQISEMSLRSLEEPVPLGEEENAGPGQAERESVQEKPQSSESRWLRYLE  112



>ref|XP_009063210.1| hypothetical protein LOTGIDRAFT_69762, partial [Lottia gigantea]
 gb|ESO85983.1| hypothetical protein LOTGIDRAFT_69762, partial [Lottia gigantea]
Length=63

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = -1

Query  1254  FIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR  1078
             F  +QC QC T QV+Q KK   KW C +C +KQSV +V+ +G  A D R  VQN N  R
Sbjct  4     FHVLQCHQCKTFQVQQVKKVL-KWSCKLCGEKQSVLRVYGRGSGA-DCRKHVQNLNTLR  60



>ref|XP_010899412.1| PREDICTED: UPF0544 protein C5orf45 homolog [Esox lucius]
Length=385

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 17/108 (16%)
 Frame = -1

Query  1254  FIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR-  1078
             F  ++C  C T QV+Q KKS  KW C +C +KQSV + F +G    D R  VQ  N  R 
Sbjct  5     FHVLRCYSCQTYQVQQVKKS-KKWNCKMCGEKQSVLKEFGRG-SGVDCRRHVQKLNARRG  62

Query  1077  --------------QFSDLAQHEEPQTLEGPAEEDRFPSKRTDWTEYL  976
                           +  DLA  +  + +EG    +   ++ + WT+YL
Sbjct  63    EMLEQDQKAWSQWKEVGDLAAEQLAEGVEGGGSHNSEEAQGSRWTKYL  110



>ref|NP_001246788.1| CG43295 [Drosophila melanogaster]
 gb|AFH04459.1| CG43295 [Drosophila melanogaster]
Length=167

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 74/170 (44%), Gaps = 22/170 (13%)
 Frame = -1

Query  1248  AVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSR---  1078
              VQC QC   QV   KK+S  W C +C QKQS+ + F +G  A + R+ VQ+ N+ R   
Sbjct  7     VVQCIQCKMYQVDFVKKAST-WQCKICRQKQSLLKEFFRG-SAAECRVKVQHLNLERGMQ  64

Query  1077  -------QFSDLAQHEEPQTLEGPAEEDRFPSKRTD-WTEYLDFEDESVEKEDEQST-GD  925
                     F    Q  E +      EE+  P K+T+ W  Y+D   E+ +K   + T  D
Sbjct  65    EECLNTGLFLTAKQQLEEEKDCQEKEENTTPQKKTNKWANYVDNTIETTQKPAAKPTKTD  124

Query  924   GLETRIVTELPKAVFKRPKLSNYSAGSESDCKKRFRPTFTKRDTRKQSTF  775
              L   I     K     P+ S  SA +         PT TK+   K + F
Sbjct  125   ELSDEISMNFKKTRNTGPRSSKRSAEN--------MPTVTKKICSKWNDF  166



>ref|XP_008850465.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X1 [Nannospalax 
galili]
Length=333

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 62/136 (46%), Gaps = 21/136 (15%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP Q   + ++CC C   Q  Q KKS  KW C  C +KQS  +V+ +G  A D R  VQ
Sbjct  1     MAPAQQSRV-LRCCSCHLFQAHQVKKSL-KWTCKACGEKQSFMRVYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSDLAQHEEPQTLEGPAEED-------------RFPSKRTDWTEYLDFEDES  958
               N+ + Q S+L+     + L    EE+             +F    + W ++LD   E 
Sbjct  58    KLNLLQGQVSELSFRSVDEALRAQEEENAGSRQAKNKSLQGKFQPSESRWLKFLDNNLE-  116

Query  957   VEKEDEQSTGDGLETR  910
                E E   G  L+T+
Sbjct  117   ---EQELGGGASLQTQ  129



>ref|XP_004945012.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X3 [Gallus 
gallus]
Length=319

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M A    ++CC C   Q +Q K+S  KW C VC Q+Q++++V+ QG   +D R+ VQ  N
Sbjct  1     MAASCWVLRCCSCRRFQAQQAKRS-GKWSCSVCGQRQALQKVYGQG-SGRDCRLHVQKLN  58

Query  1086  M  1084
             +
Sbjct  59    L  59



>ref|XP_007542873.1| PREDICTED: UPF0544 protein C5orf45 homolog [Poecilia formosa]
Length=222

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 61/124 (49%), Gaps = 20/124 (16%)
 Frame = -1

Query  1254  FIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSRQ  1075
             F  V+C +C + QV+Q KK+  KW C +C +KQS+ + F +G  A D R  VQ  N  R 
Sbjct  5     FHVVRCFRCQSFQVQQVKKA-KKWSCKLCGEKQSLLKEFGRGSGA-DCRRHVQKLNAMRG  62

Query  1074  FSDLAQHEEPQTL---------EGPAEEDRFPSKRTDWTEYLDFEDESVEKEDEQSTGDG  922
                  Q     +L         + PA +   P++ + W++YLD  +E  EKE       G
Sbjct  63    AKMEEQEAHTWSLCEQEEEEEQQQPAGDQVRPAQVSRWSKYLDTPEE--EKE-------G  113

Query  921   LETR  910
             LE R
Sbjct  114   LEGR  117



>ref|XP_005350214.1| PREDICTED: LOW QUALITY PROTEIN: UPF0544 protein C5orf45 homolog 
[Microtus ochrogaster]
Length=334

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 61/123 (50%), Gaps = 17/123 (14%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP Q   + ++CC C   Q  Q KKS  KW C  C +KQS  + + +G  A D R+ VQ
Sbjct  1     MAPSQQSRV-LRCCSCHLFQAHQVKKSL-KWTCKACGEKQSFVRAYGEGSGA-DCRLHVQ  57

Query  1095  NFNMSR-QFSDL--------AQHEE---PQTLEGPAEEDRFPSKRTDWTEYL--DFEDES  958
               N+ + Q S+L        A+ EE   PQ  E   ++       + W +YL  D ED+ 
Sbjct  58    KLNLLQGQVSELSLRSVAKAAREEENAGPQQTENSRQQALSEPLESRWLKYLDKDCEDQE  117

Query  957   VEK  949
             +++
Sbjct  118   LDR  120



>ref|XP_007906321.1| PREDICTED: UPF0544 protein C5orf45 homolog [Callorhinchus milii]
Length=389

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 36/61 (59%), Gaps = 2/61 (3%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M   F A++C  C T QV+Q KKS  +W C VC + QSV +V+ QG  A D R  VQ  N
Sbjct  1     MGPQFQALRCFSCKTFQVQQVKKS-KRWNCKVCGETQSVLKVYGQGSGA-DCRHHVQKLN  58

Query  1086  M  1084
             +
Sbjct  59    L  59



>ref|XP_007629821.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X2 [Cricetulus 
griseus]
 gb|ERE68060.1| putative UPF0544 protein C5orf45 like protein [Cricetulus griseus]
Length=338

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 60/123 (49%), Gaps = 17/123 (14%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP Q   + ++CC C   Q  Q KKS  KW C  C +KQS  + + +G  A D R  VQ
Sbjct  1     MAPAQQSRV-LRCCSCRLFQAHQVKKSL-KWTCKACGEKQSFVRAYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSDLA-----------QHEEPQTLEGPAEEDRFPSKRTDWTEYLD--FEDES  958
               N+ + Q S+L+           +H  PQ  E  +++       + W +Y+D   ED+ 
Sbjct  58    KLNLLQGQVSELSLRSVDRAASEEEHAGPQQAENRSQQALSEPLESRWLKYMDKGCEDQE  117

Query  957   VEK  949
             +++
Sbjct  118   LDR  120



>ref|XP_006987155.1| PREDICTED: UPF0544 protein C5orf45 homolog [Peromyscus maniculatus 
bairdii]
Length=324

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 55/113 (49%), Gaps = 15/113 (13%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP Q   + ++CC C   Q  Q KKS  KW C  C +KQS  + + +G  A D R  VQ
Sbjct  1     MAPAQQSRV-LRCCSCHLFQAHQVKKSL-KWTCKACGEKQSFVRAYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSDL--------AQHEE---PQTLEGPAEEDRFPSKRTDWTEYLD  973
               N+ + Q S+L        A  EE   PQ  E  +++     + + W +YLD
Sbjct  58    KLNLLQGQVSELSLRSVDRAASEEENAGPQQAENGSQQAPSEPQESRWLKYLD  110



>ref|XP_007671294.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X1 [Ornithorhynchus 
anatinus]
Length=364

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 58/125 (46%), Gaps = 23/125 (18%)
 Frame = -1

Query  1254  FIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNMSRQ  1075
             F  ++C  C   QV Q KKS NKW C  C +KQS+ +V+ QG  A D R  VQ  N+ + 
Sbjct  7     FQVLRCFSCRLFQVHQVKKS-NKWNCKACGEKQSLLKVYGQGSGA-DCRRHVQKLNLMQG  64

Query  1074  FSDLAQHEE--------------PQTLEGPAEEDRFP---SKRTDWTEYL--DFEDESVE  952
                + Q  E                T + P E  + P      + W++YL  D ED  VE
Sbjct  65    L--MGQTAEMTLGSSESPSNSNEENTGDPPGEHLKQPELNQSESRWSKYLDQDTEDSPVE  122

Query  951   KEDEQ  937
              +D++
Sbjct  123   DDDDE  127



>ref|XP_005147395.1| PREDICTED: UPF0544 protein C5orf45 homolog [Melopsittacus undulatus]
Length=373

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = -1

Query  1248  AVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFNM  1084
             A++CC+C   QV+Q K+S  KW C VC Q+Q+V++++ QG  A D R  VQ  N+
Sbjct  7     ALRCCRCRRFQVQQAKRS-GKWSCCVCGQRQAVQKLYGQG-SALDCRRHVQKLNL  59



>ref|NP_001102500.2| UPF0544 protein C5orf45 homolog [Rattus norvegicus]
 gb|EDM04254.1| similar to RIKEN cDNA 3010026O09 (predicted), isoform CRA_b [Rattus 
norvegicus]
 gb|AAI66832.1| RGD1564036 protein [Rattus norvegicus]
Length=343

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 56/122 (46%), Gaps = 17/122 (14%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP Q   + ++CC C   Q  Q KKS  KW C  C +KQS  + + +G  A D R  VQ
Sbjct  1     MAPAQQSRV-LRCCSCHIFQAHQVKKSL-KWTCKACGEKQSFVRAYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSDLAQHEEPQTLEGPAEEDRFPSKRTD-------------WTEYLDFEDES  958
               N+ + Q S+L+     + +    EE+  P +  D             W +YLD + E 
Sbjct  58    KLNLLQGQASELSLRSVEEAVNASEEENAGPQQAKDGSQQALSEPLESRWLKYLDQDCEG  117

Query  957   VE  952
              E
Sbjct  118   QE  119



>ref|XP_414603.2| PREDICTED: UPF0544 protein C5orf45 homolog isoform X2 [Gallus 
gallus]
Length=356

 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = -1

Query  1266  MQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN  1087
             M A    ++CC C   Q +Q K+S  KW C VC Q+Q++++V+ QG   +D R+ VQ  N
Sbjct  1     MAASCWVLRCCSCRRFQAQQAKRS-GKWSCSVCGQRQALQKVYGQG-SGRDCRLHVQKLN  58

Query  1086  M  1084
             +
Sbjct  59    L  59



>ref|XP_005893497.1| PREDICTED: UPF0544 protein C5orf45 homolog [Bos mutus]
 gb|ELR58018.1| hypothetical protein M91_07679 [Bos mutus]
Length=368

 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 48/91 (53%), Gaps = 5/91 (5%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP QA  +  +CC CS  Q  Q KKS  KW C  C +KQS  Q + +G  A D R  VQ
Sbjct  1     MAPQQARVL--RCCCCSLFQAHQVKKSL-KWTCKACGKKQSFLQAYGEGSGA-DCRRHVQ  56

Query  1095  NFNMSR-QFSDLAQHEEPQTLEGPAEEDRFP  1006
               N+ + Q S+++     +++    EE+  P
Sbjct  57    KLNLLQGQISEMSLRSLGESISANEEENVGP  87



>ref|XP_010828979.1| PREDICTED: UPF0544 protein C5orf45 homolog [Bison bison bison]
Length=368

 Score = 51.6 bits (122),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 48/91 (53%), Gaps = 5/91 (5%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP QA  +  +CC CS  Q  Q KKS  KW C  C +KQS  Q + +G  A D R  VQ
Sbjct  1     MAPQQARVL--RCCCCSLFQAHQVKKSL-KWTCKACGKKQSFLQAYGEGSGA-DCRRHVQ  56

Query  1095  NFNMSR-QFSDLAQHEEPQTLEGPAEEDRFP  1006
               N+ + Q S+++     +++    EE+  P
Sbjct  57    KLNLLQGQISEMSLRSLGESVSANEEENVGP  87



>ref|XP_004759061.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X1 [Mustela 
putorius furo]
 ref|XP_004812615.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X1 [Mustela 
putorius furo]
Length=339

 Score = 51.6 bits (122),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 67/144 (47%), Gaps = 27/144 (19%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             M P Q V + ++CC+C   Q  Q KK   KW C  C +KQS  + + +G  A D R  VQ
Sbjct  1     MVPPQRVRV-LRCCRCRLFQAHQEKKGL-KWTCKACGEKQSFLRTYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSDLA--QHEEPQTLE-----GPAE------EDRFPSKRTDWTEYLDFEDES  958
               N+ + Q S++A    EEP  ++     GP +      +++  S    W +YL      
Sbjct  58    KLNLLQGQISEMAFRSLEEPGNVDEEENVGPRQAEHESVQEKPQSSENRWLKYL------  111

Query  957   VEKEDEQSTGDGLETRIVTELPKA  886
                 ++ S G G+E  +  E P +
Sbjct  112   ----EKDSKGLGMEGGVCFESPPS  131



>ref|XP_005072028.1| PREDICTED: UPF0544 protein C5orf45 homolog [Mesocricetus auratus]
Length=324

 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 54/109 (50%), Gaps = 9/109 (8%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP Q   + ++CC C   Q  Q KKS  KW C  C +KQS  + + +G  A D R  VQ
Sbjct  1     MAPAQQSRV-LRCCSCHLFQAHQVKKSL-KWTCKACGEKQSFVRAYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSDLAQHEEPQTLEGPAEEDRFPSKRTDWTEYLDFEDESVE  952
               N+ + Q S+L+       L+G A  +   S+   W +Y+D   E  E
Sbjct  58    KLNLLQGQVSELSLRYG--VLKGVALSEPLESR---WLKYMDKGSEDQE  101



>ref|XP_010591537.1| PREDICTED: UPF0544 protein C5orf45 homolog isoform X2 [Loxodonta 
africana]
Length=154

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 58/127 (46%), Gaps = 17/127 (13%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP Q   + ++CC C   Q  Q KKS  KW C  C +KQS  + + +G  A D R  VQ
Sbjct  1     MAPPQPARV-LRCCSCRLFQAHQMKKSL-KWTCKACGEKQSFLRAYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSD--LAQHEEP-----------QTLEGPAEEDRFPSKRTDWTEYLDFEDES  958
               N+ + Q S+  L   EEP           Q  E  + ++R     + W +YL      
Sbjct  58    KLNLLQGQVSEMLLRSVEEPVNASEEESAGHQQAENVSLQERSQPTESRWLKYLGKGSNE  117

Query  957   VEKEDEQ  937
             +E E E+
Sbjct  118   LELEGEE  124



>ref|XP_005339397.1| PREDICTED: UPF0544 protein C5orf45 homolog [Ictidomys tridecemlineatus]
Length=341

 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 4/73 (5%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP Q   + ++CC C   Q  Q KKS  KW C  C +KQS+ +V+ +G  A D R  VQ
Sbjct  1     MAPSQQSRV-LRCCSCRLFQAHQVKKSL-KWTCKACGEKQSLLKVYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSDLA  1060
               N+ + Q S+L+
Sbjct  58    KLNLLQGQVSELS  70



>ref|XP_004008432.1| PREDICTED: UPF0544 protein C5orf45 homolog [Ovis aries]
Length=368

 Score = 51.2 bits (121),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 56/121 (46%), Gaps = 17/121 (14%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP Q   + ++CC CS  Q  Q KKS  KW C  C +KQS  Q + +G  A D R  VQ
Sbjct  1     MAPPQQARV-LRCCGCSLFQAHQVKKSL-KWTCKACGKKQSFLQAYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSDLAQHEEPQTLEGPAEEDRFP-------------SKRTDWTEYLDFEDES  958
               N+ + Q S+++      ++    EE+  P               +  W +YL+ + E 
Sbjct  58    KLNLLQGQISEMSLRSLGDSISANEEENVGPWQAASAGPQEKPQPSKNRWLKYLERDSEE  117

Query  957   V  955
             +
Sbjct  118   L  118



>ref|XP_004387241.1| PREDICTED: UPF0544 protein C5orf45 homolog [Trichechus manatus 
latirostris]
Length=338

 Score = 51.2 bits (121),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 61/127 (48%), Gaps = 17/127 (13%)
 Frame = -1

Query  1275  MAPMQAVFIAVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQ  1096
             MAP Q   + ++CC C   Q  Q KKS  KW C  C +KQS  + + +G  A D R  VQ
Sbjct  1     MAPPQPARV-LRCCSCRLFQAHQVKKSL-KWTCKACGEKQSFLRDYGEGSGA-DCRRHVQ  57

Query  1095  NFNMSR-QFSD--LAQHEEP-----------QTLEGPAEEDRFPSKRTDWTEYLDFEDES  958
               N+ + Q S+  L   EEP           Q  E  + ++R   + + W +YL+   + 
Sbjct  58    KLNLLQGQISEMLLRSLEEPVNASEEESAGHQQAENVSLQERSQPRESRWLKYLEKGSKE  117

Query  957   VEKEDEQ  937
             +E E E+
Sbjct  118   LELEGEE  124



>ref|XP_011069012.1| PREDICTED: UPF0544 protein C5orf45 homolog [Acromyrmex echinatior]
 gb|EGI70951.1| UPF0544 protein C5orf45-like protein [Acromyrmex echinatior]
Length=205

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 50/98 (51%), Gaps = 8/98 (8%)
 Frame = -1

Query  1248  AVQCCQCSTMQVKQRKKSSNKWICVVCNQKQSVRQVFAQGFMAKDVRIFVQNFN------  1087
              ++C  C   QV   KK+  KW C +CN KQS+++V+ QG   KD R+ VQ+ N      
Sbjct  7     VLRCYSCKMYQVHIVKKAR-KWQCKLCNAKQSIQKVYFQG-SGKDCRLHVQHLNYLKTND  64

Query  1086  MSRQFSDLAQHEEPQTLEGPAEEDRFPSKRTDWTEYLD  973
             +S        +++  T     E D   S  ++WT+YLD
Sbjct  65    ISFSLYQKNSNDDCNTTNTIQELDIDKSVESEWTKYLD  102



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3345061407520