BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15486_g1_i2 len=660 path=[443:0-37 481:38-411 442:412-437
246:438-633 442:634-659]

Length=660
                                                                      Score     E

ref|XP_011091785.1|  PREDICTED: putative transcription factor kapC      127   7e-32   
ref|XP_011042103.1|  PREDICTED: uncharacterized protein LOC105137...    122   4e-30   
ref|XP_011042101.1|  PREDICTED: uncharacterized protein LOC105137...    122   4e-30   
ref|XP_002303896.2|  hypothetical protein POPTR_0003s20320g             121   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_011037808.1|  PREDICTED: uncharacterized protein LOC105134916    119   7e-29   
emb|CAN72907.1|  hypothetical protein VITISV_033868                     118   2e-28   Vitis vinifera
ref|XP_007008741.1|  Basic-leucine zipper transcription factor fa...    117   3e-28   
ref|XP_003633543.1|  PREDICTED: uncharacterized protein LOC100255414    117   3e-28   
ref|XP_010279543.1|  PREDICTED: uncharacterized protein LOC104613430    116   2e-27   
emb|CBI28617.3|  unnamed protein product                                117   2e-27   
ref|XP_010104020.1|  hypothetical protein L484_001603                   113   7e-27   
gb|KDO83274.1|  hypothetical protein CISIN_1g024477mg                   114   8e-27   
ref|XP_006438937.1|  hypothetical protein CICLE_v10032430mg             114   9e-27   
emb|CDP21594.1|  unnamed protein product                                113   2e-26   
ref|XP_006368575.1|  hypothetical protein POPTR_0001s05750g             112   3e-26   
ref|XP_002299223.2|  hypothetical protein POPTR_0001s05750g             112   4e-26   Populus trichocarpa [western balsam poplar]
ref|XP_009354398.1|  PREDICTED: transcription factor TGA3               110   1e-25   
ref|XP_004303083.1|  PREDICTED: uncharacterized protein LOC101298...    104   2e-23   
dbj|BAK03166.1|  predicted protein                                      103   4e-23   
ref|XP_007149027.1|  hypothetical protein PHAVU_005G034400g             103   9e-23   
ref|NP_001237285.1|  uncharacterized protein LOC100527780               100   3e-22   
gb|KHN22064.1|  hypothetical protein glysoja_008976                     101   3e-22   
ref|XP_008364717.1|  PREDICTED: uncharacterized protein LOC103428389    100   5e-22   
ref|XP_006403861.1|  hypothetical protein EUTSA_v10010764mg           99.4    5e-22   
ref|XP_008344616.1|  PREDICTED: uncharacterized protein LOC103407459    100   5e-22   
emb|CDY23178.1|  BnaA04g05810D                                        99.0    8e-22   
ref|XP_006291938.1|  hypothetical protein CARUB_v10018125mg           97.8    1e-21   
ref|XP_006644854.1|  PREDICTED: uncharacterized protein LOC102712588  98.6    2e-21   
gb|AEX11142.1|  hypothetical protein 0_12104_01                       95.9    4e-21   
gb|AEX11144.1|  hypothetical protein 0_12104_01                       95.9    4e-21   
gb|AEX11140.1|  hypothetical protein 0_12104_01                       95.5    4e-21   
gb|AEX11155.1|  hypothetical protein 0_12104_01                       95.1    7e-21   
emb|CDY60641.1|  BnaCnng36700D                                        96.3    8e-21   
ref|XP_010426786.1|  PREDICTED: uncharacterized protein LOC104711...  96.3    9e-21   
ref|XP_010426784.1|  PREDICTED: uncharacterized protein LOC104711...  96.7    1e-20   
ref|XP_002877837.1|  bZIP family transcription factor                 96.3    1e-20   
ref|XP_006850552.1|  hypothetical protein AMTR_s00159p00081760        97.1    2e-20   
ref|XP_009117143.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  94.4    2e-20   
ref|XP_008788583.1|  PREDICTED: uncharacterized protein LOC103706294  95.1    4e-20   
ref|XP_010269693.1|  PREDICTED: uncharacterized protein LOC104606282  95.9    4e-20   
ref|XP_010515641.1|  PREDICTED: uncharacterized protein LOC104791...  93.6    8e-20   
ref|XP_002456496.1|  hypothetical protein SORBIDRAFT_03g037300        92.8    1e-19   Sorghum bicolor [broomcorn]
ref|XP_009395944.1|  PREDICTED: uncharacterized protein LOC103981078  93.6    2e-19   
ref|XP_008231525.1|  PREDICTED: uncharacterized protein LOC103330...  93.6    2e-19   
ref|XP_010515638.1|  PREDICTED: uncharacterized protein LOC104791...  92.8    2e-19   
ref|XP_010931563.1|  PREDICTED: uncharacterized protein LOC105052451  92.8    2e-19   
ref|XP_010922246.1|  PREDICTED: uncharacterized protein LOC105045595  92.4    5e-19   
ref|XP_010692028.1|  PREDICTED: uncharacterized protein LOC104905249  92.8    5e-19   
gb|EAY76169.1|  hypothetical protein OsI_04102                        90.5    6e-19   Oryza sativa Indica Group [Indian rice]
gb|EAZ13857.1|  hypothetical protein OsJ_03780                        90.5    7e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654590.1|  PREDICTED: uncharacterized protein LOC102713546  90.9    1e-18   
ref|NP_179268.2|  transcription factor bZIP23                         91.3    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAD24610.1|  hypothetical protein                                  90.9    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002441312.1|  hypothetical protein SORBIDRAFT_09g024290        90.5    2e-18   Sorghum bicolor [broomcorn]
gb|EYU42976.1|  hypothetical protein MIMGU_mgv1a023968mg              89.7    2e-18   
ref|XP_003566090.1|  PREDICTED: uncharacterized protein LOC100823248  90.1    3e-18   
gb|EAY98546.1|  hypothetical protein OsI_20459                        89.7    3e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001055929.1|  Os05g0495200                                     89.7    3e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010489260.1|  PREDICTED: uncharacterized protein LOC104766980  90.1    3e-18   
ref|XP_010516149.1|  PREDICTED: uncharacterized protein LOC104791854  90.1    3e-18   
ref|XP_004961638.1|  PREDICTED: uncharacterized protein LOC101767291  89.7    4e-18   
ref|XP_009112401.1|  PREDICTED: uncharacterized protein LOC103837...  89.7    4e-18   
gb|EMS45371.1|  hypothetical protein TRIUR3_18393                     88.2    5e-18   
ref|XP_009112403.1|  PREDICTED: uncharacterized protein LOC103837...  89.4    6e-18   
ref|XP_010467405.1|  PREDICTED: uncharacterized protein LOC104747472  89.4    6e-18   
emb|CAB41316.1|  putative protein                                     87.4    7e-18   Arabidopsis thaliana [mouse-ear cress]
gb|ACN36681.1|  unknown                                               87.8    2e-17   Zea mays [maize]
ref|XP_008786882.1|  PREDICTED: uncharacterized protein LOC103705064  87.4    2e-17   
ref|XP_002884017.1|  DNA binding protein                              87.8    2e-17   
ref|NP_001142351.1|  putative bZIP transcription factor superfami...  87.4    2e-17   Zea mays [maize]
ref|XP_006284366.1|  hypothetical protein CARUB_v10005538mg           87.4    3e-17   
emb|CDY26786.1|  BnaC09g09130D                                        86.7    4e-17   
emb|CDP14558.1|  unnamed protein product                              87.0    5e-17   
ref|XP_006656494.1|  PREDICTED: uncharacterized protein LOC102721653  87.0    5e-17   
ref|NP_850680.1|  basic leucine zipper 24                             86.3    5e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47478.1|  BnaA09g08870D                                        86.7    6e-17   
ref|XP_002973971.1|  hypothetical protein SELMODRAFT_414462           86.7    6e-17   
ref|XP_002969093.1|  hypothetical protein SELMODRAFT_409920           86.7    7e-17   
ref|XP_004231042.1|  PREDICTED: uncharacterized protein LOC101266077  86.7    7e-17   
ref|XP_006664845.1|  PREDICTED: uncharacterized protein LOC102716091  85.5    7e-17   
ref|XP_006359698.1|  PREDICTED: uncharacterized protein LOC102599645  86.7    7e-17   
ref|XP_008231529.1|  PREDICTED: uncharacterized protein LOC103330...  84.7    7e-17   
ref|XP_007219551.1|  hypothetical protein PRUPE_ppa019868mg           85.9    7e-17   
emb|CDM84592.1|  unnamed protein product                              85.9    7e-17   
ref|NP_190764.2|  basic leucine zipper 24                             85.9    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008647614.1|  PREDICTED: putative bZIP transcription facto...  86.7    9e-17   
ref|XP_006663805.1|  PREDICTED: uncharacterized protein LOC102722911  85.1    9e-17   
gb|ACI90291.1|  putative bZIP transcription factor                    86.3    1e-16   Picrorhiza kurrooa
gb|EMS45140.1|  hypothetical protein TRIUR3_21208                     85.5    1e-16   
ref|XP_010447005.1|  PREDICTED: uncharacterized protein LOC104729711  85.9    1e-16   
ref|XP_002869111.1|  bZIP transcription factor family protein         85.5    1e-16   
ref|XP_010920114.1|  PREDICTED: uncharacterized protein LOC105044037  85.5    1e-16   
emb|CAA17769.1|  putative protein                                     85.5    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004970277.1|  PREDICTED: uncharacterized protein LOC101760...  84.7    1e-16   
ref|NP_567974.1|  transcription factor bZIP19                         85.5    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011088608.1|  PREDICTED: uncharacterized protein LOC105169791  85.5    2e-16   
emb|CDX89748.1|  BnaC03g46620D                                        85.1    2e-16   
ref|XP_003577077.2|  PREDICTED: uncharacterized protein LOC100844010  84.7    2e-16   
gb|EMS54685.1|  hypothetical protein TRIUR3_17772                     85.5    2e-16   
ref|XP_009391011.1|  PREDICTED: uncharacterized protein LOC103977271  85.1    2e-16   
ref|XP_002305521.2|  bZIP transcription factor family protein         84.7    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006384577.1|  hypothetical protein POPTR_0004s18120g           84.7    3e-16   
ref|XP_003563276.1|  PREDICTED: uncharacterized protein LOC100823660  84.7    3e-16   
gb|AAM63358.1|  putative transcription factor                         84.3    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530900.1|  PREDICTED: uncharacterized protein LOC104807371  84.3    4e-16   
ref|XP_010432347.1|  PREDICTED: uncharacterized protein LOC104716633  84.0    5e-16   
ref|XP_010232460.1|  PREDICTED: uncharacterized protein LOC100829391  84.0    5e-16   
ref|XP_010437531.1|  PREDICTED: uncharacterized protein LOC104721282  84.0    5e-16   
ref|XP_001758867.1|  predicted protein                                82.8    5e-16   
ref|XP_004966468.1|  PREDICTED: uncharacterized protein LOC101762...  84.0    5e-16   
ref|XP_010028728.1|  PREDICTED: uncharacterized protein LOC104418944  84.0    6e-16   
ref|XP_009797256.1|  PREDICTED: uncharacterized protein LOC104243716  84.0    6e-16   
gb|EMT18405.1|  hypothetical protein F775_16738                       82.8    6e-16   
ref|XP_009401478.1|  PREDICTED: uncharacterized protein LOC103985487  83.6    7e-16   
ref|XP_009631591.1|  PREDICTED: uncharacterized protein LOC104121329  83.6    7e-16   
gb|EAY79873.1|  hypothetical protein OsI_35035                        87.0    7e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_006412160.1|  hypothetical protein EUTSA_v10026007mg           83.6    7e-16   
ref|XP_006422601.1|  hypothetical protein CICLE_v10028931mg           83.6    7e-16   
gb|ACG32751.1|  DNA binding protein                                   83.6    8e-16   Zea mays [maize]
ref|NP_001141059.1|  uncharacterized protein LOC100273140             83.6    8e-16   Zea mays [maize]
ref|XP_009418779.1|  PREDICTED: uncharacterized protein LOC103998893  83.6    8e-16   
ref|XP_006422593.1|  hypothetical protein CICLE_v10028931mg           83.2    9e-16   
gb|KDO68071.1|  hypothetical protein CISIN_1g024365mg                 83.2    9e-16   
gb|KFK30142.1|  hypothetical protein AALP_AA7G222200                  83.2    9e-16   
dbj|BAJ84803.1|  predicted protein                                    83.2    9e-16   
ref|XP_011046688.1|  PREDICTED: uncharacterized protein LOC105141...  82.8    1e-15   
ref|XP_011046685.1|  PREDICTED: uncharacterized protein LOC105141...  82.8    1e-15   
gb|AFW69519.1|  putative bZIP transcription factor superfamily pr...  83.6    1e-15   
ref|XP_011046689.1|  PREDICTED: uncharacterized protein LOC105141...  82.8    1e-15   
ref|XP_006409393.1|  hypothetical protein EUTSA_v10022810mg           82.8    1e-15   
emb|CDY02237.1|  BnaA03g39300D                                        82.4    1e-15   
ref|XP_006298365.1|  hypothetical protein CARUB_v10014436mg           82.4    1e-15   
ref|XP_006409392.1|  hypothetical protein EUTSA_v10022810mg           82.4    2e-15   
ref|NP_001058591.1|  Os06g0716800                                     82.4    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EPS65924.1|  hypothetical protein M569_08855                       82.0    2e-15   
ref|XP_009136335.1|  PREDICTED: uncharacterized protein LOC103860484  82.0    2e-15   
dbj|BAJ86065.1|  predicted protein                                    81.6    2e-15   
ref|XP_004505820.1|  PREDICTED: uncharacterized protein LOC101509009  82.0    2e-15   
ref|XP_002439031.1|  hypothetical protein SORBIDRAFT_10g030250        82.0    2e-15   Sorghum bicolor [broomcorn]
ref|XP_009626744.1|  PREDICTED: uncharacterized protein LOC104117398  82.0    2e-15   
gb|EMS67651.1|  hypothetical protein TRIUR3_23486                     81.6    3e-15   
ref|XP_009108690.1|  PREDICTED: uncharacterized protein LOC103834377  81.6    3e-15   
ref|NP_001130683.1|  putative bZIP transcription factor superfami...  81.3    3e-15   Zea mays [maize]
gb|AAL79736.1|AC091774_27  putative transcription factor              81.6    3e-15   Oryza sativa [red rice]
gb|AFW82390.1|  putative bZIP transcription factor superfamily pr...  81.3    3e-15   
gb|AFP19452.1|  bZIP transcription factor family protein 1            81.6    3e-15   
emb|CDX76308.1|  BnaA08g10920D                                        81.3    4e-15   
ref|XP_010548099.1|  PREDICTED: uncharacterized protein LOC104819648  81.3    4e-15   
gb|KHG28517.1|  Protein FD -like protein                              81.3    4e-15   
emb|CDY17503.1|  BnaC03g65600D                                        80.9    6e-15   
ref|XP_004289872.1|  PREDICTED: uncharacterized protein LOC101314...  80.5    8e-15   
ref|XP_010266832.1|  PREDICTED: uncharacterized protein LOC104604256  80.5    9e-15   
ref|XP_010107666.1|  hypothetical protein L484_008383                 80.1    9e-15   
gb|EMT32713.1|  hypothetical protein F775_17323                       80.9    9e-15   
ref|XP_009791619.1|  PREDICTED: uncharacterized protein LOC104238836  80.1    1e-14   
ref|XP_011092974.1|  PREDICTED: uncharacterized protein LOC105173...  80.1    1e-14   
ref|XP_010935120.1|  PREDICTED: uncharacterized protein LOC105055101  79.7    1e-14   
ref|XP_011092972.1|  PREDICTED: uncharacterized protein LOC105173...  79.7    1e-14   
gb|EYU37954.1|  hypothetical protein MIMGU_mgv1a011243mg              79.7    1e-14   
gb|EMT13528.1|  hypothetical protein F775_07298                       79.3    1e-14   
gb|AFP19453.1|  bZIP transcription factor family protein 2            79.7    2e-14   
ref|XP_010526894.1|  PREDICTED: uncharacterized protein LOC104804328  79.3    2e-14   
ref|XP_002534148.1|  DNA binding protein, putative                    79.3    2e-14   Ricinus communis
ref|XP_011046168.1|  PREDICTED: uncharacterized protein LOC105140851  79.0    2e-14   
gb|EEE52735.1|  hypothetical protein OsJ_35154                        78.6    3e-14   Oryza sativa Japonica Group [Japonica rice]
emb|CAN73631.1|  hypothetical protein VITISV_026643                   78.6    4e-14   Vitis vinifera
ref|XP_002278836.1|  PREDICTED: uncharacterized protein LOC100243471  78.6    4e-14   Vitis vinifera
ref|XP_009106517.1|  PREDICTED: uncharacterized protein LOC103832273  78.2    4e-14   
ref|XP_008457697.1|  PREDICTED: uncharacterized protein LOC103497...  78.2    4e-14   
ref|XP_010265995.1|  PREDICTED: uncharacterized protein LOC104603629  78.6    4e-14   
ref|XP_008800177.1|  PREDICTED: uncharacterized protein LOC103714...  78.2    4e-14   
emb|CDY52654.1|  BnaAnng11690D                                        78.2    4e-14   
ref|XP_008800178.1|  PREDICTED: uncharacterized protein LOC103714...  78.2    5e-14   
ref|XP_008457698.1|  PREDICTED: uncharacterized protein LOC103497...  78.2    5e-14   
ref|XP_007041832.1|  Basic-leucine zipper (bZIP) transcription fa...  77.4    5e-14   
ref|XP_002313707.2|  hypothetical protein POPTR_0009s13730g           78.2    5e-14   Populus trichocarpa [western balsam poplar]
ref|XP_009408222.1|  PREDICTED: uncharacterized protein LOC103990...  77.8    6e-14   
gb|KDP29660.1|  hypothetical protein JCGZ_18822                       77.8    6e-14   
ref|XP_007041828.1|  Basic-leucine zipper transcription factor fa...  77.8    8e-14   
ref|XP_010690366.1|  PREDICTED: uncharacterized protein LOC104903923  77.8    8e-14   
ref|XP_007041827.1|  Basic-leucine zipper transcription factor fa...  77.8    9e-14   
ref|XP_007041826.1|  Basic-leucine zipper transcription factor fa...  77.4    9e-14   
ref|XP_004303084.1|  PREDICTED: uncharacterized protein LOC101298...  77.0    9e-14   
emb|CDX69107.1|  BnaC01g03460D                                        77.4    1e-13   
ref|XP_009408220.1|  PREDICTED: uncharacterized protein LOC103990...  77.4    1e-13   
ref|XP_004164905.1|  PREDICTED: uncharacterized protein LOC101232700  77.0    1e-13   
ref|XP_008447959.1|  PREDICTED: uncharacterized protein LOC103490288  77.0    1e-13   
ref|XP_004147043.1|  PREDICTED: uncharacterized protein LOC101219501  76.6    1e-13   
ref|XP_008236016.1|  PREDICTED: uncharacterized protein LOC103334...  76.6    1e-13   
ref|XP_004144846.1|  PREDICTED: uncharacterized protein LOC101208161  76.6    1e-13   
ref|XP_008236021.1|  PREDICTED: uncharacterized protein LOC103334...  76.6    2e-13   
gb|EMT00406.1|  hypothetical protein F775_29696                       76.6    2e-13   
ref|XP_003607180.1|  hypothetical protein MTR_4g073100                76.3    2e-13   
ref|XP_007131714.1|  hypothetical protein PHAVU_011G035700g           76.3    2e-13   
ref|XP_008813516.1|  PREDICTED: uncharacterized protein LOC103724133  76.3    3e-13   
ref|XP_008790182.1|  PREDICTED: uncharacterized protein LOC103707462  75.9    3e-13   
ref|NP_001148839.1|  LOC100282457                                     75.5    4e-13   Zea mays [maize]
ref|XP_008647848.1|  PREDICTED: LOC100282457 isoform X1               75.5    4e-13   
gb|EMT32714.1|  hypothetical protein F775_17324                       74.3    5e-13   
gb|EAY82198.1|  hypothetical protein OsI_37401                        77.8    5e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_007201303.1|  hypothetical protein PRUPE_ppa009913mg           75.1    5e-13   
ref|NP_001235033.1|  bZIP transcription factor bZIP122                75.1    5e-13   
ref|XP_006591923.1|  PREDICTED: bZIP transcription factor bZIP122...  75.1    6e-13   
gb|KHN39873.1|  hypothetical protein glysoja_020613                   74.3    1e-12   
ref|XP_006590380.1|  PREDICTED: bZIP transcription factor bZIP121...  74.3    1e-12   
ref|NP_001237296.1|  bZIP transcription factor bZIP121                74.3    1e-12   
ref|XP_009395145.1|  PREDICTED: uncharacterized protein LOC103980446  73.6    1e-12   
ref|XP_009624365.1|  PREDICTED: uncharacterized protein LOC104115438  73.6    2e-12   
gb|EMS47152.1|  hypothetical protein TRIUR3_12850                     72.0    3e-12   
ref|XP_004499761.1|  PREDICTED: uncharacterized protein LOC101513...  71.2    4e-12   
ref|XP_009787001.1|  PREDICTED: uncharacterized protein LOC104235...  72.4    5e-12   
ref|XP_009786999.1|  PREDICTED: uncharacterized protein LOC104235...  72.4    5e-12   
dbj|BAJ85954.1|  predicted protein                                    71.6    5e-12   
ref|XP_006846902.1|  hypothetical protein AMTR_s00152p00031760        72.4    6e-12   
gb|EMT32723.1|  hypothetical protein F775_08202                       70.9    6e-12   
ref|XP_010067780.1|  PREDICTED: uncharacterized protein LOC104454578  71.6    7e-12   
gb|KHN25468.1|  hypothetical protein glysoja_010385                   69.3    5e-11   
gb|EMS52367.1|  hypothetical protein TRIUR3_01653                     66.6    2e-10   
ref|XP_010327411.1|  PREDICTED: uncharacterized protein LOC104649609  67.8    2e-10   
ref|XP_009376950.1|  PREDICTED: uncharacterized protein LOC103965600  67.8    2e-10   
ref|XP_009376970.1|  PREDICTED: uncharacterized protein LOC103965622  67.8    2e-10   
ref|XP_009355669.1|  PREDICTED: uncharacterized protein LOC103946638  67.0    4e-10   
gb|EMS52399.1|  hypothetical protein TRIUR3_11502                     64.7    2e-09   
ref|XP_008377738.1|  PREDICTED: uncharacterized protein LOC103440807  62.0    3e-08   
ref|XP_010694687.1|  PREDICTED: GATA zinc finger domain-containin...  57.8    8e-07   
gb|EEE51623.1|  hypothetical protein OsJ_32902                        52.4    1e-04   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_011091785.1| PREDICTED: putative transcription factor kapC [Sesamum indicum]
Length=256

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 115/189 (61%), Gaps = 36/189 (19%)
 Frame = +1

Query  49   EMEVSDHFLVLnssdsssnnVKVQPSLSVGSVLDGMLRNNAQTYTHTHTHIYPN------  210
            E+E+SD  L+     +S ++  +Q SLS  S LD +LRN AQT THTHT   P       
Sbjct  9    EVELSDRLLL----PNSDSSSNIQASLSADSFLDDLLRN-AQTCTHTHTCNPPGPDTAHT  63

Query  211  ------------SQSDGEP---------RRRASGNREAVRKYREKKKAHTAYLEEEVRKL  327
                        S+ D +P         R+R  GNREAVRKYREKKKAH AYLEEEV+KL
Sbjct  64   HTCYHTHTHVIPSEEDNDPCDEKSPVSKRQRPLGNREAVRKYREKKKAHAAYLEEEVKKL  123

Query  328  RAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATPFEQ  507
            R +N+Q++KK++RQ +LEAE++RLR LLL L  KI++E G     FPFQK     T F++
Sbjct  124  RLLNQQLMKKLQRQAILEAEIVRLRTLLLDLSGKINNELG----DFPFQKRSSAITTFKE  179

Query  508  GDCAVQSSG  534
            G+  +Q +G
Sbjct  180  GEYGIQPTG  188



>ref|XP_011042103.1| PREDICTED: uncharacterized protein LOC105137881 isoform X2 [Populus 
euphratica]
Length=229

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 112/185 (61%), Gaps = 31/185 (17%)
 Frame = +1

Query  49   EMEVSDHFLVLnssdsssnnVKVQPSLSVGSVLDGMLRNNAQTYTHTHTHIY-PN-----  210
            E+EVSDH L+ +   S      +Q S SV S+LD +L+N          +   P+     
Sbjct  5    EVEVSDHVLLPDPGASG----SLQCSGSVDSLLDELLKNTRTCTHTHTCNPPGPDAIHTH  60

Query  211  -----------SQSDGEP------RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVN  339
                       S+ D  P      R+R +GNREAVRKYREKKKAHTAYLEEE++KL  +N
Sbjct  61   TCYHTHTQVIASEEDVNPDNREHSRKRPAGNREAVRKYREKKKAHTAYLEEEIKKLHLLN  120

Query  340  EQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCA  519
            +Q+VKK++RQ +LEAEV+RLR++L+ LR KID+E G     FPFQ  C+  T  ++GDC 
Sbjct  121  QQLVKKIQRQAILEAEVLRLRSILVDLRGKIDTELGV----FPFQNQCNTTTVLKEGDCG  176

Query  520  VQSSG  534
             QS+G
Sbjct  177  AQSTG  181



>ref|XP_011042101.1| PREDICTED: uncharacterized protein LOC105137881 isoform X1 [Populus 
euphratica]
 ref|XP_011042102.1| PREDICTED: uncharacterized protein LOC105137881 isoform X1 [Populus 
euphratica]
Length=234

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 113/185 (61%), Gaps = 31/185 (17%)
 Frame = +1

Query  49   EMEVSDHFLVLnssdsssnnVKVQPSLSVGSVLDGMLRNNAQTYTHTHTHIY-PN-----  210
            E+EVSDH L+ +   S S    +Q S SV S+LD +L+N          +   P+     
Sbjct  10   EVEVSDHVLLPDPGASGS----LQCSGSVDSLLDELLKNTRTCTHTHTCNPPGPDAIHTH  65

Query  211  -----------SQSDGEP------RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVN  339
                       S+ D  P      R+R +GNREAVRKYREKKKAHTAYLEEE++KL  +N
Sbjct  66   TCYHTHTQVIASEEDVNPDNREHSRKRPAGNREAVRKYREKKKAHTAYLEEEIKKLHLLN  125

Query  340  EQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCA  519
            +Q+VKK++RQ +LEAEV+RLR++L+ LR KID+E G     FPFQ  C+  T  ++GDC 
Sbjct  126  QQLVKKIQRQAILEAEVLRLRSILVDLRGKIDTELGV----FPFQNQCNTTTVLKEGDCG  181

Query  520  VQSSG  534
             QS+G
Sbjct  182  AQSTG  186



>ref|XP_002303896.2| hypothetical protein POPTR_0003s20320g [Populus trichocarpa]
 gb|ABK94687.1| unknown [Populus trichocarpa]
 gb|EEE78875.2| hypothetical protein POPTR_0003s20320g [Populus trichocarpa]
Length=237

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 113/185 (61%), Gaps = 31/185 (17%)
 Frame = +1

Query  49   EMEVSDHFLVLnssdsssnnVKVQPSLSVGSVLDGMLRNNAQTYTHTHTHIY-PN-----  210
            E+E+SDH L+ +   S      +Q S SV S+LD +L+N          + + P+     
Sbjct  10   EVELSDHVLLPDPGTSG----SLQCSGSVDSLLDELLKNTRTCTHTHTCNPHGPDAIHTH  65

Query  211  -----------SQSDGEP------RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVN  339
                       S+ D  P      R+R +GNREAVRKYREKKKAHTAYLEEEV+KL  +N
Sbjct  66   TCYHTHTQVIASEEDDNPDNREHSRKRPAGNREAVRKYREKKKAHTAYLEEEVKKLHLLN  125

Query  340  EQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCA  519
            +Q+V+K++RQ +LEAEV RLR++L+ LR KID+E G     FPFQ HC+  T  ++G+C 
Sbjct  126  QQLVRKIQRQAILEAEVSRLRSILVDLRGKIDTELGV----FPFQNHCNTTTVLKEGECG  181

Query  520  VQSSG  534
             QS+G
Sbjct  182  AQSTG  186



>ref|XP_011037808.1| PREDICTED: uncharacterized protein LOC105134916 [Populus euphratica]
 ref|XP_011037809.1| PREDICTED: uncharacterized protein LOC105134916 [Populus euphratica]
Length=266

 Score =   119 bits (299),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 109/193 (56%), Gaps = 35/193 (18%)
 Frame = +1

Query  49   EMEVSDHFLVLnssdsssnnVKVQPSLSVGSVLDGMLRNNA-------------------  171
            E+E+SDH L+ N   S      +Q S SV S+LD  L+N                     
Sbjct  10   EIELSDHVLLPNPDSSGI----LQSSASVDSLLDEFLKNTRTCTHTHTCNPLGPDITHTH  65

Query  172  -------QTYTHTHTHIYPNSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLR  330
                   Q  T        N +      +R +GNREAVRKYREKKKAHTAYLEEEV+KLR
Sbjct  66   TCYHTHTQVITSEEDDHVNNREHSNSKAKRPAGNREAVRKYREKKKAHTAYLEEEVKKLR  125

Query  331  AVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATPFEQG  510
              N+Q+V+K+++QV+LEAEV+RLR++L+ LR KID+E G     FPFQ   D    F+ G
Sbjct  126  ISNQQLVRKIQQQVILEAEVLRLRSILMGLRGKIDTELGV----FPFQNQGDATAAFKDG  181

Query  511  DCAVQSSGKGPGN  549
            +C  QS+G GP N
Sbjct  182  NCGAQSTG-GPKN  193



>emb|CAN72907.1| hypothetical protein VITISV_033868 [Vitis vinifera]
Length=260

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 108/187 (58%), Gaps = 34/187 (18%)
 Frame = +1

Query  49   EMEVSDHFLVLnssdsssnnVKVQPSLSVGSVLDGMLRNNA-------------------  171
            E+E+SDH L+     + +++   Q S  + S LD  L+N                     
Sbjct  5    EVELSDHVLL----SNPNSSSNFQGSTPIDSFLDDFLKNTRTCTHTHTCNPPGPDAAHTH  60

Query  172  -------QTYTHTHTHIYPNSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLR  330
                   Q +      +  N +      RR SGNREAVRKYREKKKAHTAYLEEEV+KLR
Sbjct  61   TCYHTHTQVFASEEDEVPNNKEHXISKVRRPSGNREAVRKYREKKKAHTAYLEEEVKKLR  120

Query  331  AVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATPFEQG  510
             +N+Q+VKK++ Q VLEAEV+RLR+LLL LR KID+E G     FPFQK C+    F++G
Sbjct  121  LLNQQLVKKLQGQAVLEAEVLRLRSLLLDLRGKIDNELGV----FPFQKQCNTTLSFKEG  176

Query  511  DCAVQSS  531
            DC +QS+
Sbjct  177  DCGLQSA  183



>ref|XP_007008741.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007008742.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY17551.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY17552.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
Length=245

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 84/113 (74%), Gaps = 4/113 (4%)
 Frame = +1

Query  208  NSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAE  387
            N  S     RR SGNREAVRKYREKKKAHTAYLEEEV+KLR +N+Q+V+K++ Q +LEAE
Sbjct  80   NKNSSSLKPRRPSGNREAVRKYREKKKAHTAYLEEEVKKLRLLNQQLVRKLQGQTILEAE  139

Query  388  VMrlralllklrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCAVQSSGKGPG  546
            V+RLR+LL+ LR KID     G   FPFQK C+ AT  ++GDC VQS+ +  G
Sbjct  140  VLRLRSLLVDLRAKID----GGLGVFPFQKQCNNATILKEGDCGVQSTDESIG  188



>ref|XP_003633543.1| PREDICTED: uncharacterized protein LOC100255414 [Vitis vinifera]
 ref|XP_010659259.1| PREDICTED: uncharacterized protein LOC100255414 [Vitis vinifera]
 ref|XP_010659260.1| PREDICTED: uncharacterized protein LOC100255414 [Vitis vinifera]
Length=260

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 108/187 (58%), Gaps = 34/187 (18%)
 Frame = +1

Query  49   EMEVSDHFLVLnssdsssnnVKVQPSLSVGSVLDGMLRNNA-------------------  171
            E+E+SDH L+     + +++   Q S  + S LD  L+N                     
Sbjct  5    EVELSDHVLL----SNPNSSSNFQGSTPIDSFLDDFLKNTRTCTHTHTCNPPGPDAAHTH  60

Query  172  -------QTYTHTHTHIYPNSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLR  330
                   Q +      +  N +      RR SGNREAVRKYREKKKAHTAYLEEEV+KLR
Sbjct  61   TCYHTHTQVFASEEDEVPNNKEHLISKVRRPSGNREAVRKYREKKKAHTAYLEEEVKKLR  120

Query  331  AVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATPFEQG  510
             +N+Q+VKK++ Q VLEAEV+RLR+LLL LR KID+E G     FPFQK C+    F++G
Sbjct  121  LLNQQLVKKLQGQAVLEAEVLRLRSLLLDLRGKIDNELGV----FPFQKQCNTTLSFKEG  176

Query  511  DCAVQSS  531
            DC +QS+
Sbjct  177  DCGLQSA  183



>ref|XP_010279543.1| PREDICTED: uncharacterized protein LOC104613430 [Nelumbo nucifera]
Length=300

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 81/104 (78%), Gaps = 4/104 (4%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            RR SGNREAVRKYREKKKA TAYLEEEV+KLR +N+Q+++K++ Q +LE EV+RL+ LL+
Sbjct  117  RRPSGNREAVRKYREKKKAQTAYLEEEVKKLRLLNQQLIRKLQGQAILETEVLRLKTLLI  176

Query  415  klrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCAVQSSGKGPG  546
             LR KID+E G     FP+QK C+  T F +GDC++QS+  G G
Sbjct  177  DLRGKIDNELGV----FPYQKQCNSTTSFRKGDCSIQSASGGIG  216



>emb|CBI28617.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 81/100 (81%), Gaps = 4/100 (4%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            RR SGNREAVRKYREKKKAHTAYLEEEV+KLR +N+Q+VKK++ Q VLEAEV+RLR+LLL
Sbjct  190  RRPSGNREAVRKYREKKKAHTAYLEEEVKKLRLLNQQLVKKLQGQAVLEAEVLRLRSLLL  249

Query  415  klrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCAVQSSG  534
             LR KID+E G     FPFQK C+    F++GDC +QS+ 
Sbjct  250  DLRGKIDNELGV----FPFQKQCNTTLSFKEGDCGLQSAS  285



>ref|XP_010104020.1| hypothetical protein L484_001603 [Morus notabilis]
 gb|EXB97908.1| hypothetical protein L484_001603 [Morus notabilis]
Length=232

 Score =   113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 96/165 (58%), Gaps = 32/165 (19%)
 Frame = +1

Query  127  LSVGSVLDGMLRNNAQTYTHTHTHIYP---------------------------NSQSDG  225
            +S+ S +D +L+N A+T THTHT   P                           + Q+  
Sbjct  1    MSLDSFIDDLLKN-ARTCTHTHTCNPPGPDSTHTHTCYHTHTQVLASEDDDHTTSKQNST  59

Query  226  EPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlra  405
               RR SGNR+AVRKYREKKKAH AYLEEEV KLR  N+Q+ +K+ RQ VLEAEV+RLR 
Sbjct  60   SKSRRPSGNRDAVRKYREKKKAHAAYLEEEVNKLRLANQQLARKLRRQAVLEAEVLRLRG  119

Query  406  lllklrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCAVQSSGKG  540
            LL+ LR KIDS  G     +PFQK  +  + F++ DC VQ S  G
Sbjct  120  LLVDLRGKIDSTLGT----YPFQKQSNTTSFFKEADCQVQPSAAG  160



>gb|KDO83274.1| hypothetical protein CISIN_1g024477mg [Citrus sinensis]
 gb|KDO83275.1| hypothetical protein CISIN_1g024477mg [Citrus sinensis]
Length=267

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 105/193 (54%), Gaps = 36/193 (19%)
 Frame = +1

Query  49   EMEVSDHFLVLnssdsssnnVKVQPSLSVGSVLDGMLRNNAQTY----------------  180
            E+E+SDH L+LN   S         S SV S LD  L+N                     
Sbjct  9    EVELSDHALLLNQEFSR----NFHNSASVDSFLDEFLKNTKTCTHTHTCNPPGPDAAHTH  64

Query  181  -----------THTHTHIYPNSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKL  327
                       +    H      S  +PRR +SGNREAVRKYREKKKAHTAYLEEEV+KL
Sbjct  65   TCYHTHTQVIASEEDNHSNSKENSVSKPRR-SSGNREAVRKYREKKKAHTAYLEEEVKKL  123

Query  328  RAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATPFEQ  507
              +N+Q+V+K++ Q +LEAE +RLR+LL   R KID E G     FP+QK C+     ++
Sbjct  124  HTLNQQLVRKLQGQAILEAEFLRLRSLLADFRGKIDDELGV----FPYQKQCNGVAILKE  179

Query  508  GDCAVQSSGKGPG  546
            GDC +QS+G+  G
Sbjct  180  GDCGLQSNGEAVG  192



>ref|XP_006438937.1| hypothetical protein CICLE_v10032430mg [Citrus clementina]
 ref|XP_006438938.1| hypothetical protein CICLE_v10032430mg [Citrus clementina]
 ref|XP_006482937.1| PREDICTED: uncharacterized protein LOC102609311 isoform X1 [Citrus 
sinensis]
 ref|XP_006482938.1| PREDICTED: uncharacterized protein LOC102609311 isoform X2 [Citrus 
sinensis]
 gb|ESR52177.1| hypothetical protein CICLE_v10032430mg [Citrus clementina]
 gb|ESR52178.1| hypothetical protein CICLE_v10032430mg [Citrus clementina]
Length=267

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 105/193 (54%), Gaps = 36/193 (19%)
 Frame = +1

Query  49   EMEVSDHFLVLnssdsssnnVKVQPSLSVGSVLDGMLRNNAQTY----------------  180
            E+E+SDH L+LN   S         S SV S LD  L+N                     
Sbjct  9    EVELSDHALLLNQEFSG----NFHNSASVDSFLDEFLKNTKTCTHTHTCNPPGPDAAHTH  64

Query  181  -----------THTHTHIYPNSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKL  327
                       +    H      S  +PRR +SGNREAVRKYREKKKAHTAYLEEEV+KL
Sbjct  65   TCYHTHTQVIASEEDNHSNSKENSVSKPRR-SSGNREAVRKYREKKKAHTAYLEEEVKKL  123

Query  328  RAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATPFEQ  507
              +N+Q+V+K++ Q +LEAE +RLR+LL   R KID E G     FP+QK C+     ++
Sbjct  124  HTLNQQLVRKLQGQAILEAEFLRLRSLLADFRGKIDDELGV----FPYQKQCNGVAILKE  179

Query  508  GDCAVQSSGKGPG  546
            GDC +QS+G+  G
Sbjct  180  GDCGLQSNGEAVG  192



>emb|CDP21594.1| unnamed protein product [Coffea canephora]
Length=265

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 99/168 (59%), Gaps = 39/168 (23%)
 Frame = +1

Query  133  VGSVLDGMLRNNAQTYTHTHT-------------------HIYP---------------N  210
            V S LD +LRN AQT THTHT                    + P               +
Sbjct  29   VDSFLDELLRN-AQTCTHTHTCNPPGPDAAHTHTCYHTHTQVIPSERVENPSEKVDGPCD  87

Query  211  SQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEV  390
            S+      RR+SGNREAVRKYREKKKA TAYLEEE +KLR VN+Q+++KV+RQ +LEAE+
Sbjct  88   SRKSTSKTRRSSGNREAVRKYREKKKAQTAYLEEEAKKLRLVNQQLIRKVQRQAILEAEI  147

Query  391  MrlralllklrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCAVQSSG  534
             RLR+LLL +R KID+E GA    +P QK C  +   ++GD  +Q SG
Sbjct  148  SRLRSLLLDVRGKIDTELGA----YPLQKQCISSFKVKEGDSGMQYSG  191



>ref|XP_006368575.1| hypothetical protein POPTR_0001s05750g [Populus trichocarpa]
 gb|ERP65144.1| hypothetical protein POPTR_0001s05750g [Populus trichocarpa]
Length=253

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 81/105 (77%), Gaps = 5/105 (5%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            +R +GNREAVRKYR+KKKAHTAYLEEEV+KLR  N+Q+V+K+++QV+LEAEV+RLR++L+
Sbjct  94   KRPAGNREAVRKYRQKKKAHTAYLEEEVKKLRISNQQLVRKIQQQVILEAEVLRLRSILM  153

Query  415  klrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCAVQSSGKGPGN  549
             LR KID+E G      PFQ   D    F+ G+C  QS+G GP N
Sbjct  154  GLRGKIDTELGV----LPFQNQGDATAAFKDGNCGAQSTG-GPMN  193



>ref|XP_002299223.2| hypothetical protein POPTR_0001s05750g [Populus trichocarpa]
 gb|EEE84028.2| hypothetical protein POPTR_0001s05750g [Populus trichocarpa]
Length=266

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 81/105 (77%), Gaps = 5/105 (5%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            +R +GNREAVRKYR+KKKAHTAYLEEEV+KLR  N+Q+V+K+++QV+LEAEV+RLR++L+
Sbjct  94   KRPAGNREAVRKYRQKKKAHTAYLEEEVKKLRISNQQLVRKIQQQVILEAEVLRLRSILM  153

Query  415  klrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCAVQSSGKGPGN  549
             LR KID+E G      PFQ   D    F+ G+C  QS+G GP N
Sbjct  154  GLRGKIDTELGV----LPFQNQGDATAAFKDGNCGAQSTG-GPMN  193



>ref|XP_009354398.1| PREDICTED: transcription factor TGA3 [Pyrus x bretschneideri]
 ref|XP_009354399.1| PREDICTED: transcription factor TGA3 [Pyrus x bretschneideri]
Length=245

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 98/160 (61%), Gaps = 34/160 (21%)
 Frame = +1

Query  139  SVLDGMLRNNAQTYTHTHT-------------------HIYPNSQSDGEP----------  231
            +  D  L+  A+T THTHT                    + P+   DG            
Sbjct  31   TFFDEFLKT-ARTCTHTHTCNPPGPEAAHTHTCYHTHTQVLPSEDDDGTKNKEHSNLRPR  89

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            RRR+SGN+EAVRKYREKKKAHTAYLE+EV+KL+ +N+Q+V+K++ Q +LEAE +RLR LL
Sbjct  90   RRRSSGNKEAVRKYREKKKAHTAYLEDEVKKLQVLNQQLVRKLQGQAILEAERLRLRGLL  149

Query  412  lklrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCAVQSS  531
            L+LR KID+E GA    FPFQK C+  T FE   C +QSS
Sbjct  150  LELRGKIDTELGA----FPFQKQCNSNTYFEDSQCNLQSS  185



>ref|XP_004303083.1| PREDICTED: uncharacterized protein LOC101298723 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=255

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 86/122 (70%), Gaps = 15/122 (12%)
 Frame = +1

Query  199  IYPNSQSDGE----------PRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQM  348
            + P+ ++DG+           RRR SGNREAVRKYREKKKAHTAYLEEEV+KL+ +N+Q+
Sbjct  61   VLPSEENDGDHSKEDLVLKPKRRRPSGNREAVRKYREKKKAHTAYLEEEVKKLQLLNQQL  120

Query  349  VKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK-HCDPATPFEQGDCAVQ  525
            V+K++ Q  LEAE +RLR LLL  R KIDSE GA    FPF+K +  P    ++GDC +Q
Sbjct  121  VRKLQGQASLEAEFLRLRNLLLDFRGKIDSELGA----FPFEKQYYKPGVISKEGDCELQ  176

Query  526  SS  531
            S+
Sbjct  177  SN  178



>dbj|BAK03166.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=225

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 91/172 (53%), Gaps = 37/172 (22%)
 Frame = +1

Query  142  VLDGMLRNNAQTYTHTHTHIYPN----------------------SQSDGEPR-RRASGN  252
              D +L + A T THTHT   P                       S+ D   R RR  GN
Sbjct  21   AFDDLLADAAATCTHTHTCNPPGPSAAMHTHTCLHTHTHQLFAAGSEDDDAARPRRPLGN  80

Query  253  REAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKI  432
            REAVRKYREKKKAH A+LEEEV+KLRA N+Q++++++    LEAEV RLR LL  +R KI
Sbjct  81   REAVRKYREKKKAHAAFLEEEVKKLRAANQQLLRRLQGHATLEAEVARLRGLLSDVRAKI  140

Query  433  DSESGAGHSGFPFQKHC--------DPATPFEQGDC----AVQSSGKGPGNA  552
            D+E  AG  GFPFQK C        DP   F  G+     A      GP +A
Sbjct  141  DAEVAAG--GFPFQKQCSVGSVACTDPTLCFNNGNSEVGGACWGDSSGPASA  190



>ref|XP_007149027.1| hypothetical protein PHAVU_005G034400g [Phaseolus vulgaris]
 ref|XP_007149028.1| hypothetical protein PHAVU_005G034400g [Phaseolus vulgaris]
 gb|ESW21021.1| hypothetical protein PHAVU_005G034400g [Phaseolus vulgaris]
 gb|ESW21022.1| hypothetical protein PHAVU_005G034400g [Phaseolus vulgaris]
Length=260

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 88/133 (66%), Gaps = 12/133 (9%)
 Frame = +1

Query  169  AQTYT--HTHTHIY-PNSQSDGE----PRRRASGNREAVRKYREKKKAHTAYLEEEVRKL  327
            A T+T  H+HT I+ P    D E      +R SGNREAVRKYREKKKAHTAYLEEEV+KL
Sbjct  61   AHTHTCYHSHTQIFGPEDDDDKEHTNSKPKRPSGNREAVRKYREKKKAHTAYLEEEVKKL  120

Query  328  RAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATPFEQ  507
            R VN+Q+ +K++ Q  LEAE+ RLR++L  L+ KIDSE GA    FPFQ  C  +   ++
Sbjct  121  RLVNQQLARKLQGQAHLEAELARLRSILALLKGKIDSELGA----FPFQNQCS-SYILKE  175

Query  508  GDCAVQSSGKGPG  546
            GD  + S+    G
Sbjct  176  GDAGLLSTAGTIG  188



>ref|NP_001237285.1| uncharacterized protein LOC100527780 [Glycine max]
 gb|ACU16954.1| unknown [Glycine max]
Length=199

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 80/99 (81%), Gaps = 5/99 (5%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            ++R SGNREAVRKYREKKKAHTAYLEEEV+KL  VN+Q+V+K++ Q +LEAE+ RLR++L
Sbjct  78   QKRPSGNREAVRKYREKKKAHTAYLEEEVKKLHMVNQQLVRKLQGQALLEAELARLRSIL  137

Query  412  lklrDKIDSESGAGHSGFPFQK-HCDPATPFEQGDCAVQ  525
             +L+ KIDSE GA    +PFQK +C+ +  F++GD  ++
Sbjct  138  ARLKGKIDSELGA----WPFQKQYCNTSYIFKEGDAGLE  172



>gb|KHN22064.1| hypothetical protein glysoja_008976 [Glycine soja]
Length=240

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 80/99 (81%), Gaps = 5/99 (5%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            ++R SGNREAVRKYREKKKAHTAYLEEEV+KL  VN+Q+V+K++ Q +LEAE+ RLR++L
Sbjct  78   QKRPSGNREAVRKYREKKKAHTAYLEEEVKKLHMVNQQLVRKLQGQALLEAELARLRSIL  137

Query  412  lklrDKIDSESGAGHSGFPFQK-HCDPATPFEQGDCAVQ  525
             +L+ KIDSE GA    +PFQK +C+ +  F++GD  ++
Sbjct  138  ARLKGKIDSELGA----WPFQKQYCNTSYIFKEGDAGLE  172



>ref|XP_008364717.1| PREDICTED: uncharacterized protein LOC103428389 [Malus domestica]
Length=245

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 75/100 (75%), Gaps = 4/100 (4%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            RRR  GNREAVRKYR+KKKAH AYLEEE+RKL+ +N+Q+V K++ Q  LEAE ++L+ L+
Sbjct  90   RRRPLGNREAVRKYRDKKKAHAAYLEEEIRKLQVLNQQLVGKIQAQATLEAEFLKLKGLV  149

Query  412  lklrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCAVQSS  531
            L+LR  ID+E GA    FPFQK  +  T F++  C +QSS
Sbjct  150  LELRRMIDNELGA----FPFQKQLNSNTYFKESQCNLQSS  185



>ref|XP_006403861.1| hypothetical protein EUTSA_v10010764mg [Eutrema salsugineum]
 gb|ESQ45314.1| hypothetical protein EUTSA_v10010764mg [Eutrema salsugineum]
Length=176

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 87/123 (71%), Gaps = 10/123 (8%)
 Frame = +1

Query  163  NNAQTYTHTHTH-IYP----NSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKL  327
            +++ T  H HTH I P    N   DG  ++R+ GNREAVRKYREKKKA TAYLE+EV++L
Sbjct  31   SHSHTCFHAHTHLIIPDSGENDHCDGSNKKRSCGNREAVRKYREKKKARTAYLEDEVKRL  90

Query  328  RAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCD-PATPFE  504
            +++NEQ+++K++ Q ++E E++RLR LL++++  ID E G    GF FQK C+     F+
Sbjct  91   QSLNEQLIRKLQSQEMVETEIIRLRTLLVEMQGMIDGELG----GFSFQKQCNGSGFVFK  146

Query  505  QGD  513
            +GD
Sbjct  147  EGD  149



>ref|XP_008344616.1| PREDICTED: uncharacterized protein LOC103407459 [Malus domestica]
 ref|XP_008344617.1| PREDICTED: uncharacterized protein LOC103407459 [Malus domestica]
 ref|XP_008363297.1| PREDICTED: uncharacterized protein LOC103426998 [Malus domestica]
 ref|XP_008363299.1| PREDICTED: uncharacterized protein LOC103426998 [Malus domestica]
Length=245

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 73/96 (76%), Gaps = 4/96 (4%)
 Frame = +1

Query  244  SGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklr  423
            SGNREAVRKYREKKKAHTAYLEEEV+KL+ +N+Q+V+K++ Q +LEAE +RLR LLL+ R
Sbjct  94   SGNREAVRKYREKKKAHTAYLEEEVKKLQVLNQQLVRKLQGQAILEAERLRLRGLLLEFR  153

Query  424  DKIDSESGAGHSGFPFQKHCDPATPFEQGDCAVQSS  531
             KID+E G     FPF   C+  T FE   C +QSS
Sbjct  154  GKIDTELGV----FPFGNQCNSNTYFEDSQCNLQSS  185



>emb|CDY23178.1| BnaA04g05810D [Brassica napus]
Length=188

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 89/128 (70%), Gaps = 10/128 (8%)
 Frame = +1

Query  163  NNAQTYTHTHTH-IYPNSQ----SDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKL  327
            +++ T  HTHTH I P+SQ    SD   +RR  GNREAVRKYREKKKA TAYLE+EV++L
Sbjct  31   SHSHTCFHTHTHLIIPDSQENDHSDSSNKRRPCGNREAVRKYREKKKARTAYLEDEVKRL  90

Query  328  RAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCD-PATPFE  504
            +++NE +++K++ Q ++EAE++RLR LL +++  ID E G    GF FQK C+     F+
Sbjct  91   QSMNEFLLRKLQSQAIVEAEIIRLRTLLAEMQKTIDDELG----GFSFQKQCNGSGFVFK  146

Query  505  QGDCAVQS  528
            +  C V +
Sbjct  147  EDGCNVAT  154



>ref|XP_006291938.1| hypothetical protein CARUB_v10018125mg [Capsella rubella]
 gb|EOA24836.1| hypothetical protein CARUB_v10018125mg [Capsella rubella]
Length=171

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 87/129 (67%), Gaps = 10/129 (8%)
 Frame = +1

Query  163  NNAQTYTHTHTH-IYP----NSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKL  327
            +++ T  HTHTH I P    N  SD   ++R+ GNREAVRKYREKKKA TAYLE+EV++L
Sbjct  33   SHSHTCFHTHTHLIIPDQQENDHSDSSNKKRSCGNREAVRKYREKKKARTAYLEDEVKRL  92

Query  328  RAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHC-DPATPFE  504
            + +NE + +K++ Q  +E EV+RLR LL++++ KID E G    GF  QKHC      F+
Sbjct  93   QTLNEHLHRKLQSQATVETEVIRLRTLLVEMQGKIDGELG----GFSNQKHCFGSGLVFK  148

Query  505  QGDCAVQSS  531
            +  C+V +S
Sbjct  149  EDGCSVATS  157



>ref|XP_006644854.1| PREDICTED: uncharacterized protein LOC102712588 [Oryza brachyantha]
Length=224

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 84/138 (61%), Gaps = 14/138 (10%)
 Frame = +1

Query  172  QTYTHTHTHIY------PNSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRA  333
             T+T  HTHI        N + D    R+  GNREAVRKYREKKKAH A+LEEEV+KLR 
Sbjct  50   HTHTCLHTHIQVLASGENNVEEDLRKTRKPLGNREAVRKYREKKKAHAAFLEEEVKKLRT  109

Query  334  VNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATPFEQGD  513
             N+Q++++++  + LEAEV+RLRALL  +R KID+E G     FPFQK C     F    
Sbjct  110  TNQQLLRRLQGHISLEAEVVRLRALLFDIRGKIDAEIGT----FPFQKQCS----FGSVT  161

Query  514  CAVQSSGKGPGNAVALRE  567
            C   S     G  VA+RE
Sbjct  162  CTDHSPRINTGAEVAVRE  179



>gb|AEX11142.1| hypothetical protein 0_12104_01 [Pinus taeda]
 gb|AEX11147.1| hypothetical protein 0_12104_01 [Pinus taeda]
Length=135

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 82/118 (69%), Gaps = 14/118 (12%)
 Frame = +1

Query  160  RNNAQTYT--HTHTHIYPNSQSD---GEP-----RRRASGNREAVRKYREKKKAHTAYLE  309
            R+   T+T  H+HT  +   Q D   G P     R+R SGNREAV+KYREK+KAHTAYLE
Sbjct  15   RDKPHTHTCYHSHTQFFSTEQEDQLGGTPDSLAKRKRPSGNREAVKKYREKQKAHTAYLE  74

Query  310  EEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHC  483
            ++V+KLR++N+Q+ +KV+ QV LEAE  RLR++L + + KIDSE G+     P+QK C
Sbjct  75   DKVQKLRSLNQQLWRKVQDQVALEAEAERLRSILFEFKGKIDSELGS----VPYQKPC  128



>gb|AEX11144.1| hypothetical protein 0_12104_01 [Pinus taeda]
Length=135

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 82/118 (69%), Gaps = 14/118 (12%)
 Frame = +1

Query  160  RNNAQTYT--HTHTHIYPNSQSD---GEP-----RRRASGNREAVRKYREKKKAHTAYLE  309
            R+   T+T  H+HT  +   Q D   G P     R+R SGNREAV+KYREK+KAHTAYLE
Sbjct  15   RDKPHTHTCYHSHTQFFSTEQEDQLGGTPQSLAKRKRPSGNREAVKKYREKQKAHTAYLE  74

Query  310  EEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHC  483
            ++V+KLR++N+Q+ +KV+ QV LEAE  RLR++L + + KIDSE G+     P+QK C
Sbjct  75   DKVQKLRSLNQQLWRKVQDQVALEAEAERLRSILFEFKGKIDSELGS----VPYQKPC  128



>gb|AEX11140.1| hypothetical protein 0_12104_01 [Pinus taeda]
 gb|AEX11141.1| hypothetical protein 0_12104_01 [Pinus taeda]
 gb|AEX11143.1| hypothetical protein 0_12104_01 [Pinus taeda]
 gb|AEX11145.1| hypothetical protein 0_12104_01 [Pinus taeda]
 gb|AEX11146.1| hypothetical protein 0_12104_01 [Pinus taeda]
 gb|AEX11148.1| hypothetical protein 0_12104_01 [Pinus taeda]
 gb|AEX11149.1| hypothetical protein 0_12104_01 [Pinus taeda]
 gb|AEX11150.1| hypothetical protein 0_12104_01 [Pinus taeda]
 gb|AEX11151.1| hypothetical protein 0_12104_01 [Pinus taeda]
 gb|AEX11152.1| hypothetical protein 0_12104_01 [Pinus taeda]
 gb|AEX11153.1| hypothetical protein 0_12104_01 [Pinus taeda]
 gb|AEX11154.1| hypothetical protein 0_12104_01 [Pinus taeda]
Length=135

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 82/118 (69%), Gaps = 14/118 (12%)
 Frame = +1

Query  160  RNNAQTYT--HTHTHIYPNSQSD---GEP-----RRRASGNREAVRKYREKKKAHTAYLE  309
            R+   T+T  H+HT  +   Q D   G P     R+R SGNREAV+KYREK+KAHTAYLE
Sbjct  15   RDKPHTHTCYHSHTQFFSTEQEDQLGGTPESLAKRKRPSGNREAVKKYREKQKAHTAYLE  74

Query  310  EEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHC  483
            ++V+KLR++N+Q+ +KV+ QV LEAE  RLR++L + + KIDSE G+     P+QK C
Sbjct  75   DKVQKLRSLNQQLWRKVQDQVALEAEAERLRSILFEFKGKIDSELGS----VPYQKPC  128



>gb|AEX11155.1| hypothetical protein 0_12104_01 [Pinus radiata]
Length=135

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 81/118 (69%), Gaps = 14/118 (12%)
 Frame = +1

Query  160  RNNAQTYT--HTHTHIYPNSQSD---GEP-----RRRASGNREAVRKYREKKKAHTAYLE  309
            R+   T+T  H+HT  +   Q D   G P     R+R SGNREAV+KYREK+KAHTAYLE
Sbjct  15   RDKPHTHTCYHSHTQFFSTEQEDQLGGTPESLAKRKRPSGNREAVKKYREKQKAHTAYLE  74

Query  310  EEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHC  483
            ++V+KLR++N+Q+ +KV+ QV LEAE  RLR++L + + KIDSE G      P+QK C
Sbjct  75   DKVQKLRSLNQQLWRKVQDQVALEAEAERLRSILFEFKGKIDSELGP----VPYQKPC  128



>emb|CDY60641.1| BnaCnng36700D [Brassica napus]
Length=188

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 92/128 (72%), Gaps = 10/128 (8%)
 Frame = +1

Query  163  NNAQTYTHTHTH-IYPNSQ----SDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKL  327
            +++ T  HTHTH I P+SQ    SD   +RR+ GNREAVRKYREKKKA TAYLE+EV++L
Sbjct  31   SHSHTCFHTHTHLIIPDSQENGHSDSSNKRRSCGNREAVRKYREKKKARTAYLEDEVQRL  90

Query  328  RAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPAT-PFE  504
            +++NE +++K++ Q ++EAE++RLR LL++++  ++ E G    GF FQK C+ +   F+
Sbjct  91   QSMNEFLLRKLQSQAIVEAEIVRLRTLLVEMQGTMNDELG----GFSFQKQCNGSGFVFK  146

Query  505  QGDCAVQS  528
            +  C V +
Sbjct  147  EDGCNVAT  154



>ref|XP_010426786.1| PREDICTED: uncharacterized protein LOC104711744 isoform X2 [Camelina 
sativa]
 ref|XP_010426787.1| PREDICTED: uncharacterized protein LOC104711744 isoform X2 [Camelina 
sativa]
 ref|XP_010426788.1| PREDICTED: uncharacterized protein LOC104711744 isoform X2 [Camelina 
sativa]
 ref|XP_010426789.1| PREDICTED: uncharacterized protein LOC104711744 isoform X2 [Camelina 
sativa]
 ref|XP_010426790.1| PREDICTED: uncharacterized protein LOC104711744 isoform X2 [Camelina 
sativa]
Length=190

 Score = 96.3 bits (238),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 89/131 (68%), Gaps = 11/131 (8%)
 Frame = +1

Query  163  NNAQTYTHTHTH-IYP----NSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKL  327
            +++ T  HTHTH I P    N  SD   ++R+ GNREAVRKYREKKKA TAYLE+EV++L
Sbjct  31   SHSHTCFHTHTHLIIPDQQENDHSDSSNKKRSCGNREAVRKYREKKKARTAYLEDEVKRL  90

Query  328  RAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATP--F  501
              +NE +V+K++ Q ++EAE++RLR LL+++++KID E G    GF  QK     T   F
Sbjct  91   ETLNEHLVRKLQSQAIVEAELIRLRTLLVEMQEKIDGELG----GFSNQKQNKQCTDFVF  146

Query  502  EQGDCAVQSSG  534
            ++  C+V +S 
Sbjct  147  KEDGCSVATSN  157



>ref|XP_010426784.1| PREDICTED: uncharacterized protein LOC104711744 isoform X1 [Camelina 
sativa]
Length=231

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 89/131 (68%), Gaps = 11/131 (8%)
 Frame = +1

Query  163  NNAQTYTHTHTH-IYP----NSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKL  327
            +++ T  HTHTH I P    N  SD   ++R+ GNREAVRKYREKKKA TAYLE+EV++L
Sbjct  72   SHSHTCFHTHTHLIIPDQQENDHSDSSNKKRSCGNREAVRKYREKKKARTAYLEDEVKRL  131

Query  328  RAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATP--F  501
              +NE +V+K++ Q ++EAE++RLR LL+++++KID E G    GF  QK     T   F
Sbjct  132  ETLNEHLVRKLQSQAIVEAELIRLRTLLVEMQEKIDGELG----GFSNQKQNKQCTDFVF  187

Query  502  EQGDCAVQSSG  534
            ++  C+V +S 
Sbjct  188  KEDGCSVATSN  198



>ref|XP_002877837.1| bZIP family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54096.1| bZIP family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=211

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 90/128 (70%), Gaps = 10/128 (8%)
 Frame = +1

Query  166  NAQTYTHTHTH-IYP----NSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLR  330
            ++ T  H HTH I P    N  SD   ++R+ GNREAVRKYREKKKA TAYLE+EV++L+
Sbjct  55   HSHTCFHAHTHLIIPDQQENDHSDSSNKKRSCGNREAVRKYREKKKARTAYLEDEVKRLQ  114

Query  331  AVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCD-PATPFEQ  507
            ++NEQM++K++ Q ++E+E++RLR L+++++ KID E      GF FQK C+     +++
Sbjct  115  SLNEQMLRKLQSQEMMESELIRLRTLVVEMQGKIDVEL----CGFSFQKQCNGSGFVYKE  170

Query  508  GDCAVQSS  531
              C+V +S
Sbjct  171  DGCSVATS  178



>ref|XP_006850552.1| hypothetical protein AMTR_s00159p00081760 [Amborella trichopoda]
 gb|ERN12133.1| hypothetical protein AMTR_s00159p00081760 [Amborella trichopoda]
Length=271

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 91/148 (61%), Gaps = 32/148 (22%)
 Frame = +1

Query  163  NNAQTYTHTHT---------------------HIYPNSQSDGEPRR--RASGNREAVRKY  273
            ++A+T THTHT                        PN +    P +  + SGNREAVRKY
Sbjct  49   SSARTCTHTHTCNPPGPDSTHTHTCYHTHTTQLFSPNEEPSNSPSKPNKTSGNREAVRKY  108

Query  274  REKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAG  453
            REKKKAHTAYLEEEV+KLRA+N+Q+++ ++ Q +LEAEV+RLR +L+ LR KID E G  
Sbjct  109  REKKKAHTAYLEEEVKKLRALNQQLLRTLQGQAMLEAEVVRLRTILMDLRGKIDGELGVS  168

Query  454  HSGFPFQKH---CDPATPFEQGDCAVQS  528
                PFQ+    C   + F++G+C++ S
Sbjct  169  ----PFQRASTIC--GSGFKEGNCSLGS  190



>ref|XP_009117143.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103842271 
[Brassica rapa]
Length=163

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = +1

Query  163  NNAQTYTHTHTH-IYPNSQ-SDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAV  336
            +++ T  HTHTH I P+ Q +D    +R+ GNREA RKYREKKKA TAYLE+EV++L+++
Sbjct  31   SHSHTCFHTHTHLIIPDPQENDNSDXKRSCGNREAARKYREKKKARTAYLEDEVKRLQSL  90

Query  337  NEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCD-PATPFEQGD  513
            NE +++K++ Q ++E E+++LRALL++++ KID E G     F FQK C+     F++GD
Sbjct  91   NEYLLRKLQSQRMVETEIIKLRALLVEMQVKIDDELGV----FSFQKQCNGSGFVFKEGD  146

Query  514  CAVQS  528
             ++ S
Sbjct  147  VSLLS  151



>ref|XP_008788583.1| PREDICTED: uncharacterized protein LOC103706294 [Phoenix dactylifera]
Length=225

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 79/115 (69%), Gaps = 14/115 (12%)
 Frame = +1

Query  169  AQTYTHT--HTHIYPNSQSDGE--------PRRRASGNREAVRKYREKKKAHTAYLEEEV  318
            A  +THT  HTH+   + +DGE          R+  GNREAVRKYREKKKA  AYLEEEV
Sbjct  46   AAMHTHTCYHTHMQVFATTDGERGGEEELKTSRKPLGNREAVRKYREKKKAQAAYLEEEV  105

Query  319  RKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHC  483
            +KLR  N+Q++++++ Q  LEAEV+RLR+LL+ LR KID+E G     FPFQK C
Sbjct  106  KKLRHANQQLLRRLQGQAALEAEVVRLRSLLVDLRAKIDAELGT----FPFQKQC  156



>ref|XP_010269693.1| PREDICTED: uncharacterized protein LOC104606282 [Nelumbo nucifera]
Length=285

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 77/98 (79%), Gaps = 4/98 (4%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            +R+SGNREAVRKYR KKKAHTAYLEEEV+KLR +N+Q++++++ Q +LEAEV+RLR+LL+
Sbjct  102  KRSSGNREAVRKYRAKKKAHTAYLEEEVKKLRLLNQQLIRRLQGQAMLEAEVLRLRSLLI  161

Query  415  klrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCAVQS  528
             LR KID+E          QKH + +T F++G+  +QS
Sbjct  162  DLRGKIDNE----LDNLSSQKHYNRSTSFKEGNGGIQS  195



>ref|XP_010515641.1| PREDICTED: uncharacterized protein LOC104791444 isoform X2 [Camelina 
sativa]
Length=194

 Score = 93.6 bits (231),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 88/132 (67%), Gaps = 13/132 (10%)
 Frame = +1

Query  163  NNAQTYTHTHTH-IYP----NSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKL  327
            +++ T  HTHTH I P    N  SD   ++R+ GNREAVRKYREKKKA TAYLE+EV++L
Sbjct  33   SHSHTCFHTHTHLIIPDQQENDHSDSNNKKRSCGNREAVRKYREKKKARTAYLEDEVKRL  92

Query  328  RAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATP---  498
              +NE +V+K++ Q ++E E++RLR LL+++++KID E G    GF  QK     T    
Sbjct  93   ETLNEHLVRKLQSQAIVETELIRLRTLLVEIQEKIDGELG----GFSNQKQNKQCTGSGF  148

Query  499  -FEQGDCAVQSS  531
             F++  C+V +S
Sbjct  149  VFKEDGCSVATS  160



>ref|XP_002456496.1| hypothetical protein SORBIDRAFT_03g037300 [Sorghum bicolor]
 gb|EES01616.1| hypothetical protein SORBIDRAFT_03g037300 [Sorghum bicolor]
Length=176

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 77/131 (59%), Gaps = 11/131 (8%)
 Frame = +1

Query  184  HTHTHIYPNSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVE  363
            HTH     +S  +    R+  GNREAVRKYREKKKAH A+LEEEV+KLRA N+ ++++++
Sbjct  8    HTHRQFIASSSEELRTPRKPLGNREAVRKYREKKKAHAAFLEEEVKKLRATNQHLLRRLQ  67

Query  364  RQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKH--------CDPATPFEQGDCA  519
            R   LEAEV+RLR LL  ++ KID+E       FPFQKH         DP   F   D  
Sbjct  68   RHAALEAEVVRLRGLLFDVQGKIDAEIVG---AFPFQKHRSFGSVICTDPTLCFVNDDAE  124

Query  520  VQSSGKGPGNA  552
            V    +   +A
Sbjct  125  VAVPAREESSA  135



>ref|XP_009395944.1| PREDICTED: uncharacterized protein LOC103981078 [Musa acuminata 
subsp. malaccensis]
Length=227

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 66/86 (77%), Gaps = 4/86 (5%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            R+  GN+EAVRKYREKKKAH A+LEEEV+KLR VN+Q++++++ Q  LEAEV+RLR LL+
Sbjct  78   RKPLGNKEAVRKYREKKKAHAAFLEEEVKKLRLVNQQLLRRLQGQAALEAEVIRLRNLLV  137

Query  415  klrDKIDSESGAGHSGFPFQKHCDPA  492
              R KID+E G    GFPFQ  C P 
Sbjct  138  DFRGKIDAELG----GFPFQNQCRPG  159



>ref|XP_008231525.1| PREDICTED: uncharacterized protein LOC103330700 isoform X1 [Prunus 
mume]
 ref|XP_008231526.1| PREDICTED: uncharacterized protein LOC103330700 isoform X1 [Prunus 
mume]
 ref|XP_008231527.1| PREDICTED: uncharacterized protein LOC103330700 isoform X1 [Prunus 
mume]
 ref|XP_008231528.1| PREDICTED: uncharacterized protein LOC103330700 isoform X1 [Prunus 
mume]
Length=244

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 67/90 (74%), Gaps = 4/90 (4%)
 Frame = +1

Query  256  EAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKID  435
            EAVRKYREKKKAHTAYLEEEV+KLR +N+Q+V+K++ Q +LE E +RLR++ L LR KID
Sbjct  82   EAVRKYREKKKAHTAYLEEEVKKLRLLNQQLVRKIQGQAILETEFLRLRSVFLDLRGKID  141

Query  436  SESGAGHSGFPFQKHCDPATPFEQGDCAVQ  525
             E GA    FPFQ  C  ++   +GDC  Q
Sbjct  142  HELGA----FPFQNQCKTSSVLTEGDCNPQ  167



>ref|XP_010515638.1| PREDICTED: uncharacterized protein LOC104791444 isoform X1 [Camelina 
sativa]
 ref|XP_010515639.1| PREDICTED: uncharacterized protein LOC104791444 isoform X1 [Camelina 
sativa]
 ref|XP_010515640.1| PREDICTED: uncharacterized protein LOC104791444 isoform X1 [Camelina 
sativa]
Length=207

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 87/131 (66%), Gaps = 13/131 (10%)
 Frame = +1

Query  163  NNAQTYTHTHTH-IYP----NSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKL  327
            +++ T  HTHTH I P    N  SD   ++R+ GNREAVRKYREKKKA TAYLE+EV++L
Sbjct  33   SHSHTCFHTHTHLIIPDQQENDHSDSNNKKRSCGNREAVRKYREKKKARTAYLEDEVKRL  92

Query  328  RAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATP---  498
              +NE +V+K++ Q ++E E++RLR LL+++++KID E G    GF  QK     T    
Sbjct  93   ETLNEHLVRKLQSQAIVETELIRLRTLLVEIQEKIDGELG----GFSNQKQNKQCTGSGF  148

Query  499  -FEQGDCAVQS  528
             F++GD +  S
Sbjct  149  VFKEGDISYGS  159



>ref|XP_010931563.1| PREDICTED: uncharacterized protein LOC105052451 [Elaeis guineensis]
Length=225

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 68/86 (79%), Gaps = 4/86 (5%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            R+  GNREAVRKYREKKKAH AYLEEEV+KLR VN+Q++++++ Q  LEAEV+RLR+LL+
Sbjct  78   RKPFGNREAVRKYREKKKAHVAYLEEEVKKLRLVNQQLLRRLQGQAALEAEVVRLRSLLV  137

Query  415  klrDKIDSESGAGHSGFPFQKHCDPA  492
             LR KID+E G     FPFQK C  A
Sbjct  138  DLRAKIDAELGT----FPFQKQCSGA  159



>ref|XP_010922246.1| PREDICTED: uncharacterized protein LOC105045595 [Elaeis guineensis]
Length=230

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 80/135 (59%), Gaps = 30/135 (22%)
 Frame = +1

Query  166  NAQTYTHTHTHIYPN------------------SQSDGE--------PRRRASGNREAVR  267
            N++  THTHT   P                   + +DGE          R+  GNREAVR
Sbjct  34   NSRKCTHTHTCNPPGPADAMHTHTCYHTHTQVFATADGEREGEEEQKKSRKPLGNREAVR  93

Query  268  KYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESG  447
            KYREKKKA  AYLEEEV+KLR +N+Q++K+++ Q  LEAEV+RLR+ L+ LR KIDSE G
Sbjct  94   KYREKKKAQAAYLEEEVKKLRLLNQQLLKRLQGQAALEAEVVRLRSHLMDLRAKIDSELG  153

Query  448  AGHSGFPFQKHCDPA  492
                 FPFQK C  A
Sbjct  154  T----FPFQKQCSGA  164



>ref|XP_010692028.1| PREDICTED: uncharacterized protein LOC104905249 [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 74/106 (70%), Gaps = 8/106 (8%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            R++ GNREAVRKYREKKKAHTAYLEEEV+KLR VN+ +V K++ Q + EAE++RLR LL+
Sbjct  93   RKSLGNREAVRKYREKKKAHTAYLEEEVKKLRLVNQDLVGKLQNQAIFEAEILRLRGLLI  152

Query  415  klrDKIDSESGAGHSGFPFQKHCDP---ATPFEQGDCAVQS-SGKG  540
              R KIDSE       F  Q  C+     + F++GD  +QS S KG
Sbjct  153  HFRGKIDSELNT----FRIQNSCNSNADGSSFKEGDYGIQSTSSKG  194



>gb|EAY76169.1| hypothetical protein OsI_04102 [Oryza sativa Indica Group]
Length=163

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 73/111 (66%), Gaps = 8/111 (7%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            R+  GNREAVRKYREKKKAH A+LEEEV+KLR  N+Q++++++  + LEAEV+RLRALL 
Sbjct  16   RKPLGNREAVRKYREKKKAHAAFLEEEVKKLRTTNQQLLRRLQGHISLEAEVVRLRALLF  75

Query  415  klrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCAVQSSGKGPGNAVALRE  567
             +R KID+E G     FPFQK C     F    C   S        VA+RE
Sbjct  76   DIRGKIDAEIGT----FPFQKQCS----FGSVTCTDHSPCFNTSTEVAVRE  118



>gb|EAZ13857.1| hypothetical protein OsJ_03780 [Oryza sativa Japonica Group]
Length=163

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 73/111 (66%), Gaps = 8/111 (7%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            R+  GNREAVRKYREKKKAH A+LEEEV+KLR  N+Q++++++  + LEAEV+RLRALL 
Sbjct  16   RKPLGNREAVRKYREKKKAHAAFLEEEVKKLRTTNQQLLRRLQGHISLEAEVVRLRALLF  75

Query  415  klrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCAVQSSGKGPGNAVALRE  567
             +R KID+E G     FPFQK C     F    C   S        VA+RE
Sbjct  76   DIRGKIDAEIGT----FPFQKQCS----FGSVTCTDHSPCFNTSTEVAVRE  118



>ref|XP_006654590.1| PREDICTED: uncharacterized protein LOC102713546 [Oryza brachyantha]
Length=222

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 65/83 (78%), Gaps = 4/83 (5%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            RR  GNREAVRKYREKKKAH A+LEEEV+KLRA N+Q++++++    LEAEV+RLR++LL
Sbjct  72   RRPLGNREAVRKYREKKKAHAAFLEEEVKKLRATNQQLLRRLQGHAALEAEVIRLRSILL  131

Query  415  klrDKIDSESGAGHSGFPFQKHC  483
             +R KID E G     FPFQK C
Sbjct  132  DVRGKIDMEIGT----FPFQKQC  150



>ref|NP_179268.2| transcription factor bZIP23 [Arabidopsis thaliana]
 dbj|BAC42143.1| putative bzip transcription factor atbzip23 [Arabidopsis thaliana]
 gb|ABI93931.1| At2g16770 [Arabidopsis thaliana]
 gb|AEC06536.1| Basic-leucine zipper (bZIP) transcription factor family protein 
[Arabidopsis thaliana]
Length=249

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 88/150 (59%), Gaps = 27/150 (18%)
 Frame = +1

Query  121  PSLSVGSVLDGMLRNN-AQTYTHT-----------------HTHIYPN-----SQSDGEP  231
            PS S+ S  D +LR++ A T+THT                 HT I P+       S+   
Sbjct  18   PSCSMDSFFDELLRDSHACTHTHTCNPPGPENTHTHTCLHVHTKILPDKVSTDDTSESSG  77

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            ++R  GNREAVRKYREKKKA  A LE+EV +L+AVN Q++K+++ Q  LEAEV RL+ LL
Sbjct  78   KKRPLGNREAVRKYREKKKAKAASLEDEVMRLKAVNNQLLKRLQGQAALEAEVTRLKCLL  137

Query  412  lklrDKIDSESGAGHSGFPFQKHCDPATPF  501
            + +R +ID E GA    FP+QK      P+
Sbjct  138  VDIRGRIDGEIGA----FPYQKPAVTNVPY  163



>gb|AAD24610.1| hypothetical protein [Arabidopsis thaliana]
Length=255

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 88/150 (59%), Gaps = 27/150 (18%)
 Frame = +1

Query  121  PSLSVGSVLDGMLRNN-AQTYTHT-----------------HTHIYPN-----SQSDGEP  231
            PS S+ S  D +LR++ A T+THT                 HT I P+       S+   
Sbjct  18   PSCSMDSFFDELLRDSHACTHTHTCNPPGPENTHTHTCLHVHTKILPDKVSTDDTSESSG  77

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            ++R  GNREAVRKYREKKKA  A LE+EV +L+AVN Q++K+++ Q  LEAEV RL+ LL
Sbjct  78   KKRPLGNREAVRKYREKKKAKAASLEDEVMRLKAVNNQLLKRLQGQAALEAEVTRLKCLL  137

Query  412  lklrDKIDSESGAGHSGFPFQKHCDPATPF  501
            + +R +ID E GA    FP+QK      P+
Sbjct  138  VDIRGRIDGEIGA----FPYQKPAVTNVPY  163



>ref|XP_002441312.1| hypothetical protein SORBIDRAFT_09g024290 [Sorghum bicolor]
 gb|EES19742.1| hypothetical protein SORBIDRAFT_09g024290 [Sorghum bicolor]
Length=217

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 75/111 (68%), Gaps = 16/111 (14%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            R+  GNREAVRKYREKKKAH A+LEEEV+KLRA N+Q++++++    LEAEV RLR+LLL
Sbjct  82   RKPLGNREAVRKYREKKKAHAAFLEEEVKKLRAANQQLLRRLQGHAALEAEVARLRSLLL  141

Query  415  klrDKIDSESGAGHSGFPFQKHC--------DPATPF----EQGDCAVQSS  531
             +R KID+E G     FPFQ+ C        DPA  F    E G C  +SS
Sbjct  142  DVRGKIDAEVGV----FPFQRPCSVGSVACADPALCFNGNSEVGGCWEESS  188



>gb|EYU42976.1| hypothetical protein MIMGU_mgv1a023968mg [Erythranthe guttata]
Length=175

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 78/143 (55%), Gaps = 32/143 (22%)
 Frame = +1

Query  139  SVLDGMLRNNAQTYTHTHT-------------------HIYPNSQSDG---------EPR  234
            S LD + R NAQ  THTH                    +  P+S             +P 
Sbjct  29   SFLDNLSRINAQVCTHTHICNPPGPDAPHTHTCHHTHTNFIPSSDDIALHEKRTPVSKPS  88

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
             R  GNREAVRKYREKKKA  AYLEEEVRKLR  N+ +V K++R  VLE EV+RLR LL+
Sbjct  89   SRPLGNREAVRKYREKKKAQEAYLEEEVRKLRDANKLLVAKLQRGPVLETEVLRLRRLLV  148

Query  415  klrDKIDSESGAGHSGFPFQKHC  483
            ++R KID E G     FPF K C
Sbjct  149  EIRGKIDGELG----DFPFGKKC  167



>ref|XP_003566090.1| PREDICTED: uncharacterized protein LOC100823248 [Brachypodium 
distachyon]
Length=233

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 73/108 (68%), Gaps = 5/108 (5%)
 Frame = +1

Query  169  AQTYTHTHTHIYPNSQ--SDGEP---RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRA  333
            + T  HTHT ++       DG P    RR  GNREAVRKYREKKKA  A+LEEEVRKLRA
Sbjct  54   SHTCQHTHTKVFATGSEDDDGNPAAKTRRPLGNREAVRKYREKKKARAAFLEEEVRKLRA  113

Query  334  VNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             N+Q++++++    LEAEV+RLR+LL  +R KID+E     +  PFQK
Sbjct  114  ANQQLLRRLQGHGALEAEVVRLRSLLPDVRAKIDAEVAVPVAVTPFQK  161



>gb|EAY98546.1| hypothetical protein OsI_20459 [Oryza sativa Indica Group]
Length=223

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 65/83 (78%), Gaps = 4/83 (5%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            RR  GNREAVRKYREKKKAH A+LEEEV+KLRA N+Q++K+++    LEAEV+RLR++LL
Sbjct  74   RRPLGNREAVRKYREKKKAHAAFLEEEVKKLRAANQQLLKRLQGHAALEAEVIRLRSILL  133

Query  415  klrDKIDSESGAGHSGFPFQKHC  483
             +R KID E G     FP+QK C
Sbjct  134  DVRGKIDMEIGT----FPYQKPC  152



>ref|NP_001055929.1| Os05g0495200 [Oryza sativa Japonica Group]
 gb|AAU44046.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17843.1| Os05g0495200 [Oryza sativa Japonica Group]
 dbj|BAG92906.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97063.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62453.1| hypothetical protein OsJ_17245 [Oryza sativa Japonica Group]
Length=224

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 65/83 (78%), Gaps = 4/83 (5%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            RR  GNREAVRKYREKKKAH A+LEEEV+KLRA N+Q++K+++    LEAEV+RLR++LL
Sbjct  74   RRPLGNREAVRKYREKKKAHAAFLEEEVKKLRAANQQLLKRLQGHAALEAEVIRLRSILL  133

Query  415  klrDKIDSESGAGHSGFPFQKHC  483
             +R KID E G     FP+QK C
Sbjct  134  DVRGKIDMEIGT----FPYQKPC  152



>ref|XP_010489260.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
 ref|XP_010489261.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
 ref|XP_010489262.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
 ref|XP_010489264.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
Length=256

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 77/124 (62%), Gaps = 15/124 (12%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYP---------NSQSDGEPRRRASGNREAVRKYREKKKAHTAYLE  309
            NN  T+T  H HT I P         +  S+   ++R  GNREAVRKYREKKKA  A LE
Sbjct  51   NNTHTHTCLHVHTKILPSQSEDKVSTDDTSESSGKKRPLGNREAVRKYREKKKAKAASLE  110

Query  310  EEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDP  489
            +EVR+L AVN Q++K+++ Q  LEAEV RL+ LL+ +R +ID E G+    FP+QK    
Sbjct  111  DEVRRLTAVNNQLMKRLQGQAALEAEVTRLKCLLVDIRGRIDGEIGS----FPYQKPAVA  166

Query  490  ATPF  501
              PF
Sbjct  167  NVPF  170



>ref|XP_010516149.1| PREDICTED: uncharacterized protein LOC104791854 [Camelina sativa]
 ref|XP_010516157.1| PREDICTED: uncharacterized protein LOC104791854 [Camelina sativa]
Length=256

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 77/124 (62%), Gaps = 15/124 (12%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYP---------NSQSDGEPRRRASGNREAVRKYREKKKAHTAYLE  309
            NN  T+T  H HT I P         +  S+   ++R  GNREAVRKYREKKKA  A LE
Sbjct  51   NNTHTHTCLHVHTKILPSQSEDKVSTDDTSESSGKKRPLGNREAVRKYREKKKAKAASLE  110

Query  310  EEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDP  489
            +EVR+L AVN Q++K+++ Q  LEAEV RL+ LL+ +R +ID E G+    FP+QK    
Sbjct  111  DEVRRLTAVNNQLMKRLQGQAALEAEVTRLKCLLVDIRGRIDGEIGS----FPYQKPAVA  166

Query  490  ATPF  501
              PF
Sbjct  167  NVPF  170



>ref|XP_004961638.1| PREDICTED: uncharacterized protein LOC101767291 [Setaria italica]
Length=228

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 69/97 (71%), Gaps = 12/97 (12%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            R+  GNR AVRKYREKKKAH A+LEEEV+KLRA N+Q++++V+   VLEAEV+RLR LLL
Sbjct  79   RKPLGNRVAVRKYREKKKAHAAFLEEEVKKLRAANQQLLRRVQDHAVLEAEVVRLRTLLL  138

Query  415  klrDKIDSESGAGHSGFPFQKHC--------DPATPF  501
             +R KID+E GA    FPFQ  C        DPA  F
Sbjct  139  DVRGKIDAEVGA----FPFQNPCSVGSVVSADPALCF  171



>ref|XP_009112401.1| PREDICTED: uncharacterized protein LOC103837781 isoform X1 [Brassica 
rapa]
 ref|XP_009112402.1| PREDICTED: uncharacterized protein LOC103837781 isoform X1 [Brassica 
rapa]
Length=242

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 77/119 (65%), Gaps = 19/119 (16%)
 Frame = +1

Query  166  NAQTYT--HTHTHIYPNSQSDGE-------------PRRRASGNREAVRKYREKKKAHTA  300
            N  T+T  H HT I P +QSD +              ++R SGNREAVRKYREKKKA  A
Sbjct  43   NTHTHTCLHVHTKILPAAQSDDKETTDDTSESSGKRSKKRPSGNREAVRKYREKKKAKAA  102

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             LE+EV +LRAVN Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E GA    FP+QK
Sbjct  103  SLEDEVLRLRAVNNQLMKRLQGQAALEAEVTRLKCLLVDIRGRIEGEIGA----FPYQK  157



>gb|EMS45371.1| hypothetical protein TRIUR3_18393 [Triticum urartu]
Length=178

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 79/138 (57%), Gaps = 28/138 (20%)
 Frame = +1

Query  229  PR-RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlra  405
            PR RR  GNREAVRKYREKKKAH A+LEEEV++LRA N+Q+ ++++    LEAEV RLR 
Sbjct  18   PRPRRPLGNREAVRKYREKKKAHAAFLEEEVKQLRAANQQLQRRLQGHATLEAEVARLRG  77

Query  406  lllklrDKIDSESGAGHSGFPFQKHC--------DPATPFEQGD------CAVQSSG---  534
            LL  +R KID+E+      FPFQK C        DP   F  G+      C   SSG   
Sbjct  78   LLFDVRAKIDAEAA---GAFPFQKQCSVGSVACADPTLCFNNGNSEVGGACWEDSSGPAA  134

Query  535  -------KGPGNAVALRE  567
                    G GN  A RE
Sbjct  135  ADYRFDEDGNGNGGASRE  152



>ref|XP_009112403.1| PREDICTED: uncharacterized protein LOC103837781 isoform X2 [Brassica 
rapa]
Length=239

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 77/119 (65%), Gaps = 19/119 (16%)
 Frame = +1

Query  166  NAQTYT--HTHTHIYPNSQSDGE-------------PRRRASGNREAVRKYREKKKAHTA  300
            N  T+T  H HT I P +QSD +              ++R SGNREAVRKYREKKKA  A
Sbjct  43   NTHTHTCLHVHTKILPAAQSDDKETTDDTSESSGKRSKKRPSGNREAVRKYREKKKAKAA  102

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             LE+EV +LRAVN Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E GA    FP+QK
Sbjct  103  SLEDEVLRLRAVNNQLMKRLQGQAALEAEVTRLKCLLVDIRGRIEGEIGA----FPYQK  157



>ref|XP_010467405.1| PREDICTED: uncharacterized protein LOC104747472 [Camelina sativa]
 ref|XP_010467406.1| PREDICTED: uncharacterized protein LOC104747472 [Camelina sativa]
Length=259

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 80/127 (63%), Gaps = 18/127 (14%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYPN-----------SQSDGE-PRRRASGNREAVRKYREKKKAHTA  300
            NN  T+T  H HT I P+           S+S G+  ++R  GNREAVRKYREKKKA  A
Sbjct  51   NNTHTHTCLHVHTKILPSQSEDKVSTDDTSESSGKNSKKRPLGNREAVRKYREKKKAKAA  110

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKH  480
             LE+EV +LRAVN Q++K+++ Q  LEAEV RL+ LL+ +R +ID E G+    FP+QK 
Sbjct  111  SLEDEVTRLRAVNNQLMKRLQGQAALEAEVTRLKCLLVDIRGRIDGEIGS----FPYQKP  166

Query  481  CDPATPF  501
                 PF
Sbjct  167  AVANVPF  173



>emb|CAB41316.1| putative protein [Arabidopsis thaliana]
Length=157

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 84/124 (68%), Gaps = 11/124 (9%)
 Frame = +1

Query  163  NNAQTYTHTHTHIY------PNSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRK  324
            +++ T  H HTH+        N  SD   ++R  GNREAVRKYREKKKA TAYLE+EV +
Sbjct  31   SHSHTCFHAHTHLIISQDQQENDHSDSSNKKRLCGNREAVRKYREKKKARTAYLEDEVMR  90

Query  325  LRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCD-PATPF  501
            L+++NEQ ++K++ Q ++E E++RLRALL++++ KI+ E  +    F FQK C+     F
Sbjct  91   LQSLNEQFLRKLQSQEMVETELIRLRALLVEMQGKIEVELCS----FSFQKQCNGSGFVF  146

Query  502  EQGD  513
            ++GD
Sbjct  147  KEGD  150



>gb|ACN36681.1| unknown [Zea mays]
 gb|AIB05224.1| bZIP transcription factor, partial [Zea mays]
Length=229

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 76/125 (61%), Gaps = 18/125 (14%)
 Frame = +1

Query  172  QTYTHTHTHIY-------PNSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLR  330
            +T  H HT +         +++ D    RR  GNREAVRKYREKKKAH A+LEEEV+KLR
Sbjct  51   RTCLHAHTLVLGSGGEDDDDAREDSAKPRRPLGNREAVRKYREKKKAHAAFLEEEVKKLR  110

Query  331  AVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHC--------D  486
            A N+Q+ ++++    LEAEV RLR LLL +R KID+E G      PFQK C        D
Sbjct  111  AANQQLQRRLQGHAALEAEVARLRGLLLDIRGKIDAEVGG---VLPFQKPCSVGSVACAD  167

Query  487  PATPF  501
            PA  F
Sbjct  168  PALCF  172



>ref|XP_008786882.1| PREDICTED: uncharacterized protein LOC103705064 [Phoenix dactylifera]
Length=213

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 74/101 (73%), Gaps = 6/101 (6%)
 Frame = +1

Query  196  HIYPNSQSDGEPRR--RASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQ  369
             ++P +  + E ++  +  GNREAVRKYR+KKKAH AYLEEEV+KLR VN+Q++++++ Q
Sbjct  60   RMFPTAGGEEEQKKSQKPLGNREAVRKYRQKKKAHAAYLEEEVKKLRLVNQQLLRRLQGQ  119

Query  370  VVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPA  492
              LEAEV+RLR+LL+ LR KID+E G      PFQK C  A
Sbjct  120  AALEAEVVRLRSLLVDLRAKIDAELGTS----PFQKQCSGA  156



>ref|XP_002884017.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60276.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 88/153 (58%), Gaps = 31/153 (20%)
 Frame = +1

Query  124  SLSVGSVLDGMLRNN-AQTYTHT-----------------HTHIYP---------NSQSD  222
            S S+ S  D +LR++ A T+THT                 HT I P         +  S+
Sbjct  21   SCSMDSFFDELLRDSHACTHTHTCNPPGPENTHTHTCLHVHTKILPSQSEDKVSTDDTSE  80

Query  223  GEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlr  402
               ++R  GNREAVRKYREKKKA  A LE+EV +L+AVN Q++K+++ Q VLEAEV RL+
Sbjct  81   SSGKKRPLGNREAVRKYREKKKAKAASLEDEVMRLKAVNNQLLKRLQGQAVLEAEVTRLK  140

Query  403  alllklrDKIDSESGAGHSGFPFQKHCDPATPF  501
             LL+ +R +ID E GA    FP+QK      P+
Sbjct  141  CLLVDIRGRIDGEIGA----FPYQKPAVTNVPY  169



>ref|NP_001142351.1| putative bZIP transcription factor superfamily protein isoform 
1 [Zea mays]
 gb|ACF88261.1| unknown [Zea mays]
 gb|ACN25229.1| unknown [Zea mays]
 gb|ACR38309.1| unknown [Zea mays]
 gb|AFW78521.1| putative bZIP transcription factor superfamily protein isoform 
1 [Zea mays]
 gb|AFW78522.1| putative bZIP transcription factor superfamily protein isoform 
2 [Zea mays]
 gb|AFW78523.1| putative bZIP transcription factor superfamily protein isoform 
3 [Zea mays]
 gb|AFW78524.1| putative bZIP transcription factor superfamily protein isoform 
4 [Zea mays]
Length=229

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 75/124 (60%), Gaps = 18/124 (15%)
 Frame = +1

Query  175  TYTHTHTHIY-------PNSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRA  333
            T  H HT +         +++ D    RR  GNREAVRKYREKKKAH A+LEEEV+KLRA
Sbjct  52   TCLHAHTLVLGSGGEDDDDAREDSAKPRRPLGNREAVRKYREKKKAHAAFLEEEVKKLRA  111

Query  334  VNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHC--------DP  489
             N+Q+ ++++    LEAEV RLR LLL +R KID+E G      PFQK C        DP
Sbjct  112  ANQQLQRRLQGHAALEAEVARLRGLLLDIRGKIDAEVGG---VLPFQKPCSVGSVACADP  168

Query  490  ATPF  501
            A  F
Sbjct  169  ALCF  172



>ref|XP_006284366.1| hypothetical protein CARUB_v10005538mg [Capsella rubella]
 gb|EOA17264.1| hypothetical protein CARUB_v10005538mg [Capsella rubella]
Length=258

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 91/163 (56%), Gaps = 35/163 (21%)
 Frame = +1

Query  130  SVGSVLDGML--RNNAQTYTHT-----------------HTHIYPN-----------SQS  219
            S+ S  DG+L   N A T+THT                 HT I P+           ++S
Sbjct  28   SMDSFFDGLLMDTNAACTHTHTCNPTGPENTHTHTCFHVHTKILPDDSDEKVSTDDTAES  87

Query  220  DGEP-RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMr  396
             G+   +R  GNREAVRKYREKKKA  A LE+EV +LRAVN+Q+VK+++ Q  LEAEV R
Sbjct  88   CGKKGEKRPLGNREAVRKYREKKKAKAASLEDEVSRLRAVNQQLVKRLQNQATLEAEVSR  147

Query  397  lralllklrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCAVQ  525
            L+ LL+ LR +ID E G+    FP+QK   P+       C VQ
Sbjct  148  LKCLLVDLRGRIDGEIGS----FPYQKPNIPSFSHMMNPCNVQ  186



>emb|CDY26786.1| BnaC09g09130D [Brassica napus]
Length=239

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 77/119 (65%), Gaps = 19/119 (16%)
 Frame = +1

Query  166  NAQTYT--HTHTHIYPNSQSDGE-------------PRRRASGNREAVRKYREKKKAHTA  300
            N  T+T  H HT I P +QSD +              ++R SGNREAVRKYREKKKA  A
Sbjct  42   NTHTHTCLHVHTKILPAAQSDDKETTDDTSESSGKKSKKRPSGNREAVRKYREKKKAKAA  101

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             LE+EV +LRAVN Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E GA    FP+QK
Sbjct  102  SLEDEVVRLRAVNNQLMKRLQGQAALEAEVTRLKCLLVDIRGRIEGEIGA----FPYQK  156



>emb|CDP14558.1| unnamed protein product [Coffea canephora]
Length=273

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 99/173 (57%), Gaps = 39/173 (23%)
 Frame = +1

Query  49   EMEVSDHFLVLnssdsssnnVKVQPSLSVGSVLDGMLRN----------------NAQTY  180
            E+E S+H +      S+S+   +  S S+GS LD +L++                N+ T+
Sbjct  5    ELEFSNHEMF-----SNSSFGDLPSSCSMGSFLDEILKDTHACTHTHTCNPPGPDNSHTH  59

Query  181  T--HTHTHIYPNSQSDGEP------------RRRASGNREAVRKYREKKKAHTAYLEEEV  318
            T  H HT I P    D  P            ++R  GNREAVRKYREKKKA  A LE+EV
Sbjct  60   TCYHVHTKIVPAPSEDKTPTDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDEV  119

Query  319  RKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             +LRA+N+Q++K+++ Q VLEAE+ RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  120  VRLRALNQQLMKRLQGQAVLEAEIARLKCLLVDIRGRIEGEIGS----FPYQK  168



>ref|XP_006656494.1| PREDICTED: uncharacterized protein LOC102721653 [Oryza brachyantha]
Length=269

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 77/124 (62%), Gaps = 16/124 (13%)
 Frame = +1

Query  175  TYTHTHTHIY---------PNSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKL  327
            T  H HT I          P +  +   ++R SGNR AVRKYREKKKAHTA LEEEV  L
Sbjct  65   TCVHVHTKIVSAPSDDADSPTTADNNASKKRPSGNRAAVRKYREKKKAHTASLEEEVVHL  124

Query  328  RAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQ---KHCDPATP  498
            RA+N+Q++KK++    LEAEV RLR LL+ +R +I+ E GA    FP+Q   K+ D  + 
Sbjct  125  RALNQQLMKKLQNHAALEAEVSRLRCLLVDIRGRIEGEIGA----FPYQRPAKNIDLVSS  180

Query  499  FEQG  510
             +QG
Sbjct  181  VDQG  184



>ref|NP_850680.1| basic leucine zipper 24 [Arabidopsis thaliana]
 dbj|BAC42285.1| putative bZip transcription factor Atbzip24 [Arabidopsis thaliana]
 gb|AAO63842.1| putative bZIP family transcription factor [Arabidopsis thaliana]
 gb|AEE78869.1| basic leucine zipper 24 [Arabidopsis thaliana]
Length=227

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 86/130 (66%), Gaps = 10/130 (8%)
 Frame = +1

Query  163  NNAQTYTHTHTHIY-----PNSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKL  327
            +++ T  H HTH+       N  SD   ++R  GNREAVRKYREKKKA TAYLE+EV +L
Sbjct  70   SHSHTCFHAHTHLIISDQQENDHSDSSNKKRLCGNREAVRKYREKKKARTAYLEDEVMRL  129

Query  328  RAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCD-PATPFE  504
            +++NEQ ++K++ Q ++E E++RLRALL++++ KI+ E  +    F FQK C+     F+
Sbjct  130  QSLNEQFLRKLQSQEMVETELIRLRALLVEMQGKIEVELCS----FSFQKQCNGSGFVFK  185

Query  505  QGDCAVQSSG  534
            +  C + +S 
Sbjct  186  EDGCNLATSN  195



>emb|CDY47478.1| BnaA09g08870D [Brassica napus]
Length=241

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 76/119 (64%), Gaps = 19/119 (16%)
 Frame = +1

Query  166  NAQTYT--HTHTHIYPNSQSDGE-------------PRRRASGNREAVRKYREKKKAHTA  300
            N  T+T  H HT I P  QSD +              ++R SGNREAVRKYREKKKA  A
Sbjct  42   NTHTHTCLHVHTKILPAPQSDDKETTDDTSESSGKKSKKRPSGNREAVRKYREKKKAKAA  101

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             LE+EV +LRAVN Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E GA    FP+QK
Sbjct  102  SLEDEVLRLRAVNNQLMKRLQGQAALEAEVTRLKCLLVDIRGRIEGEIGA----FPYQK  156



>ref|XP_002973971.1| hypothetical protein SELMODRAFT_414462 [Selaginella moellendorffii]
 gb|EFJ24926.1| hypothetical protein SELMODRAFT_414462 [Selaginella moellendorffii]
Length=285

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 66/84 (79%), Gaps = 4/84 (5%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            ++R  GNREAVRKYREKKKAH AYLEE+V +L+A+N+Q+VK+++ Q  LEAEV RLRALL
Sbjct  120  KKRPLGNREAVRKYREKKKAHAAYLEEQVAQLKALNQQLVKRLQGQAALEAEVARLRALL  179

Query  412  lklrDKIDSESGAGHSGFPFQKHC  483
             + R +ID+E G     FPF++ C
Sbjct  180  SEFRGRIDAELGC----FPFKRPC  199



>ref|XP_002969093.1| hypothetical protein SELMODRAFT_409920 [Selaginella moellendorffii]
 gb|EFJ30209.1| hypothetical protein SELMODRAFT_409920 [Selaginella moellendorffii]
Length=282

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 66/84 (79%), Gaps = 4/84 (5%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            ++R  GNREAVRKYREKKKAH AYLEE+V +L+A+N+Q+VK+++ Q  LEAEV RLRALL
Sbjct  117  KKRPLGNREAVRKYREKKKAHAAYLEEQVAQLKALNQQLVKRLQGQAALEAEVARLRALL  176

Query  412  lklrDKIDSESGAGHSGFPFQKHC  483
             + R +ID+E G     FPF++ C
Sbjct  177  SEFRGRIDAELGC----FPFKRPC  196



>ref|XP_004231042.1| PREDICTED: uncharacterized protein LOC101266077 [Solanum lycopersicum]
Length=270

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 78/119 (66%), Gaps = 18/119 (15%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYPNSQSDGEP------------RRRASGNREAVRKYREKKKAHTA  300
            +N+ T+T  H HT I P +  D  P            ++R  GN+EAVRKYREKKKA  A
Sbjct  52   DNSHTHTCYHVHTKIVPTTDDDKNPSDDTAESAENKGKKRPVGNKEAVRKYREKKKARAA  111

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             LE+EV +LRA+N+Q++K+++ Q VLEAEV RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  112  SLEDEVVRLRAINQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIEGEIGS----FPYQK  166



>ref|XP_006664845.1| PREDICTED: uncharacterized protein LOC102716091 [Oryza brachyantha]
 emb|CBX25258.1| hypothetical_protein [Oryza brachyantha]
Length=185

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 69/91 (76%), Gaps = 7/91 (8%)
 Frame = +1

Query  220  DGEPRRRAS---GNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEV  390
            D   R++AS   GNREAVRKYR+KKKAHTA LEEEV+KLRA+N+Q+VK+++ Q  LEAEV
Sbjct  72   DKTKRKKASKPLGNREAVRKYRQKKKAHTAQLEEEVKKLRAINQQLVKRLQGQDALEAEV  131

Query  391  MrlralllklrDKIDSESGAGHSGFPFQKHC  483
            + LR+LL+ +R KI+   G+    +PFQ  C
Sbjct  132  VWLRSLLVDVRAKINGALGS----YPFQAQC  158



>ref|XP_006359698.1| PREDICTED: uncharacterized protein LOC102599645 [Solanum tuberosum]
Length=272

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 78/119 (66%), Gaps = 18/119 (15%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYPNSQSDGEP------------RRRASGNREAVRKYREKKKAHTA  300
            +N+ T+T  H HT I P +  D  P            ++R  GN+EAVRKYREKKKA  A
Sbjct  52   DNSHTHTCYHVHTKIVPTTDDDKNPSDDTAESADNKGKKRPVGNKEAVRKYREKKKARAA  111

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             LE+EV +LRA+N+Q++K+++ Q VLEAEV RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  112  SLEDEVIRLRAINQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIEGEIGS----FPYQK  166



>ref|XP_008231529.1| PREDICTED: uncharacterized protein LOC103330700 isoform X2 [Prunus 
mume]
Length=153

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 4/76 (5%)
 Frame = +1

Query  256  EAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKID  435
            EAVRKYREKKKAHTAYLEEEV+KLR +N+Q+V+K++ Q +LE E +RLR++ L LR KID
Sbjct  82   EAVRKYREKKKAHTAYLEEEVKKLRLLNQQLVRKIQGQAILETEFLRLRSVFLDLRGKID  141

Query  436  SESGAGHSGFPFQKHC  483
             E GA    FPFQ  C
Sbjct  142  HELGA----FPFQNQC  153



>ref|XP_007219551.1| hypothetical protein PRUPE_ppa019868mg [Prunus persica]
 gb|EMJ20750.1| hypothetical protein PRUPE_ppa019868mg [Prunus persica]
Length=217

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 66/101 (65%), Gaps = 9/101 (9%)
 Frame = +1

Query  256  EAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKID  435
            EAVRKYREKKKAHTAYLEEEV+KLR +N+Q+V+K++ Q +LE E +RL+++ L LR KID
Sbjct  82   EAVRKYREKKKAHTAYLEEEVKKLRLLNQQLVRKIQGQAILETEFLRLKSVFLDLRGKID  141

Query  436  SESGAGHSGFPFQKH-----CDPATPFEQGDCAVQSSGKGP  543
             E GA    FPFQ       C P  P  Q   +  +    P
Sbjct  142  HELGA----FPFQNQYLPCFCSPVGPSMQASISTSAKAMVP  178



>emb|CDM84592.1| unnamed protein product [Triticum aestivum]
Length=213

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 81/138 (59%), Gaps = 19/138 (14%)
 Frame = +1

Query  166  NAQTYTHTHTHIYPNSQSDGE-----PRRRASGNREAVRKYREKKKAHTAYLEEEVRKLR  330
            +A T  H HT +  + +   E       R+  GNREAVRKYR+KKKAH A+LEEEV+KLR
Sbjct  46   HAHTCLHAHTQVIASGEDHAEHDQLRNLRKPLGNREAVRKYRQKKKAHAAFLEEEVKKLR  105

Query  331  AVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHC---------  483
            A N+Q++++++    LEAEV RL  LLL +R KID+   A   G PF++ C         
Sbjct  106  AANQQLLRRLQGHAALEAEVARLTGLLLDVRGKIDA---AEIGGLPFEERCSFGSVVSTA  162

Query  484  -DPATP-FEQGDCAVQSS  531
             +P  P F+ G   V ++
Sbjct  163  AEPTAPCFDSGSAEVPAA  180



>ref|NP_190764.2| basic leucine zipper 24 [Arabidopsis thaliana]
 gb|AEE78868.1| basic leucine zipper 24 [Arabidopsis thaliana]
Length=228

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 86/131 (66%), Gaps = 11/131 (8%)
 Frame = +1

Query  163  NNAQTYTHTHTHIY------PNSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRK  324
            +++ T  H HTH+        N  SD   ++R  GNREAVRKYREKKKA TAYLE+EV +
Sbjct  70   SHSHTCFHAHTHLIISQDQQENDHSDSSNKKRLCGNREAVRKYREKKKARTAYLEDEVMR  129

Query  325  LRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCD-PATPF  501
            L+++NEQ ++K++ Q ++E E++RLRALL++++ KI+ E  +    F FQK C+     F
Sbjct  130  LQSLNEQFLRKLQSQEMVETELIRLRALLVEMQGKIEVELCS----FSFQKQCNGSGFVF  185

Query  502  EQGDCAVQSSG  534
            ++  C + +S 
Sbjct  186  KEDGCNLATSN  196



>ref|XP_008647614.1| PREDICTED: putative bZIP transcription factor superfamily protein 
isoform 1 isoform X1 [Zea mays]
Length=332

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 76/127 (60%), Gaps = 18/127 (14%)
 Frame = +1

Query  166  NAQTYTHTHTHIY-------PNSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRK  324
            +  T  H HT +         +++ D    RR  GNREAVRKYREKKKAH A+LEEEV+K
Sbjct  152  HTHTCLHAHTLVLGSGGEDDDDAREDSAKPRRPLGNREAVRKYREKKKAHAAFLEEEVKK  211

Query  325  LRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHC-------  483
            LRA N+Q+ ++++    LEAEV RLR LLL +R KID+E G      PFQK C       
Sbjct  212  LRAANQQLQRRLQGHAALEAEVARLRGLLLDIRGKIDAEVGG---VLPFQKPCSVGSVAC  268

Query  484  -DPATPF  501
             DPA  F
Sbjct  269  ADPALCF  275



>ref|XP_006663805.1| PREDICTED: uncharacterized protein LOC102722911 [Oryza brachyantha]
 emb|CBX25355.1| hypothetical_protein [Oryza brachyantha]
Length=185

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 69/87 (79%), Gaps = 7/87 (8%)
 Frame = +1

Query  232  RRRAS---GNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlr  402
            R++AS   GNREAVRKYR+KKKAHTA LEEEV+KLRA+N+Q+VK+++ Q  LEAEV+RLR
Sbjct  76   RKKASKPLGNREAVRKYRQKKKAHTAQLEEEVKKLRAINQQLVKRLQGQDALEAEVVRLR  135

Query  403  alllklrDKIDSESGAGHSGFPFQKHC  483
            +LL+ +R KI+   G+    +PFQ  C
Sbjct  136  SLLVDVRAKINGALGS----YPFQAQC  158



>gb|ACI90291.1| putative bZIP transcription factor [Picrorhiza kurrooa]
Length=289

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 77/121 (64%), Gaps = 16/121 (13%)
 Frame = +1

Query  151  GMLRNNAQTYTHTHTHIYPNSQSDGEP------------RRRASGNREAVRKYREKKKAH  294
            G  +++  T  H HT I P S    EP            ++R SGNREAVRKYREKKKA 
Sbjct  70   GPDKSHTHTCIHVHTQIMPTSSDGHEPSDDTAESVEKKGKKRTSGNREAVRKYREKKKAR  129

Query  295  TAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQ  474
             A LE+EV +LRA+N+ ++K+++ Q +LEAE+ RL+ LL+ +R +I+ E G+    FP+Q
Sbjct  130  AASLEDEVIRLRALNQHLMKRLQGQALLEAEIARLKCLLVDIRGRIEGEIGS----FPYQ  185

Query  475  K  477
            K
Sbjct  186  K  186



>gb|EMS45140.1| hypothetical protein TRIUR3_21208 [Triticum urartu]
Length=214

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 72/111 (65%), Gaps = 8/111 (7%)
 Frame = +1

Query  166  NAQTYTHTHTHIYPNSQSDGE-----PRRRASGNREAVRKYREKKKAHTAYLEEEVRKLR  330
            ++ T  H HT +  + +   E       R+  GNREAVRKYR+KKKAH A+LEEEV+KLR
Sbjct  47   HSHTCLHAHTQVIASGEDHAEHDQLRNLRKPLGNREAVRKYRQKKKAHAAFLEEEVKKLR  106

Query  331  AVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHC  483
            A N+Q++++++    LEAEV RL  LLL +R KID   GA   G PFQ+ C
Sbjct  107  AANQQLLRRLQGHAALEAEVARLTGLLLDVRGKID---GAEIGGRPFQERC  154



>ref|XP_010447005.1| PREDICTED: uncharacterized protein LOC104729711 [Camelina sativa]
Length=261

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 82/134 (61%), Gaps = 18/134 (13%)
 Frame = +1

Query  166  NAQTYT--HTHTHIYPN-----------SQSDGEP-RRRASGNREAVRKYREKKKAHTAY  303
            N  T+T  H HT I P+           ++S G+   +R  GNREAVRKYREKKKA  A 
Sbjct  60   NTHTHTCFHVHTKILPDESDEKVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAAS  119

Query  304  LEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHC  483
            LE+EV +LRAVN+Q+VK+++ Q  LEAEV RL+ LL+ LR +ID E G+    FP+QK  
Sbjct  120  LEDEVARLRAVNQQLVKRLQNQATLEAEVSRLKCLLVDLRGRIDGEIGS----FPYQKPN  175

Query  484  DPATPFEQGDCAVQ  525
             P+       C VQ
Sbjct  176  IPSFSHMMNPCNVQ  189



>ref|XP_002869111.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45370.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=261

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 87/149 (58%), Gaps = 35/149 (23%)
 Frame = +1

Query  124  SLSVGSVLDGML--RNNAQTYTHT-----------------HTHIYPN-----------S  213
            + S+ S  DG+L   N A T+THT                 HT I P+           +
Sbjct  26   NCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHTHTCFHVHTKILPDESDEKVSTDDTA  85

Query  214  QSDGEP-RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEV  390
            +S G+   +R  GNREAVRKYREKKKA  A LE+EV +LRAVN+Q+VK+++ Q  LEAEV
Sbjct  86   ESCGKKGEKRPLGNREAVRKYREKKKAKAASLEDEVARLRAVNQQLVKRLQNQATLEAEV  145

Query  391  MrlralllklrDKIDSESGAGHSGFPFQK  477
             RL+ LL+ LR +ID E G+    FP+QK
Sbjct  146  SRLKCLLVDLRGRIDGEIGS----FPYQK  170



>ref|XP_010920114.1| PREDICTED: uncharacterized protein LOC105044037 [Elaeis guineensis]
 ref|XP_010920115.1| PREDICTED: uncharacterized protein LOC105044037 [Elaeis guineensis]
 ref|XP_010920117.1| PREDICTED: uncharacterized protein LOC105044037 [Elaeis guineensis]
Length=262

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 75/112 (67%), Gaps = 11/112 (10%)
 Frame = +1

Query  163  NNAQTYTHTHTHIYP-------NSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVR  321
            +++ T  H HT I          S     P++R  GNREAVRKYREKKKAHTA L +E+ 
Sbjct  55   SHSHTCFHAHTKILSAPAMETFESAEKSLPKKRPIGNREAVRKYREKKKAHTASLADELL  114

Query  322  KLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            +LRA+N+Q++K+++RQV LEAEV RLR LL+ +R +I+ E GA    FP+ +
Sbjct  115  QLRALNQQLMKRLQRQVALEAEVARLRCLLVDIRGRIEGEIGA----FPYNR  162



>emb|CAA17769.1| putative protein [Arabidopsis thaliana]
 emb|CAB80221.1| putative protein [Arabidopsis thaliana]
Length=278

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 86/147 (59%), Gaps = 35/147 (24%)
 Frame = +1

Query  130  SVGSVLDGML--RNNAQTYTHT-----------------HTHIYPN-----------SQS  219
            S+ S  DG+L   N A T+THT                 HT I P+           ++S
Sbjct  28   SMDSFFDGLLMDTNAACTHTHTCNPTGPENTHTHTCFHVHTKILPDESDEKVSTDDTAES  87

Query  220  DGEP-RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMr  396
             G+   +R  GNREAVRKYREKKKA  A LE+EV +LRAVN+Q+VK+++ Q  LEAEV R
Sbjct  88   CGKKGEKRPLGNREAVRKYREKKKAKAASLEDEVARLRAVNQQLVKRLQNQATLEAEVSR  147

Query  397  lralllklrDKIDSESGAGHSGFPFQK  477
            L+ LL+ LR +ID E G+    FP+QK
Sbjct  148  LKCLLVDLRGRIDGEIGS----FPYQK  170



>ref|XP_004970277.1| PREDICTED: uncharacterized protein LOC101760983 isoform X1 [Setaria 
italica]
 ref|XP_004970278.1| PREDICTED: uncharacterized protein LOC101760983 isoform X2 [Setaria 
italica]
Length=213

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 68/91 (75%), Gaps = 7/91 (8%)
 Frame = +1

Query  217  SDGEPRRRAS---GNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAE  387
            + GE +R+     GNREAVRKYREKKKAH A+LEEEV+KLRA N+Q++++++    LEAE
Sbjct  63   ASGEEQRKPQKPLGNREAVRKYREKKKAHAAFLEEEVKKLRATNQQLLRRLQGHAALEAE  122

Query  388  VMrlralllklrDKIDSESGAGHSGFPFQKH  480
            V+RLR LL  +R KID+E  +    FPFQKH
Sbjct  123  VVRLRVLLFDVRGKIDAEIDS----FPFQKH  149



>ref|NP_567974.1| transcription factor bZIP19 [Arabidopsis thaliana]
 gb|AAL62378.1| putative protein [Arabidopsis thaliana]
 gb|AAN15479.1| putative protein [Arabidopsis thaliana]
 gb|AEE86454.1| transcription factor bZIP19 [Arabidopsis thaliana]
Length=261

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 86/147 (59%), Gaps = 35/147 (24%)
 Frame = +1

Query  130  SVGSVLDGML--RNNAQTYTHT-----------------HTHIYPN-----------SQS  219
            S+ S  DG+L   N A T+THT                 HT I P+           ++S
Sbjct  28   SMDSFFDGLLMDTNAACTHTHTCNPTGPENTHTHTCFHVHTKILPDESDEKVSTDDTAES  87

Query  220  DGEP-RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMr  396
             G+   +R  GNREAVRKYREKKKA  A LE+EV +LRAVN+Q+VK+++ Q  LEAEV R
Sbjct  88   CGKKGEKRPLGNREAVRKYREKKKAKAASLEDEVARLRAVNQQLVKRLQNQATLEAEVSR  147

Query  397  lralllklrDKIDSESGAGHSGFPFQK  477
            L+ LL+ LR +ID E G+    FP+QK
Sbjct  148  LKCLLVDLRGRIDGEIGS----FPYQK  170



>ref|XP_011088608.1| PREDICTED: uncharacterized protein LOC105169791 [Sesamum indicum]
 ref|XP_011088609.1| PREDICTED: uncharacterized protein LOC105169791 [Sesamum indicum]
Length=287

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 80/130 (62%), Gaps = 22/130 (17%)
 Frame = +1

Query  160  RNNAQTYTHTHTHIYPNSQSDGEP------------RRRASGNREAVRKYREKKKAHTAY  303
            +++  T  H HT I P+      P            ++R  GNREAVRKYREKKKA TA 
Sbjct  73   KSHTHTCIHVHTQIMPSPSEPQAPSDDTAESVEKKGKKRPLGNREAVRKYREKKKARTAS  132

Query  304  LEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHC  483
            LE+EV +LRA+N+Q++K+++ Q +LEAE+ RL+ LL+ +R +I+ E GA    FP+QK  
Sbjct  133  LEDEVIRLRALNQQLMKRLQGQALLEAEIARLKCLLVDIRGRIEGEIGA----FPYQK--  186

Query  484  DPATPFEQGD  513
                P + GD
Sbjct  187  ----PTKSGD  192



>emb|CDX89748.1| BnaC03g46620D [Brassica napus]
Length=248

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 78/126 (62%), Gaps = 18/126 (14%)
 Frame = +1

Query  166  NAQTYT--HTHTHIYP-----------NSQSDG-EPRRRASGNREAVRKYREKKKAHTAY  303
            N  T+T  H HT I P            S+S G + ++R  GNREAVRKYREKKKA  A 
Sbjct  42   NTHTHTCLHVHTKILPAQAEDKEATDDTSESSGNKSKKRPLGNREAVRKYREKKKAKAAS  101

Query  304  LEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHC  483
            LE+EV +LRAVN Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E GA    FP+QK  
Sbjct  102  LEDEVMRLRAVNSQLMKRLQGQAALEAEVTRLKCLLVDIRGRIEGEIGA----FPYQKPV  157

Query  484  DPATPF  501
             P   F
Sbjct  158  APNAHF  163



>ref|XP_003577077.2| PREDICTED: uncharacterized protein LOC100844010 [Brachypodium 
distachyon]
Length=234

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 64/83 (77%), Gaps = 4/83 (5%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            R   GNR AVRKYR+KKKAHTA+LEEEVR+LRA+N+Q+VK+++ Q  L+AEV+RLR LL+
Sbjct  82   REPLGNRVAVRKYRQKKKAHTAHLEEEVRRLRAINQQLVKRLQGQAALKAEVVRLRTLLV  141

Query  415  klrDKIDSESGAGHSGFPFQKHC  483
             +R KID   G+    +PFQ  C
Sbjct  142  DVRAKIDGALGS----YPFQTQC  160



>gb|EMS54685.1| hypothetical protein TRIUR3_17772 [Triticum urartu]
Length=337

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 83/147 (56%), Gaps = 21/147 (14%)
 Frame = +1

Query  157  LRNNAQTYTHTHTHIY-----------PNSQSDGEPRRRASGNREAVRKYREKKKAHTAY  303
            L ++ QT  H HT I             + Q +  P++R  GNR AVRKYREKKKAHT  
Sbjct  152  LAHHTQTCVHVHTKILREESDDVAQTSESPQENNGPKKRPPGNRAAVRKYREKKKAHTTL  211

Query  304  LEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHC  483
            LEEEV +L+A+N+Q+V +++    LEAE  RLR LL+ +R +ID E GA    FP+++  
Sbjct  212  LEEEVARLKALNKQLVGRLQSHSALEAEASRLRCLLVDIRGRIDGELGA----FPYKR--  265

Query  484  DPATPFEQGDCAVQSSGKGPGNAVALR  564
                P +  D A Q S  G    V LR
Sbjct  266  ----PVKNKDLADQGSSLGGARQVRLR  288



>ref|XP_009391011.1| PREDICTED: uncharacterized protein LOC103977271 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391012.1| PREDICTED: uncharacterized protein LOC103977271 [Musa acuminata 
subsp. malaccensis]
Length=275

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 86/144 (60%), Gaps = 32/144 (22%)
 Frame = +1

Query  130  SVGSVLDGMLRNNAQ-TYTHTHTHIYPN------------------------SQSDGEP-  231
            S+ SV D +  ++ Q T THTHT   P                         ++S G+  
Sbjct  27   SMDSVFDNIFNDSQQHTCTHTHTCNPPGPDLSHTHTCFHVHTKILSAPADETAESAGKSS  86

Query  232  --RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlra  405
              ++R+ GNREAVRKYREKKKAH A LEEEV +LRA+N+Q++K+++ Q  LEAEV RLR 
Sbjct  87   PTKKRSCGNREAVRKYREKKKAHAASLEEEVAQLRAINQQLMKRLQSQAALEAEVARLRC  146

Query  406  lllklrDKIDSESGAGHSGFPFQK  477
            LL+ LR +I+ E G+    FP+Q+
Sbjct  147  LLVDLRGRIEGEIGS----FPYQR  166



>ref|XP_002305521.2| bZIP transcription factor family protein [Populus trichocarpa]
 gb|EEE86032.2| bZIP transcription factor family protein [Populus trichocarpa]
Length=265

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 76/112 (68%), Gaps = 15/112 (13%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQ-----------SDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVR  321
            T  H HT I P ++           +D + ++R+SGNREAVRKYRE+KKA  A LE+EV+
Sbjct  59   TCYHVHTKILPPAEDKVVSDDTAESTDKKSKKRSSGNREAVRKYRERKKAKAASLEDEVK  118

Query  322  KLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             LRA+N+Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  119  HLRALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGS----FPYQK  166



>ref|XP_006384577.1| hypothetical protein POPTR_0004s18120g [Populus trichocarpa]
 gb|ERP62374.1| hypothetical protein POPTR_0004s18120g [Populus trichocarpa]
Length=266

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 76/112 (68%), Gaps = 15/112 (13%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQ-----------SDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVR  321
            T  H HT I P ++           +D + ++R+SGNREAVRKYRE+KKA  A LE+EV+
Sbjct  59   TCYHVHTKILPPAEDKVVSDDTAESTDKKSKKRSSGNREAVRKYRERKKAKAASLEDEVK  118

Query  322  KLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             LRA+N+Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  119  HLRALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGS----FPYQK  166



>ref|XP_003563276.1| PREDICTED: uncharacterized protein LOC100823660 [Brachypodium 
distachyon]
Length=269

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 71/112 (63%), Gaps = 15/112 (13%)
 Frame = +1

Query  175  TYTHTHTHIYP-----------NSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVR  321
            T  H HT I             N+ S    +RR SGNR AVRKYREKKKAHTA LEEEV 
Sbjct  65   TCVHVHTKIVSASSDGAESPAENTTSGTSKKRRPSGNRAAVRKYREKKKAHTALLEEEVV  124

Query  322  KLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             L+A+N++++KKV+    LEAEV RLR LL+ +R +I+ E GA    FP+Q+
Sbjct  125  HLKALNKELMKKVQNHAALEAEVARLRCLLVDIRGRIEGEIGA----FPYQR  172



>gb|AAM63358.1| putative transcription factor [Arabidopsis thaliana]
Length=261

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 86/147 (59%), Gaps = 35/147 (24%)
 Frame = +1

Query  130  SVGSVLDGML--RNNAQTYTHT-----------------HTHIYPN-----------SQS  219
            S+ S  DG+L   N A T+THT                 HT I P+           ++S
Sbjct  28   SMDSFFDGLLMDTNAACTHTHTCNPTGPENTHTHTCFHVHTKILPDESDEKVSTDDTAES  87

Query  220  DGEP-RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMr  396
             G+   +R  GNREAVRKYREKKKA  A LE+EV +LRA+N+Q+VK+++ Q  LEAEV R
Sbjct  88   CGKKGEKRPLGNREAVRKYREKKKAKAASLEDEVARLRALNQQLVKRLQNQATLEAEVSR  147

Query  397  lralllklrDKIDSESGAGHSGFPFQK  477
            L+ LL+ LR +ID E G+    FP+QK
Sbjct  148  LKCLLVDLRGRIDGEIGS----FPYQK  170



>ref|XP_010530900.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530901.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530902.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530904.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530905.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530906.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530907.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530908.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530909.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530910.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530911.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530912.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
Length=270

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 89/152 (59%), Gaps = 35/152 (23%)
 Frame = +1

Query  115  VQPS-LSVGSVLDGMLRNN-AQTYTHT-----------------HTHIYPNSQ-------  216
            +QPS  S+ +  D +LR++ A T+THT                 HT I P          
Sbjct  22   IQPSSCSMDTFFDELLRDSHACTHTHTCNPPGPESTHTHTCFHVHTKILPAQSEEKVSTD  81

Query  217  -----SDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLE  381
                 S+ + ++R SGNREAVRKYREKKKA  A LE+EV KLRA N+Q++K+++ Q  LE
Sbjct  82   DTAEFSEKKNKKRPSGNREAVRKYREKKKARAASLEDEVIKLRANNQQLLKRLQGQAALE  141

Query  382  AEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            AEV RL+ LL+ +R +I+ E GA    FP+QK
Sbjct  142  AEVARLKCLLVDIRGRIEGEIGA----FPYQK  169



>ref|XP_010432347.1| PREDICTED: uncharacterized protein LOC104716633 [Camelina sativa]
 ref|XP_010432348.1| PREDICTED: uncharacterized protein LOC104716633 [Camelina sativa]
Length=264

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 87/152 (57%), Gaps = 38/152 (25%)
 Frame = +1

Query  124  SLSVGSVLDGMLR-----NNAQTYTHT-----------------HTHIYPN---------  210
            + S+ S  DG+L      N A T+THT                 HT I P+         
Sbjct  26   NCSMDSFFDGLLMDTTNANAACTHTHTCNPTGPENTHTHTCFHVHTKILPDESDEKVSTD  85

Query  211  --SQSDGEP-RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLE  381
              ++S G+   +R  GNREAVRKYREKKKA  A LE+EV +LRAVN+Q+VK+++ Q  LE
Sbjct  86   DTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLEDEVARLRAVNQQLVKRLQNQATLE  145

Query  382  AEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            AEV RL+ LL+ LR +ID E G+    FP+QK
Sbjct  146  AEVSRLKCLLVDLRGRIDGEIGS----FPYQK  173



>ref|XP_010232460.1| PREDICTED: uncharacterized protein LOC100829391 [Brachypodium 
distachyon]
 ref|XP_003567206.2| PREDICTED: uncharacterized protein LOC100829391 [Brachypodium 
distachyon]
Length=238

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 73/106 (69%), Gaps = 12/106 (11%)
 Frame = +1

Query  184  HTHTHIYPNSQ----SDGEPRR----RASGNREAVRKYREKKKAHTAYLEEEVRKLRAVN  339
            HTHT ++ ++Q    ++ EPR     +  GNREAVRKYREKKKAH A+LEEEVR LRA N
Sbjct  76   HTHTCLHRHTQVLASAEQEPRNPRVIKPLGNREAVRKYREKKKAHAAFLEEEVRSLRAAN  135

Query  340  EQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            +Q++++++    LEAEV+RL +LL  +R KID+E G      P Q+
Sbjct  136  QQLLRRLQGHAALEAEVVRLTSLLFDVRAKIDAEIG----DLPLQQ  177



>ref|XP_010437531.1| PREDICTED: uncharacterized protein LOC104721282 [Camelina sativa]
 ref|XP_010437532.1| PREDICTED: uncharacterized protein LOC104721282 [Camelina sativa]
Length=264

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 87/152 (57%), Gaps = 38/152 (25%)
 Frame = +1

Query  124  SLSVGSVLDGMLR-----NNAQTYTHT-----------------HTHIYPN---------  210
            + S+ S  DG+L      N A T+THT                 HT I P+         
Sbjct  26   NCSMDSFFDGLLMDTTNANAACTHTHTCNPTGPENTHTHTCFHVHTKILPDESDEKVSTD  85

Query  211  --SQSDGEP-RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLE  381
              ++S G+   +R  GNREAVRKYREKKKA  A LE+EV +LRAVN+Q+VK+++ Q  LE
Sbjct  86   DTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLEDEVARLRAVNQQLVKRLQNQATLE  145

Query  382  AEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            AEV RL+ LL+ LR +ID E G+    FP+QK
Sbjct  146  AEVSRLKCLLVDLRGRIDGEIGS----FPYQK  173



>ref|XP_001758867.1| predicted protein [Physcomitrella patens]
 gb|EDQ76373.1| predicted protein [Physcomitrella patens]
Length=171

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 64/81 (79%), Gaps = 4/81 (5%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            ++R  GNREAVRKYREKKKAHTAYLEE+V  LR +N+Q+VK+++ Q  LE+EV+RLR+LL
Sbjct  95   KKRPLGNREAVRKYREKKKAHTAYLEEQVHHLRGLNQQLVKRLQGQASLESEVIRLRSLL  154

Query  412  lklrDKIDSESGAGHSGFPFQ  474
             + R +ID+E G+    FP Q
Sbjct  155  SEFRGRIDAEIGS----FPVQ  171



>ref|XP_004966468.1| PREDICTED: uncharacterized protein LOC101762708 isoform X1 [Setaria 
italica]
 ref|XP_004966469.1| PREDICTED: uncharacterized protein LOC101762708 isoform X2 [Setaria 
italica]
Length=261

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 76/125 (61%), Gaps = 17/125 (14%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQSDGE----------PRRRASGNREAVRKYREKKKAHTAYLEEEVRK  324
            T  H HT I   S    E           ++R SGNR AVRKYREKKKAHTA LEEEV  
Sbjct  63   TCVHVHTKIVAASPDAAETAESPSENNASKKRPSGNRAAVRKYREKKKAHTASLEEEVVH  122

Query  325  LRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQ---KHCDPAT  495
            LRA+N+Q++KK++    LEAEV RLR LL+ +R +I+ E GA    FP+Q   K+ D  +
Sbjct  123  LRALNQQLMKKLQNHAALEAEVARLRCLLVDIRGRIEGEIGA----FPYQRPVKNIDLVS  178

Query  496  PFEQG  510
              +QG
Sbjct  179  SVDQG  183



>ref|XP_010028728.1| PREDICTED: uncharacterized protein LOC104418944 [Eucalyptus grandis]
 gb|KCW55527.1| hypothetical protein EUGRSUZ_I01416 [Eucalyptus grandis]
 gb|KCW55528.1| hypothetical protein EUGRSUZ_I01416 [Eucalyptus grandis]
Length=269

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 16/129 (12%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQSDG------------EPRRRASGNREAVRKYREKKKAHTAYLEEEV  318
            T  H HT I P +  +             + ++R  GNREAVRKYREKKKA  A LE+EV
Sbjct  66   TCFHVHTKIVPATSEEKVSTDDTAESMEKKSKKRPLGNREAVRKYREKKKARAASLEDEV  125

Query  319  RKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATP  498
             +LRAVN+Q++K+++ Q  LEAE+ RL+ LL+ +R +I+ E GA    FP+Q+   P + 
Sbjct  126  NRLRAVNQQLMKRLQNQAALEAEIARLKCLLVDIRGRIEGEIGA----FPYQRTAMPGSA  181

Query  499  FEQGDCAVQ  525
            +    C +Q
Sbjct  182  YVVNPCNMQ  190



>ref|XP_009797256.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797257.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797258.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797259.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797260.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
Length=273

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 24/131 (18%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYPNSQSD------------GEPRRRASGNREAVRKYREKKKAHTA  300
            +N  T+T  H HT I P    D            G+ ++R  GNREAVRKYREKKKA  A
Sbjct  54   DNTHTHTCYHVHTKIVPPLSEDKTASDDTAESAEGKRKKRPLGNREAVRKYREKKKARAA  113

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKH  480
             LE+EV +LRA+N+Q++K+++ Q VLE+E+ RL+ LL+ +R +I+ E G+    FP+QK 
Sbjct  114  SLEDEVVRLRAINQQLMKRLQGQAVLESEIARLKCLLVDIRGRIEGEIGS----FPYQK-  168

Query  481  CDPATPFEQGD  513
                 P + GD
Sbjct  169  -----PMKSGD  174



>gb|EMT18405.1| hypothetical protein F775_16738 [Aegilops tauschii]
Length=195

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 79/136 (58%), Gaps = 19/136 (14%)
 Frame = +1

Query  166  NAQTYTHTHTHIYPNSQSDGE-----PRRRASGNREAVRKYREKKKAHTAYLEEEVRKLR  330
            +A T  H HT +  + +   E       R+  GNREAVRKYR+KKKAH A+LEEEV+KLR
Sbjct  48   HAHTCLHAHTQVIASGEDHAEHDQLRNLRKPLGNREAVRKYRQKKKAHAAFLEEEVKKLR  107

Query  331  AVNEQMVKKVERQVVLEAEVMrlralllklrDKID-SESGAGHSGFPFQKHCD-------  486
            A N+Q++++++    LEAEV RL  LLL +R KID +E GA     P ++ C        
Sbjct  108  AANQQLLRRLQGHAALEAEVARLTGLLLDVRGKIDAAEIGA----LPLEERCSFGSVVQA  163

Query  487  --PATPFEQGDCAVQS  528
               A P E+   A+ S
Sbjct  164  EIGALPLEEAASALSS  179



>ref|XP_009401478.1| PREDICTED: uncharacterized protein LOC103985487 [Musa acuminata 
subsp. malaccensis]
Length=275

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 71/109 (65%), Gaps = 12/109 (11%)
 Frame = +1

Query  175  TYTHTHTHIYPNS--------QSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLR  330
            T  H HT I   +        + +   ++R+ GNREAVRKYREKKKAH A LEEE+ +LR
Sbjct  63   TCLHVHTKILTAAADETAESVEKNSSTKKRSCGNREAVRKYREKKKAHAASLEEEIAQLR  122

Query  331  AVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             +N+Q+VK+++ Q  LEAEV RLR LL+ LR +I+ E G     FP+QK
Sbjct  123  LINQQLVKRLQNQAALEAEVARLRCLLVDLRGRIEGEIGT----FPYQK  167



>ref|XP_009631591.1| PREDICTED: uncharacterized protein LOC104121329 [Nicotiana tomentosiformis]
 ref|XP_009631599.1| PREDICTED: uncharacterized protein LOC104121329 [Nicotiana tomentosiformis]
Length=273

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 80/129 (62%), Gaps = 26/129 (20%)
 Frame = +1

Query  175  TYTHT----HTHIYPNSQSD------------GEPRRRASGNREAVRKYREKKKAHTAYL  306
            T+THT    HT I P    D            G+ ++R  GNREAVRKYREKKKA  A L
Sbjct  56   THTHTCYHVHTKIVPPLSEDKTASDDTAESAEGKRKKRPLGNREAVRKYREKKKARAASL  115

Query  307  EEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCD  486
            E+EV +LRA+N+Q++K+++ Q VLEAE+ RL+ LL+ +R +I+ E G+    FP+QK   
Sbjct  116  EDEVVRLRAINQQLMKRLQGQAVLEAEIARLKCLLVDIRGRIEGEIGS----FPYQK---  168

Query  487  PATPFEQGD  513
               P + GD
Sbjct  169  ---PMKSGD  174



>gb|EAY79873.1| hypothetical protein OsI_35035 [Oryza sativa Indica Group]
Length=1181

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 67/83 (81%), Gaps = 4/83 (5%)
 Frame = +1

Query  235   RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
             R+  GNREAVRKYR+KKKAHTA+LEEEV++LRA+N+Q+VK+++ Q  LEAEV+RLR+LL+
Sbjct  1035  RKPLGNREAVRKYRQKKKAHTAHLEEEVKRLRAINQQLVKRLQGQAALEAEVVRLRSLLV  1094

Query  415   klrDKIDSESGAGHSGFPFQKHC  483
              +R +I+   G+    +PFQ  C
Sbjct  1095  DVRSRINGALGS----YPFQAQC  1113



>ref|XP_006412160.1| hypothetical protein EUTSA_v10026007mg [Eutrema salsugineum]
 gb|ESQ53613.1| hypothetical protein EUTSA_v10026007mg [Eutrema salsugineum]
Length=262

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 76/118 (64%), Gaps = 18/118 (15%)
 Frame = +1

Query  166  NAQTYT--HTHTHIYP-----------NSQSDGEP-RRRASGNREAVRKYREKKKAHTAY  303
            N  T+T  H HT I P            ++S G+   +R  GNREAVRKYREKKKA  A 
Sbjct  58   NTHTHTCFHVHTKILPEDSDEKVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAAS  117

Query  304  LEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            LE+EV +LRAVN+Q+VK+++ Q  LEAEV RL+ LL+ LR +ID E G+    FP+QK
Sbjct  118  LEDEVSRLRAVNQQLVKRLQSQATLEAEVSRLKCLLVDLRGRIDGEIGS----FPYQK  171



>ref|XP_006422601.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35841.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
Length=302

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 90/149 (60%), Gaps = 34/149 (23%)
 Frame = +1

Query  121  PSLSVGSVLDGMLRNN-AQTYTHT---------HTH---------IYPNSQ---------  216
            PS S+ S  + +L++  A T+THT         HTH         + P S+         
Sbjct  22   PSCSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCFHVHTKIVAPTSEDKVSTDDTA  81

Query  217  --SDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEV  390
              ++ + ++R  GNREAVRKYREKKKA TA LE+EV +LRAVN+Q++K+++ Q  LEAEV
Sbjct  82   ESTEKKTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQGQAALEAEV  141

Query  391  MrlralllklrDKIDSESGAGHSGFPFQK  477
             RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  142  ARLKCLLVDIRGRIEGEIGS----FPYQK  166



>gb|ACG32751.1| DNA binding protein [Zea mays]
Length=276

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 4/82 (5%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            ++R SGNR AVRKYREKKKAHTA LEEEV  LRA+N+Q+VKK++    LEAEV RLR LL
Sbjct  102  KKRPSGNRAAVRKYREKKKAHTASLEEEVVHLRALNQQLVKKLQSHAALEAEVARLRCLL  161

Query  412  lklrDKIDSESGAGHSGFPFQK  477
            + +R +I+ E GA    FP+Q+
Sbjct  162  VDIRGRIEGEIGA----FPYQR  179



>ref|NP_001141059.1| uncharacterized protein LOC100273140 [Zea mays]
 ref|XP_008681415.1| PREDICTED: uncharacterized protein LOC100273140 isoform X1 [Zea 
mays]
 gb|ACF85309.1| unknown [Zea mays]
 gb|ADX60074.1| bZIP transcription factor [Zea mays]
 gb|AFW69520.1| putative bZIP transcription factor superfamily protein isoform 
1 [Zea mays]
 gb|AFW69521.1| putative bZIP transcription factor superfamily protein isoform 
2 [Zea mays]
 gb|AFW69522.1| putative bZIP transcription factor superfamily protein isoform 
3 [Zea mays]
 gb|AFW69523.1| putative bZIP transcription factor superfamily protein isoform 
4 [Zea mays]
 gb|AIB04274.1| bZIP transcription factor, partial [Zea mays]
Length=276

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 4/82 (5%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            ++R SGNR AVRKYREKKKAHTA LEEEV  LRA+N+Q+VKK++    LEAEV RLR LL
Sbjct  102  KKRPSGNRAAVRKYREKKKAHTASLEEEVVHLRALNQQLVKKLQSHAALEAEVARLRCLL  161

Query  412  lklrDKIDSESGAGHSGFPFQK  477
            + +R +I+ E GA    FP+Q+
Sbjct  162  VDIRGRIEGEIGA----FPYQR  179



>ref|XP_009418779.1| PREDICTED: uncharacterized protein LOC103998893 [Musa acuminata 
subsp. malaccensis]
Length=272

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 85/142 (60%), Gaps = 28/142 (20%)
 Frame = +1

Query  124  SLSVGSVLDGMLRNNAQ-TYTHTHT-----------HIY-------PNSQSDG-----EP  231
            S S+ S  D +  +  Q T THTHT           H++       P+  ++        
Sbjct  26   SRSIDSFFDDIFNDGQQHTCTHTHTCNPLSHTHTCFHVHTKIVSAPPDEAAESMEKSSST  85

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            ++R+ GNREAVRKYR+KKKAH A LEEEV  LRA+N+Q++K+++ Q  LEAEV RLR LL
Sbjct  86   KKRSCGNREAVRKYRQKKKAHAASLEEEVAHLRAINQQLMKRLQGQAALEAEVARLRCLL  145

Query  412  lklrDKIDSESGAGHSGFPFQK  477
            + +R +I+ E G+    FP+QK
Sbjct  146  VDMRGRIEGEIGS----FPYQK  163



>ref|XP_006422593.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422594.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422595.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422596.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422597.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422598.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422599.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422600.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006486739.1| PREDICTED: uncharacterized protein LOC102628933 isoform X1 [Citrus 
sinensis]
 ref|XP_006486740.1| PREDICTED: uncharacterized protein LOC102628933 isoform X2 [Citrus 
sinensis]
 ref|XP_006486741.1| PREDICTED: uncharacterized protein LOC102628933 isoform X3 [Citrus 
sinensis]
 gb|ESR35833.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35834.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35835.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35836.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35837.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35838.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35839.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35840.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|KDO68066.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68067.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68068.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68069.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68070.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
Length=268

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 90/149 (60%), Gaps = 34/149 (23%)
 Frame = +1

Query  121  PSLSVGSVLDGMLRNN-AQTYTHT---------HTH---------IYPNSQ---------  216
            PS S+ S  + +L++  A T+THT         HTH         + P S+         
Sbjct  22   PSCSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCFHVHTKIVAPTSEDKVSTDDTA  81

Query  217  --SDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEV  390
              ++ + ++R  GNREAVRKYREKKKA TA LE+EV +LRAVN+Q++K+++ Q  LEAEV
Sbjct  82   ESTEKKTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQGQAALEAEV  141

Query  391  MrlralllklrDKIDSESGAGHSGFPFQK  477
             RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  142  ARLKCLLVDIRGRIEGEIGS----FPYQK  166



>gb|KDO68071.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
Length=262

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 90/149 (60%), Gaps = 34/149 (23%)
 Frame = +1

Query  121  PSLSVGSVLDGMLRNN-AQTYTHT---------HTH---------IYPNSQ---------  216
            PS S+ S  + +L++  A T+THT         HTH         + P S+         
Sbjct  22   PSCSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCFHVHTKIVAPTSEDKVSTDDTA  81

Query  217  --SDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEV  390
              ++ + ++R  GNREAVRKYREKKKA TA LE+EV +LRAVN+Q++K+++ Q  LEAEV
Sbjct  82   ESTEKKTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQGQAALEAEV  141

Query  391  MrlralllklrDKIDSESGAGHSGFPFQK  477
             RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  142  ARLKCLLVDIRGRIEGEIGS----FPYQK  166



>gb|KFK30142.1| hypothetical protein AALP_AA7G222200 [Arabis alpina]
Length=263

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 87/150 (58%), Gaps = 36/150 (24%)
 Frame = +1

Query  124  SLSVGSVLDGMLRNNAQ----------------TYTHT----HTHIYPN-----------  210
            + S+ S  DG+L ++ Q                T+THT    HT I P+           
Sbjct  26   NCSMDSFFDGLLMDSHQAACTHTHTCNPTGPENTHTHTCFHVHTKILPDESDEKVSTDDT  85

Query  211  SQSDGEP-RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAE  387
            ++S G+   +R  GNREAVRKYREKKKA  A LE+EV +LRAVN+Q+VK+++    LEAE
Sbjct  86   AESCGKKGEKRPLGNREAVRKYREKKKAKAASLEDEVARLRAVNQQLVKRLQSHATLEAE  145

Query  388  VMrlralllklrDKIDSESGAGHSGFPFQK  477
            V RL+ LL+ LR +ID E GA    FP+QK
Sbjct  146  VSRLKCLLVDLRGRIDGEIGA----FPYQK  171



>dbj|BAJ84803.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=251

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 80/148 (54%), Gaps = 34/148 (23%)
 Frame = +1

Query  124  SLSVGSVLDGMLRNNAQTYTHTHTH----------------------IYPNSQSDGEP--  231
            S S+GS  D +L ++A     THTH                      I   S    E   
Sbjct  26   SCSMGSYFDDILNSDADHLACTHTHTCNPPVHDLAHHTHTCVHVHTKILSASDDAAETSE  85

Query  232  ------RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVM  393
                  ++R SGNR AVRKYREKKKAHTA LEEEV  L+AVN+Q+VKK++    LEAEV 
Sbjct  86   SLPDAKKQRPSGNRAAVRKYREKKKAHTALLEEEVAHLKAVNQQLVKKLQSHSALEAEVA  145

Query  394  rlralllklrDKIDSESGAGHSGFPFQK  477
            RLR LL+ +R +I+ E G     FP+Q+
Sbjct  146  RLRCLLVDIRGRIEGEIGT----FPYQR  169



>ref|XP_011046688.1| PREDICTED: uncharacterized protein LOC105141220 isoform X2 [Populus 
euphratica]
 ref|XP_011046690.1| PREDICTED: uncharacterized protein LOC105141220 isoform X2 [Populus 
euphratica]
Length=265

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 76/112 (68%), Gaps = 15/112 (13%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQ-----------SDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVR  321
            T  H HT I P ++           +D + ++++SGNREAVRKYRE+KKA  A LE+EV+
Sbjct  59   TCYHVHTKILPPAEDKVVSDDTAESTDKKSKKQSSGNREAVRKYRERKKAKAASLEDEVK  118

Query  322  KLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             LRA+N+Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  119  HLRALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGS----FPYQK  166



>ref|XP_011046685.1| PREDICTED: uncharacterized protein LOC105141220 isoform X1 [Populus 
euphratica]
 ref|XP_011046686.1| PREDICTED: uncharacterized protein LOC105141220 isoform X1 [Populus 
euphratica]
 ref|XP_011046687.1| PREDICTED: uncharacterized protein LOC105141220 isoform X1 [Populus 
euphratica]
Length=266

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 76/112 (68%), Gaps = 15/112 (13%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQ-----------SDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVR  321
            T  H HT I P ++           +D + ++++SGNREAVRKYRE+KKA  A LE+EV+
Sbjct  59   TCYHVHTKILPPAEDKVVSDDTAESTDKKSKKQSSGNREAVRKYRERKKAKAASLEDEVK  118

Query  322  KLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             LRA+N+Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  119  HLRALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGS----FPYQK  166



>gb|AFW69519.1| putative bZIP transcription factor superfamily protein [Zea mays]
Length=332

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 4/82 (5%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            ++R SGNR AVRKYREKKKAHTA LEEEV  LRA+N+Q+VKK++    LEAEV RLR LL
Sbjct  102  KKRPSGNRAAVRKYREKKKAHTASLEEEVVHLRALNQQLVKKLQSHAALEAEVARLRCLL  161

Query  412  lklrDKIDSESGAGHSGFPFQK  477
            + +R +I+ E GA    FP+Q+
Sbjct  162  VDIRGRIEGEIGA----FPYQR  179



>ref|XP_011046689.1| PREDICTED: uncharacterized protein LOC105141220 isoform X3 [Populus 
euphratica]
Length=265

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 76/112 (68%), Gaps = 15/112 (13%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQ-----------SDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVR  321
            T  H HT I P ++           +D + ++++SGNREAVRKYRE+KKA  A LE+EV+
Sbjct  59   TCYHVHTKILPPAEDKVVSDDTAESTDKKSKKQSSGNREAVRKYRERKKAKAASLEDEVK  118

Query  322  KLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             LRA+N+Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  119  HLRALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGS----FPYQK  166



>ref|XP_006409393.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
 gb|ESQ50846.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
Length=265

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 77/127 (61%), Gaps = 20/127 (16%)
 Frame = +1

Query  166  NAQTYT--HTHTHIYPNSQSDGEPR-------------RRASGNREAVRKYREKKKAHTA  300
            N  T+T  H HT I P +QSD +               +R  GNREAVRKYREKKKA  A
Sbjct  56   NTHTHTCLHVHTKILP-AQSDDKASTDDTSESSGKKSKKRPLGNREAVRKYREKKKAKAA  114

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKH  480
             LE+EV +LRAVN Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E GA    FP+QK 
Sbjct  115  SLEDEVIRLRAVNNQLLKRLQGQAALEAEVTRLKCLLVDIRGRIEGEIGA----FPYQKP  170

Query  481  CDPATPF  501
                 PF
Sbjct  171  AVTNVPF  177



>emb|CDY02237.1| BnaA03g39300D [Brassica napus]
Length=239

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 78/134 (58%), Gaps = 16/134 (12%)
 Frame = +1

Query  166  NAQTYT--HTHTHIYPNSQSDGEPRRRAS------GNREAVRKYREKKKAHTAYLEEEVR  321
            N  T+T  H HT I P    D      +       GNREAVRKYREKKKA  A LE+EV 
Sbjct  42   NTHTHTCLHVHTKILPAKADDTSESSGSKSKKTPLGNREAVRKYREKKKAKAASLEDEVI  101

Query  322  KLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPAT--  495
            +LRAVN Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E GA    FP+QK   P +  
Sbjct  102  RLRAVNSQLMKRLQGQAALEAEVTRLKCLLVDIRGRIEGEIGA----FPYQKRAVPYSYT  157

Query  496  --PFEQGDCAVQSS  531
              P +   C V +S
Sbjct  158  MQPCDNVPCGVDNS  171



>ref|XP_006298365.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
 ref|XP_006298366.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
 gb|EOA31263.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
 gb|EOA31264.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
Length=258

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 86/156 (55%), Gaps = 34/156 (22%)
 Frame = +1

Query  124  SLSVGSVLDGMLRNN-AQTYTHT-----------------HTHIYPNSQSD---------  222
            S S+ S  D +LR++ A T+THT                 HT I P    D         
Sbjct  21   SCSMDSFFDELLRDSHACTHTHTCNPSGPENTHTHTCLHVHTKILPAQSEDKVSTDDTSE  80

Query  223  ---GEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVM  393
                + ++R  GNREAVRKYREKKKA  A LE+EV +LRAVN Q++K+++ Q  LEAEV 
Sbjct  81   SSGKKSKKRPLGNREAVRKYREKKKAKAASLEDEVMRLRAVNNQLMKRLQGQAALEAEVT  140

Query  394  rlralllklrDKIDSESGAGHSGFPFQKHCDPATPF  501
            RL+ LL+ +R +ID E G+    FP+QK      P+
Sbjct  141  RLKCLLVDIRGRIDGEIGS----FPYQKPAAANVPY  172



>ref|XP_006409392.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
 gb|ESQ50845.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
Length=263

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 77/127 (61%), Gaps = 20/127 (16%)
 Frame = +1

Query  166  NAQTYT--HTHTHIYPNSQSDGEPR-------------RRASGNREAVRKYREKKKAHTA  300
            N  T+T  H HT I P +QSD +               +R  GNREAVRKYREKKKA  A
Sbjct  56   NTHTHTCLHVHTKILP-AQSDDKASTDDTSESSGKKSKKRPLGNREAVRKYREKKKAKAA  114

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKH  480
             LE+EV +LRAVN Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E GA    FP+QK 
Sbjct  115  SLEDEVIRLRAVNNQLLKRLQGQAALEAEVTRLKCLLVDIRGRIEGEIGA----FPYQKP  170

Query  481  CDPATPF  501
                 PF
Sbjct  171  AVTNVPF  177



>ref|NP_001058591.1| Os06g0716800 [Oryza sativa Japonica Group]
 dbj|BAD53586.1| transcription factor-like [Oryza sativa Japonica Group]
 dbj|BAD61716.1| transcription factor-like [Oryza sativa Japonica Group]
 dbj|BAF20505.1| Os06g0716800 [Oryza sativa Japonica Group]
 gb|EAZ02370.1| hypothetical protein OsI_24474 [Oryza sativa Indica Group]
 dbj|BAG96347.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92598.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66367.1| hypothetical protein OsJ_22672 [Oryza sativa Japonica Group]
Length=272

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 69/96 (72%), Gaps = 7/96 (7%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            ++R SGNR AVRKYREKKKAHTA LEEEV  LRA+N+Q++KK++    LEAEV RLR LL
Sbjct  97   KKRPSGNRAAVRKYREKKKAHTASLEEEVVHLRALNQQLMKKLQNHATLEAEVSRLRCLL  156

Query  412  lklrDKIDSESGAGHSGFPFQ---KHCDPATPFEQG  510
            + +R +I+ E GA    FP+Q   K+ D  +  +QG
Sbjct  157  VDIRGRIEGEIGA----FPYQRPVKNIDLVSSVDQG  188



>gb|EPS65924.1| hypothetical protein M569_08855 [Genlisea aurea]
Length=246

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 76/116 (66%), Gaps = 11/116 (9%)
 Frame = +1

Query  151  GMLRNNAQTYTHTHTHIYPNSQSD-------GEPRRRASGNREAVRKYREKKKAHTAYLE  309
            G  +++  T  H HT I  +   D        + ++R  GNREAVRKYREKKKA  A LE
Sbjct  68   GPDKSHTHTCIHVHTQIMASPSDDTAESIDKNKSKKRPLGNREAVRKYREKKKARAASLE  127

Query  310  EEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            +EV KLRA+N+Q++K+V+ Q +LEAEV RL+ LL+ +R +I+ E G+    FP+Q+
Sbjct  128  DEVIKLRAINQQLMKRVQSQSLLEAEVARLKCLLVDIRGRIEGEIGS----FPYQQ  179



>ref|XP_009136335.1| PREDICTED: uncharacterized protein LOC103860484 [Brassica rapa]
 ref|XP_009136337.1| PREDICTED: uncharacterized protein LOC103860484 [Brassica rapa]
Length=239

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 77/134 (57%), Gaps = 16/134 (12%)
 Frame = +1

Query  166  NAQTYT--HTHTHIYPNSQSDGEPRRRAS------GNREAVRKYREKKKAHTAYLEEEVR  321
            N  T+T  H HT I P    D      +       GNREAVRKYREKKKA  A LE+EV 
Sbjct  42   NTHTHTCLHVHTKILPAQADDTSESSGSKSKKTPLGNREAVRKYREKKKAKAASLEDEVI  101

Query  322  KLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPAT--  495
            +LRAVN Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E GA    FP+QK   P +  
Sbjct  102  RLRAVNSQLMKRLQGQAALEAEVTRLKCLLVDIRGRIEGEIGA----FPYQKRVVPNSYT  157

Query  496  --PFEQGDCAVQSS  531
              P     C V +S
Sbjct  158  MQPCNNVPCGVDNS  171



>dbj|BAJ86065.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=213

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +1

Query  169  AQTYTHTHTHIYPNSQSDGEPR----------RRASGNREAVRKYREKKKAHTAYLEEEV  318
            A  +THT  H +    + GE            R+  GNREAVRKYR+KKKAH A+LEEEV
Sbjct  43   AAAHTHTCLHAHTQVVASGEDYAVEQDELRNPRKPLGNREAVRKYRQKKKAHAAFLEEEV  102

Query  319  RKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKID-SESGAGHSGFPFQKHC  483
            +KLRA N+Q++++++    LEAEV RL +LLL +R KID +E GA     PF + C
Sbjct  103  KKLRAANQQLLRRLQGHAALEAEVARLTSLLLDVRGKIDEAEIGA----LPFDERC  154



>ref|XP_004505820.1| PREDICTED: uncharacterized protein LOC101509009 [Cicer arietinum]
Length=269

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 77/122 (63%), Gaps = 18/122 (15%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQSD------------GEPRRRASGNREAVRKYREKKKAHTAYLEEEV  318
            T  H HT I P  + D             + ++R +GN+EAVRKYREKKKA  A LEEEV
Sbjct  60   TCYHVHTKIVPAPEEDQIGTDDTAESAEKKSKKRPTGNKEAVRKYREKKKARAASLEEEV  119

Query  319  RKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK--HCDPA  492
             KLRA+N+ +++K++ Q  LEAEV RL+ LL+ +R +I+ E G+    FP+QK  + +PA
Sbjct  120  MKLRALNQHLMRKLQGQAALEAEVARLKCLLVDIRGRIEGEIGS----FPYQKPTNANPA  175

Query  493  TP  498
             P
Sbjct  176  IP  177



>ref|XP_002439031.1| hypothetical protein SORBIDRAFT_10g030250 [Sorghum bicolor]
 gb|EER90398.1| hypothetical protein SORBIDRAFT_10g030250 [Sorghum bicolor]
Length=273

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 8/97 (8%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            ++R SGNR AVRKYREKKKAHTA LEEEV  LRA+N+Q++KK++    LEAEV RLR LL
Sbjct  100  KKRPSGNRAAVRKYREKKKAHTASLEEEVVHLRALNQQLMKKLQSHATLEAEVARLRCLL  159

Query  412  lklrDKIDSESGAGHSGFPFQ----KHCDPATPFEQG  510
            + +R +I+ E GA    FP+Q    K+ D  +  +QG
Sbjct  160  VDIRGRIEGEIGA----FPYQRPPVKNVDLVSSVDQG  192



>ref|XP_009626744.1| PREDICTED: uncharacterized protein LOC104117398 [Nicotiana tomentosiformis]
 ref|XP_009626745.1| PREDICTED: uncharacterized protein LOC104117398 [Nicotiana tomentosiformis]
Length=276

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 78/121 (64%), Gaps = 20/121 (17%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYPNSQSDGEP--------------RRRASGNREAVRKYREKKKAH  294
            +N+ T+T  H HT I P S+ D +               ++R  GN+EAVRKYREKKKA 
Sbjct  53   DNSHTHTCYHVHTKIVPPSEEDEDKNPSDDTAESSEKKGKKRPVGNKEAVRKYREKKKAR  112

Query  295  TAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQ  474
             A LE+EV +LRA+N+Q+ K+++ Q VLEAEV RL+ LL+ +R +I+ E G+    FP+Q
Sbjct  113  AASLEDEVIRLRAINQQLFKRLQGQAVLEAEVARLKCLLVDIRGRIEGEIGS----FPYQ  168

Query  475  K  477
            K
Sbjct  169  K  169



>gb|EMS67651.1| hypothetical protein TRIUR3_23486 [Triticum urartu]
Length=253

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 80/151 (53%), Gaps = 37/151 (25%)
 Frame = +1

Query  124  SLSVGSVLDGMLRNNAQTYTHTHTH----------------------IYPNSQSDGEP--  231
            S S+GS  D +L ++A     THTH                      I   S    E   
Sbjct  26   SCSMGSYFDDILNSDADHLACTHTHTCNPPVHDLAHHTHTCVHVHTKILSASDDAAETSE  85

Query  232  ---------RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEA  384
                     ++R SGNR AVRKYREKKKAHTA LEEEV  L+AVN+Q+VKK++    LEA
Sbjct  86   SLPEGGATKKQRPSGNRAAVRKYREKKKAHTALLEEEVAHLKAVNQQLVKKLQSHSALEA  145

Query  385  EVMrlralllklrDKIDSESGAGHSGFPFQK  477
            EV RLR LL+ +R +I+ E G     FP+Q+
Sbjct  146  EVARLRCLLVDIRGRIEGEIGT----FPYQR  172



>ref|XP_009108690.1| PREDICTED: uncharacterized protein LOC103834377 [Brassica rapa]
Length=255

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 78/126 (62%), Gaps = 22/126 (17%)
 Frame = +1

Query  166  NAQTYT--HTHTHIYP-----------NSQSDGE--PRRRASGNREAVRKYREKKKAHTA  300
            NA T+T  H HT I P            ++S G+    +R  GNREAVRKYREKKKA  A
Sbjct  57   NAHTHTCFHVHTKILPEDSDEKVSTDDTAESCGKKGDNKRPLGNREAVRKYREKKKAKAA  116

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKH  480
             LE+EV +L AVN Q+VK+++ Q  LEAEV RL+ LL+ LR +ID E G+    FP+QK 
Sbjct  117  SLEDEVARLTAVNHQLVKRLQSQGALEAEVSRLKCLLVDLRGRIDGEIGS----FPYQK-  171

Query  481  CDPATP  498
              P+ P
Sbjct  172  --PSVP  175



>ref|NP_001130683.1| putative bZIP transcription factor superfamily protein [Zea mays]
 gb|ACF78997.1| unknown [Zea mays]
 gb|AFW82391.1| putative bZIP transcription factor superfamily protein [Zea mays]
 gb|AIB05090.1| bZIP transcription factor, partial [Zea mays]
Length=225

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 13/99 (13%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            RR  GNREAVRKYREKKKA  A+LE EV+KLRA N+Q+V++++    LEAEV RLR LLL
Sbjct  76   RRPLGNREAVRKYREKKKARAAFLEGEVKKLRAANQQLVRRLQDHAALEAEVARLRGLLL  135

Query  415  klrDKIDSESGAGHSGFPFQKHC---------DPATPFE  504
             +R +ID+E G      PFQ+ C         DPA  F+
Sbjct  136  DVRGRIDAEVGVS----PFQRPCSAGSVECGADPALRFD  170



>gb|AAL79736.1|AC091774_27 putative transcription factor [Oryza sativa Japonica Group]
Length=297

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 69/96 (72%), Gaps = 7/96 (7%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            ++R SGNR AVRKYREKKKAHTA LEEEV  LRA+N+Q++KK++    LEAEV RLR LL
Sbjct  97   KKRPSGNRAAVRKYREKKKAHTASLEEEVVHLRALNQQLMKKLQNHATLEAEVSRLRCLL  156

Query  412  lklrDKIDSESGAGHSGFPFQ---KHCDPATPFEQG  510
            + +R +I+ E GA    FP+Q   K+ D  +  +QG
Sbjct  157  VDIRGRIEGEIGA----FPYQRPVKNIDLVSSVDQG  188



>gb|AFW82390.1| putative bZIP transcription factor superfamily protein [Zea mays]
Length=235

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 13/99 (13%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            RR  GNREAVRKYREKKKA  A+LE EV+KLRA N+Q+V++++    LEAEV RLR LLL
Sbjct  76   RRPLGNREAVRKYREKKKARAAFLEGEVKKLRAANQQLVRRLQDHAALEAEVARLRGLLL  135

Query  415  klrDKIDSESGAGHSGFPFQKHC---------DPATPFE  504
             +R +ID+E G      PFQ+ C         DPA  F+
Sbjct  136  DVRGRIDAEVGVS----PFQRPCSAGSVECGADPALRFD  170



>gb|AFP19452.1| bZIP transcription factor family protein 1 [Camellia sinensis]
Length=270

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 76/127 (60%), Gaps = 22/127 (17%)
 Frame = +1

Query  169  AQTYTHTHTHIYPNSQSDG------------EPRRRASGNREAVRKYREKKKAHTAYLEE  312
            + T  H HT I P +  D             +  R  +GNREAVRKYREKKKA TA LE+
Sbjct  56   SHTCRHVHTKIVPAATQDKVSTGDIAECLEKKSNRCPTGNREAVRKYREKKKARTASLED  115

Query  313  EVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPA  492
            EV +LRAVN+Q+VK+++ Q  LE E+ RL+ LL+ +R +I+ E G+    FP+QK     
Sbjct  116  EVVRLRAVNQQLVKRLQGQAALETEIARLKCLLVDIRGRIEGEIGS----FPYQK-----  166

Query  493  TPFEQGD  513
             P + GD
Sbjct  167  -PSKNGD  172



>emb|CDX76308.1| BnaA08g10920D [Brassica napus]
Length=273

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 77/126 (61%), Gaps = 22/126 (17%)
 Frame = +1

Query  166  NAQTYT--HTHTHIYP-----------NSQSDGE--PRRRASGNREAVRKYREKKKAHTA  300
            NA T+T  H HT I P            ++S G+    +R  GNREAVRKYREKKKA  A
Sbjct  57   NAHTHTCFHVHTKILPEDSDEKVSTDDTAESCGKKGDNKRPLGNREAVRKYREKKKAKAA  116

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKH  480
             LE+EV +L AVN Q+VK+++ Q  LEAEV RL+ LL+ LR +ID E G+    FP+QK 
Sbjct  117  SLEDEVARLTAVNHQLVKRLQSQGALEAEVSRLKCLLVDLRGRIDGEIGS----FPYQK-  171

Query  481  CDPATP  498
              P  P
Sbjct  172  --PNVP  175



>ref|XP_010548099.1| PREDICTED: uncharacterized protein LOC104819648 [Tarenaya hassleriana]
Length=260

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 82/149 (55%), Gaps = 36/149 (24%)
 Frame = +1

Query  124  SLSVGSVLDGMLRNNAQTYTHTHTHIYPNSQ-----------------------------  216
            S S+ S  D +L++  QT THTHT   P  +                             
Sbjct  28   SCSMDSFFDELLKD-PQTCTHTHTCNPPGPENTHSHTCFHVHTKFLPLQSGEKVSTDDTA  86

Query  217  --SDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEV  390
              S+   R R SGNREAVRKYREKK+A  A LE+EV KLRA+N+Q++K+++ Q  LEAEV
Sbjct  87   ESSEKRNRNRPSGNREAVRKYREKKRARAASLEDEVIKLRAINQQLLKRLQSQAGLEAEV  146

Query  391  MrlralllklrDKIDSESGAGHSGFPFQK  477
             RL+ LL+ +R +I+ E G     FP+QK
Sbjct  147  ARLKCLLVDIRGRIEGEIGT----FPYQK  171



>gb|KHG28517.1| Protein FD -like protein [Gossypium arboreum]
Length=261

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 79/125 (63%), Gaps = 21/125 (17%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYPNSQSD----------GE--PRRRASGNREAVRKYREKKKAHTA  300
            +N+ T+T  H HT I P S  D          GE   ++R  GNREAVRKYREK KA  A
Sbjct  54   DNSHTHTCFHFHTKIVPASSEDKAAIDDTAVSGENKSKKRPLGNREAVRKYREKVKARAA  113

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKH  480
             LE+EV +LRA+N+Q+VK+++ Q  LEAEV RL+ LL+ +R +I+ E G     FP+QK 
Sbjct  114  SLEDEVVRLRALNQQLVKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGP----FPYQK-  168

Query  481  CDPAT  495
              PAT
Sbjct  169  --PAT  171



>emb|CDY17503.1| BnaC03g65600D [Brassica napus]
Length=255

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 77/126 (61%), Gaps = 22/126 (17%)
 Frame = +1

Query  166  NAQTYT--HTHTHIYP-----------NSQSDGE--PRRRASGNREAVRKYREKKKAHTA  300
            NA T+T  H HT I P            ++S G+    +R  GNREAVRKYREKKKA  A
Sbjct  57   NAHTHTCFHVHTKILPEDSDEKVSTDDTAESCGKKGDNKRPLGNREAVRKYREKKKAKAA  116

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKH  480
             LE+EV +L AVN Q+VK+++ Q  LEAEV RL+ LL+ LR +ID E G+    FP+QK 
Sbjct  117  SLEDEVARLTAVNHQLVKRLQSQGALEAEVSRLKCLLVDLRGRIDGEIGS----FPYQK-  171

Query  481  CDPATP  498
              P  P
Sbjct  172  --PNVP  175



>ref|XP_004289872.1| PREDICTED: uncharacterized protein LOC101314521 isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004289873.1| PREDICTED: uncharacterized protein LOC101314521 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=276

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 75/119 (63%), Gaps = 17/119 (14%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQSD-----------GE--PRRRASGNREAVRKYREKKKAHTAYLEEE  315
            T  H HT I  +  S+           GE   ++R  GNREAVRKYREKKKA  A LE+E
Sbjct  64   TCIHVHTKILSSGASEDKAGTDDTAESGEKNSKKRPLGNREAVRKYREKKKARAASLEDE  123

Query  316  VRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPA  492
            V +LRAVN+Q++K+++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK  +P 
Sbjct  124  VIRLRAVNQQLMKRLQGQAALEAEIARLKCLLVDIRGRIEGEIGS----FPYQKPVNPG  178



>ref|XP_010266832.1| PREDICTED: uncharacterized protein LOC104604256 [Nelumbo nucifera]
Length=273

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 74/117 (63%), Gaps = 20/117 (17%)
 Frame = +1

Query  175  TYTHT----HTHIYPNSQSDG------------EPRRRASGNREAVRKYREKKKAHTAYL  306
            T+THT    HT I P    D             + ++R  GNREAVRKYREKKKA  A L
Sbjct  57   THTHTCFHVHTKILPAPSEDKAATDDTEESVEKKAKKRPLGNREAVRKYREKKKARAASL  116

Query  307  EEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            E+EV KLRA+N+Q++K+++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  117  EDEVVKLRALNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIEGEIGS----FPYQK  169



>ref|XP_010107666.1| hypothetical protein L484_008383 [Morus notabilis]
 gb|EXC16577.1| hypothetical protein L484_008383 [Morus notabilis]
Length=262

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 85/148 (57%), Gaps = 34/148 (23%)
 Frame = +1

Query  124  SLSVGSVLDGMLRNN-AQTYTHT-----------------HTHIYPNSQSDG--------  225
            S S+ S  D +L++  A T+THT                 HT I P S  D         
Sbjct  26   SCSMDSFFDELLKDTHACTHTHTCNPPGPDFSHTHTCFHVHTKIVPASGEDKAASDDTAE  85

Query  226  ----EPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVM  393
                + ++R  GNREAVRKYREKKKA  A LE+EV +LRA+N+Q++K+++ Q  LE+EV 
Sbjct  86   STEKKSKKRPLGNREAVRKYREKKKARAASLEDEVVRLRAINQQLLKRLQGQAALESEVA  145

Query  394  rlralllklrDKIDSESGAGHSGFPFQK  477
            RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  146  RLKCLLVDIRGRIEGEIGS----FPYQK  169



>gb|EMT32713.1| hypothetical protein F775_17323 [Aegilops tauschii]
Length=318

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 62/82 (76%), Gaps = 4/82 (5%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            ++R SGNR AVRKYREKKKAHTA LEEEV  L+AVN+Q+VKK++    LEAEV RLR LL
Sbjct  92   KQRPSGNRAAVRKYREKKKAHTALLEEEVAHLKAVNQQLVKKLQSHSALEAEVARLRCLL  151

Query  412  lklrDKIDSESGAGHSGFPFQK  477
            + +R +I+ E G     FP+Q+
Sbjct  152  VDIRGRIEGEIGT----FPYQR  169



>ref|XP_009791619.1| PREDICTED: uncharacterized protein LOC104238836 [Nicotiana sylvestris]
 ref|XP_009791625.1| PREDICTED: uncharacterized protein LOC104238836 [Nicotiana sylvestris]
Length=276

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 77/121 (64%), Gaps = 20/121 (17%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYPNSQSDGEP--------------RRRASGNREAVRKYREKKKAH  294
            +N+ T+T  H HT   P S+ D +               ++R  GN+EAVRKYREKKKA 
Sbjct  53   DNSHTHTCYHVHTKFVPPSEEDEDKNPSDDTAESSEKKGKKRPVGNKEAVRKYREKKKAR  112

Query  295  TAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQ  474
             A LE+EV +LRA+N+Q+ K+++ Q VLEAEV RL+ LL+ +R +I+ E G+    FP+Q
Sbjct  113  AASLEDEVIRLRAINQQLFKRLQGQAVLEAEVARLKCLLVDIRGRIEGEIGS----FPYQ  168

Query  475  K  477
            K
Sbjct  169  K  169



>ref|XP_011092974.1| PREDICTED: uncharacterized protein LOC105173033 isoform X2 [Sesamum 
indicum]
Length=287

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 78/118 (66%), Gaps = 16/118 (14%)
 Frame = +1

Query  160  RNNAQTYTHTHTHIYPN-----------SQSDGE-PRRRASGNREAVRKYREKKKAHTAY  303
            +++  T  H HT I P            ++S G+  ++R SGN EAVRKYREKKKA  A 
Sbjct  73   KSHTHTCIHVHTQIMPTPGELHAPGDDTAESVGKKAKKRPSGNNEAVRKYREKKKARAAS  132

Query  304  LEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            LE+EV +LRA+N+ ++K+++ Q +LEAEV RL+ LL+ +R +I++E G+    FP+QK
Sbjct  133  LEDEVVRLRALNQHLMKRLQSQALLEAEVARLKCLLVDIRGRIEAEIGS----FPYQK  186



>ref|XP_010935120.1| PREDICTED: uncharacterized protein LOC105055101 [Elaeis guineensis]
Length=273

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 70/108 (65%), Gaps = 11/108 (10%)
 Frame = +1

Query  175  TYTHTHTHIY-------PNSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRA  333
            T  H HT I          S      ++R SGNREAVRKYREKKKA  A LE+EV +LRA
Sbjct  63   TCFHVHTKILSAPADETAESAEKSSSKKRPSGNREAVRKYREKKKARAASLEDEVIQLRA  122

Query  334  VNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            +N+Q++KK++ Q  LEAEV RLR LL+ LR +I+ E G+    FP+Q+
Sbjct  123  LNQQLLKKLQGQAALEAEVARLRCLLVDLRGRIEGEIGS----FPYQR  166



>ref|XP_011092972.1| PREDICTED: uncharacterized protein LOC105173033 isoform X1 [Sesamum 
indicum]
 ref|XP_011092973.1| PREDICTED: uncharacterized protein LOC105173033 isoform X1 [Sesamum 
indicum]
Length=288

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 78/118 (66%), Gaps = 16/118 (14%)
 Frame = +1

Query  160  RNNAQTYTHTHTHIYPN-----------SQSDGE-PRRRASGNREAVRKYREKKKAHTAY  303
            +++  T  H HT I P            ++S G+  ++R SGN EAVRKYREKKKA  A 
Sbjct  73   KSHTHTCIHVHTQIMPTPGELHAPGDDTAESVGKKAKKRPSGNNEAVRKYREKKKARAAS  132

Query  304  LEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            LE+EV +LRA+N+ ++K+++ Q +LEAEV RL+ LL+ +R +I++E G+    FP+QK
Sbjct  133  LEDEVVRLRALNQHLMKRLQSQALLEAEVARLKCLLVDIRGRIEAEIGS----FPYQK  186



>gb|EYU37954.1| hypothetical protein MIMGU_mgv1a011243mg [Erythranthe guttata]
Length=288

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 77/121 (64%), Gaps = 16/121 (13%)
 Frame = +1

Query  151  GMLRNNAQTYTHTHTHIYPNSQSDGEP------------RRRASGNREAVRKYREKKKAH  294
            G  +++  T  H HT I  +     +P            ++R +GNREAVRKYREKKKA 
Sbjct  70   GPDKSHTHTCIHVHTQIMHSPSEGQDPSDDTAESVEKKGKKRPTGNREAVRKYREKKKAR  129

Query  295  TAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQ  474
             A LE+EV +LRA+N+Q++K+++ Q +LEAE+ RL+ LL+ +R +I+ E G+    FP+Q
Sbjct  130  AASLEDEVIRLRALNQQLMKRLQGQALLEAEITRLKCLLVDIRGRIEGEIGS----FPYQ  185

Query  475  K  477
            K
Sbjct  186  K  186



>gb|EMT13528.1| hypothetical protein F775_07298 [Aegilops tauschii]
Length=238

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 80/141 (57%), Gaps = 21/141 (15%)
 Frame = +1

Query  157  LRNNAQTYTHTHTHIYP-----------NSQSDGEPRRRASGNREAVRKYREKKKAHTAY  303
            L ++A T  H HT I+P           + Q +   ++R SGNR AVR+YR+K+KA TA 
Sbjct  42   LAHHAHTCVHVHTKIHPAESDDVAETSESPQQNSGAKKRPSGNRAAVRRYRDKRKARTAL  101

Query  304  LEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHC  483
            LEEEV +L+A+N Q+V+K++    L+AE  RLR LL+ +R +I+ E G     FP Q+  
Sbjct  102  LEEEVARLKALNRQLVRKIQSHSALQAEASRLRYLLVDIRGRIEGELGV----FPCQR--  155

Query  484  DPATPFEQGDCAVQSSGKGPG  546
                P    D A Q S  G G
Sbjct  156  ----PMRNNDSADQGSFLGGG  172



>gb|AFP19453.1| bZIP transcription factor family protein 2 [Camellia sinensis]
Length=270

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 76/125 (61%), Gaps = 22/125 (18%)
 Frame = +1

Query  175  TYTHTHTHIYPNS------------QSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEV  318
            T  H HT I P               S+ + ++  +GNREAVRKYREKKKA TA LE+EV
Sbjct  58   TCFHVHTKIVPAPTEDKVSTDDTAESSEKKSKKCPTGNREAVRKYREKKKARTASLEDEV  117

Query  319  RKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATP  498
             +LRAVN+Q+VK+++ Q  LE E+ RL+ LL+ +R +I+ E G+    FP+QK      P
Sbjct  118  VRLRAVNQQLVKRLQGQAALETEIARLKCLLVDIRGRIEGEIGS----FPYQK------P  167

Query  499  FEQGD  513
             + GD
Sbjct  168  SKNGD  172



>ref|XP_010526894.1| PREDICTED: uncharacterized protein LOC104804328 [Tarenaya hassleriana]
Length=273

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 85/149 (57%), Gaps = 35/149 (23%)
 Frame = +1

Query  124  SLSVGSVLDGMLRNN-AQTYTHT-----------------HTHIYP-------------N  210
            S S+ +  D +LR++ A T+THT                 HT I P              
Sbjct  26   SCSMDTFFDELLRDSHACTHTHTCNPPGPENTHTHTCFHVHTKILPAQSEEKVSADDTAE  85

Query  211  SQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEV  390
            S    + ++R  GNREAVRKYREKKKA  A LE+EV KLRA+N+Q++K+++ Q  LEAEV
Sbjct  86   SSEKKKNKKRPLGNREAVRKYREKKKARAASLEDEVIKLRAINQQLLKRLQGQAALEAEV  145

Query  391  MrlralllklrDKIDSESGAGHSGFPFQK  477
             RL+ LL+ +R +I+ E GA    FP+QK
Sbjct  146  ARLKCLLVDIRGRIEGEIGA----FPYQK  170



>ref|XP_002534148.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF28231.1| DNA binding protein, putative [Ricinus communis]
Length=284

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 76/118 (64%), Gaps = 22/118 (19%)
 Frame = +1

Query  178  YTHTHT--HIY------PNSQSDG----------EPRRRASGNREAVRKYREKKKAHTAY  303
            Y+HTHT  H++      P+    G          + ++R  GNREAVRKYREKKKA  A 
Sbjct  55   YSHTHTCFHVHTKIVSAPSDDKTGTDDTAESTEKKSKKRPLGNREAVRKYREKKKARAAS  114

Query  304  LEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            LE+EV KLRA+N+Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  115  LEDEVVKLRALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGS----FPYQK  168



>ref|XP_011046168.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
 ref|XP_011046178.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
 ref|XP_011046187.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
 ref|XP_011046199.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
Length=267

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 81/149 (54%), Gaps = 34/149 (23%)
 Frame = +1

Query  121  PSLSVGSVLDGMLRNNAQTYTHTHTHIYPNSQS---------------------DGE---  228
            PS      LD +L++     THTHT   P   +                     D E   
Sbjct  23   PSSCSYGFLDELLKDTPHACTHTHTCNPPGPDNPHTHVCFHAHTKLLSSSEDKVDSEDTA  82

Query  229  ------PRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEV  390
                   ++R  GNREAVRKYREKKKA  A LE+EV++LRA+N+Q++K+++ Q  LEAEV
Sbjct  83   ESIEKKSKKRPLGNREAVRKYREKKKAKAASLEDEVKRLRALNQQLLKRLQGQAALEAEV  142

Query  391  MrlralllklrDKIDSESGAGHSGFPFQK  477
             RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  143  ARLKCLLVDIRGRIEGEIGS----FPYQK  167



>gb|EEE52735.1| hypothetical protein OsJ_35154 [Oryza sativa Japonica Group]
Length=226

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 63/83 (76%), Gaps = 4/83 (5%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            R+  GNREAVRKYR+KKKAHTA+LEEEV++LR +N+Q+VK+++ Q  LE EV+RLR+LL+
Sbjct  80   RKPLGNREAVRKYRQKKKAHTAHLEEEVKRLRVINQQLVKRLQGQAALEVEVVRLRSLLV  139

Query  415  klrDKIDSESGAGHSGFPFQKHC  483
             +R +I+   G+     P Q  C
Sbjct  140  DVRSRINGALGS----CPIQAQC  158



>emb|CAN73631.1| hypothetical protein VITISV_026643 [Vitis vinifera]
Length=264

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 71/113 (63%), Gaps = 16/113 (14%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQSDG------------EPRRRASGNREAVRKYREKKKAHTAYLEEEV  318
            T  H HT I P    D             + ++R  GNREAVRKYREKKKA  A LE+EV
Sbjct  60   TCFHVHTKIVPAPAEDNIATDDTAESAEKKSKKRPLGNREAVRKYREKKKARAASLEDEV  119

Query  319  RKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             +LR++N+Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  120  VRLRSLNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGS----FPYQK  168



>ref|XP_002278836.1| PREDICTED: uncharacterized protein LOC100243471 [Vitis vinifera]
Length=273

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 71/113 (63%), Gaps = 16/113 (14%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQSDG------------EPRRRASGNREAVRKYREKKKAHTAYLEEEV  318
            T  H HT I P    D             + ++R  GNREAVRKYREKKKA  A LE+EV
Sbjct  62   TCFHVHTKIVPAPAEDNIATDDTAESAEKKSKKRPLGNREAVRKYREKKKARAASLEDEV  121

Query  319  RKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             +LR++N+Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  122  VRLRSLNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGS----FPYQK  170



>ref|XP_009106517.1| PREDICTED: uncharacterized protein LOC103832273 [Brassica rapa]
Length=237

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 77/131 (59%), Gaps = 16/131 (12%)
 Frame = +1

Query  169  AQTYTHTHTHIYP-----------NSQSDGE-PRRRASGNREAVRKYREKKKAHTAYLEE  312
            A T  H HT I P            ++S G+   +R  GNREAVRKYREKKKA  A LE+
Sbjct  50   AHTCFHVHTKILPEDSDEKVSTDDTAESCGKNGEKRPLGNREAVRKYREKKKAKAASLED  109

Query  313  EVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPA  492
            E  +LR +N+Q+VK+++ Q  LE+EV RL+ LL+ LR +ID E G+    FP+QK   P+
Sbjct  110  ECSRLRGLNQQLVKRLQSQGALESEVSRLKCLLVDLRGRIDGEIGS----FPYQKPNIPS  165

Query  493  TPFEQGDCAVQ  525
                   C VQ
Sbjct  166  FSHLVNPCNVQ  176



>ref|XP_008457697.1| PREDICTED: uncharacterized protein LOC103497333 isoform X1 [Cucumis 
melo]
Length=273

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 89/160 (56%), Gaps = 34/160 (21%)
 Frame = +1

Query  109  VKVQPSLSVGSVLDGMLRNN------------AQTYTHTHT--HIYPNSQS---------  219
            V++  S S+ S  D +L++                Y+HTHT  H++    S         
Sbjct  20   VELPSSCSMDSFFDEILKDTHACTHAHTCNPPGPDYSHTHTCFHVHTKIVSSPTEEKLST  79

Query  220  -------DGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVL  378
                   D + ++R  GNREAVRKYREKKKA  A LE+EV +LRA+N+Q++K+++ Q  L
Sbjct  80   DDTEDSVDKKNKKRPLGNREAVRKYREKKKARAASLEDEVVRLRALNQQLLKRLQGQAAL  139

Query  379  EAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATP  498
            EAEV RL+ LL+ +R +I+ E G+    FP+QK  +   P
Sbjct  140  EAEVSRLKCLLVDIRGRIEGEIGS----FPYQKPANSNPP  175



>ref|XP_010265995.1| PREDICTED: uncharacterized protein LOC104603629 [Nelumbo nucifera]
Length=280

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 74/118 (63%), Gaps = 22/118 (19%)
 Frame = +1

Query  178  YTHTHTHIYPNSQSDGEP------------------RRRASGNREAVRKYREKKKAHTAY  303
            +THTHT  + +++    P                  ++R  GNREAVRKYREKKKA  A 
Sbjct  56   FTHTHTCFHVHTKILSAPSEDKIATDDTAESVEKKAKKRPLGNREAVRKYREKKKARAAS  115

Query  304  LEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            LE+EV KLRA+N+Q++K+++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  116  LEDEVVKLRALNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIEGEIGS----FPYQK  169



>ref|XP_008800177.1| PREDICTED: uncharacterized protein LOC103714633 isoform X1 [Phoenix 
dactylifera]
Length=271

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 74/114 (65%), Gaps = 13/114 (11%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYP-------NSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEE  315
            N + T+T  H HT I         +S      ++R  GNREAVRKYREKKKAHTA L +E
Sbjct  57   NLSHTHTCFHVHTKIVSASAEETSDSAEKSSSKKRPMGNREAVRKYREKKKAHTASLVDE  116

Query  316  VRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            V +LR++N+Q++K+++ Q  LEAE  RLR LL+ +R +I+ E GA    FP+Q+
Sbjct  117  VVQLRSLNQQLMKRLQGQAALEAEATRLRCLLVDIRGRIEGEIGA----FPYQR  166



>emb|CDY52654.1| BnaAnng11690D [Brassica napus]
Length=238

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 77/131 (59%), Gaps = 16/131 (12%)
 Frame = +1

Query  169  AQTYTHTHTHIYP-----------NSQSDGE-PRRRASGNREAVRKYREKKKAHTAYLEE  312
            A T  H HT I P            ++S G+   +R  GNREAVRKYREKKKA  A LE+
Sbjct  51   AHTCFHVHTKILPEDSDEKVSTDDTAESCGKNGEKRPLGNREAVRKYREKKKAKAASLED  110

Query  313  EVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPA  492
            E  +LR +N+Q+VK+++ Q  LE+EV RL+ LL+ LR +ID E G+    FP+QK   P+
Sbjct  111  ECSRLRGLNQQLVKRLQSQGALESEVSRLKCLLVDLRGRIDGEIGS----FPYQKPNIPS  166

Query  493  TPFEQGDCAVQ  525
                   C VQ
Sbjct  167  FSHLVNPCNVQ  177



>ref|XP_008800178.1| PREDICTED: uncharacterized protein LOC103714633 isoform X2 [Phoenix 
dactylifera]
Length=266

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 74/114 (65%), Gaps = 13/114 (11%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYP-------NSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEE  315
            N + T+T  H HT I         +S      ++R  GNREAVRKYREKKKAHTA L +E
Sbjct  57   NLSHTHTCFHVHTKIVSASAEETSDSAEKSSSKKRPMGNREAVRKYREKKKAHTASLVDE  116

Query  316  VRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            V +LR++N+Q++K+++ Q  LEAE  RLR LL+ +R +I+ E GA    FP+Q+
Sbjct  117  VVQLRSLNQQLMKRLQGQAALEAEATRLRCLLVDIRGRIEGEIGA----FPYQR  166



>ref|XP_008457698.1| PREDICTED: uncharacterized protein LOC103497333 isoform X2 [Cucumis 
melo]
 ref|XP_008457699.1| PREDICTED: uncharacterized protein LOC103497333 isoform X2 [Cucumis 
melo]
Length=272

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 89/160 (56%), Gaps = 34/160 (21%)
 Frame = +1

Query  109  VKVQPSLSVGSVLDGMLRNN------------AQTYTHTHT--HIYPNSQS---------  219
            V++  S S+ S  D +L++                Y+HTHT  H++    S         
Sbjct  20   VELPSSCSMDSFFDEILKDTHACTHAHTCNPPGPDYSHTHTCFHVHTKIVSSPTEEKLST  79

Query  220  -------DGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVL  378
                   D + ++R  GNREAVRKYREKKKA  A LE+EV +LRA+N+Q++K+++ Q  L
Sbjct  80   DDTEDSVDKKNKKRPLGNREAVRKYREKKKARAASLEDEVVRLRALNQQLLKRLQGQAAL  139

Query  379  EAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATP  498
            EAEV RL+ LL+ +R +I+ E G+    FP+QK  +   P
Sbjct  140  EAEVSRLKCLLVDIRGRIEGEIGS----FPYQKPANSNPP  175



>ref|XP_007041832.1| Basic-leucine zipper (bZIP) transcription factor family protein 
isoform 7, partial [Theobroma cacao]
 gb|EOX97663.1| Basic-leucine zipper (bZIP) transcription factor family protein 
isoform 7, partial [Theobroma cacao]
Length=202

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 75/119 (63%), Gaps = 18/119 (15%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYPNSQSDG------------EPRRRASGNREAVRKYREKKKAHTA  300
            +N+ T+T  H HT I P    D             + ++R  GNREAVRKYREK KA  A
Sbjct  53   DNSHTHTCFHVHTKIVPAPTEDKAAIDDTAESREKKSKKRPLGNREAVRKYREKVKARAA  112

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             LE+EV +LRA+N+Q++K+++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  113  SLEDEVVRLRALNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIEGEIGS----FPYQK  167



>ref|XP_002313707.2| hypothetical protein POPTR_0009s13730g [Populus trichocarpa]
 gb|EEE87662.2| hypothetical protein POPTR_0009s13730g [Populus trichocarpa]
Length=267

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 72/109 (66%), Gaps = 15/109 (14%)
 Frame = +1

Query  184  HTHTHIYPNSQSDGEP-----------RRRASGNREAVRKYREKKKAHTAYLEEEVRKLR  330
            H HT +  +S+   E            ++R  GNREAVRKYREKKKA  A LE+EV++LR
Sbjct  63   HAHTKLLSSSEDKVESEDTAESIEKKSKKRPLGNREAVRKYREKKKAKAASLEDEVKRLR  122

Query  331  AVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            A+N+Q++K+++ Q  LEAEV RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  123  ALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGS----FPYQK  167



>ref|XP_009408222.1| PREDICTED: uncharacterized protein LOC103990705 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=239

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 80/145 (55%), Gaps = 32/145 (22%)
 Frame = +1

Query  124  SLSVGSVLDGMLRNNAQTYTHTHT---------------HIY-------PNSQSDG----  225
            S S+ S  D +L N+  T THTHT               H++       P+  ++     
Sbjct  26   SCSMDSFFDKIL-NDGHTCTHTHTCNPPGPNLSHTHTCFHVHTKILSSPPDETAESVEKS  84

Query  226  -EPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlr  402
               ++R   NREAVRKYREKKKAH A LEEE   LRA+N+Q+ K+++ Q  LEAE+ RL+
Sbjct  85   DSSKKRPCNNREAVRKYREKKKAHAASLEEEAAHLRAINQQLFKRLQNQAALEAEIARLK  144

Query  403  alllklrDKIDSESGAGHSGFPFQK  477
             LL+ LR +I+ E G     FP+ K
Sbjct  145  CLLVDLRGRIEGEIGP----FPYHK  165



>gb|KDP29660.1| hypothetical protein JCGZ_18822 [Jatropha curcas]
Length=284

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 63/82 (77%), Gaps = 4/82 (5%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            ++R  GNREAVRKYREKKKA  A LE+EV KLRA+N+Q++K+++ Q  LEAEV RL+ LL
Sbjct  91   KKRPLGNREAVRKYREKKKARAASLEDEVVKLRALNQQLLKRLQGQAALEAEVARLKCLL  150

Query  412  lklrDKIDSESGAGHSGFPFQK  477
            + +R +I+ E G+    FP+QK
Sbjct  151  VDIRGRIEGEIGS----FPYQK  168



>ref|XP_007041828.1| Basic-leucine zipper transcription factor family protein isoform 
3 [Theobroma cacao]
 gb|EOX97659.1| Basic-leucine zipper transcription factor family protein isoform 
3 [Theobroma cacao]
Length=281

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 75/119 (63%), Gaps = 18/119 (15%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYPNSQSDG------------EPRRRASGNREAVRKYREKKKAHTA  300
            +N+ T+T  H HT I P    D             + ++R  GNREAVRKYREK KA  A
Sbjct  53   DNSHTHTCFHVHTKIVPAPTEDKAAIDDTAESREKKSKKRPLGNREAVRKYREKVKARAA  112

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             LE+EV +LRA+N+Q++K+++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  113  SLEDEVVRLRALNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIEGEIGS----FPYQK  167



>ref|XP_010690366.1| PREDICTED: uncharacterized protein LOC104903923 [Beta vulgaris 
subsp. vulgaris]
Length=290

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 90/168 (54%), Gaps = 45/168 (27%)
 Frame = +1

Query  115  VQPSLSVGSVLDGMLRN-NAQTYTHT-----------------HTHIYP---------NS  213
            V  S S+ S  D +L++ +A T+THT                 HT I P         N+
Sbjct  44   VPSSGSMDSFFDELLKDTHACTHTHTCNPPGPDLHHTHTCFHVHTKILPPPSEEEKSGNN  103

Query  214  QSDGEPR--------RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQ  369
                E          R   GNREAVRKYR+KKKAH A LE+EV KLRA+N+Q+V++++ Q
Sbjct  104  DDSAESEELKSKKRGRERGGNREAVRKYRQKKKAHAASLEDEVAKLRALNQQLVRRLQGQ  163

Query  370  VVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATPFEQGD  513
              LEAE+ RL+ LL+ +R +I+ E G+    FP+Q+      P + GD
Sbjct  164  AALEAEIARLKCLLVDIRGRIEGEIGS----FPYQR------PVKSGD  201



>ref|XP_007041827.1| Basic-leucine zipper transcription factor family protein isoform 
2 [Theobroma cacao]
 gb|EOX97658.1| Basic-leucine zipper transcription factor family protein isoform 
2 [Theobroma cacao]
Length=310

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 75/119 (63%), Gaps = 18/119 (15%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYPNSQSDG------------EPRRRASGNREAVRKYREKKKAHTA  300
            +N+ T+T  H HT I P    D             + ++R  GNREAVRKYREK KA  A
Sbjct  53   DNSHTHTCFHVHTKIVPAPTEDKAAIDDTAESREKKSKKRPLGNREAVRKYREKVKARAA  112

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             LE+EV +LRA+N+Q++K+++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  113  SLEDEVVRLRALNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIEGEIGS----FPYQK  167



>ref|XP_007041826.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007041829.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007041830.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007041831.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97657.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97660.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97661.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97662.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
Length=266

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 75/119 (63%), Gaps = 18/119 (15%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYPNSQSDG------------EPRRRASGNREAVRKYREKKKAHTA  300
            +N+ T+T  H HT I P    D             + ++R  GNREAVRKYREK KA  A
Sbjct  53   DNSHTHTCFHVHTKIVPAPTEDKAAIDDTAESREKKSKKRPLGNREAVRKYREKVKARAA  112

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             LE+EV +LRA+N+Q++K+++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  113  SLEDEVVRLRALNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIEGEIGS----FPYQK  167



>ref|XP_004303084.1| PREDICTED: uncharacterized protein LOC101298723 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=222

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 51/67 (76%), Gaps = 10/67 (15%)
 Frame = +1

Query  199  IYPNSQSDGE----------PRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQM  348
            + P+ ++DG+           RRR SGNREAVRKYREKKKAHTAYLEEEV+KL+ +N+Q+
Sbjct  61   VLPSEENDGDHSKEDLVLKPKRRRPSGNREAVRKYREKKKAHTAYLEEEVKKLQLLNQQL  120

Query  349  VKKVERQ  369
            V+K++ Q
Sbjct  121  VRKLQGQ  127



>emb|CDX69107.1| BnaC01g03460D [Brassica napus]
Length=271

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 76/131 (58%), Gaps = 16/131 (12%)
 Frame = +1

Query  169  AQTYTHTHTHIYP-----------NSQSDGE-PRRRASGNREAVRKYREKKKAHTAYLEE  312
            + T  H HT + P            ++S G+   +R  GNREAVRKYREKKKA  A LE+
Sbjct  72   SHTCFHVHTKVLPEDSDEKVSTDDTAESCGKNGEKRPLGNREAVRKYREKKKAKAASLED  131

Query  313  EVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPA  492
            E  +LR +N+Q+VK+++ Q  LE EV RL+ LL+ LR +ID E G+    FP+QK   P+
Sbjct  132  ECSRLRGLNQQLVKRLQSQSALEGEVSRLKCLLVDLRGRIDGEIGS----FPYQKPNIPS  187

Query  493  TPFEQGDCAVQ  525
                   C VQ
Sbjct  188  FSHLVNPCNVQ  198



>ref|XP_009408220.1| PREDICTED: uncharacterized protein LOC103990705 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009408221.1| PREDICTED: uncharacterized protein LOC103990705 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=273

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 80/145 (55%), Gaps = 32/145 (22%)
 Frame = +1

Query  124  SLSVGSVLDGMLRNNAQTYTHTHT---------------HIY-------PNSQSDG----  225
            S S+ S  D +L N+  T THTHT               H++       P+  ++     
Sbjct  26   SCSMDSFFDKIL-NDGHTCTHTHTCNPPGPNLSHTHTCFHVHTKILSSPPDETAESVEKS  84

Query  226  -EPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlr  402
               ++R   NREAVRKYREKKKAH A LEEE   LRA+N+Q+ K+++ Q  LEAE+ RL+
Sbjct  85   DSSKKRPCNNREAVRKYREKKKAHAASLEEEAAHLRAINQQLFKRLQNQAALEAEIARLK  144

Query  403  alllklrDKIDSESGAGHSGFPFQK  477
             LL+ LR +I+ E G     FP+ K
Sbjct  145  CLLVDLRGRIEGEIGP----FPYHK  165



>ref|XP_004164905.1| PREDICTED: uncharacterized protein LOC101232700 [Cucumis sativus]
Length=262

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 73/118 (62%), Gaps = 17/118 (14%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQ-------------SDGEPRRRASGNREAVRKYREKKKAHTAYLEEE  315
            T  H HT I P                ++ + ++R  GNREAVRKYREKKKA  A LE+E
Sbjct  59   TCFHVHTKIVPAPSEEDKVVTDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  316  VRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDP  489
            V +LRA+N+ ++K+++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK  +P
Sbjct  119  VVRLRALNQHLMKRLQGQAALEAEIARLKCLLVDIRGRIEGEIGS----FPYQKALNP  172



>ref|XP_008447959.1| PREDICTED: uncharacterized protein LOC103490288 [Cucumis melo]
Length=270

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 91/158 (58%), Gaps = 35/158 (22%)
 Frame = +1

Query  109  VKVQPSLSVGSVLDGMLRNN------------AQTYTHTHT--HIY------PNSQ----  216
            +++  S S+ S  D +L++                Y+HTHT  H++      P+ +    
Sbjct  19   IEIPSSCSMDSFFDELLKDTHTCTHTHTCNPPGPDYSHTHTCFHVHTKIVPAPSEEDKVV  78

Query  217  -------SDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVV  375
                   ++ + ++R  GNREAVRKYREKKKA  A LE+EV +LRA+N+ ++K+++ Q  
Sbjct  79   TDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDEVVRLRALNQHLMKRLQGQAA  138

Query  376  LEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDP  489
            LEAE+ RL+ LL+ +R +I+ E G+    FP+QK  +P
Sbjct  139  LEAEIARLKCLLVDIRGRIEGEIGS----FPYQKAVNP  172



>ref|XP_004147043.1| PREDICTED: uncharacterized protein LOC101219501 [Cucumis sativus]
 ref|XP_004158374.1| PREDICTED: uncharacterized LOC101219501 [Cucumis sativus]
 gb|KGN61936.1| hypothetical protein Csa_2G270780 [Cucumis sativus]
Length=273

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 88/160 (55%), Gaps = 34/160 (21%)
 Frame = +1

Query  109  VKVQPSLSVGSVLDGMLRNN------------AQTYTHTHT--HIYPNSQS---------  219
            +++  S S+ S  D +L++                Y+HTHT  H++    S         
Sbjct  20   IELPSSCSMDSFFDEILKDTHACTHAHTCNPPGPDYSHTHTCFHVHTKIVSSPTEEKVST  79

Query  220  -------DGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVL  378
                   D + ++R  GNREAVRKYREKKKA  A LE+EV +LRA+N+Q++K+++ Q  L
Sbjct  80   DDTADSVDKKNKKRPLGNREAVRKYREKKKARAASLEDEVVRLRALNQQLLKRLQGQAAL  139

Query  379  EAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATP  498
            EAE+ RL+ LL+ +R +I+ E G     FP+QK  +   P
Sbjct  140  EAEISRLKCLLVDIRGRIEGEIG----NFPYQKPTNSNPP  175



>ref|XP_008236016.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
 ref|XP_008236017.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
 ref|XP_008236018.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
 ref|XP_008236020.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
Length=272

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 76/120 (63%), Gaps = 24/120 (20%)
 Frame = +1

Query  178  YTHTHT--HIYP----------------NSQSDGE--PRRRASGNREAVRKYREKKKAHT  297
            Y+HTHT  H++                 ++   GE   ++R  GNREAVRKYREKKKA  
Sbjct  56   YSHTHTCFHVHTKIVSSATGSEDKAGTDDTAESGEKKSKKRPLGNREAVRKYREKKKARA  115

Query  298  AYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            A LE+EV +LRA+N+Q++K+++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  116  ASLEDEVVRLRALNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIEGEIGS----FPYQK  171



>ref|XP_004144846.1| PREDICTED: uncharacterized protein LOC101208161 [Cucumis sativus]
 gb|KGN43249.1| DNA binding protein [Cucumis sativus]
Length=270

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 73/118 (62%), Gaps = 17/118 (14%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQ-------------SDGEPRRRASGNREAVRKYREKKKAHTAYLEEE  315
            T  H HT I P                ++ + ++R  GNREAVRKYREKKKA  A LE+E
Sbjct  59   TCFHVHTKIVPAPSEEDKVVTDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  316  VRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDP  489
            V +LRA+N+ ++K+++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK  +P
Sbjct  119  VVRLRALNQHLMKRLQGQAALEAEIARLKCLLVDIRGRIEGEIGS----FPYQKALNP  172



>ref|XP_008236021.1| PREDICTED: uncharacterized protein LOC103334826 isoform X2 [Prunus 
mume]
Length=265

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 76/120 (63%), Gaps = 24/120 (20%)
 Frame = +1

Query  178  YTHTHT--HIYP----------------NSQSDGE--PRRRASGNREAVRKYREKKKAHT  297
            Y+HTHT  H++                 ++   GE   ++R  GNREAVRKYREKKKA  
Sbjct  56   YSHTHTCFHVHTKIVSSATGSEDKAGTDDTAESGEKKSKKRPLGNREAVRKYREKKKARA  115

Query  298  AYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            A LE+EV +LRA+N+Q++K+++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  116  ASLEDEVVRLRALNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIEGEIGS----FPYQK  171



>gb|EMT00406.1| hypothetical protein F775_29696 [Aegilops tauschii]
Length=266

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 75/122 (61%), Gaps = 19/122 (16%)
 Frame = +1

Query  175  TYTHTHTHIYPNS---------QSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKL  327
            T  H HT I   S         ++ G  ++R SGNR AVRKYREKKKAHTA LEEEV +L
Sbjct  62   TCVHVHTKIVSASSDGGADSPAENSGASKKRPSGNRAAVRKYREKKKAHTALLEEEVVQL  121

Query  328  RAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATPFEQ  507
            +A+N+Q++KK++    LEAE  RLR LL+ +R +ID E G     FP+Q+      P + 
Sbjct  122  KALNKQLLKKLQNHAALEAEAARLRCLLVDIRGRIDGEIGT----FPYQR------PVKN  171

Query  508  GD  513
            GD
Sbjct  172  GD  173



>ref|XP_003607180.1| hypothetical protein MTR_4g073100 [Medicago truncatula]
 gb|ACJ84596.1| unknown [Medicago truncatula]
 gb|AES89377.1| BZIP transcription factor [Medicago truncatula]
Length=267

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 83/150 (55%), Gaps = 34/150 (23%)
 Frame = +1

Query  118  QPSLSVGSVLDGMLRNN-AQTYTHT-----------------HTHIYP------------  207
            Q S S+ S  D +L++  A T+THT                 HT I P            
Sbjct  23   QTSGSMDSFFDELLKDTHACTHTHTCNPPGPDFSHTHTCYHVHTKIVPAEDDQVGTDDTA  82

Query  208  NSQSDGEPRRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAE  387
             S      ++R  GN+EAVRKYREKKKA  A LE+EV KLRA+N+ +++K++ Q  LEAE
Sbjct  83   ESAEKKSSKKRPVGNKEAVRKYREKKKARAASLEDEVMKLRALNQHLMRKLQGQAALEAE  142

Query  388  VMrlralllklrDKIDSESGAGHSGFPFQK  477
            V RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  143  VARLKCLLVDIRGRIEGEIGS----FPYQK  168



>ref|XP_007131714.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
 ref|XP_007131715.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
 gb|ESW03708.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
 gb|ESW03709.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
Length=265

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 70/113 (62%), Gaps = 16/113 (14%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQSD------------GEPRRRASGNREAVRKYREKKKAHTAYLEEEV  318
            T  H HT I P    D             + ++R  GN+EAVRKYREKKKA  A LE+EV
Sbjct  60   TCYHVHTKIVPAPAEDQVATDDTAESAEKKSKKRPLGNKEAVRKYREKKKARAASLEDEV  119

Query  319  RKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             KLRA+N+ ++KK++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  120  VKLRALNQHLMKKLQSQAGLEAEIARLKCLLVDIRGRIEGEIGS----FPYQK  168



>ref|XP_008813516.1| PREDICTED: uncharacterized protein LOC103724133, partial [Phoenix 
dactylifera]
Length=277

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = +1

Query  238  RASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllk  417
            R  GNREAVRKYREKKKA TA LE+E+ +LRA+N+Q++K+++ QV LEAEV RLR LL+ 
Sbjct  89   RPIGNREAVRKYREKKKAQTASLEDEIVQLRALNQQLMKRLQGQVALEAEVARLRCLLVD  148

Query  418  lrDKIDSESGAGHSGFPFQK  477
            +R +I+ E GA    FP+ +
Sbjct  149  IRGRIEGEIGA----FPYYR  164



>ref|XP_008790182.1| PREDICTED: uncharacterized protein LOC103707462 [Phoenix dactylifera]
Length=268

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = +1

Query  238  RASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllk  417
            R  GNREAVRKYREKKKA TA LE+E+ +LRA+N+Q++K+++ QV LEAEV RLR LL+ 
Sbjct  91   RPIGNREAVRKYREKKKAQTASLEDEIVQLRALNQQLMKRLQGQVALEAEVARLRCLLVD  150

Query  418  lrDKIDSESGAGHSGFPFQK  477
            +R +I+ E GA    FP+ +
Sbjct  151  IRGRIEGEIGA----FPYYR  166



>ref|NP_001148839.1| LOC100282457 [Zea mays]
 gb|ACG33099.1| DNA binding protein [Zea mays]
Length=267

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 70/113 (62%), Gaps = 16/113 (14%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQSDGEP------------RRRASGNREAVRKYREKKKAHTAYLEEEV  318
            T  H HT I   S  D E             ++R SGNR AVRKYREKKKAHTA LEEEV
Sbjct  63   TCVHVHTKIVAASPGDAESPSENNSNGNAASKKRPSGNRAAVRKYREKKKAHTASLEEEV  122

Query  319  RKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
              LRA+N+Q++KK++    LEAE  RLR LL+ +R +I+ E GA    FP+Q+
Sbjct  123  VHLRALNQQLMKKLQSHAALEAEAARLRCLLVDIRGRIEGEIGA----FPYQR  171



>ref|XP_008647848.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647849.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647850.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647851.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647852.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647853.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 gb|ACF83160.1| unknown [Zea mays]
 gb|ACN29059.1| unknown [Zea mays]
 gb|ACR33895.1| unknown [Zea mays]
 gb|AFU81623.1| bZIP-type transcription factor, partial [Zea mays subsp. mays]
 gb|AFW75759.1| putative bZIP transcription factor superfamily protein isoform 
1 [Zea mays]
 gb|AFW75760.1| putative bZIP transcription factor superfamily protein isoform 
2 [Zea mays]
 gb|AFW75761.1| putative bZIP transcription factor superfamily protein isoform 
3 [Zea mays]
 gb|AFW75762.1| putative bZIP transcription factor superfamily protein isoform 
4 [Zea mays]
 gb|AFW75763.1| putative bZIP transcription factor superfamily protein isoform 
5 [Zea mays]
 gb|AFW75764.1| putative bZIP transcription factor superfamily protein isoform 
6 [Zea mays]
 gb|AFW75765.1| putative bZIP transcription factor superfamily protein isoform 
7 [Zea mays]
Length=267

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 70/113 (62%), Gaps = 16/113 (14%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQSDGEP------------RRRASGNREAVRKYREKKKAHTAYLEEEV  318
            T  H HT I   S  D E             ++R SGNR AVRKYREKKKAHTA LEEEV
Sbjct  63   TCVHVHTKIVAASPGDAESPSENNSNGNAASKKRPSGNRAAVRKYREKKKAHTASLEEEV  122

Query  319  RKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
              LRA+N+Q++KK++    LEAE  RLR LL+ +R +I+ E GA    FP+Q+
Sbjct  123  VHLRALNQQLMKKLQSHAALEAEAARLRCLLVDIRGRIEGEIGA----FPYQR  171



>gb|EMT32714.1| hypothetical protein F775_17324 [Aegilops tauschii]
Length=188

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 67/100 (67%), Gaps = 6/100 (6%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            RRR SGN+ AVRKYREKKKAHTA LEEE  +LRA+NEQ+ KKV+    LEAE  RLR LL
Sbjct  80   RRRPSGNQAAVRKYREKKKAHTALLEEEAARLRAMNEQLAKKVQDHAALEAEAARLRCLL  139

Query  412  lklrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCAVQSS  531
            + +R +I+ E GA    FP+ +   PA    QG   V SS
Sbjct  140  VDVRGRIEGEIGA----FPYHRR--PAKGAGQGGAQVMSS  173



>gb|EAY82198.1| hypothetical protein OsI_37401 [Oryza sativa Indica Group]
Length=783

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 63/83 (76%), Gaps = 4/83 (5%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            R+  GNREAVRKYR+KKKAHTA+LEEEV++LR +N+Q+VK+++ Q  LE EV+RLR+LL+
Sbjct  637  RKPLGNREAVRKYRQKKKAHTAHLEEEVKRLRVINQQLVKRLQGQAALEVEVVRLRSLLV  696

Query  415  klrDKIDSESGAGHSGFPFQKHC  483
             +R +I+   G+     P Q  C
Sbjct  697  DVRSRINGALGS----CPIQAQC  715



>ref|XP_007201303.1| hypothetical protein PRUPE_ppa009913mg [Prunus persica]
 gb|EMJ02502.1| hypothetical protein PRUPE_ppa009913mg [Prunus persica]
Length=272

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 75/120 (63%), Gaps = 24/120 (20%)
 Frame = +1

Query  178  YTHTHT--HIYP----------------NSQSDGE--PRRRASGNREAVRKYREKKKAHT  297
            Y+HTHT  H++                 ++   GE   ++R  GNREAVRKYREKKKA  
Sbjct  56   YSHTHTCFHVHTKIVSSATGSEDKAGTDDTAESGEKKSKKRPLGNREAVRKYREKKKARA  115

Query  298  AYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            A LE+EV +LR +N+Q++K+++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  116  ASLEDEVVRLRTLNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIEGEIGS----FPYQK  171



>ref|NP_001235033.1| bZIP transcription factor bZIP122 [Glycine max]
 ref|XP_006591930.1| PREDICTED: bZIP transcription factor bZIP122 isoform X8 [Glycine 
max]
 ref|XP_006591931.1| PREDICTED: bZIP transcription factor bZIP122 isoform X9 [Glycine 
max]
 gb|ABI34664.1| bZIP transcription factor bZIP122 [Glycine max]
Length=265

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 73/124 (59%), Gaps = 19/124 (15%)
 Frame = +1

Query  172  QTYTHTHTHIYPNSQSD---------------GEPRRRASGNREAVRKYREKKKAHTAYL  306
             T  H HT I P  + D                  ++R+ GN+EAVRKYREKKKA  A L
Sbjct  59   HTCYHVHTKIVPAPEEDHVATDDTAESAEKKSSSSKKRSLGNKEAVRKYREKKKARAASL  118

Query  307  EEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCD  486
            E+EV KLRA+N+ ++KK++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK   
Sbjct  119  EDEVVKLRALNQHLMKKLKGQAALEAEIARLKCLLVDIRGRIEGEIGS----FPYQKPTP  174

Query  487  PATP  498
             A P
Sbjct  175  NANP  178



>ref|XP_006591923.1| PREDICTED: bZIP transcription factor bZIP122 isoform X1 [Glycine 
max]
 ref|XP_006591924.1| PREDICTED: bZIP transcription factor bZIP122 isoform X2 [Glycine 
max]
 ref|XP_006591925.1| PREDICTED: bZIP transcription factor bZIP122 isoform X3 [Glycine 
max]
 ref|XP_006591926.1| PREDICTED: bZIP transcription factor bZIP122 isoform X4 [Glycine 
max]
 ref|XP_006591927.1| PREDICTED: bZIP transcription factor bZIP122 isoform X5 [Glycine 
max]
 ref|XP_006591928.1| PREDICTED: bZIP transcription factor bZIP122 isoform X6 [Glycine 
max]
 ref|XP_006591929.1| PREDICTED: bZIP transcription factor bZIP122 isoform X7 [Glycine 
max]
Length=271

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 73/124 (59%), Gaps = 19/124 (15%)
 Frame = +1

Query  172  QTYTHTHTHIYPNSQSD---------------GEPRRRASGNREAVRKYREKKKAHTAYL  306
             T  H HT I P  + D                  ++R+ GN+EAVRKYREKKKA  A L
Sbjct  59   HTCYHVHTKIVPAPEEDHVATDDTAESAEKKSSSSKKRSLGNKEAVRKYREKKKARAASL  118

Query  307  EEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCD  486
            E+EV KLRA+N+ ++KK++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK   
Sbjct  119  EDEVVKLRALNQHLMKKLKGQAALEAEIARLKCLLVDIRGRIEGEIGS----FPYQKPTP  174

Query  487  PATP  498
             A P
Sbjct  175  NANP  178



>gb|KHN39873.1| hypothetical protein glysoja_020613 [Glycine soja]
Length=268

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 72/119 (61%), Gaps = 18/119 (15%)
 Frame = +1

Query  163  NNAQTYTHTHTHIYPNSQSD--------------GEPRRRASGNREAVRKYREKKKAHTA  300
            ++  T  H HT I P  + D                 ++R  GN+EAVRKYREKKKA  A
Sbjct  56   SHTHTCYHVHTKIVPAPEEDQVATDDTAESAEKKSSSKKRPLGNKEAVRKYREKKKARAA  115

Query  301  YLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
             LE+EV KLRA+N+ ++KK++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  116  SLEDEVVKLRALNQHLMKKLQGQAALEAEIARLKCLLVDIRGRIEGEIGS----FPYQK  170



>ref|XP_006590380.1| PREDICTED: bZIP transcription factor bZIP121 isoform X1 [Glycine 
max]
 ref|XP_006590381.1| PREDICTED: bZIP transcription factor bZIP121 isoform X2 [Glycine 
max]
 ref|XP_006590382.1| PREDICTED: bZIP transcription factor bZIP121 isoform X3 [Glycine 
max]
Length=270

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 70/115 (61%), Gaps = 18/115 (16%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQSD--------------GEPRRRASGNREAVRKYREKKKAHTAYLEE  312
            T  H HT I P  + D                 ++R  GN+EAVRKYREKKKA  A LE+
Sbjct  60   TCYHVHTKIVPAPEEDQVATDDTAESAEKKSSSKKRPLGNKEAVRKYREKKKARAASLED  119

Query  313  EVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            EV KLRA+N+ ++KK++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  120  EVVKLRALNQHLMKKLQGQAALEAEIARLKCLLVDIRGRIEGEIGS----FPYQK  170



>ref|NP_001237296.1| bZIP transcription factor bZIP121 [Glycine max]
 gb|ABI34680.1| bZIP transcription factor bZIP121 [Glycine max]
Length=270

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 70/116 (60%), Gaps = 18/116 (16%)
 Frame = +1

Query  172  QTYTHTHTHIYPNSQSD--------------GEPRRRASGNREAVRKYREKKKAHTAYLE  309
             T  H HT I P  + D                 ++R  GN+EAVRKYREKKKA  A LE
Sbjct  59   HTCYHVHTKIVPAPEEDHVATDDTAESAEKKSSSKKRPLGNKEAVRKYREKKKARAASLE  118

Query  310  EEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            +EV KLRA+N+ ++KK++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  119  DEVVKLRALNQHLMKKLQGQAALEAEIARLKCLLVDIRGRIEGEIGS----FPYQK  170



>ref|XP_009395145.1| PREDICTED: uncharacterized protein LOC103980446 [Musa acuminata 
subsp. malaccensis]
Length=204

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 67/88 (76%), Gaps = 4/88 (5%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            RRR  GNREAVRKYREKKKAH A+LEEEV+KLR +N+Q++++++ Q  LEAEV+RLR LL
Sbjct  78   RRRPLGNREAVRKYREKKKAHAAFLEEEVKKLRLLNQQLLRRLQGQAALEAEVVRLRDLL  137

Query  412  lklrDKIDSESGAGHSGFP-FQKHCDPA  492
              LR KID+E G    GFP   K C PA
Sbjct  138  ADLRGKIDAEVGG---GFPLLLKKCSPA  162



>ref|XP_009624365.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
 ref|XP_009624366.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
 ref|XP_009624367.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
 ref|XP_009624368.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
Length=263

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 73/114 (64%), Gaps = 13/114 (11%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYPNSQSDGE-------PRRRASGNREAVRKYREKKKAHTAYLEEE  315
            +N+ T+T  H HT + P    D          ++R   N+EAVRKYREK KA  A LE+E
Sbjct  54   DNSHTHTCYHVHTKVVPPLSDDTAESAENKIGKKRPLSNKEAVRKYREKNKARVASLEDE  113

Query  316  VRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            V +LRA+N+Q++K+++ Q VLEAE+ +L+ LL+ +R +I+ + G     FP+QK
Sbjct  114  VVRLRAINQQLLKRLQGQSVLEAEISKLKCLLVDIRGRIEGDIGF----FPYQK  163



>gb|EMS47152.1| hypothetical protein TRIUR3_12850 [Triticum urartu]
Length=195

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 91/181 (50%), Gaps = 56/181 (31%)
 Frame = +1

Query  124  SLSVGSVLDGMLRNNAQTY---THTHT-----HIYPNSQS--------------------  219
            S+S+GS  D +L   A+     THTHT     H  P++ +                    
Sbjct  10   SMSMGSYFDDLLGGTAEHLACCTHTHTCNPPAHDLPHTHTCHHVHSKFAASASSDAAADS  69

Query  220  DGEP----------RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQ  369
              EP          +RR SGNR AVRKYREKKK HTA L+EE  +LRA+NEQ+ KKV+  
Sbjct  70   PTEPEDAHATSRSKKRRPSGNRAAVRKYREKKKEHTAVLQEEAARLRAMNEQLTKKVQDH  129

Query  370  VVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCAVQSSGKGPGN  549
              LEAE  RLR LL+ +R +I+ E GA    FP+Q+   PA             G GPG+
Sbjct  130  AALEAEAARLRCLLVDVRGRIEGEIGA----FPYQRR--PA------------KGDGPGS  171

Query  550  A  552
            A
Sbjct  172  A  172



>ref|XP_004499761.1| PREDICTED: uncharacterized protein LOC101513495 isoform X1 [Cicer 
arietinum]
 ref|XP_004499762.1| PREDICTED: uncharacterized protein LOC101513495 isoform X2 [Cicer 
arietinum]
Length=143

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  235  RRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralll  414
            +RASGN+EAV+KYREKKKA TAYLEEEV+KLR VN+Q+V+K++ + +LEAE++RLR +L 
Sbjct  66   KRASGNKEAVKKYREKKKAETAYLEEEVKKLRLVNQQLVRKLQGKQLLEAELLRLRKILA  125

Query  415  klrDKIDSE  441
            +++ KIDSE
Sbjct  126  QVKGKIDSE  134



>ref|XP_009787001.1| PREDICTED: uncharacterized protein LOC104235029 isoform X2 [Nicotiana 
sylvestris]
Length=269

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 77/132 (58%), Gaps = 25/132 (19%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYP-------------NSQSDGEPRRRASGNREAVRKYREKKKAHT  297
            +N+ T++  H HT + P              S  +   ++R   N EAVRKYREK KA  
Sbjct  54   DNSHTHSCYHVHTKVVPPPIEDKILSDDTAESAENKIGKKRPLSNNEAVRKYREKNKARV  113

Query  298  AYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            A LE+EV +LRA+N+Q++K+++ Q VLEAE+ RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  114  ASLEDEVVRLRAINQQLLKRLQGQSVLEAEITRLKCLLVDIRGRIEGEIGS----FPYQK  169

Query  478  HCDPATPFEQGD  513
                  P E  D
Sbjct  170  ------PMESAD  175



>ref|XP_009786999.1| PREDICTED: uncharacterized protein LOC104235029 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009787000.1| PREDICTED: uncharacterized protein LOC104235029 isoform X1 [Nicotiana 
sylvestris]
Length=274

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 77/132 (58%), Gaps = 25/132 (19%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIYP-------------NSQSDGEPRRRASGNREAVRKYREKKKAHT  297
            +N+ T++  H HT + P              S  +   ++R   N EAVRKYREK KA  
Sbjct  54   DNSHTHSCYHVHTKVVPPPIEDKILSDDTAESAENKIGKKRPLSNNEAVRKYREKNKARV  113

Query  298  AYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
            A LE+EV +LRA+N+Q++K+++ Q VLEAE+ RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  114  ASLEDEVVRLRAINQQLLKRLQGQSVLEAEITRLKCLLVDIRGRIEGEIGS----FPYQK  169

Query  478  HCDPATPFEQGD  513
                  P E  D
Sbjct  170  ------PMESAD  175



>dbj|BAJ85954.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=199

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 68/106 (64%), Gaps = 18/106 (17%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            RRR SGNR AVRKYREKKK HTA L+EE  +LRA+N+Q+V+KV+    LEAE  RLR LL
Sbjct  84   RRRPSGNRAAVRKYREKKKEHTAVLQEEAARLRALNDQLVRKVQDHAALEAEAARLRCLL  143

Query  412  lklrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCAVQSSGKGPGN  549
            + +R +I+ E GA    FP+Q+               Q+ G GPG+
Sbjct  144  VDVRGRIEGEIGA----FPYQRR--------------QAKGDGPGS  171



>ref|XP_006846902.1| hypothetical protein AMTR_s00152p00031760 [Amborella trichopoda]
 gb|ERN08483.1| hypothetical protein AMTR_s00152p00031760 [Amborella trichopoda]
Length=293

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 75/130 (58%), Gaps = 25/130 (19%)
 Frame = +1

Query  169  AQTYT--HTHTHIY----PNSQSDG---------------EPRRRASGNREAVRKYREKK  285
            A T+T  H HT I     PN+  D                + ++R  GN+EAVRKYREKK
Sbjct  64   AHTHTCFHVHTKILSSADPNNDDDAAATTGEEESSSINEQQKKKRPLGNKEAVRKYREKK  123

Query  286  KAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGF  465
            KA  A LE+EV  LRA+N Q++KK++ Q  LEAEV RL+ LL+ +R +I+ E G+    F
Sbjct  124  KARAASLEDEVVHLRAMNHQLMKKLQGQAALEAEVARLKCLLVDIRGRIEGEIGS----F  179

Query  466  PFQKHCDPAT  495
            P+     P++
Sbjct  180  PYTNKPPPSS  189



>gb|EMT32723.1| hypothetical protein F775_08202 [Aegilops tauschii]
Length=176

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 86/168 (51%), Gaps = 48/168 (29%)
 Frame = +1

Query  124  SLSVGSVLDGMLRNNAQTY---THTHT-----HIYPNSQS--------------------  219
            S+S+GS  D +L   A+     THTHT     H  P+S +                    
Sbjct  10   SMSMGSYFDDVLGGAAEHLACCTHTHTCNPPAHDLPHSHTCHHVHSKFAASASSDAAADS  69

Query  220  DGEP----------RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQ  369
              EP          +RR SGNR AVRKYREKKK HTA L+EE  +LRA+NEQ+ KKV+  
Sbjct  70   PTEPEDAHATSRSKKRRPSGNRAAVRKYREKKKEHTAVLQEEAARLRAMNEQLTKKVQDH  129

Query  370  VVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKH------CDPAT  495
              LEAE  RLR LL+ +R +I+ E GA    FP+Q+       C P T
Sbjct  130  AALEAEAARLRCLLVDVRGRIEGEIGA----FPYQRRAAKSDECKPGT  173



>ref|XP_010067780.1| PREDICTED: uncharacterized protein LOC104454578 [Eucalyptus grandis]
 ref|XP_010067781.1| PREDICTED: uncharacterized protein LOC104454578 [Eucalyptus grandis]
 ref|XP_010067782.1| PREDICTED: uncharacterized protein LOC104454578 [Eucalyptus grandis]
 gb|KCW65977.1| hypothetical protein EUGRSUZ_G03275 [Eucalyptus grandis]
Length=259

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 64/93 (69%), Gaps = 5/93 (5%)
 Frame = +1

Query  250  NREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDK  429
            N+ AVRKYREKKKAHTA LE+EV++LR  N+Q+  ++  Q  L  EV+RLR LLL LR K
Sbjct  93   NKVAVRKYREKKKAHTACLEQEVQELRMKNQQLNGRLHVQANLYDEVIRLRRLLLDLRGK  152

Query  430  IDSESGAGHSGFPFQKHCDPATPFEQGDCAVQS  528
            ID E G      PFQK C+  +  ++GDC VQS
Sbjct  153  IDYELGL----MPFQKPCNYMS-IKEGDCGVQS  180



>gb|KHN25468.1| hypothetical protein glysoja_010385 [Glycine soja]
Length=247

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 63/91 (69%), Gaps = 8/91 (9%)
 Frame = +1

Query  238  RASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVE----RQVVLEAEVMrlra  405
            R+ GN+EAVRKYREKKKA  A LE+EV KLRA+N+ ++KK++     Q  LEAE+ RL+ 
Sbjct  74   RSLGNKEAVRKYREKKKARAASLEDEVVKLRALNQHLMKKLKGQAAGQAALEAEIARLKC  133

Query  406  lllklrDKIDSESGAGHSGFPFQKHCDPATP  498
            LL+ +R +I+ E G+    FP+QK    A P
Sbjct  134  LLVDIRGRIEGEIGS----FPYQKPTPNANP  160



>gb|EMS52367.1| hypothetical protein TRIUR3_01653 [Triticum urartu]
Length=182

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 64/97 (66%), Gaps = 6/97 (6%)
 Frame = +1

Query  232  RRRASGNREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlrall  411
            +RR  GNR AVRKYREKKK HTA L+EE  +LRA+NEQ+ KKV+    LEAE  RLR LL
Sbjct  80   KRRPLGNRAAVRKYREKKKEHTAVLQEEAARLRAMNEQLTKKVQDHAALEAEAARLRCLL  139

Query  412  lklrDKIDSESGAGHSGFPFQKHCDPATPFEQGDCAV  522
            + +R +I+ E GA    FP+Q+   PA    QG   +
Sbjct  140  VDVRGRIEGEIGA----FPYQRR--PAKGAGQGGAQI  170



>ref|XP_010327411.1| PREDICTED: uncharacterized protein LOC104649609 [Solanum lycopersicum]
 ref|XP_010327412.1| PREDICTED: uncharacterized protein LOC104649609 [Solanum lycopersicum]
Length=262

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 75/127 (59%), Gaps = 20/127 (16%)
 Frame = +1

Query  163  NNAQTYT--HTHTHIY--PNSQSDGEP------RRRASGNREAVRKYREKKKAHTAYLEE  312
            +N+ T+T  H HT +   P   +  E       ++R+  N+EAVRKY EKKKA  A LEE
Sbjct  54   DNSHTHTCYHVHTKVVTPPRDDTTAESTAANVGKKRSLSNKEAVRKYCEKKKARVASLEE  113

Query  313  EVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPA  492
            EV +LR +N+Q++ +++ Q VLEAEV RL+ LL+ +R +I  E G+    FP+ K     
Sbjct  114  EVVRLRDINQQLLNRLQGQAVLEAEVSRLKCLLVDIRGRIAGEIGS----FPYHK-----  164

Query  493  TPFEQGD  513
             P E  D
Sbjct  165  -PMEGAD  170



>ref|XP_009376950.1| PREDICTED: uncharacterized protein LOC103965600 [Pyrus x bretschneideri]
 ref|XP_009376951.1| PREDICTED: uncharacterized protein LOC103965600 [Pyrus x bretschneideri]
Length=268

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 69/118 (58%), Gaps = 14/118 (12%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQSD--------GE--PRRRASGNREAVRKYREKKKAHTAYLEEEVRK  324
            T  H HT I  ++  D        GE   +++  GN+ AVRKYRE KKA    LE EV  
Sbjct  61   TCFHVHTKIVSSASEDKADDTCESGEKKSKKQPLGNKVAVRKYRENKKARVKLLEAEVVN  120

Query  325  LRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATP  498
            LRA N Q+V +++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK  +P+ P
Sbjct  121  LRAENRQLVMRLQGQPALEAEIARLKCLLVDIRGRIEGEIGS----FPYQKSVNPSLP  174



>ref|XP_009376970.1| PREDICTED: uncharacterized protein LOC103965622 [Pyrus x bretschneideri]
Length=268

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 69/118 (58%), Gaps = 14/118 (12%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQSD--------GE--PRRRASGNREAVRKYREKKKAHTAYLEEEVRK  324
            T  H HT I  ++  D        GE   +++  GN+ AVRKYRE KKA    LE EV  
Sbjct  61   TCFHVHTKIVSSASEDKADDTCESGEKKSKKQPLGNKVAVRKYRENKKARVKLLEAEVVN  120

Query  325  LRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATP  498
            LRA N Q+V +++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK  +P+ P
Sbjct  121  LRAENRQLVMRLQGQPALEAEIARLKCLLVDIRGRIEGEIGS----FPYQKSVNPSLP  174



>ref|XP_009355669.1| PREDICTED: uncharacterized protein LOC103946638 [Pyrus x bretschneideri]
Length=263

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 71/120 (59%), Gaps = 16/120 (13%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQSD----------GE--PRRRASGNREAVRKYREKKKAHTAYLEEEV  318
            T  H HT I  ++  D          GE   +++  GN+ AVRKYREK+KA    LE+EV
Sbjct  54   TCFHVHTKILSSASEDKAGTDDTAESGEKKSKKQPLGNKVAVRKYREKEKARVKLLEDEV  113

Query  319  RKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQKHCDPATP  498
              LRA N ++V +++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK  +P+ P
Sbjct  114  LNLRAENRRLVMRLQGQPALEAEIARLKCLLVDIRGRIEGEIGS----FPYQKSVNPSLP  169



>gb|EMS52399.1| hypothetical protein TRIUR3_11502 [Triticum urartu]
Length=259

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 77/130 (59%), Gaps = 20/130 (15%)
 Frame = +1

Query  130  SVGSVLDGMLRNNAQTYTHTHTHIYPNSQSDGEPRRRASGNREAVRKYREKKKAHTAYLE  309
            S+ S  DG+L N+ +    THTH   N   D           + VRKYREKKKAHTA LE
Sbjct  54   SMDSYFDGIL-NDTEHLACTHTHTC-NPPVD-----------DTVRKYREKKKAHTALLE  100

Query  310  EEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQ---KH  480
            EEV +L+A+N+Q++KK++    LEAE  RLR LL+ +R +ID E G     FP+Q   K+
Sbjct  101  EEVVQLKALNKQLLKKLQNHAALEAEAARLRCLLVDIRGRIDGEIGT----FPYQRPVKN  156

Query  481  CDPATPFEQG  510
             D  +  +QG
Sbjct  157  VDLVSGVDQG  166



>ref|XP_008377738.1| PREDICTED: uncharacterized protein LOC103440807 [Malus domestica]
 ref|XP_008377739.1| PREDICTED: uncharacterized protein LOC103440807 [Malus domestica]
Length=263

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 67/113 (59%), Gaps = 16/113 (14%)
 Frame = +1

Query  175  TYTHTHTHIYPNSQSD----------GE--PRRRASGNREAVRKYREKKKAHTAYLEEEV  318
            T  H HT I  ++  D          GE   +++  GN+ AVRKYREK+KA    LE+EV
Sbjct  54   TCFHVHTKILSSASEDKAGTDDTAESGEKKSKKQPLGNKVAVRKYREKEKARVKLLEDEV  113

Query  319  RKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDKIDSESGAGHSGFPFQK  477
              LRA N ++V +++ Q  LEAE+ RL+ LL+ +R +I+ E G+    FP+QK
Sbjct  114  VNLRAENRRLVMRLQGQPALEAEIARLKCLLVDIRGRIEGEIGS----FPYQK  162



>ref|XP_010694687.1| PREDICTED: GATA zinc finger domain-containing protein 4-like 
[Beta vulgaris subsp. vulgaris]
Length=275

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +1

Query  250  NREAVRKYREKKKAHTAYLEEEVRKLRAVNEQMVKKVERQVVLEAEVMrlralllklrDK  429
            NREAVRKYREK K   A LE+E+++L+ +N+Q++KK+E +  ++AE+  L++LL+ +R +
Sbjct  136  NREAVRKYREKLKTREAALEDEIKELKTLNQQLLKKLEGEAAMQAEIYWLKSLLVDIRGR  195

Query  430  IDSESGAGHSGFP  468
            I+ E+ +   G P
Sbjct  196  IEGETRSFRYGRP  208



>gb|EEE51623.1| hypothetical protein OsJ_32902 [Oryza sativa Japonica Group]
Length=1042

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  235   RRASGNREAVRKYREKKKAHTAYLEEEVRK  324
             R+  GNREAVRKYR+KKKAHTA+LEEEV +
Sbjct  1004  RKPLGNREAVRKYRQKKKAHTAHLEEEVEE  1033



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 959982664718