BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15479_g1_i1 len=1757 path=[1:0-1054 @1056@!:1055-1464
3484:1465-1465 1466:1466-1756]

Length=1757
                                                                      Score     E

ref|XP_006338238.1|  PREDICTED: mediator of RNA polymerase II tra...    378   4e-143   
ref|XP_004232066.1|  PREDICTED: mediator of RNA polymerase II tra...    374   4e-141   
ref|XP_006338239.1|  PREDICTED: mediator of RNA polymerase II tra...    371   5e-141   
ref|XP_009757336.1|  PREDICTED: putative mediator of RNA polymera...    335   2e-129   
ref|XP_009591714.1|  PREDICTED: putative mediator of RNA polymera...    333   4e-128   
ref|XP_008361379.1|  PREDICTED: uncharacterized protein LOC103425081    320   3e-122   
dbj|BAO49731.1|  nuclear pore complex protein Nup58a                    310   4e-122   
ref|XP_007047129.1|  Hydroxyproline-rich glycoprotein family protein    320   7e-122   
ref|XP_003635636.2|  PREDICTED: nuclear pore complex protein NUP5...    317   1e-121   
ref|XP_009366224.1|  PREDICTED: polyhomeotic-proximal chromatin p...    317   9e-121   
ref|XP_008339088.1|  PREDICTED: uncharacterized serine-rich prote...    316   1e-120   
ref|XP_009376485.1|  PREDICTED: forkhead box protein O-like             313   2e-119   
gb|ACY30439.1|  hypothetical protein                                    306   2e-119   Nicotiana tabacum [American tobacco]
ref|XP_010088996.1|  hypothetical protein L484_020279                   303   8e-119   
ref|XP_010548383.1|  PREDICTED: uncharacterized protein LOC104819...    316   1e-117   
ref|XP_010548384.1|  PREDICTED: uncharacterized protein LOC104819...    316   1e-117   
ref|XP_010070489.1|  PREDICTED: uncharacterized protein LOC104457250    301   1e-117   
ref|XP_010548382.1|  PREDICTED: uncharacterized protein LOC104819...    316   2e-117   
ref|XP_008241573.1|  PREDICTED: uncharacterized serine-rich prote...    310   4e-117   
ref|XP_007202048.1|  hypothetical protein PRUPE_ppa004547mg             309   7e-117   
ref|XP_003517267.1|  PREDICTED: uncharacterized protein LOC100776992    302   1e-116   
gb|KHN36183.1|  Peroxidase A                                            301   4e-116   
ref|XP_011099233.1|  PREDICTED: LOW QUALITY PROTEIN: nuclear pore...    294   1e-115   
ref|XP_010680500.1|  PREDICTED: nuclear pore complex protein NUP58      304   1e-115   
gb|KDP31861.1|  hypothetical protein JCGZ_12322                         303   1e-115   
ref|XP_003537376.1|  PREDICTED: uncharacterized serine-rich prote...    292   1e-115   
ref|XP_006590668.1|  PREDICTED: uncharacterized serine-rich prote...    292   1e-115   
ref|XP_006425809.1|  hypothetical protein CICLE_v10025487mg             292   2e-115   
ref|XP_006466667.1|  PREDICTED: uncharacterized serine-rich prote...    291   4e-115   
ref|XP_006466666.1|  PREDICTED: uncharacterized serine-rich prote...    291   6e-115   
ref|XP_004511979.1|  PREDICTED: serine-rich adhesin for platelets...    286   3e-113   
ref|XP_008440230.1|  PREDICTED: uncharacterized serine-rich prote...    281   5e-112   
ref|XP_007156848.1|  hypothetical protein PHAVU_002G022500g             287   5e-112   
ref|XP_004301860.1|  PREDICTED: uncharacterized protein LOC101302275    294   2e-111   
ref|XP_004141933.1|  PREDICTED: uncharacterized protein LOC101220...    280   1e-110   
ref|XP_004141932.1|  PREDICTED: uncharacterized protein LOC101220...    280   2e-110   
ref|XP_004167287.1|  PREDICTED: uncharacterized LOC101220360            278   4e-110   
gb|KHN42049.1|  Peroxidase A                                            291   1e-109   
ref|XP_010437281.1|  PREDICTED: mediator of RNA polymerase II tra...    283   2e-109   
ref|XP_006283606.1|  hypothetical protein CARUB_v10004663mg             281   1e-108   
ref|XP_002866977.1|  hydroxyproline-rich glycoprotein family protein    281   1e-108   
ref|XP_010432110.1|  PREDICTED: putative mediator of RNA polymera...    279   5e-108   
ref|XP_006411941.1|  hypothetical protein EUTSA_v10025060mg             283   6e-108   
ref|NP_195430.2|  hydroxyproline-rich glycoprotein family protein       279   8e-108   Arabidopsis thaliana [mouse-ear cress]
emb|CAB16782.1|  nucleoporin-like protein                               279   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003611836.1|  Peroxidase A                                       273   1e-107   
ref|XP_010446718.1|  PREDICTED: putative mediator of RNA polymera...    276   4e-107   
ref|XP_010446719.1|  PREDICTED: putative mediator of RNA polymera...    276   5e-107   
ref|XP_002522356.1|  conserved hypothetical protein                     269   1e-105   Ricinus communis
ref|XP_006856242.1|  hypothetical protein AMTR_s00059p00214550          272   9e-105   
gb|KFK30341.1|  hypothetical protein AALP_AA7G249000                    273   4e-103   
emb|CDX75613.1|  BnaA01g00890D                                          259   2e-102   
ref|XP_009140235.1|  PREDICTED: uncharacterized protein LOC103864202    257   6e-102   
ref|XP_011039245.1|  PREDICTED: nuclear pore complex protein NUP5...    254   3e-100   
ref|XP_011039244.1|  PREDICTED: nuclear pore complex protein NUP5...    253   5e-100   
emb|CDX69263.1|  BnaC01g01900D                                          246   9e-99    
ref|XP_009397295.1|  PREDICTED: uncharacterized protein LOC103982182    260   2e-97    
emb|CDY44056.1|  BnaA08g15500D                                          255   6e-95    
ref|XP_009109352.1|  PREDICTED: uncharacterized protein LOC103835013    256   2e-94    
ref|XP_010263779.1|  PREDICTED: uncharacterized protein LOC104601956    308   6e-94    
ref|XP_008440231.1|  PREDICTED: uncharacterized protein DDB_G0271...    282   3e-93    
ref|XP_010941868.1|  PREDICTED: nuclear pore complex protein NUP58      245   3e-93    
emb|CDP02451.1|  unnamed protein product                                306   7e-93    
ref|XP_008813222.1|  PREDICTED: uncharacterized protein LOC103723909    245   2e-92    
emb|CDY62340.1|  BnaCnng39960D                                          244   3e-92    
gb|KDO79366.1|  hypothetical protein CISIN_1g015366mg                   292   1e-89    
gb|KDO79367.1|  hypothetical protein CISIN_1g015366mg                   291   2e-88    
gb|EYU44345.1|  hypothetical protein MIMGU_mgv1a004636mg                291   5e-87    
ref|NP_001132589.1|  nucleoporin p58/p45                                225   2e-83    Zea mays [maize]
ref|XP_008650940.1|  PREDICTED: nucleoporin p58/p45 isoform X1          226   5e-82    
ref|XP_003632460.2|  PREDICTED: nuclear pore complex protein NUP5...    186   8e-82    
ref|NP_001149260.1|  nucleoporin p58/p45                                224   3e-81    Zea mays [maize]
ref|XP_004956993.1|  PREDICTED: nuclear pore complex protein Nup2...    207   4e-78    
gb|EMT16289.1|  hypothetical protein F775_31538                         197   2e-75    
gb|EPS70070.1|  hypothetical protein M569_04692                         254   1e-73    
ref|XP_011039243.1|  PREDICTED: nuclear pore complex protein NUP5...    254   5e-73    
ref|XP_002310761.2|  hypothetical protein POPTR_0007s11760g             250   9e-72    Populus trichocarpa [western balsam poplar]
gb|EEC84690.1|  hypothetical protein OsI_31617                          236   5e-67    Oryza sativa Indica Group [Indian rice]
ref|NP_001063345.1|  Os09g0453500                                       236   6e-67    Oryza sativa Japonica Group [Japonica rice]
gb|EMS57385.1|  hypothetical protein TRIUR3_04014                       196   2e-63    
ref|XP_004981650.1|  PREDICTED: uncharacterized protein LOC101784961    178   2e-60    
gb|EEE59989.1|  hypothetical protein OsJ_12705                          166   9e-58    Oryza sativa Japonica Group [Japonica rice]
gb|EEC76237.1|  hypothetical protein OsI_13655                          165   1e-57    Oryza sativa Indica Group [Indian rice]
ref|XP_003559394.2|  PREDICTED: uncharacterized protein LOC100840866    149   2e-56    
ref|XP_003578215.1|  PREDICTED: uncharacterized protein YMR317W         201   2e-53    
ref|XP_001765100.1|  predicted protein                                  178   8e-53    
dbj|BAK04506.1|  predicted protein                                      196   9e-52    
gb|AAP50947.1|  hypothetical protein                                    165   4e-51    Oryza sativa Japonica Group [Japonica rice]
gb|ABF99044.1|  nucleoporin, putative, expressed                        155   2e-48    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA51590.1|  TPA: hypothetical protein ZEAMMB73_978488              153   1e-43    
ref|XP_008666876.1|  PREDICTED: uncharacterized protein LOC103645634    156   5e-39    
gb|EMT25811.1|  hypothetical protein F775_23907                         116   2e-31    
gb|EMS46427.1|  hypothetical protein TRIUR3_01275                     95.5    3e-18    
ref|XP_008380789.1|  PREDICTED: putative GATA zinc finger domain-...  84.7    6e-16    
emb|CDY08623.1|  BnaC04g19320D                                        76.6    2e-13    
ref|XP_008665480.1|  PREDICTED: uncharacterized protein LOC103644062  67.4    3e-09    
emb|CDY61927.1|  BnaCnng38700D                                        60.5    1e-07    
ref|XP_005850499.1|  hypothetical protein CHLNCDRAFT_56832            63.9    2e-07    
ref|XP_002952378.1|  hypothetical protein VOLCADRAFT_105503           63.9    2e-07    
sp|P84752.1|PERA_ALOVR  RecName: Full=Peroxidase A                    61.2    1e-06    Aloe vera [acibar]
gb|AFK48117.1|  unknown                                               53.9    1e-05    
ref|XP_002307490.1|  hydroxyproline-rich glycoprotein                 48.9    6e-04    Populus trichocarpa [western balsam poplar]



>ref|XP_006338238.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Solanum tuberosum]
Length=534

 Score =   378 bits (970),  Expect(2) = 4e-143, Method: Compositional matrix adjust.
 Identities = 259/340 (76%), Positives = 292/340 (86%), Gaps = 4/340 (1%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatp-sqaSGAIVAPTSS  1296
             +K+IL ELM VVKDMLRNTEV VRSFMMLRPRF HQ+ PA++S T  SQASGA VAPT+S
Sbjct  196   QKAILQELMIVVKDMLRNTEVGVRSFMMLRPRFHHQSAPAAASVTAPSQASGATVAPTAS  255

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDRKsl  1119
               A + PN  +FDFYSGIPKKPSPF+QQT+ARFEK+L ECRQWVEELEQL+ LDSDR S+
Sbjct  256   GSAQSTPNAAIFDFYSGIPKKPSPFLQQTVARFEKYLVECRQWVEELEQLMALDSDRNSM  315

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             NSS SLLQSLP+VMSNVH FFVHVAAKVESIHQYIESMKTAYL DQRRRG+ SDPFLEAD
Sbjct  316   NSSSSLLQSLPKVMSNVHGFFVHVAAKVESIHQYIESMKTAYLADQRRRGDGSDPFLEAD  375

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasg  759
             RRETAKQEAAA+RVHPTLHLP   QP+TQV GL  SSAAPG S  PQ S+ +S +S  SG
Sbjct  376   RRETAKQEAAAKRVHPTLHLPTISQPSTQVAGLISSSAAPGVSGTPQMSSAVSFASTGSG  435

Query  758   sslfsTpaiaasssslfstptasapAVSLFG-SGASPQTSLFGFLATSSPAFSTPNLFGS  582
             SSLF+TP++AASSSSLF+TPT SAP  SLFG SGASPQ+SLFG L+TS+PAFSTP LFGS
Sbjct  436   SSLFATPSVAASSSSLFTTPTMSAPVSSLFGTSGASPQSSLFGSLSTSTPAFSTP-LFGS  494

Query  581   TPSSGVTNfstpfatgaatgsgssfgTLSKARAKSRPGRR  462
             TP+SGV++F+TPFA+GA   SG+SFGT SK RAKSR GRR
Sbjct  495   TPASGVSSFATPFASGATLASGASFGTQSKTRAKSRTGRR  534


 Score =   160 bits (404),  Expect(2) = 4e-143, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             +LFTN KTPATY TKWADLHPDSQK+LLQIEE+ILEYRDESQRLDQCSRLYDSSVSNDGF
Sbjct  116   YLFTNDKTPATYSTKWADLHPDSQKLLLQIEERILEYRDESQRLDQCSRLYDSSVSNDGF  175

Query  1533  ELDSSHNIQELVGISTSMERQKKYI  1459
             ELD+S +IQEL GISTSMERQK  +
Sbjct  176   ELDASRSIQELGGISTSMERQKAIL  200



>ref|XP_004232066.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 [Solanum lycopersicum]
Length=536

 Score =   374 bits (959),  Expect(2) = 4e-141, Method: Compositional matrix adjust.
 Identities = 260/340 (76%), Positives = 295/340 (87%), Gaps = 4/340 (1%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatps-qaSGAIVAPTSS  1296
             +K+IL ELM VVKDMLRNTEVAVRSFMMLRP+FLHQ+ PA++SAT   QASGA VAPT+S
Sbjct  198   QKAILQELMIVVKDMLRNTEVAVRSFMMLRPKFLHQSAPATASATAPSQASGATVAPTAS  257

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDRKsl  1119
               A + PN  +FDFYSGIPKKPSPF+QQT+ARFEK+L ECRQWVEELEQL+ LDSDR S+
Sbjct  258   GSAQSTPNAAIFDFYSGIPKKPSPFLQQTVARFEKYLVECRQWVEELEQLMALDSDRNSM  317

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             NS+ SLLQSLP VMSNVH FFVHVAAKVESIHQYIESMKTAYL DQRRRG+ SDPFLEAD
Sbjct  318   NSNSSLLQSLPNVMSNVHGFFVHVAAKVESIHQYIESMKTAYLADQRRRGDGSDPFLEAD  377

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasg  759
             RRETAKQEAAA+RVHPTLHLP   QP+TQV GL  SSAAPG S  PQTS+ +S++SA SG
Sbjct  378   RRETAKQEAAAKRVHPTLHLPTISQPSTQVAGLISSSAAPGVSGTPQTSSAVSSASAGSG  437

Query  758   sslfsTpaiaasssslfstptasapAVSLFG-SGASPQTSLFGFLATSSPAFSTPNLFGS  582
             SSLF+TP++AASSSSLF+TPT SAP  SLFG SGASPQ+SLFG L+TS+PAFSTP LFGS
Sbjct  438   SSLFATPSVAASSSSLFTTPTMSAPVSSLFGTSGASPQSSLFGSLSTSTPAFSTP-LFGS  496

Query  581   TPSSGVTNfstpfatgaatgsgssfgTLSKARAKSRPGRR  462
             TP+SGV++F+TPFA+G A  SG+SFGT SK RAKSR  RR
Sbjct  497   TPASGVSSFATPFASGPALASGASFGTQSKTRAKSRTSRR  536


 Score =   157 bits (397),  Expect(2) = 4e-141, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             +LFTN KTPATY TKW DLHPDSQK+LLQIEE+ILEYRDESQRLDQCSRLYDSSVSNDGF
Sbjct  118   YLFTNDKTPATYSTKWTDLHPDSQKLLLQIEERILEYRDESQRLDQCSRLYDSSVSNDGF  177

Query  1533  ELDSSHNIQELVGISTSMERQKKYI  1459
             ELD+S +IQEL GISTSMERQK  +
Sbjct  178   ELDASRSIQELGGISTSMERQKAIL  202



>ref|XP_006338239.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X2 [Solanum tuberosum]
Length=533

 Score =   371 bits (952),  Expect(2) = 5e-141, Method: Compositional matrix adjust.
 Identities = 258/340 (76%), Positives = 291/340 (86%), Gaps = 5/340 (1%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatp-sqaSGAIVAPTSS  1296
             +K+IL ELM VVKDMLRNTEV VRSFMMLRPRF HQ+ PA++S T  SQASGA VAPT+S
Sbjct  196   QKAILQELMIVVKDMLRNTEVGVRSFMMLRPRFHHQSAPAAASVTAPSQASGATVAPTAS  255

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDRKsl  1119
               A + PN  +FDFYSGIPKKPSPF+QQT+ARFEK+L ECRQWVEELEQL+ LDSDR S+
Sbjct  256   GSAQSTPNAAIFDFYSGIPKKPSPFLQQTVARFEKYLVECRQWVEELEQLMALDSDRNSM  315

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             NSS SLLQSLP+VMSNVH FFVHVAAKVESIHQYIESMKTAYL DQRRRG+ SDPFLEAD
Sbjct  316   NSSSSLLQSLPKVMSNVHGFFVHVAAKVESIHQYIESMKTAYLADQRRRGDGSDPFLEAD  375

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasg  759
             RRETAKQEAAA+RVHPTLHLP   QP+TQV GL  SSAAPG S  PQ S+ +S +S  SG
Sbjct  376   RRETAKQEAAAKRVHPTLHLPTISQPSTQVAGLISSSAAPGVSGTPQMSSAVSFASTGSG  435

Query  758   sslfsTpaiaasssslfstptasapAVSLFG-SGASPQTSLFGFLATSSPAFSTPNLFGS  582
             SSLF+TP++AASSSSLF+TPT SAP  SLFG SGASPQ+SLFG L+TS+PAFSTP LFGS
Sbjct  436   SSLFATPSVAASSSSLFTTPTMSAPVSSLFGTSGASPQSSLFGSLSTSTPAFSTP-LFGS  494

Query  581   TPSSGVTNfstpfatgaatgsgssfgTLSKARAKSRPGRR  462
             TP+SGV++F+TPFA+GA   SG+SFGT S  RAKSR GRR
Sbjct  495   TPASGVSSFATPFASGATLASGASFGTQS-TRAKSRTGRR  533


 Score =   160 bits (404),  Expect(2) = 5e-141, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             +LFTN KTPATY TKWADLHPDSQK+LLQIEE+ILEYRDESQRLDQCSRLYDSSVSNDGF
Sbjct  116   YLFTNDKTPATYSTKWADLHPDSQKLLLQIEERILEYRDESQRLDQCSRLYDSSVSNDGF  175

Query  1533  ELDSSHNIQELVGISTSMERQKKYI  1459
             ELD+S +IQEL GISTSMERQK  +
Sbjct  176   ELDASRSIQELGGISTSMERQKAIL  200



>ref|XP_009757336.1| PREDICTED: putative mediator of RNA polymerase II transcription 
subunit 26 [Nicotiana sylvestris]
Length=553

 Score =   335 bits (859),  Expect(2) = 2e-129, Method: Compositional matrix adjust.
 Identities = 257/340 (76%), Positives = 292/340 (86%), Gaps = 4/340 (1%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +K+IL ELM VVKDMLRNTEVAVRSFMMLRPRFL Q+ PA++SAT    + GA VA T+S
Sbjct  215   QKAILQELMVVVKDMLRNTEVAVRSFMMLRPRFLRQSAPAAASATAPSQASGATVAQTAS  274

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQL-ILDSDRKsl  1119
              QA + PN PVFDFY GIPKKP+PF+QQT+ARFEK+L ECRQWVEELEQL +LDSDR S+
Sbjct  275   TQAHSTPNAPVFDFYRGIPKKPTPFLQQTVARFEKYLLECRQWVEELEQLMLLDSDRNSM  334

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             NSS SLLQSLP+VMSNVHDFFVHVAAKVESIHQYIESMKTAYL DQRRRG+ SDPFLEAD
Sbjct  335   NSSSSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLADQRRRGDGSDPFLEAD  394

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasg  759
             RRETAK EAAARRVHPTLHLPA  QP+TQV GL  SSAAPG S+APQTS+ + ++   SG
Sbjct  395   RRETAKLEAAARRVHPTLHLPAISQPSTQVAGLISSSAAPGASSAPQTSSAVPSALPGSG  454

Query  758   sslfsTpaiaasssslfstptasapAVSLFG-SGASPQTSLFGFLATSSPAFSTPNLFGS  582
             SSLF+TP++AASSSSLF+TPT SAP  SLFG SGASPQTSLFG L+TSS   S+  LFGS
Sbjct  455   SSLFATPSVAASSSSLFTTPTISAPVSSLFGTSGASPQTSLFGSLSTSS-PASSAPLFGS  513

Query  581   TPSSGVTNfstpfatgaatgsgssfgTLSKARAKSRPGRR  462
             TP+SGV+ F+TPF +GAA GSG+SFGT+SK+RAKSR GRR
Sbjct  514   TPASGVSGFATPFGSGAALGSGASFGTVSKSRAKSRTGRR  553


 Score =   157 bits (397),  Expect(2) = 2e-129, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             +LFTN KTPATY TKWADLHPDSQK+LLQIEE+ILEYRDESQRLDQCSRLYDSSV+NDGF
Sbjct  135   YLFTNDKTPATYSTKWADLHPDSQKLLLQIEERILEYRDESQRLDQCSRLYDSSVANDGF  194

Query  1533  ELDSSHNIQELVGISTSMERQKKYI  1459
             ELD+S +IQEL G+STSMERQK  +
Sbjct  195   ELDASRSIQELGGVSTSMERQKAIL  219



>ref|XP_009591714.1| PREDICTED: putative mediator of RNA polymerase II transcription 
subunit 23 [Nicotiana tomentosiformis]
Length=556

 Score =   333 bits (853),  Expect(2) = 4e-128, Method: Compositional matrix adjust.
 Identities = 255/340 (75%), Positives = 290/340 (85%), Gaps = 4/340 (1%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +K+IL ELM VVKDMLRNTEVAVRSFMMLRPRFL Q+ PA++S+T    + GA VA T+S
Sbjct  218   QKAILQELMVVVKDMLRNTEVAVRSFMMLRPRFLRQSAPAAASSTAPSQASGATVAQTAS  277

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQL-ILDSDRKsl  1119
              QA + PN PVFDFY GIPKKPSPF+QQT+ARFEK+L ECRQWVEELEQL +LDSDR S+
Sbjct  278   TQAQSTPNAPVFDFYRGIPKKPSPFLQQTVARFEKYLLECRQWVEELEQLMLLDSDRNSM  337

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             NSS SLLQSLP+VMSNVHDFFVHVAAKVESIHQYIESMK AYL DQRRRG+ SDPFLEAD
Sbjct  338   NSSSSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKMAYLADQRRRGDGSDPFLEAD  397

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasg  759
             RRETAK EAAARRVHPTLHLPA  QP+TQV GL  SSAAPG S+APQTS+ + ++   SG
Sbjct  398   RRETAKLEAAARRVHPTLHLPAISQPSTQVAGLISSSAAPGASSAPQTSSAVPSALPGSG  457

Query  758   sslfsTpaiaasssslfstptasapAVSLFG-SGASPQTSLFGFLATSSPAFSTPNLFGS  582
             SSLF+TP++AASSSSLF+TPT SAP  SLFG SGASPQ SLFG L+TSS   S+  LFGS
Sbjct  458   SSLFATPSVAASSSSLFTTPTMSAPVSSLFGTSGASPQNSLFGSLSTSS-PASSAPLFGS  516

Query  581   TPSSGVTNfstpfatgaatgsgssfgTLSKARAKSRPGRR  462
             TP+SGV+ F+TPF +GAA GSG+SFGT+SK+RAKSR GRR
Sbjct  517   TPASGVSGFATPFGSGAALGSGASFGTVSKSRAKSRTGRR  556


 Score =   155 bits (391),  Expect(2) = 4e-128, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             +LFTN KTPATY TKWADLHPDSQK+LLQIEE+ILEYRDESQRLDQCSRLYDSSV+NDGF
Sbjct  138   YLFTNDKTPATYSTKWADLHPDSQKLLLQIEERILEYRDESQRLDQCSRLYDSSVANDGF  197

Query  1533  ELDSSHNIQELVGISTSMERQKKYI  1459
             ELD+S +IQEL G+S SMERQK  +
Sbjct  198   ELDASRSIQELGGVSISMERQKAIL  222



>ref|XP_008361379.1| PREDICTED: uncharacterized protein LOC103425081 [Malus domestica]
Length=501

 Score =   320 bits (821),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 190/226 (84%), Gaps = 1/226 (0%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +K++LHELM +VKDMLRN+EVAVRSFM+LRPRFLH N   +S+AT    + GA V   SS
Sbjct  159   QKAVLHELMAIVKDMLRNSEVAVRSFMILRPRFLHPNAGGTSNATAPSQAPGATVPLXSS  218

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKsln  1116
             +Q T     PVFDFY+GIP+KPSPF+QQTIARFEK+L ECRQW+EELEQL+LDS+R S N
Sbjct  219   SQPTATSXVPVFDFYNGIPRKPSPFLQQTIARFEKYLVECRQWIEELEQLLLDSERTSAN  278

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
                SLLQSLP+VM NVHDFFVHVAAKVESIHQY+ SMKTAYL +QRR+G+ +DPFLEADR
Sbjct  279   DRSSLLQSLPKVMKNVHDFFVHVAAKVESIHQYVVSMKTAYLVNQRRQGDGNDPFLEADR  338

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RETA+QEAAA+RVHPTLHLPA  QP+TQV GLF SS  PGTSTAPQ
Sbjct  339   RETARQEAAAKRVHPTLHLPATSQPSTQVAGLFASSGTPGTSTAPQ  384


 Score =   147 bits (372),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             +LFTN KTPA+YGTKWAD HPDSQK+LLQIEE+IL YRDESQRLDQCSRLYDSS+SND F
Sbjct  79    YLFTNEKTPASYGTKWADXHPDSQKVLLQIEERILGYRDESQRLDQCSRLYDSSISNDAF  138

Query  1533  ELDSSHNIQELVGISTSMERQKKYI  1459
             E D+SH +QEL GI TSM+RQK  +
Sbjct  139   EHDASHILQELGGIGTSMDRQKAVL  163



>dbj|BAO49731.1| nuclear pore complex protein Nup58a [Nicotiana benthamiana]
Length=599

 Score =   310 bits (795),  Expect(2) = 4e-122, Method: Compositional matrix adjust.
 Identities = 255/375 (68%), Positives = 289/375 (77%), Gaps = 39/375 (10%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +K+IL ELM VVKD+LRNTEV VRSFMMLRPRFL Q+ PA++SAT    + GA VA T+S
Sbjct  226   QKAILQELMVVVKDILRNTEVVVRSFMMLRPRFLRQSAPAAASATAPSQASGATVAQTAS  285

Query  1295  AQATTIPNFPVFDFYSGIPKKPS-----------------------------------PF  1221
              QA + PN PVFDFY GIPKKPS                                   PF
Sbjct  286   TQAHSTPNAPVFDFYRGIPKKPSLFLQQTVAQIASSQAHSTPNAPVFDFYRGVPKKPSPF  345

Query  1220  MQQTIARFEKHLAECRQWVEELEQL-ILDSDRKslnssvsllqsLPQVMSNVHDFFVHVA  1044
             +QQT+ARFEK+L ECRQWVEELEQL +LDSDR S+NSS SLLQSLP+VMSNVHDFFVHVA
Sbjct  346   LQQTVARFEKYLLECRQWVEELEQLMLLDSDRNSMNSSSSLLQSLPKVMSNVHDFFVHVA  405

Query  1043  AKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRRETAKQEAAARRVHPTLHLPAAPQ  864
             AKVESIHQYIESMKTAYL DQRRRG+ SDPFLEADRRETAK EAAARRVHPTLHLPA  Q
Sbjct  406   AKVESIHQYIESMKTAYLADQRRRGDGSDPFLEADRRETAKLEAAARRVHPTLHLPAISQ  465

Query  863   PATQVTGLFPSSAAPGTSTAPQtsailstssaasgsslfsTpaiaasssslfstptasap  684
             P+TQV GL  SSAAPG S+APQTS  +S +   SGSSLF+TP++AASSSSLF+TPT SAP
Sbjct  466   PSTQVVGLISSSAAPGASSAPQTSCAVSCALPGSGSSLFATPSVAASSSSLFTTPTMSAP  525

Query  683   AVSLFG-SGASPQTSLFGFLATSSPAFSTPNLFGSTPSSGVTNfstpfatgaatgsgssf  507
               SLFG SGASPQ SLFG L+TSS   S+  LFGSTP+SGV+ F+TPF +GAA GSG+SF
Sbjct  526   VSSLFGTSGASPQPSLFGSLSTSS-PASSAPLFGSTPASGVSGFATPFGSGAALGSGASF  584

Query  506   gTLSKARAKSRPGRR  462
             GT+SK+R+KSR GRR
Sbjct  585   GTVSKSRSKSRTGRR  599


 Score =   157 bits (397),  Expect(2) = 4e-122, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             +LFTN KTPATY TKWADLHPDSQK+LLQIEE+ILEYRDESQRLDQCSRLYDSSV+NDGF
Sbjct  146   YLFTNDKTPATYSTKWADLHPDSQKLLLQIEERILEYRDESQRLDQCSRLYDSSVANDGF  205

Query  1533  ELDSSHNIQELVGISTSMERQKKYI  1459
             ELD+S +IQEL G+STSMERQK  +
Sbjct  206   ELDASRSIQELGGVSTSMERQKAIL  230



>ref|XP_007047129.1| Hydroxyproline-rich glycoprotein family protein [Theobroma cacao]
 gb|EOX91286.1| Hydroxyproline-rich glycoprotein family protein [Theobroma cacao]
Length=486

 Score =   320 bits (819),  Expect(2) = 7e-122, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 188/227 (83%), Gaps = 2/227 (1%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +K++L ELM  VKDMLRNTEVAVRSFMMLRPRFLH N   +S+ T    + GA   P SS
Sbjct  147   QKALLQELMATVKDMLRNTEVAVRSFMMLRPRFLHSNIAGASNTTAPSQAPGATTTPGSS  206

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKsl  1119
             AQ +     PVFDFY G+PKKPS F+Q TIARFEK+L ECRQW+EELEQL+L +SDR S+
Sbjct  207   AQPSAASILPVFDFYHGLPKKPSLFLQHTIARFEKYLGECRQWIEELEQLLLFNSDRNSI  266

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             N + SLLQSLP+VMSNVHDFFVHVAAKVESIHQYIESMKTAYL DQRRRG+V+DPFLEAD
Sbjct  267   NHTSSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLADQRRRGDVNDPFLEAD  326

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RRETAKQEA A+RVHPTLHLPA  QP+TQV GLF SSA PG ++APQ
Sbjct  327   RRETAKQEAVAKRVHPTLHLPANSQPSTQVAGLFASSANPGAASAPQ  373


 Score =   147 bits (372),  Expect(2) = 7e-122, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = -3

Query  1704  TNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGFELD  1525
             TN KTPA+Y TKWADLHPDSQK+LLQIEE+ILEYRDESQRLDQCSRLYDSSVSN+GFELD
Sbjct  70    TNDKTPASYSTKWADLHPDSQKLLLQIEERILEYRDESQRLDQCSRLYDSSVSNEGFELD  129

Query  1524  SSHNIQELVGISTSMERQKKYI  1459
             +SH +QEL G+ST+ME+QK  +
Sbjct  130   ASHIVQELGGVSTAMEQQKALL  151



>ref|XP_003635636.2| PREDICTED: nuclear pore complex protein NUP58-like [Vitis vinifera]
Length=514

 Score =   317 bits (811),  Expect(2) = 1e-121, Method: Compositional matrix adjust.
 Identities = 191/301 (63%), Positives = 228/301 (76%), Gaps = 3/301 (1%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +K++L ELM VVKDMLRNTEVAVRSFMMLRPRFLH    A SSA     + GA V P++S
Sbjct  150   QKAVLQELMAVVKDMLRNTEVAVRSFMMLRPRFLHPGSGAVSSAPAPSQAPGATVVPSAS  209

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKsln  1116
             +Q T     PVFDFYSG+P+KPSPF+ QT+ARFEK+L ECRQW+EELEQL++D DR S N
Sbjct  210   SQLTVTSMAPVFDFYSGLPRKPSPFLLQTVARFEKYLGECRQWIEELEQLLIDFDRNSSN  269

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
              S SLLQSLP+VMSNVHDFFVHVAAKVESIHQYIESMK AYL DQRRRG+ +DPFLEADR
Sbjct  270   GSSSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKMAYLADQRRRGDGNDPFLEADR  329

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasgs  756
             RETAKQEAA++RVHPTLHLPA   P+TQV GL  SS+  G  TAPQ +   ++S +    
Sbjct  330   RETAKQEAASKRVHPTLHLPAVSPPSTQVAGLCASSSTTGALTAPQQTFASASSGSGFSL  389

Query  755   slfsTpaiaasssslfstptasapAV-SLFG-SGASPQTSLFGFLATSSPAFSTPNLFGS  582
                 + A +A+++S   T   ++  V SLFG SGASPQTSLF   ++   + STP+LFGS
Sbjct  390   FGTPSSAPSATTTSSLFTTPTTSAPVPSLFGTSGASPQTSLFNSSSSLFGSSSTPSLFGS  449

Query  581   T  579
             T
Sbjct  450   T  450


 Score =   149 bits (377),  Expect(2) = 1e-121, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             +LFTN K PATY TKWADLHPDSQK LLQIEE+ILEYRDESQRLDQC RLYDSSVSND F
Sbjct  70    YLFTNDKAPATYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCGRLYDSSVSNDAF  129

Query  1533  ELDSSHNIQELVGISTSMERQKKYI  1459
             ELD+S  +QEL G+ST+MERQK  +
Sbjct  130   ELDASRIVQELGGVSTAMERQKAVL  154



>ref|XP_009366224.1| PREDICTED: polyhomeotic-proximal chromatin protein-like [Pyrus 
x bretschneideri]
Length=510

 Score =   317 bits (812),  Expect(2) = 9e-121, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 191/226 (85%), Gaps = 1/226 (0%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +K++L ELM +VKDMLRN+EVAVRSFM+LRPRFLH N  ++S+AT    + GA V P SS
Sbjct  168   QKALLQELMAIVKDMLRNSEVAVRSFMILRPRFLHLNAGSTSNATAPSQAPGATVPPGSS  227

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKsln  1116
             +Q TT    PVFDFY+GIP+KPSPF+QQTIARFEK+L ECRQW+EELEQL+LDS+R  +N
Sbjct  228   SQLTTSSIVPVFDFYNGIPRKPSPFLQQTIARFEKYLVECRQWIEELEQLLLDSERNPVN  287

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
                SLLQSLP+VMSNVHDFFVHVAAKVESIHQY+ SMKTAYL ++RR+G  +DPFLEADR
Sbjct  288   DRSSLLQSLPKVMSNVHDFFVHVAAKVESIHQYVVSMKTAYLVNERRQGYGNDPFLEADR  347

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RETA+QEAAA+RVHPTLHLPA  QP+TQV GLF SS  PGTST PQ
Sbjct  348   RETARQEAAAKRVHPTLHLPATLQPSTQVAGLFASSGTPGTSTTPQ  393


 Score =   146 bits (369),  Expect(2) = 9e-121, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             +LFTN KTPA+YGTKWADLHPDSQKILLQIEE+IL YRDESQRLDQCSRLYDSS+SND F
Sbjct  88    YLFTNDKTPASYGTKWADLHPDSQKILLQIEERILGYRDESQRLDQCSRLYDSSISNDAF  147

Query  1533  ELDSSHNIQELVGISTSMERQKKYI  1459
             E D+S  +QEL GI TSM+RQK  +
Sbjct  148   EHDASRILQELGGIGTSMDRQKALL  172



>ref|XP_008339088.1| PREDICTED: uncharacterized serine-rich protein C215.13 [Malus 
domestica]
Length=515

 Score =   316 bits (809),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 190/226 (84%), Gaps = 1/226 (0%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +K +L ELM +VKDMLRN+EVAVRSFM+LRPRFLH N   +S+AT    + GA + P  S
Sbjct  173   QKVLLQELMAIVKDMLRNSEVAVRSFMILRPRFLHLNAGGTSNATAPSQAPGATLPPGLS  232

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKsln  1116
             +Q TT    PVFDFY+GIP+KPSPF+QQT+ARFEK+L ECRQW+EELEQL+LDS+R S N
Sbjct  233   SQPTTSSIVPVFDFYNGIPRKPSPFLQQTVARFEKYLVECRQWIEELEQLLLDSERNSAN  292

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
                SLLQSLP+VMSNVHDFFVHVAAKVES HQY+ SMKTAYL ++RR+G V+DPFLEADR
Sbjct  293   DRSSLLQSLPKVMSNVHDFFVHVAAKVESFHQYVVSMKTAYLVNERRQGYVNDPFLEADR  352

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RETA+QEAAA+RVHPTLHLPA  QP+TQV+GLF SS  PGTSTAPQ
Sbjct  353   RETARQEAAAKRVHPTLHLPATSQPSTQVSGLFASSGTPGTSTAPQ  398


 Score =   147 bits (370),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             +LFTN KTPA+YGTKWADLHPDSQKILLQIEE+IL YRDESQRLDQCSRLYDSSVSND F
Sbjct  93    YLFTNDKTPASYGTKWADLHPDSQKILLQIEERILGYRDESQRLDQCSRLYDSSVSNDAF  152

Query  1533  ELDSSHNIQELVGISTSMERQK  1468
             E D+S  +QEL GI TSM+RQK
Sbjct  153   EHDASRILQELGGIGTSMDRQK  174



>ref|XP_009376485.1| PREDICTED: forkhead box protein O-like [Pyrus x bretschneideri]
Length=499

 Score =   313 bits (802),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 161/226 (71%), Positives = 187/226 (83%), Gaps = 1/226 (0%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +K++LHELM +VKDMLRN+EVAVRSFM+L PRFLH N  A+S+AT    + GA + P SS
Sbjct  157   EKAVLHELMAIVKDMLRNSEVAVRSFMILHPRFLHPNAGATSNATAPSQAPGATIPPGSS  216

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKsln  1116
             +Q TT    PVFDFY+GIP+KPSPF+QQTIARFEK+L EC QW+EELEQL+LD +R S N
Sbjct  217   SQPTTTSIVPVFDFYNGIPRKPSPFLQQTIARFEKYLVECSQWIEELEQLLLDPERNSAN  276

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
                SLLQSLP VM NVHDFFVHVAAKVESIHQY+ SMKTAYL +QRR+G+ +DPFLEADR
Sbjct  277   DRSSLLQSLPNVMKNVHDFFVHVAAKVESIHQYVVSMKTAYLVNQRRQGDGNDPFLEADR  336

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RETA+QEAAA+R HPTLHL A  QP+TQV GLF SS  PGTSTAPQ
Sbjct  337   RETARQEAAAKRAHPTLHLSATSQPSTQVAGLFASSGTPGTSTAPQ  382


 Score =   145 bits (367),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             +LFTN KTPA+YGTKWADLHPDSQK+LLQIEE+IL YRDESQRLDQCSRLYDSSVSND F
Sbjct  77    YLFTNEKTPASYGTKWADLHPDSQKVLLQIEERILGYRDESQRLDQCSRLYDSSVSNDAF  136

Query  1533  ELDSSHNIQELVGISTSMERQKKYI  1459
             E D+S  +QEL GI TSM+R+K  +
Sbjct  137   EHDASRILQELGGIGTSMDREKAVL  161



>gb|ACY30439.1| hypothetical protein [Nicotiana tabacum]
Length=515

 Score =   306 bits (783),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 186/214 (87%), Gaps = 2/214 (1%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +K+IL ELM VVKDML NTEVAVRSFMMLRPRFL Q+ PA++SAT    + GA VA T+S
Sbjct  256   QKAILQELMVVVKDMLHNTEVAVRSFMMLRPRFLRQSAPAAASATAPSQASGATVAQTAS  315

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQL-ILDSDRKsl  1119
              QA + PN PVFDFY GIPKKP+PF+QQT+ARFEK+L ECRQWVEELEQL +LDSDR S+
Sbjct  316   TQAHSTPNAPVFDFYRGIPKKPTPFLQQTVARFEKYLLECRQWVEELEQLMLLDSDRNSM  375

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             NSS SLLQSLP+VMSNVHDFFVHVAAKVESIHQYIESMKTAYL DQRRRG+ SDPFLEAD
Sbjct  376   NSSSSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLADQRRRGDGSDPFLEAD  435

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLF  837
             RRETAK EAAARRVHPTLHLPA  QP+TQV GL 
Sbjct  436   RRETAKLEAAARRVHPTLHLPAISQPSTQVAGLI  469


 Score =   153 bits (386),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             +LFTN KTPATY TKWADLHPDSQK+LLQIEE+ILEYRD+SQRLDQCSRLYDSSV+NDGF
Sbjct  176   YLFTNDKTPATYSTKWADLHPDSQKLLLQIEERILEYRDKSQRLDQCSRLYDSSVANDGF  235

Query  1533  ELDSSHNIQELVGISTSMERQKKYI  1459
             E+D+S +IQEL G+STSMERQK  +
Sbjct  236   EVDASRSIQELGGVSTSMERQKAIL  260


 Score = 95.1 bits (235),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -3

Query  1623  EEKILEYRDESQRLDQCSRLYDSSVSNDGFELDSSHNIQELVGISTSMERQKKYI  1459
             EE+ILEYRD+SQRLDQCSRLYDSSV+NDGFE+D+S +IQEL G+STSMERQK  +
Sbjct  1     EERILEYRDKSQRLDQCSRLYDSSVANDGFEVDASRSIQELGGVSTSMERQKAIL  55


 Score = 64.7 bits (156),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQ  1365
             +K+IL ELM VVKDML NTEVAVRSFMMLRPRFL Q
Sbjct  51    QKAILQELMVVVKDMLHNTEVAVRSFMMLRPRFLRQ  86



>ref|XP_010088996.1| hypothetical protein L484_020279 [Morus notabilis]
 gb|EXB37223.1| hypothetical protein L484_020279 [Morus notabilis]
Length=528

 Score =   303 bits (777),  Expect(2) = 8e-119, Method: Compositional matrix adjust.
 Identities = 165/226 (73%), Positives = 186/226 (82%), Gaps = 1/226 (0%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +KS+LHELM  VKDMLRNTEVAVRSFMMLRPRF+H N    S AT      GA V P SS
Sbjct  196   QKSLLHELMASVKDMLRNTEVAVRSFMMLRPRFVHPNIGGGSIATAPSQLPGATVPPGSS  255

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKsln  1116
              Q+T     PVFDFY+GIP+KPSPF+QQT+ARFEK+L +CRQW+EELEQL+L    K+  
Sbjct  256   GQSTATSIVPVFDFYNGIPRKPSPFLQQTVARFEKYLCQCRQWIEELEQLLLLDSEKNSC  315

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
             +  SLLQSLP+VMSNVHDFFVHVAAKVESIHQYIESMK AYL DQRRRG+V+DPFLEADR
Sbjct  316   NGASLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKAAYLADQRRRGDVNDPFLEADR  375

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RETA+QEAAA+RVHPTLHLPA  QP+TQV GL  SSA+ GTSTAPQ
Sbjct  376   RETARQEAAAKRVHPTLHLPANSQPSTQVAGLLASSASQGTSTAPQ  421


 Score =   153 bits (386),  Expect(2) = 8e-119, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -3

Query  1707  FTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGFEL  1528
             FTN KTPATYGTKWADLHPDS KILLQIEE+ILEYRDESQRLDQCSRLY+SSVSNDGFE 
Sbjct  118   FTNDKTPATYGTKWADLHPDSHKILLQIEERILEYRDESQRLDQCSRLYNSSVSNDGFEQ  177

Query  1527  DSSHNIQELVGISTSMERQKKYI  1459
             D+SH +QEL GIST+MERQK  +
Sbjct  178   DASHIVQELGGISTAMERQKSLL  200



>ref|XP_010548383.1| PREDICTED: uncharacterized protein LOC104819823 isoform X2 [Tarenaya 
hassleriana]
Length=462

 Score =   316 bits (809),  Expect(2) = 1e-117, Method: Compositional matrix adjust.
 Identities = 199/317 (63%), Positives = 228/317 (72%), Gaps = 17/317 (5%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLH--QNppasssatpsqaSGAIVAPTS  1299
             +K +L ELM V KDMLRN E+AVRSFMMLRPRFLH  Q    SS        GAI    S
Sbjct  113   QKVVLQELMVVAKDMLRNAEIAVRSFMMLRPRFLHSKQGSGVSSGQPSQTPGGAIPTAVS  172

Query  1298  SAQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDRKs  1122
             S Q       PV DFY GIPKKPSPF+QQT+ RFEK+L ECRQW+EELEQL+ LDSD+ +
Sbjct  173   SGQPAATSLVPVADFYRGIPKKPSPFIQQTVVRFEKYLGECRQWIEELEQLLALDSDKNT  232

Query  1121  lnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEA  942
              ++S+      P+VMSNVHDFFVHVAAKVE+IHQYIESM+TAYL DQRRRGE +DPFLEA
Sbjct  233   RHASLLEAL--PKVMSNVHDFFVHVAAKVENIHQYIESMRTAYLADQRRRGECNDPFLEA  290

Query  941   DRRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsa-----ilst  777
             DRRETAKQEAAA+RVHPTLHLPA+ QP+TQV GLF SSA PG S APQ SA         
Sbjct  291   DRRETAKQEAAAKRVHPTLHLPASTQPSTQVAGLFASSATPGASNAPQASAPALMPAAVA  350

Query  776   ssaasgsslfsTpaiaasssslfstptasapAVSLFG-SGASPQTSLFGFLATSSPAF--  606
             +S++ G     T   +A SSSLF+TP++ AP  SLFG S AS Q SLFG  + SS  F  
Sbjct  351   ASSSGGGFSLFTTPSSAPSSSLFATPSSVAPTSSLFGSSNASSQPSLFG--SASSTLFGP  408

Query  605   -STPNLF-GSTPSSGVT  561
              STP+LF GSTPS GVT
Sbjct  409   TSTPSLFGGSTPSLGVT  425


 Score =   137 bits (344),  Expect(2) = 1e-117, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K  A Y TKWADLHPDSQK+LL+IEE+IL YRDESQRLDQCSRLYDSSVSN+ 
Sbjct  32    LYLFTNDKALANYSTKWADLHPDSQKLLLKIEERILGYRDESQRLDQCSRLYDSSVSNEV  91

Query  1536  FELDSSHNIQELVGISTSMERQK  1468
             FELD+S  +QEL GIST+M+RQK
Sbjct  92    FELDASRIVQELGGISTAMDRQK  114



>ref|XP_010548384.1| PREDICTED: uncharacterized protein LOC104819823 isoform X3 [Tarenaya 
hassleriana]
Length=461

 Score =   316 bits (809),  Expect(2) = 1e-117, Method: Compositional matrix adjust.
 Identities = 199/317 (63%), Positives = 228/317 (72%), Gaps = 17/317 (5%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLH--QNppasssatpsqaSGAIVAPTS  1299
             +K +L ELM V KDMLRN E+AVRSFMMLRPRFLH  Q    SS        GAI    S
Sbjct  112   QKVVLQELMVVAKDMLRNAEIAVRSFMMLRPRFLHSKQGSGVSSGQPSQTPGGAIPTAVS  171

Query  1298  SAQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDRKs  1122
             S Q       PV DFY GIPKKPSPF+QQT+ RFEK+L ECRQW+EELEQL+ LDSD+ +
Sbjct  172   SGQPAATSLVPVADFYRGIPKKPSPFIQQTVVRFEKYLGECRQWIEELEQLLALDSDKNT  231

Query  1121  lnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEA  942
              ++S+      P+VMSNVHDFFVHVAAKVE+IHQYIESM+TAYL DQRRRGE +DPFLEA
Sbjct  232   RHASLLEAL--PKVMSNVHDFFVHVAAKVENIHQYIESMRTAYLADQRRRGECNDPFLEA  289

Query  941   DRRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsa-----ilst  777
             DRRETAKQEAAA+RVHPTLHLPA+ QP+TQV GLF SSA PG S APQ SA         
Sbjct  290   DRRETAKQEAAAKRVHPTLHLPASTQPSTQVAGLFASSATPGASNAPQASAPALMPAAVA  349

Query  776   ssaasgsslfsTpaiaasssslfstptasapAVSLFG-SGASPQTSLFGFLATSSPAF--  606
             +S++ G     T   +A SSSLF+TP++ AP  SLFG S AS Q SLFG  + SS  F  
Sbjct  350   ASSSGGGFSLFTTPSSAPSSSLFATPSSVAPTSSLFGSSNASSQPSLFG--SASSTLFGP  407

Query  605   -STPNLF-GSTPSSGVT  561
              STP+LF GSTPS GVT
Sbjct  408   TSTPSLFGGSTPSLGVT  424


 Score =   137 bits (344),  Expect(2) = 1e-117, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K  A Y TKWADLHPDSQK+LL+IEE+IL YRDESQRLDQCSRLYDSSVSN+ 
Sbjct  31    LYLFTNDKALANYSTKWADLHPDSQKLLLKIEERILGYRDESQRLDQCSRLYDSSVSNEV  90

Query  1536  FELDSSHNIQELVGISTSMERQK  1468
             FELD+S  +QEL GIST+M+RQK
Sbjct  91    FELDASRIVQELGGISTAMDRQK  113



>ref|XP_010070489.1| PREDICTED: uncharacterized protein LOC104457250 [Eucalyptus grandis]
 gb|KCW59291.1| hypothetical protein EUGRSUZ_H01972 [Eucalyptus grandis]
Length=505

 Score =   301 bits (772),  Expect(2) = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/227 (72%), Positives = 188/227 (83%), Gaps = 2/227 (1%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +K++L ELM  VKDMLRNTEVAVRSFMMLRPRF+H N  +S++AT    + GA V P+SS
Sbjct  154   QKALLQELMAAVKDMLRNTEVAVRSFMMLRPRFIHSNAGSSTNATAPSQTPGATVTPSSS  213

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKsl  1119
              Q  +    PVFDFYSG+PKKPSPF+QQT+ARFEK+L  CRQWVEELEQL+L DSDR   
Sbjct  214   GQPASTSVVPVFDFYSGLPKKPSPFLQQTVARFEKYLGACRQWVEELEQLLLLDSDRNGT  273

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             N S SL++SLP+V+SNVHDFFVHVAAKVESIHQYI SMKTAYL DQR RG+ +DPFLEAD
Sbjct  274   NLSSSLVESLPKVISNVHDFFVHVAAKVESIHQYIGSMKTAYLADQRHRGDGNDPFLEAD  333

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RRETA+QEAA+RRVHPTLHLP   QP+TQV GLF SSA PG STAPQ
Sbjct  334   RRETARQEAASRRVHPTLHLPPVSQPSTQVAGLFASSATPGASTAPQ  380


 Score =   151 bits (381),  Expect(2) = 1e-117, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN KT A+YGTKWADLHPDSQKILLQIEEKILEYR ESQ+LDQCSRLYDSSVS+DG
Sbjct  73    LYLFTNDKTSASYGTKWADLHPDSQKILLQIEEKILEYRVESQKLDQCSRLYDSSVSSDG  132

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+SH +QEL GISTSMERQK  +
Sbjct  133   FEHDASHIVQELGGISTSMERQKALL  158



>ref|XP_010548382.1| PREDICTED: uncharacterized protein LOC104819823 isoform X1 [Tarenaya 
hassleriana]
Length=497

 Score =   316 bits (809),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 199/317 (63%), Positives = 228/317 (72%), Gaps = 17/317 (5%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLH--QNppasssatpsqaSGAIVAPTS  1299
             +K +L ELM V KDMLRN E+AVRSFMMLRPRFLH  Q    SS        GAI    S
Sbjct  148   QKVVLQELMVVAKDMLRNAEIAVRSFMMLRPRFLHSKQGSGVSSGQPSQTPGGAIPTAVS  207

Query  1298  SAQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDRKs  1122
             S Q       PV DFY GIPKKPSPF+QQT+ RFEK+L ECRQW+EELEQL+ LDSD+ +
Sbjct  208   SGQPAATSLVPVADFYRGIPKKPSPFIQQTVVRFEKYLGECRQWIEELEQLLALDSDKNT  267

Query  1121  lnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEA  942
              ++S+      P+VMSNVHDFFVHVAAKVE+IHQYIESM+TAYL DQRRRGE +DPFLEA
Sbjct  268   RHASLLEAL--PKVMSNVHDFFVHVAAKVENIHQYIESMRTAYLADQRRRGECNDPFLEA  325

Query  941   DRRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsa-----ilst  777
             DRRETAKQEAAA+RVHPTLHLPA+ QP+TQV GLF SSA PG S APQ SA         
Sbjct  326   DRRETAKQEAAAKRVHPTLHLPASTQPSTQVAGLFASSATPGASNAPQASAPALMPAAVA  385

Query  776   ssaasgsslfsTpaiaasssslfstptasapAVSLFG-SGASPQTSLFGFLATSSPAF--  606
             +S++ G     T   +A SSSLF+TP++ AP  SLFG S AS Q SLFG  + SS  F  
Sbjct  386   ASSSGGGFSLFTTPSSAPSSSLFATPSSVAPTSSLFGSSNASSQPSLFG--SASSTLFGP  443

Query  605   -STPNLF-GSTPSSGVT  561
              STP+LF GSTPS GVT
Sbjct  444   TSTPSLFGGSTPSLGVT  460


 Score =   137 bits (344),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K  A Y TKWADLHPDSQK+LL+IEE+IL YRDESQRLDQCSRLYDSSVSN+ 
Sbjct  67    LYLFTNDKALANYSTKWADLHPDSQKLLLKIEERILGYRDESQRLDQCSRLYDSSVSNEV  126

Query  1536  FELDSSHNIQELVGISTSMERQK  1468
             FELD+S  +QEL GIST+M+RQK
Sbjct  127   FELDASRIVQELGGISTAMDRQK  149



>ref|XP_008241573.1| PREDICTED: uncharacterized serine-rich protein C215.13 [Prunus 
mume]
Length=501

 Score =   310 bits (794),  Expect(2) = 4e-117, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 189/226 (84%), Gaps = 1/226 (0%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatp-sqaSGAIVAPTSS  1296
             +K++LHELM +VKDMLRN+EVAVR+FM+LRPRFLH N   +S+A   SQASGA V P SS
Sbjct  156   QKALLHELMAIVKDMLRNSEVAVRTFMILRPRFLHPNTGGTSNAIAPSQASGATVPPGSS  215

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKsln  1116
             +Q T     PVFDFY+G+P+KPSPF+QQTIARFEK+L ECRQW+EELEQL+L S+R S N
Sbjct  216   SQPTATSIVPVFDFYNGLPRKPSPFLQQTIARFEKYLVECRQWIEELEQLLLASERNSAN  275

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
                SLLQSLP+VMSNVHDFFVHVAAKVESIHQYI SMK+AYL +QRR G+ +DPFLEADR
Sbjct  276   DGSSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIVSMKSAYLANQRRLGDGNDPFLEADR  335

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RETA+QEAAA+RVHPTLHLPA  QP+TQV GLF SS   G S APQ
Sbjct  336   RETARQEAAAKRVHPTLHLPATSQPSTQVAGLFASSGTQGASPAPQ  381


 Score =   141 bits (355),  Expect(2) = 4e-117, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             +FLFTN K PA+Y TKWADLHPDSQKILLQIEE+IL +RDESQRLDQCSRLYDSSVSND 
Sbjct  75    MFLFTNDKAPASYSTKWADLHPDSQKILLQIEERILGHRDESQRLDQCSRLYDSSVSNDT  134

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+S  +QEL GI T+M+RQK  +
Sbjct  135   FEHDASRILQELGGIGTAMDRQKALL  160



>ref|XP_007202048.1| hypothetical protein PRUPE_ppa004547mg [Prunus persica]
 gb|EMJ03247.1| hypothetical protein PRUPE_ppa004547mg [Prunus persica]
Length=504

 Score =   309 bits (792),  Expect(2) = 7e-117, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 189/226 (84%), Gaps = 1/226 (0%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatp-sqaSGAIVAPTSS  1296
             +K++LHELM +VKDMLRN+EV+VR+FM+LRPRFLH N   +S+A   SQASGA V P SS
Sbjct  154   QKALLHELMAIVKDMLRNSEVSVRTFMILRPRFLHPNTGGTSNAIAPSQASGATVPPGSS  213

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKsln  1116
             +Q T     PVFDFY+G+P+KPSPF+QQTIARFEK+L ECRQW+EELEQL+L S+R S N
Sbjct  214   SQPTATSIVPVFDFYNGLPRKPSPFLQQTIARFEKYLVECRQWIEELEQLLLASERNSAN  273

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
                SLLQSLP+VMSNVHDFFVHVAAKVESIHQYI SMK+AYL +QRR G+ +DPFLEADR
Sbjct  274   DGSSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIVSMKSAYLANQRRLGDGNDPFLEADR  333

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RETA+QEAAA+RVHPTLHLPA  QP+TQV GLF SS   G S APQ
Sbjct  334   RETARQEAAAKRVHPTLHLPATSQPSTQVAGLFASSGTQGASPAPQ  379


 Score =   141 bits (355),  Expect(2) = 7e-117, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             +FLFTN K PA+Y TKWADLHPDSQKILLQIEE+IL +RDESQRLDQCSRLYDSSVSND 
Sbjct  73    MFLFTNDKAPASYSTKWADLHPDSQKILLQIEERILGHRDESQRLDQCSRLYDSSVSNDT  132

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+S  +QEL GI T+M+RQK  +
Sbjct  133   FEHDASRILQELGGIGTAMDRQKALL  158



>ref|XP_003517267.1| PREDICTED: uncharacterized protein LOC100776992 [Glycine max]
Length=470

 Score =   302 bits (774),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 190/226 (84%), Gaps = 1/226 (0%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K++L ELM+ VKDMLRNTEVAVRSFMMLRPRFLH +   SS+  PSQ  GA +AP+SS+
Sbjct  134   QKTLLQELMSTVKDMLRNTEVAVRSFMMLRPRFLHPSGGTSSATAPSQTPGATIAPSSSS  193

Query  1292  QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKsln  1116
             Q TT    PVFDFYSG+PKKPSPF+QQT+ RFEK+L EC QW+EELEQL+L DS+R +  
Sbjct  194   QPTTASIVPVFDFYSGLPKKPSPFLQQTVLRFEKYLGECHQWIEELEQLLLLDSERNASA  253

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
             +  SLLQSLP+VM+NVHDFFVHVAAKVESIHQYIESMK+AYL DQRRRGEV+DPFLEADR
Sbjct  254   NGSSLLQSLPKVMTNVHDFFVHVAAKVESIHQYIESMKSAYLADQRRRGEVNDPFLEADR  313

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RETA+QEAA++RVHPTLHLPA  QP+TQV GLF SS      TAPQ
Sbjct  314   RETARQEAASKRVHPTLHLPANSQPSTQVAGLFSSSGTQAALTAPQ  359


 Score =   147 bits (370),  Expect(2) = 1e-116, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -3

Query  1704  TNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGFELD  1525
             TN +TPA+Y T WADLHPDSQKILLQIEE+ILEYRDESQRLDQCSRLYDSSVSNDGFELD
Sbjct  57    TNDRTPASYSTNWADLHPDSQKILLQIEERILEYRDESQRLDQCSRLYDSSVSNDGFELD  116

Query  1524  SSHNIQELVGISTSMERQKKYI  1459
             + H +QEL GI+T+MERQK  +
Sbjct  117   AGHIVQELGGINTAMERQKTLL  138



>gb|KHN36183.1| Peroxidase A [Glycine soja]
Length=470

 Score =   301 bits (771),  Expect(2) = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 190/226 (84%), Gaps = 1/226 (0%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K++L ELM+ VKDMLRNTEVAVRSFMMLRPRFLH +   SS+  PSQ  GA +AP+S++
Sbjct  134   QKTLLQELMSTVKDMLRNTEVAVRSFMMLRPRFLHPSGGTSSATAPSQTPGATIAPSSNS  193

Query  1292  QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKsln  1116
             Q TT    PVFDFYSG+PKKPSPF+QQT+ RFEK+L EC QW+EELEQL+L DS+R +  
Sbjct  194   QPTTASIVPVFDFYSGLPKKPSPFLQQTVLRFEKYLGECHQWIEELEQLLLLDSERNASA  253

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
             +  SLLQSLP+VM+NVHDFFVHVAAKVESIHQYIESMK+AYL DQRRRGEV+DPFLEADR
Sbjct  254   NGSSLLQSLPKVMTNVHDFFVHVAAKVESIHQYIESMKSAYLADQRRRGEVNDPFLEADR  313

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RETA+QEAA++RVHPTLHLPA  QP+TQV GLF SS      TAPQ
Sbjct  314   RETARQEAASKRVHPTLHLPANSQPSTQVAGLFSSSGTQAALTAPQ  359


 Score =   147 bits (370),  Expect(2) = 4e-116, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -3

Query  1704  TNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGFELD  1525
             TN +TPA+Y T WADLHPDSQKILLQIEE+ILEYRDESQRLDQCSRLYDSSVSNDGFELD
Sbjct  57    TNDRTPASYSTNWADLHPDSQKILLQIEERILEYRDESQRLDQCSRLYDSSVSNDGFELD  116

Query  1524  SSHNIQELVGISTSMERQKKYI  1459
             + H +QEL GI+T+MERQK  +
Sbjct  117   AGHIVQELGGINTAMERQKTLL  138



>ref|XP_011099233.1| PREDICTED: LOW QUALITY PROTEIN: nuclear pore complex protein 
NUP58 [Sesamum indicum]
Length=472

 Score =   294 bits (752),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 224/354 (63%), Positives = 255/354 (72%), Gaps = 32/354 (9%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqa-SGAIVAPTSS  1296
             +K+ L ELMTVVKDMLRNTEVAVRSFM+LRPRFLHQN   ++S T     SGA    TS 
Sbjct  134   QKATLQELMTVVKDMLRNTEVAVRSFMILRPRFLHQNKTGAASTTAPSQPSGATTTQTSG  193

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKsl  1119
             +Q       P+ DFYSG+PKKPSPF+ QT+ARFEK+L+ECRQW+EELEQL+L DS+R S 
Sbjct  194   SQPDANSMVPIIDFYSGLPKKPSPFLHQTVARFEKYLSECRQWIEELEQLLLLDSERNSS  253

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             N S SLLQSLP+VM+NVHDFFVHVAAKVESIHQY+ESMKTAYL DQR RG+ +DPFLEAD
Sbjct  254   NPSSSLLQSLPKVMANVHDFFVHVAAKVESIHQYLESMKTAYLADQRHRGDGNDPFLEAD  313

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasg  759
             RRETAKQEAAARRVHPTLHLPAA     Q TG F  SAAPGTSTA               
Sbjct  314   RRETAKQEAAARRVHPTLHLPAASLSTGQGTGPFAISAAPGTSTA--------------A  359

Query  758   sslfsTpaiaasssslfstptasapAVSLFG--SGASPQTSLFGFLA-------------  624
             S+     A + S SSLFSTP A++   SLF   + A+P TSL G  A             
Sbjct  360   STPAIVSASSGSGSSLFSTPAAASSTPSLFSTPTAAAPLTSLLGTAATHQSSPFSSLSAS  419

Query  623   TSSPAFSTPNLFGSTPSSGVTNfstpfatgaatgsgssfgTLSKARAKSRPGRR  462
             TS+   STP LF  TP+SGV+ FSTPF TGAATGSG+SFGT+SKARAKSR GRR
Sbjct  420   TSAFGISTP-LFSPTPASGVSTFSTPFGTGAATGSGASFGTVSKARAKSRTGRR  472


 Score =   152 bits (385),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN KTPATY TKWADLHPDSQK+LLQIEE+ILEYRDESQRLDQCSRLYDSSVS++G
Sbjct  53    LYLFTNDKTPATYSTKWADLHPDSQKVLLQIEERILEYRDESQRLDQCSRLYDSSVSSNG  112

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FELD+S+ +QEL GIS +MERQK  +
Sbjct  113   FELDASYIVQELGGISIAMERQKATL  138



>ref|XP_010680500.1| PREDICTED: nuclear pore complex protein NUP58 [Beta vulgaris 
subsp. vulgaris]
Length=498

 Score =   304 bits (778),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 183/227 (81%), Gaps = 2/227 (1%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +K  L ELM VVK+MLRN E+A+RSFMMLRPRF HQ    +S+ T    + GA  AP+ +
Sbjct  156   QKVTLQELMVVVKEMLRNAEIAIRSFMMLRPRFFHQKAGTASNPTAPAQTPGATTAPSVT  215

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKsl  1119
              QA       V DFY GIPKKPSPF+Q T+ARFEK++ ECRQW+EELEQL+L DSDR S+
Sbjct  216   GQAAASSMVQVADFYCGIPKKPSPFIQHTVARFEKYVGECRQWIEELEQLLLSDSDRNSI  275

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             + + S+LQSLP+V++N H+FFVHVAAKVESIHQYIESM+TAYL+DQRRRG+ +DPFLEAD
Sbjct  276   SYNSSVLQSLPKVLTNAHEFFVHVAAKVESIHQYIESMRTAYLSDQRRRGDGNDPFLEAD  335

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RRE A+QEAAA+RVHPTLHLPAAPQP TQV GLF S+ APG S APQ
Sbjct  336   RREMARQEAAAKRVHPTLHLPAAPQPTTQVAGLFASTGAPGVSNAPQ  382


 Score =   142 bits (358),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = -3

Query  1704  TNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGFELD  1525
             TN KTPA+Y TKWADLHPDSQK+LLQIEE+ILEYRDESQRLDQCSRL+DSSVSN+ FELD
Sbjct  79    TNEKTPASYSTKWADLHPDSQKVLLQIEERILEYRDESQRLDQCSRLFDSSVSNNTFELD  138

Query  1524  SSHNIQELVGISTSMERQK  1468
             +S  +QEL GISTSMERQK
Sbjct  139   ASLIVQELGGISTSMERQK  157



>gb|KDP31861.1| hypothetical protein JCGZ_12322 [Jatropha curcas]
Length=492

 Score =   303 bits (776),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/227 (74%), Positives = 190/227 (84%), Gaps = 2/227 (1%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqa-SGAIVAPTSS  1296
             +K++L ELM  VKDMLRNTE+AVRSFM+LRPRF H N   +S+AT     SGA   P SS
Sbjct  143   QKALLQELMVNVKDMLRNTEMAVRSFMILRPRFFHPNAGGASNATSPSQPSGATGTPGSS  202

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKsl  1119
             +Q T+    PVFDFYSG+PKKPSPF+QQT+ RFEK+L ECRQW+EELEQL+L DS R S 
Sbjct  203   SQPTSASIVPVFDFYSGVPKKPSPFLQQTVIRFEKYLGECRQWIEELEQLLLLDSGRNSS  262

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             +   SLLQSLP+VMSNVHDFFVHVA+KVESIHQYIESMKTAYL DQRRRG+V+DPFLEAD
Sbjct  263   HPGSSLLQSLPKVMSNVHDFFVHVASKVESIHQYIESMKTAYLADQRRRGDVNDPFLEAD  322

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RRETAKQEAAA+RVHPTLHLPA+ QP+TQV GLF SSA PG STAPQ
Sbjct  323   RRETAKQEAAAKRVHPTLHLPASSQPSTQVVGLFASSATPGASTAPQ  369


 Score =   143 bits (360),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             +LFTN K PA Y TKWADLHPDSQK+LLQIEE+ILE RDESQRLDQCSRLYDSS+SN+GF
Sbjct  63    YLFTNEKAPANYSTKWADLHPDSQKLLLQIEERILEDRDESQRLDQCSRLYDSSISNEGF  122

Query  1533  ELDSSHNIQELVGISTSMERQKKYI  1459
             E D+   IQEL GIST+MERQK  +
Sbjct  123   EFDAGRVIQELGGISTAMERQKALL  147



>ref|XP_003537376.1| PREDICTED: uncharacterized serine-rich protein C215.13-like isoform 
X1 [Glycine max]
Length=485

 Score =   292 bits (747),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 187/226 (83%), Gaps = 1/226 (0%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K++LHELM+ VKDMLRNTEVAVRSFMMLRPRFLH +   SS+  PSQ  GA +AP+SS+
Sbjct  148   QKTLLHELMSTVKDMLRNTEVAVRSFMMLRPRFLHPSGGTSSATAPSQTPGATIAPSSSS  207

Query  1292  QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSD-RKsln  1116
             Q TT    PVFDFYSG+P+KPSPF+QQT+ RFEK+L EC QW+EELEQL+L    R + +
Sbjct  208   QPTTASIVPVFDFYSGLPRKPSPFLQQTVLRFEKYLGECHQWIEELEQLLLLESERNASS  267

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
             +  SLLQSLP+VM+NVHDFFVHVAAKVESIHQYIESMK+AYL DQR RGEV+DPFLEADR
Sbjct  268   NGSSLLQSLPKVMTNVHDFFVHVAAKVESIHQYIESMKSAYLADQRHRGEVNDPFLEADR  327

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RETA+QEAA++RVHPTLHLPA  QP+TQV GLF SS       APQ
Sbjct  328   RETARQEAASKRVHPTLHLPANSQPSTQVAGLFSSSGTQAALPAPQ  373


 Score =   154 bits (389),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             LFLFTN +TPA+Y T WADLHPDSQKILLQIEE+ILE+RDESQRLDQCSRLYDSSVSNDG
Sbjct  67    LFLFTNDRTPASYSTNWADLHPDSQKILLQIEERILEFRDESQRLDQCSRLYDSSVSNDG  126

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FELD+ H +QEL GI+T+MERQK  +
Sbjct  127   FELDAGHIVQELGGINTAMERQKTLL  152



>ref|XP_006590668.1| PREDICTED: uncharacterized serine-rich protein C215.13-like isoform 
X2 [Glycine max]
Length=462

 Score =   292 bits (748),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 194/305 (64%), Positives = 228/305 (75%), Gaps = 8/305 (3%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K++LHELM+ VKDMLRNTEVAVRSFMMLRPRFLH +   SS+  PSQ  GA +AP+SS+
Sbjct  148   QKTLLHELMSTVKDMLRNTEVAVRSFMMLRPRFLHPSGGTSSATAPSQTPGATIAPSSSS  207

Query  1292  QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSD-RKsln  1116
             Q TT    PVFDFYSG+P+KPSPF+QQT+ RFEK+L EC QW+EELEQL+L    R + +
Sbjct  208   QPTTASIVPVFDFYSGLPRKPSPFLQQTVLRFEKYLGECHQWIEELEQLLLLESERNASS  267

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
             +  SLLQSLP+VM+NVHDFFVHVAAKVESIHQYIESMK+AYL DQR RGEV+DPFLEADR
Sbjct  268   NGSSLLQSLPKVMTNVHDFFVHVAAKVESIHQYIESMKSAYLADQRHRGEVNDPFLEADR  327

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasgs  756
             RETA+QEAA++RVHPTLHLPA  QP+TQV GLF SS       APQT+A  S+ S+ SG 
Sbjct  328   RETARQEAASKRVHPTLHLPANSQPSTQVAGLFSSSGTQAALPAPQTAASTSSLSSGSGL  387

Query  755   slfsTpaiaasssslfstptasapAVSLFGSGASPQTSLFGFLATSSPAFSTPNLFGSTP  576
             SLFSTP+ A SSS L S      P          PQTSLFG         STP+LFG+  
Sbjct  388   SLFSTPSSAPSSSMLSSLFATPTP-------APGPQTSLFGSTTPVPGPVSTPSLFGTAT  440

Query  575   SSGVT  561
              SG +
Sbjct  441   GSGAS  445


 Score =   154 bits (388),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             LFLFTN +TPA+Y T WADLHPDSQKILLQIEE+ILE+RDESQRLDQCSRLYDSSVSNDG
Sbjct  67    LFLFTNDRTPASYSTNWADLHPDSQKILLQIEERILEFRDESQRLDQCSRLYDSSVSNDG  126

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FELD+ H +QEL GI+T+MERQK  +
Sbjct  127   FELDAGHIVQELGGINTAMERQKTLL  152



>ref|XP_006425809.1| hypothetical protein CICLE_v10025487mg [Citrus clementina]
 gb|ESR39049.1| hypothetical protein CICLE_v10025487mg [Citrus clementina]
Length=485

 Score =   292 bits (748),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 198/309 (64%), Positives = 228/309 (74%), Gaps = 11/309 (4%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatp-sqaSGAIVAPTSS  1296
             +K+ L E M VVKDMLRNTE+AVRSFMMLRPRFLH N  ++SSAT  SQASGA  AP+S+
Sbjct  143   QKAQLQERMAVVKDMLRNTEIAVRSFMMLRPRFLHPNAGSASSATAPSQASGATAAPSST  202

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKsl  1119
              Q  +    PVFDFY G+PKKPS F+QQT+ARFEK+L E RQW+EELEQLIL D DR S 
Sbjct  203   GQPASSSVVPVFDFYRGLPKKPSAFLQQTVARFEKYLGEFRQWIEELEQLILLDPDRNSS  262

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             +   SLLQSLPQV+SNVH FFVHVAAK ESIHQY+E+MKTAYL DQRRRG+ SDPFLEAD
Sbjct  263   SHGSSLLQSLPQVISNVHIFFVHVAAKAESIHQYVETMKTAYLADQRRRGDGSDPFLEAD  322

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasg  759
             RRETA+QEAAA+RVHPTLHLP   QP+ QV G   ++ A G   APQTSA++S SS    
Sbjct  323   RRETARQEAAAKRVHPTLHLPVNSQPSAQVGGSL-TNTATGALVAPQTSAVISASSGGGL  381

Query  758   s--slfsTpaiaasssslfstptasapAVSLFGSGASPQTSLFGFLATSSPAFSTPNLFG  585
             S  S  S+   ++ SSSLF+TP  SA   SLFGSG SPQ S     A      ST +LFG
Sbjct  382   SLFSTPSSAPASSMSSSLFATPATSASPSSLFGSGVSPQMSSSSLFAA-----STLSLFG  436

Query  584   ST-PSSGVT  561
             ST PS G T
Sbjct  437   STVPSFGST  445


 Score =   153 bits (386),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -3

Query  1710  LFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGFE  1531
             LFTN + PA Y TKWADLHPDSQKILLQIEE++LEYRDESQRLDQCSRLYDSSVSN+GFE
Sbjct  64    LFTNDRAPANYSTKWADLHPDSQKILLQIEERVLEYRDESQRLDQCSRLYDSSVSNEGFE  123

Query  1530  LDSSHNIQELVGISTSMERQKKYI  1459
             LD+SH +QEL GISTSMERQK  +
Sbjct  124   LDASHIVQELGGISTSMERQKAQL  147



>ref|XP_006466667.1| PREDICTED: uncharacterized serine-rich protein C215.13-like isoform 
X2 [Citrus sinensis]
Length=512

 Score =   291 bits (746),  Expect(2) = 4e-115, Method: Compositional matrix adjust.
 Identities = 198/309 (64%), Positives = 228/309 (74%), Gaps = 11/309 (4%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatp-sqaSGAIVAPTSS  1296
             +K+ L E M VVKDMLRNTE+AVRSFMMLRPRFLH N  ++SSAT  SQASGA  AP+S+
Sbjct  170   QKAQLQERMAVVKDMLRNTEIAVRSFMMLRPRFLHPNAGSASSATAPSQASGATAAPSST  229

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKsl  1119
              Q  +    PVFDFY G+PKKPS F+QQT+ARFEK+L E RQW+EELEQLIL D DR S 
Sbjct  230   GQPASSSVVPVFDFYRGLPKKPSAFLQQTVARFEKYLGEFRQWIEELEQLILLDPDRNSS  289

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             +   SLLQSLPQV+SNVH FFVHVAAK ESIHQY+E+MKTAYL DQRRRG+ SDPFLEAD
Sbjct  290   SHGSSLLQSLPQVISNVHIFFVHVAAKAESIHQYVETMKTAYLADQRRRGDGSDPFLEAD  349

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasg  759
             RRETA+QEAAA+RVHPTLHLP   QP+ QV G   ++ A G   APQTSA++S SS    
Sbjct  350   RRETARQEAAAKRVHPTLHLPVNSQPSAQVGGSL-TNTATGALVAPQTSAVISASSGGGL  408

Query  758   s--slfsTpaiaasssslfstptasapAVSLFGSGASPQTSLFGFLATSSPAFSTPNLFG  585
             S  S  S+   ++ SSSLF+TP  SA   SLFGSG SPQ S     A      ST +LFG
Sbjct  409   SLFSTPSSAPASSMSSSLFATPATSASPSSLFGSGVSPQMSSSSLFAA-----STLSLFG  463

Query  584   ST-PSSGVT  561
             ST PS G T
Sbjct  464   STVPSFGST  472


 Score =   153 bits (386),  Expect(2) = 4e-115, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -3

Query  1710  LFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGFE  1531
             LFTN + PA Y TKWADLHPDSQKILLQIEE++LEYRDESQRLDQCSRLYDSSVSN+GFE
Sbjct  91    LFTNDRAPANYSTKWADLHPDSQKILLQIEERVLEYRDESQRLDQCSRLYDSSVSNEGFE  150

Query  1530  LDSSHNIQELVGISTSMERQKKYI  1459
             LD+SH +QEL GISTSMERQK  +
Sbjct  151   LDASHIVQELGGISTSMERQKAQL  174



>ref|XP_006466666.1| PREDICTED: uncharacterized serine-rich protein C215.13-like isoform 
X1 [Citrus sinensis]
Length=518

 Score =   291 bits (744),  Expect(2) = 6e-115, Method: Compositional matrix adjust.
 Identities = 198/309 (64%), Positives = 228/309 (74%), Gaps = 11/309 (4%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatp-sqaSGAIVAPTSS  1296
             +K+ L E M VVKDMLRNTE+AVRSFMMLRPRFLH N  ++SSAT  SQASGA  AP+S+
Sbjct  170   QKAQLQERMAVVKDMLRNTEIAVRSFMMLRPRFLHPNAGSASSATAPSQASGATAAPSST  229

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKsl  1119
              Q  +    PVFDFY G+PKKPS F+QQT+ARFEK+L E RQW+EELEQLIL D DR S 
Sbjct  230   GQPASSSVVPVFDFYRGLPKKPSAFLQQTVARFEKYLGEFRQWIEELEQLILLDPDRNSS  289

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             +   SLLQSLPQV+SNVH FFVHVAAK ESIHQY+E+MKTAYL DQRRRG+ SDPFLEAD
Sbjct  290   SHGSSLLQSLPQVISNVHIFFVHVAAKAESIHQYVETMKTAYLADQRRRGDGSDPFLEAD  349

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasg  759
             RRETA+QEAAA+RVHPTLHLP   QP+ QV G   ++ A G   APQTSA++S SS    
Sbjct  350   RRETARQEAAAKRVHPTLHLPVNSQPSAQVGGSL-TNTATGALVAPQTSAVISASSGGGL  408

Query  758   s--slfsTpaiaasssslfstptasapAVSLFGSGASPQTSLFGFLATSSPAFSTPNLFG  585
             S  S  S+   ++ SSSLF+TP  SA   SLFGSG SPQ S     A      ST +LFG
Sbjct  409   SLFSTPSSAPASSMSSSLFATPATSASPSSLFGSGVSPQMSSSSLFAA-----STLSLFG  463

Query  584   ST-PSSGVT  561
             ST PS G T
Sbjct  464   STVPSFGST  472


 Score =   153 bits (386),  Expect(2) = 6e-115, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -3

Query  1710  LFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGFE  1531
             LFTN + PA Y TKWADLHPDSQKILLQIEE++LEYRDESQRLDQCSRLYDSSVSN+GFE
Sbjct  91    LFTNDRAPANYSTKWADLHPDSQKILLQIEERVLEYRDESQRLDQCSRLYDSSVSNEGFE  150

Query  1530  LDSSHNIQELVGISTSMERQK  1468
             LD+SH +QEL GISTSMERQK
Sbjct  151   LDASHIVQELGGISTSMERQK  171



>ref|XP_004511979.1| PREDICTED: serine-rich adhesin for platelets-like [Cicer arietinum]
Length=493

 Score =   286 bits (733),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 200/315 (63%), Positives = 239/315 (76%), Gaps = 18/315 (6%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K++L ELM+VVKDMLRNTEVAVRSFMMLR RFLH +  ASS+  PSQ  G     T+S+
Sbjct  149   QKTLLQELMSVVKDMLRNTEVAVRSFMMLRTRFLHPSGGASSATAPSQTPG-----TTSS  203

Query  1292  QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKsln  1116
             Q T     PVFDFYSG+PKKPSPF+QQT+ RFEK++ EC QW+EELEQL+L DS++ + +
Sbjct  204   QPTATSIVPVFDFYSGLPKKPSPFLQQTVLRFEKYIGECHQWIEELEQLLLLDSEKNASS  263

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
             +  SLLQSLP+VM+NVHDFFVHVAAKVESIHQYIESMK+AYL DQRRRGEV+DPFLEADR
Sbjct  264   NGSSLLQSLPKVMTNVHDFFVHVAAKVESIHQYIESMKSAYLADQRRRGEVNDPFLEADR  323

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTA---PQtsailstssaa  765
             RETA+QEAA++RVHPTLHLPA  QP+TQV GLF SS   G  TA   P T++ LST S  
Sbjct  324   RETARQEAASKRVHPTLHLPANSQPSTQVAGLFSSSGTQGALTAQQTPATTSSLSTGSGL  383

Query  764   sgsslfsTpaiaasssslfstptasapAVSLFG-SGASPQTSLFGFLATSSP-AFSTPN-  594
             S  S   + A ++S SSLF+TPT  AP  S F  S A+PQTSLFG  ++S P A STP+ 
Sbjct  384   SLFSTPVSSAPSSSMSSLFTTPTTPAPGASWFASSSATPQTSLFGSASSSLPGATSTPSL  443

Query  593   ------LFGSTPSSG  567
                   LF STP+ G
Sbjct  444   FSNATPLFSSTPAGG  458


 Score =   151 bits (382),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             LFLFTN +TPA+Y T WADLHPDSQKILLQIEE+ILEYRDESQRLDQC+RLYDSSV NDG
Sbjct  68    LFLFTNDRTPASYSTNWADLHPDSQKILLQIEERILEYRDESQRLDQCNRLYDSSVFNDG  127

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE+D+SH +QEL GI T+MERQK  +
Sbjct  128   FEVDASHIVQELGGIGTAMERQKTLL  153



>ref|XP_008440230.1| PREDICTED: uncharacterized serine-rich protein C215.13 isoform 
X1 [Cucumis melo]
Length=496

 Score =   281 bits (720),  Expect(2) = 5e-112, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 225/307 (73%), Gaps = 7/307 (2%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTS-S  1296
             +K +L ELM   K+ML NTEVA+RSFMM+RPRFLHQ+   +S+ T          P   S
Sbjct  149   QKVMLQELMAAAKEMLWNTEVAIRSFMMIRPRFLHQSARGASNPTAPSQVSGATTPLGPS  208

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQL-ILDSDRKsl  1119
              Q T+    PVFDFYSG+P+KPSPF+QQT++RFEK+L ECRQW+E+LEQL ILDS+R + 
Sbjct  209   GQPTSTSIAPVFDFYSGLPRKPSPFLQQTVSRFEKYLGECRQWIEDLEQLLILDSNRSAS  268

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             NSS SL QSLP++MSNVH+FFVHVAAKVESIHQYIESMK+AYL DQRRRG+ ++PFLEAD
Sbjct  269   NSSSSLFQSLPKIMSNVHEFFVHVAAKVESIHQYIESMKSAYLADQRRRGDGNNPFLEAD  328

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsails-tssaas  762
             RRETA+QEAAA+R HPTLHLPA  QP+TQ  GL  +S   G ST  Q+S + +  SS   
Sbjct  329   RRETARQEAAAKRAHPTLHLPANSQPSTQAAGLLANSGNHGASTIQQSSTVATPASSGGG  388

Query  761   gsslfsTpaiaasssslfstptasapAVSLFGSGASPQTSLFGFLATSSPAFSTPNL-FG  585
              S   +  A + ++SSLF TPTAS    SLFGS ++   SLFG  ++S+P FS+ +  FG
Sbjct  389   LSLFSTPSAPSTTTSSLFMTPTASVQTSSLFGSSSAAAPSLFG--SSSAPLFSSASTPFG  446

Query  584   ST-PSSG  567
             ST PS G
Sbjct  447   STAPSFG  453


 Score =   152 bits (385),  Expect(2) = 5e-112, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             LF+FTN K PA+YGTKWADLHPDSQKILLQIEE+ILEYRDESQRLDQCSRLYDSSVSNDG
Sbjct  68    LFIFTNDKAPASYGTKWADLHPDSQKILLQIEERILEYRDESQRLDQCSRLYDSSVSNDG  127

Query  1536  FELDSSHNIQELVGISTSMERQK  1468
             FELD+S  +QEL GIS S E QK
Sbjct  128   FELDASRIVQELGGISASTEHQK  150



>ref|XP_007156848.1| hypothetical protein PHAVU_002G022500g [Phaseolus vulgaris]
 gb|ESW28842.1| hypothetical protein PHAVU_002G022500g [Phaseolus vulgaris]
Length=473

 Score =   287 bits (734),  Expect(2) = 5e-112, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 185/226 (82%), Gaps = 1/226 (0%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K++L ELM+ VKDMLRNTEVAVRSFM+LRPRF H +  +SS+  PSQ  G  +AP SS 
Sbjct  136   QKTLLQELMSNVKDMLRNTEVAVRSFMILRPRFHHPSGGSSSATAPSQTPGVTMAPGSSG  195

Query  1292  QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKsln  1116
             Q       PVFDFYSG+PKKPSPF+QQTI RFEK+L EC QW+EELEQL+L DS+R + +
Sbjct  196   QPINASIVPVFDFYSGLPKKPSPFLQQTILRFEKYLGECHQWIEELEQLLLLDSERNASS  255

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
             +  S LQSLP+VM+NVHDFFVHVAAKVESIHQYIESMK++YL DQRRRGEV+DPFLEADR
Sbjct  256   NGSSSLQSLPKVMTNVHDFFVHVAAKVESIHQYIESMKSSYLADQRRRGEVNDPFLEADR  315

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RETA+QEAA++RVHPTLHLPA PQP+TQV GLF SS       APQ
Sbjct  316   RETARQEAASKRVHPTLHLPANPQPSTQVAGLFSSSGTQAVLPAPQ  361


 Score =   147 bits (371),  Expect(2) = 5e-112, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = -3

Query  1704  TNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGFELD  1525
             TN +TPA+Y T WADLHPDSQKILLQIEE+ILEYRDESQRLDQCSRLYDSSVSNDGFELD
Sbjct  59    TNDRTPASYSTNWADLHPDSQKILLQIEERILEYRDESQRLDQCSRLYDSSVSNDGFELD  118

Query  1524  SSHNIQELVGISTSMERQKKYI  1459
             + H +QEL GIST MERQK  +
Sbjct  119   AGHIVQELGGISTGMERQKTLL  140



>ref|XP_004301860.1| PREDICTED: uncharacterized protein LOC101302275 [Fragaria vesca 
subsp. vesca]
Length=533

 Score =   294 bits (753),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 151/224 (67%), Positives = 179/224 (80%), Gaps = 1/224 (0%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +K++L ELM  VK+MLRN+E+AVRSFMMLRPRFL  N   +S+ T    + GA V P S+
Sbjct  195   QKALLQELMATVKEMLRNSEIAVRSFMMLRPRFLRPNAGGTSNGTAPSQTPGATVTPGST  254

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKsln  1116
             +Q TT    PVFDFY+G+P+KPSPF+Q TIARFEK+L ECRQW+EE+EQL+L+S+R   N
Sbjct  255   SQPTTSSIVPVFDFYNGVPRKPSPFLQHTIARFEKYLGECRQWIEEIEQLLLNSERNYTN  314

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
                SLLQSLP+VMSNVHDFFVHVAAKVESIHQYI SMK AYL +QRR G+ +DPFLEADR
Sbjct  315   DGSSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIVSMKAAYLANQRRLGDSNDPFLEADR  374

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTA  804
             RETA+QEAAA+RVHPTLHLPA  QP+TQV GL  SS     STA
Sbjct  375   RETARQEAAAKRVHPTLHLPAISQPSTQVAGLLTSSGTQAASTA  418


 Score =   138 bits (348),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -3

Query  1704  TNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGFELD  1525
             TN K PA+YGTKW+DLHPDSQKIL QIEE IL YRDESQRLDQCSRLYDSSVSNDGFE D
Sbjct  118   TNDKAPASYGTKWSDLHPDSQKILFQIEEHILGYRDESQRLDQCSRLYDSSVSNDGFEQD  177

Query  1524  SSHNIQELVGISTSMERQKKYI  1459
             +S  +QEL GI T+M+RQK  +
Sbjct  178   ASRIVQELGGIGTAMDRQKALL  199



>ref|XP_004141933.1| PREDICTED: uncharacterized protein LOC101220360 isoform 2 [Cucumis 
sativus]
 gb|KGN48489.1| hypothetical protein Csa_6G490040 [Cucumis sativus]
Length=504

 Score =   280 bits (716),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 180/227 (79%), Gaps = 2/227 (1%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +K +L ELM   K+ML NTEVA+RSFMM+RPRFLHQ+   +S+ T      GA     SS
Sbjct  156   QKVMLQELMAAAKEMLWNTEVAIRSFMMIRPRFLHQSAGGASNPTAPSQVPGATTPLGSS  215

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQL-ILDSDRKsl  1119
              Q T+    PVFDFYSG+P+KPSPF+QQT++RFEK+LAECRQW+E+LEQL +LDS+R + 
Sbjct  216   GQPTSTSIAPVFDFYSGLPRKPSPFLQQTVSRFEKYLAECRQWIEDLEQLLVLDSNRSAS  275

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             NSS SL QSLP++MSNVH+FFVHVA+KVESIHQYIESMK+AYL DQRRRG+ ++PFLEAD
Sbjct  276   NSSSSLFQSLPKIMSNVHEFFVHVASKVESIHQYIESMKSAYLADQRRRGDGNNPFLEAD  335

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RRETA+QEAAA+R HPTLHLP   QP+TQ TGL  +S   G ST  Q
Sbjct  336   RRETARQEAAAKRAHPTLHLPTNSQPSTQATGLLANSGNHGASTVQQ  382


 Score =   149 bits (377),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             F+FTN K PA+YGTKWADLHPDSQKILLQIEE+ILEYRDESQRLDQCSRLYDSSVSNDGF
Sbjct  76    FIFTNDKAPASYGTKWADLHPDSQKILLQIEERILEYRDESQRLDQCSRLYDSSVSNDGF  135

Query  1533  ELDSSHNIQELVGISTSMERQK  1468
             E D+S  +QEL GIS S E QK
Sbjct  136   EFDASRIVQELGGISASTEHQK  157



>ref|XP_004141932.1| PREDICTED: uncharacterized protein LOC101220360 isoform 1 [Cucumis 
sativus]
Length=507

 Score =   280 bits (716),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 180/227 (79%), Gaps = 2/227 (1%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +K +L ELM   K+ML NTEVA+RSFMM+RPRFLHQ+   +S+ T      GA     SS
Sbjct  156   QKVMLQELMAAAKEMLWNTEVAIRSFMMIRPRFLHQSAGGASNPTAPSQVPGATTPLGSS  215

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQL-ILDSDRKsl  1119
              Q T+    PVFDFYSG+P+KPSPF+QQT++RFEK+LAECRQW+E+LEQL +LDS+R + 
Sbjct  216   GQPTSTSIAPVFDFYSGLPRKPSPFLQQTVSRFEKYLAECRQWIEDLEQLLVLDSNRSAS  275

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             NSS SL QSLP++MSNVH+FFVHVA+KVESIHQYIESMK+AYL DQRRRG+ ++PFLEAD
Sbjct  276   NSSSSLFQSLPKIMSNVHEFFVHVASKVESIHQYIESMKSAYLADQRRRGDGNNPFLEAD  335

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RRETA+QEAAA+R HPTLHLP   QP+TQ TGL  +S   G ST  Q
Sbjct  336   RRETARQEAAAKRAHPTLHLPTNSQPSTQATGLLANSGNHGASTVQQ  382


 Score =   149 bits (375),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             F+FTN K PA+YGTKWADLHPDSQKILLQIEE+ILEYRDESQRLDQCSRLYDSSVSNDGF
Sbjct  76    FIFTNDKAPASYGTKWADLHPDSQKILLQIEERILEYRDESQRLDQCSRLYDSSVSNDGF  135

Query  1533  ELDSSHNIQELVGISTSMERQK  1468
             E D+S  +QEL GIS S E QK
Sbjct  136   EFDASRIVQELGGISASTEHQK  157



>ref|XP_004167287.1| PREDICTED: uncharacterized LOC101220360 [Cucumis sativus]
Length=502

 Score =   278 bits (711),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 147/227 (65%), Positives = 179/227 (79%), Gaps = 2/227 (1%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +K +L ELM   K+ML NTEVA+RSFMM+RPRFLHQ+   +S+ T      GA     SS
Sbjct  154   QKVMLQELMAAAKEMLWNTEVAIRSFMMIRPRFLHQSAGGASNPTAPSQVPGATTPLGSS  213

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQL-ILDSDRKsl  1119
              Q T+    PVFDFYSG+P+KPSPF+QQT++RFEK+LAECRQW+E+LEQL +LDS+R + 
Sbjct  214   GQPTSTSIAPVFDFYSGLPRKPSPFLQQTVSRFEKYLAECRQWIEDLEQLLVLDSNRSAS  273

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             NSS SL QSLP++MSNVH+FFVHVA+KVESIHQYIESMK+AYL DQRRRG+ ++PFLEAD
Sbjct  274   NSSSSLFQSLPKIMSNVHEFFVHVASKVESIHQYIESMKSAYLADQRRRGDGNNPFLEAD  333

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RRETA+QEAAA+R HPTLHLP   QP+TQ  GL  +S   G ST  Q
Sbjct  334   RRETARQEAAAKRAHPTLHLPTNSQPSTQAAGLLANSGNHGASTVQQ  380


 Score =   149 bits (377),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             F+FTN K PA+YGTKWADLHPDSQKILLQIEE+ILEYRDESQRLDQCSRLYDSSVSNDGF
Sbjct  74    FIFTNDKAPASYGTKWADLHPDSQKILLQIEERILEYRDESQRLDQCSRLYDSSVSNDGF  133

Query  1533  ELDSSHNIQELVGISTSMERQK  1468
             E D+S  +QEL GIS S E QK
Sbjct  134   EFDASRIVQELGGISASTEHQK  155



>gb|KHN42049.1| Peroxidase A [Glycine soja]
Length=409

 Score =   291 bits (746),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 187/226 (83%), Gaps = 1/226 (0%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K++LHELM+ VKDMLRNTEVAVRSFMMLRPRFLH +   SS+  PSQ  GA +AP+SS+
Sbjct  72    QKTLLHELMSTVKDMLRNTEVAVRSFMMLRPRFLHPSGGTSSATAPSQTPGATIAPSSSS  131

Query  1292  QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSD-RKsln  1116
             Q TT    PVFDFYSG+P+KPSPF+QQT+ RFEK+L EC QW+EELEQL+L    R + +
Sbjct  132   QPTTASIVPVFDFYSGLPRKPSPFLQQTVLRFEKYLGECHQWIEELEQLLLLESERNASS  191

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
             +  SLLQSLP+VM+NVHDFFVHVAAKVESIHQYIESMK+AYL DQR RGEV+DPFLEADR
Sbjct  192   NGSSLLQSLPKVMTNVHDFFVHVAAKVESIHQYIESMKSAYLADQRHRGEVNDPFLEADR  251

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RETA+QEAA++RVHPTLHLPA  QP+TQV GLF SS       APQ
Sbjct  252   RETARQEAASKRVHPTLHLPANSQPSTQVAGLFSSSGTQAALPAPQ  297


 Score =   134 bits (338),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -3

Query  1680  YGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGFELDSSHNIQEL  1501
             Y T WADLHPDSQKILLQIEE+ILE+RDESQRLDQCSRLYDSSVSNDGFELD+ H +QEL
Sbjct  3     YSTNWADLHPDSQKILLQIEERILEFRDESQRLDQCSRLYDSSVSNDGFELDAGHIVQEL  62

Query  1500  VGISTSMERQKKYI  1459
              GI+T+MERQK  +
Sbjct  63    GGINTAMERQKTLL  76



>ref|XP_010437281.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like [Camelina sativa]
Length=501

 Score =   283 bits (725),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 189/317 (60%), Positives = 223/317 (70%), Gaps = 20/317 (6%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLH---QNppasssatpsqaSGAIVAPT  1302
             +K++LHELM V KDMLRN E+AVRSFMM +PRF H        S  +  SQA GA  AP 
Sbjct  160   QKAVLHELMIVAKDMLRNAEIAVRSFMMQQPRFPHWKQGGGVVSVGSQTSQAQGANPAPA  219

Query  1301  SSAQATTIPN-FPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDR  1128
             S+ Q   +     V DFY G+PKKP+ F+QQT+ RFEK+L ECRQWVEELEQL+ LDSD+
Sbjct  220   SAGQQQAVTTTVQVSDFYRGVPKKPTVFLQQTVVRFEKYLNECRQWVEELEQLLALDSDK  279

Query  1127  KslnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFL  948
                +   SLL+SLP+VMSNVHDFFVHVAAKVES HQYIESM+T+YL DQRRRGE  DPFL
Sbjct  280   --YSRHASLLESLPKVMSNVHDFFVHVAAKVESFHQYIESMRTSYLADQRRRGECHDPFL  337

Query  947   EADRRETAKQEAAARRVHPTLHLP---AAPQPATQVTGLFPSSAAPGTSTAPQtsailst  777
             EADRRETAKQEAAA+RVHPTLHLP   A+ QP+TQV GL  SSA PG S APQ SA ++T
Sbjct  338   EADRRETAKQEAAAKRVHPTLHLPASTASTQPSTQVAGLITSSATPGASNAPQPSAAVTT  397

Query  776   ssaasgsslfsTpaiaasssslfstptasapAV-SLFGSGASP-QTSLFGFLATSSPAF-  606
             S+ +SG+        A++ SS      +SA  V SLFG   +P QT LFG    SSPA  
Sbjct  398   SNPSSGAGFSFPNTPASAPSSSLFATPSSAAPVSSLFGPSPTPAQTPLFG----SSPAST  453

Query  605   --STPNLFG-STPSSGV  564
               S P+LFG +TPS G 
Sbjct  454   FGSAPSLFGQTTPSLGA  470


 Score =   142 bits (357),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K PA Y TKWADLHPDSQK+LLQIEEKILE+R ESQRLDQCSRLYDSSVS++G
Sbjct  79    LYLFTNDKAPANYSTKWADLHPDSQKLLLQIEEKILEHRSESQRLDQCSRLYDSSVSSEG  138

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+S  +QEL GI+T+M+RQK  +
Sbjct  139   FEFDASRIVQELGGINTAMDRQKAVL  164



>ref|XP_006283606.1| hypothetical protein CARUB_v10004663mg [Capsella rubella]
 gb|EOA16504.1| hypothetical protein CARUB_v10004663mg [Capsella rubella]
Length=493

 Score =   281 bits (719),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 217/318 (68%), Gaps = 31/318 (10%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLH---QNppasssatpsqaSGAIVAPT  1302
             +K++LHELM V KDMLRN E+AVRSFMML+PRF H        S  +  SQA G   AP 
Sbjct  160   QKAVLHELMIVAKDMLRNAEIAVRSFMMLQPRFPHWKQGGGVVSVGSQTSQAQGTNPAPA  219

Query  1301  SSAQATTIPN-FPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDR  1128
             S+ Q   +     V DFY GIPKKP+ F+QQT+ RFEK+L ECRQWVEELEQL+ LDSD+
Sbjct  220   SAGQQQAVTTTVQVSDFYRGIPKKPTVFLQQTVVRFEKYLNECRQWVEELEQLLALDSDK  279

Query  1127  KslnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFL  948
                +   SLL+SLP+VMSNVHDFFVHVAAKVESIHQYIESM+T+YL DQRR GE  DPFL
Sbjct  280   --YSRHASLLESLPKVMSNVHDFFVHVAAKVESIHQYIESMRTSYLADQRRIGECHDPFL  337

Query  947   EADRRETAKQEAAARRVHPTLHLPAA---PQPATQVTGLFPSSAAPGTSTAPQtsailst  777
             EADRRETAKQEAAA+RVHPTLHLPA+    QP+TQV GL  SSA PG S APQ +   S 
Sbjct  338   EADRRETAKQEAAAKRVHPTLHLPASTANTQPSTQVAGLIASSATPGASNAPQPAVTTSN  397

Query  776   ssaasgsslfsTpaiaasssslfstptasapAVSLFG--SGASPQTSLFGFLATSSPAF-  606
              S+ +G S  +TPA A SS              SLF   S A+P +SLFG   T +P F 
Sbjct  398   PSSGAGFSFLNTPASAPSS--------------SLFATPSSAAPTSSLFGPSTTPAPLFG  443

Query  605   ---STPNLFG-STPSSGV  564
                S  +LFG +TPS G 
Sbjct  444   SFGSASSLFGQATPSLGA  461


 Score =   142 bits (357),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             +LFTN K PA Y TKWADLHPDSQK+LLQIEEKILEYR ESQRLDQCSRLYDSSVS++GF
Sbjct  80    YLFTNDKAPANYSTKWADLHPDSQKLLLQIEEKILEYRSESQRLDQCSRLYDSSVSSEGF  139

Query  1533  ELDSSHNIQELVGISTSMERQKKYI  1459
             E D+S  +QEL GI+T+M+RQK  +
Sbjct  140   EFDASRIVQELGGINTAMDRQKAVL  164



>ref|XP_002866977.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH43236.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=503

 Score =   281 bits (719),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/233 (67%), Positives = 177/233 (76%), Gaps = 10/233 (4%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLH---QNppasssatpsqaSGAIVAPT  1302
             +K++LHELM V KDMLRN E+AVRSFMML+PRF H        S  + PSQ  G   AP 
Sbjct  164   QKAVLHELMIVAKDMLRNAEIAVRSFMMLQPRFPHWKQGGGVVSVGSQPSQGQGTNPAPA  223

Query  1301  SSAQATTIPN-FPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDR  1128
             SS Q   +     V DFY GIPKKP+ F+ QT+ RFEK+L ECRQWVEELEQL+ LDSD+
Sbjct  224   SSGQQQAVTTTVQVSDFYRGIPKKPTAFLLQTVGRFEKYLNECRQWVEELEQLLALDSDK  283

Query  1127  KslnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFL  948
                N   SLL+SLP+VMSNVHDFFVHVAAKVESIHQYIESM+T+YL DQRRRGE  DPFL
Sbjct  284   --YNRHASLLESLPKVMSNVHDFFVHVAAKVESIHQYIESMRTSYLADQRRRGECHDPFL  341

Query  947   EADRRETAKQEAAARRVHPTLHLPA---APQPATQVTGLFPSSAAPGTSTAPQ  798
             EADRRETAKQEAAA+RVHPTLHLPA   + QP+TQVTGL  SSA PG S  PQ
Sbjct  342   EADRRETAKQEAAAKRVHPTLHLPASTTSTQPSTQVTGLIASSATPGASNPPQ  394


 Score =   141 bits (356),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K PA Y TKWADLHPDSQK+LLQIEEKILE+R ESQRLDQCSRLYDSSVS++G
Sbjct  83    LYLFTNDKAPANYSTKWADLHPDSQKLLLQIEEKILEHRSESQRLDQCSRLYDSSVSSEG  142

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+S  +QEL GI+T+M+RQK  +
Sbjct  143   FEFDASRIVQELGGINTAMDRQKAVL  168



>ref|XP_010432110.1| PREDICTED: putative mediator of RNA polymerase II transcription 
subunit 26 [Camelina sativa]
Length=499

 Score =   279 bits (714),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 217/310 (70%), Gaps = 20/310 (6%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLH---QNppasssatpsqaSGAIVAPT  1302
             +K++LHELM V KDMLRN E+AVRSFMM +PRF H        +  +  SQA G   AP 
Sbjct  157   QKAVLHELMIVAKDMLRNAEIAVRSFMMQQPRFPHWKQGGGVVTVGSQTSQAQGTNPAPA  216

Query  1301  SSAQATTIPN-FPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDR  1128
             S+ Q   +     V DFY GIPKKP+ F+QQT+ RFEK+L ECRQWVEELEQL+ LDSD+
Sbjct  217   SAGQQQAVTTTVQVSDFYRGIPKKPTVFLQQTVVRFEKYLNECRQWVEELEQLLALDSDK  276

Query  1127  KslnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFL  948
                +   SLL+SLP+VMSNVHDFFVHVAAKVES HQYIESM+T+YL DQRRRGE  DPFL
Sbjct  277   --YSRHASLLESLPKVMSNVHDFFVHVAAKVESFHQYIESMRTSYLADQRRRGECHDPFL  334

Query  947   EADRRETAKQEAAARRVHPTLHLPAAP---QPATQVTGLFPSSAAPGTSTAPQtsailst  777
             EADRRETAKQEAAA+RVHPTLHLPA+    QP+TQV GL  SSA PG S APQ SA ++T
Sbjct  335   EADRRETAKQEAAAKRVHPTLHLPASTASIQPSTQVAGLITSSATPGASNAPQPSAAVTT  394

Query  776   ssaasgsslfsTpaiaasssslfstptasapAV-SLFGSGASP-QTSLFGFLATSSPAFS  603
             S+ +SG+        A++ SS      +SA  V SLFG   +P QT +FG    SSPA  
Sbjct  395   SNPSSGAGFSFPNTPASAPSSSLFATPSSAAPVSSLFGPSPTPAQTPVFG----SSPA--  448

Query  602   TPNLFGSTPS  573
               + FGS PS
Sbjct  449   --STFGSAPS  456


 Score =   142 bits (357),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K PA Y TKWADLHPDSQK+LLQIEEKILE+R ESQRLDQCSRLYDSSVS++G
Sbjct  76    LYLFTNDKAPANYSTKWADLHPDSQKLLLQIEEKILEHRSESQRLDQCSRLYDSSVSSEG  135

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+S  +QEL GI+T+M+RQK  +
Sbjct  136   FEFDASRIVQELGGINTAMDRQKAVL  161



>ref|XP_006411941.1| hypothetical protein EUTSA_v10025060mg [Eutrema salsugineum]
 gb|ESQ53394.1| hypothetical protein EUTSA_v10025060mg [Eutrema salsugineum]
Length=483

 Score =   283 bits (725),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 180/233 (77%), Gaps = 10/233 (4%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQN--ppasssatpsqaSGAIVAPTS  1299
             +K++LHELM V KDMLRN E+AVRSFMML+PRF H       +  + PSQ  GA  AP S
Sbjct  152   QKAVLHELMVVAKDMLRNAEIAVRSFMMLQPRFPHSKPVGSVNGGSQPSQTQGANPAPAS  211

Query  1298  SAQA--TTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDR  1128
             S Q   T      V DFY GIPKKP+ F+QQT+ARFEK+L ECRQWVEELEQL+ LDSD+
Sbjct  212   SGQQQQTITSIVQVSDFYRGIPKKPTAFLQQTVARFEKYLGECRQWVEELEQLLALDSDK  271

Query  1127  KslnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFL  948
                N   SLL+SLP+VMSNVHDFFVHVAAKVE+IHQYIESM+TAYL DQRRRGE +DPFL
Sbjct  272   --YNRHASLLESLPKVMSNVHDFFVHVAAKVENIHQYIESMRTAYLADQRRRGECNDPFL  329

Query  947   EADRRETAKQEAAARRVHPTLHLP---AAPQPATQVTGLFPSSAAPGTSTAPQ  798
             EADRRETAKQEAAA+RVHPTLHLP   A+ Q +TQV GL  SSAAP  S APQ
Sbjct  330   EADRRETAKQEAAAKRVHPTLHLPATSASTQTSTQVAGLIASSAAPVASNAPQ  382


 Score =   137 bits (344),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -3

Query  1704  TNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGFELD  1525
             TN K PA Y TKWADLHPDSQK+LLQIEEKILEYR ESQRLDQCSRLYDSSVS++GFE D
Sbjct  75    TNDKAPANYSTKWADLHPDSQKLLLQIEEKILEYRSESQRLDQCSRLYDSSVSSEGFEFD  134

Query  1524  SSHNIQELVGISTSMERQKKYI  1459
             +S  +QEL GI+T+M+RQK  +
Sbjct  135   ASRIVQELGGINTTMDRQKAVL  156



>ref|NP_195430.2| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
 sp|Q8RWH9.1|NUP58_ARATH RecName: Full=Nuclear pore complex protein NUP58; AltName: Full=Nucleoporin 
58; AltName: Full=Protein TRANSCURVATA1 [Arabidopsis 
thaliana]
 gb|AAM13071.1| unknown protein [Arabidopsis thaliana]
 gb|AAP68318.1| At4g37130 [Arabidopsis thaliana]
 gb|AEE86757.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
Length=513

 Score =   279 bits (713),  Expect(2) = 8e-108, Method: Compositional matrix adjust.
 Identities = 155/233 (67%), Positives = 176/233 (76%), Gaps = 10/233 (4%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLH---QNppasssatpsqaSGAIVAPT  1302
             +K++LHELM V KDMLRN E+AVRSFMML+PRF H        S  + PSQ  G   AP 
Sbjct  174   QKAVLHELMIVAKDMLRNAEIAVRSFMMLQPRFPHWKQGGGVVSVGSQPSQGQGTNPAPA  233

Query  1301  SSAQATTIPN-FPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDR  1128
             SS Q   +     V DFY GIPKKP+ F+ QT+ RFEK+L ECRQWVEELEQL+ LDSD+
Sbjct  234   SSGQQQAVTTTVQVSDFYRGIPKKPTAFLLQTVVRFEKYLNECRQWVEELEQLLALDSDK  293

Query  1127  KslnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFL  948
                +   SLL+SLP+VMSNVHDFFVHVAAKVESIHQYIESM+T+YL DQRRRGE  DPFL
Sbjct  294   --YSRHASLLESLPKVMSNVHDFFVHVAAKVESIHQYIESMRTSYLADQRRRGECHDPFL  351

Query  947   EADRRETAKQEAAARRVHPTLHLPA---APQPATQVTGLFPSSAAPGTSTAPQ  798
             EADRRETAKQEAAA+RVHPTLHLPA   + QP+TQV GL  SSA PG S  PQ
Sbjct  352   EADRRETAKQEAAAKRVHPTLHLPASTTSTQPSTQVAGLIASSATPGGSNPPQ  404


 Score =   141 bits (356),  Expect(2) = 8e-108, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K PA Y TKWADLHPDSQK+LLQIEEKILE+R ESQRLDQCSRLYDSSVS++G
Sbjct  93    LYLFTNDKAPANYSTKWADLHPDSQKLLLQIEEKILEHRSESQRLDQCSRLYDSSVSSEG  152

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+S  +QEL GI+T+M+RQK  +
Sbjct  153   FEFDASRIVQELGGINTAMDRQKAVL  178



>emb|CAB16782.1| nucleoporin-like protein [Arabidopsis thaliana]
 emb|CAB80379.1| nucleoporin-like protein [Arabidopsis thaliana]
Length=595

 Score =   279 bits (713),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/233 (67%), Positives = 176/233 (76%), Gaps = 10/233 (4%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLH---QNppasssatpsqaSGAIVAPT  1302
             +K++LHELM V KDMLRN E+AVRSFMML+PRF H        S  + PSQ  G   AP 
Sbjct  174   QKAVLHELMIVAKDMLRNAEIAVRSFMMLQPRFPHWKQGGGVVSVGSQPSQGQGTNPAPA  233

Query  1301  SSAQATTIPN-FPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDR  1128
             SS Q   +     V DFY GIPKKP+ F+ QT+ RFEK+L ECRQWVEELEQL+ LDSD+
Sbjct  234   SSGQQQAVTTTVQVSDFYRGIPKKPTAFLLQTVVRFEKYLNECRQWVEELEQLLALDSDK  293

Query  1127  KslnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFL  948
                +   SLL+SLP+VMSNVHDFFVHVAAKVESIHQYIESM+T+YL DQRRRGE  DPFL
Sbjct  294   --YSRHASLLESLPKVMSNVHDFFVHVAAKVESIHQYIESMRTSYLADQRRRGECHDPFL  351

Query  947   EADRRETAKQEAAARRVHPTLHLPA---APQPATQVTGLFPSSAAPGTSTAPQ  798
             EADRRETAKQEAAA+RVHPTLHLPA   + QP+TQV GL  SSA PG S  PQ
Sbjct  352   EADRRETAKQEAAAKRVHPTLHLPASTTSTQPSTQVAGLIASSATPGGSNPPQ  404


 Score =   140 bits (353),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K PA Y TKWADLHPDSQK+LLQIEEKILE+R ESQRLDQCSRLYDSSVS++G
Sbjct  93    LYLFTNDKAPANYSTKWADLHPDSQKLLLQIEEKILEHRSESQRLDQCSRLYDSSVSSEG  152

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+S  +QEL GI+T+M+RQK  +
Sbjct  153   FEFDASRIVQELGGINTAMDRQKAVL  178



>ref|XP_003611836.1| Peroxidase A [Medicago truncatula]
 gb|AES94794.1| hydroxyproline-rich glycoprotein family protein, putative [Medicago 
truncatula]
Length=489

 Score =   273 bits (698),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 187/316 (59%), Positives = 230/316 (73%), Gaps = 30/316 (9%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K++L EL + VKDMLRNTEVAVRSFM+LRPRF + +  ASS+  PSQ  GA   P+ ++
Sbjct  145   QKTLLQELTSAVKDMLRNTEVAVRSFMILRPRFHYPSGGASSATAPSQTPGATT-PSLNS  203

Query  1292  QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILD-SDRKsln  1116
             Q       PVFDFYSG+PKKPSPF+QQTI RFEK++ EC QW++ELEQL+L  S++ + +
Sbjct  204   QPPATSMVPVFDFYSGLPKKPSPFLQQTILRFEKYIGECHQWIQELEQLLLLESEKNASS  263

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
             +  SLLQSLP+VM+NVHDFFVHVAAKVESIHQY+ESMKTAYL DQRRRGEV+DPFLEADR
Sbjct  264   NGSSLLQSLPKVMTNVHDFFVHVAAKVESIHQYMESMKTAYLADQRRRGEVNDPFLEADR  323

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasgs  756
             RETA+QEAA++RVHPTLHLPA  QP+TQV GLF SS   G   + QT+A   + S  SGS
Sbjct  324   RETARQEAASKRVHPTLHLPANSQPSTQVAGLFSSSGTQGALVSQQTAATTPSLSIGSGS  383

Query  755   slfsTpaiaasssslfstptasapAVSLFG--------------SGASPQTSLFGFLATS  618
             SLF+TP+ A S++             SLFG              S ++PQ SLFG  ++S
Sbjct  384   SLFNTPSSAPSTTP------------SLFGTPTTPAQGASWPAPSSSTPQGSLFGSASSS  431

Query  617   SP-AFSTPNLFG-STP  576
              P A STP+LFG STP
Sbjct  432   LPGATSTPSLFGNSTP  447


 Score =   146 bits (368),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -3

Query  1704  TNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGFELD  1525
             TN KTPA+Y T WADLHPDSQK LLQIEE++LEYRDESQRLDQC+RLYDSSVSNDGFE+D
Sbjct  68    TNDKTPASYSTNWADLHPDSQKFLLQIEERVLEYRDESQRLDQCNRLYDSSVSNDGFEVD  127

Query  1524  SSHNIQELVGISTSMERQKKYI  1459
             +SH +QEL GIST+MERQK  +
Sbjct  128   ASHIVQELGGISTAMERQKTLL  149



>ref|XP_010446718.1| PREDICTED: putative mediator of RNA polymerase II transcription 
subunit 26 isoform X1 [Camelina sativa]
Length=513

 Score =   276 bits (706),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 175/233 (75%), Gaps = 10/233 (4%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLH---QNppasssatpsqaSGAIVAPT  1302
             +K++LHELM V KDMLRN E+AVRSFMM +PRF H        +  +  SQ  G   AP 
Sbjct  172   QKAVLHELMIVAKDMLRNAEIAVRSFMMQQPRFPHWKQGGGVVTVGSQTSQGQGTNPAPA  231

Query  1301  SSAQATTIPN-FPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDR  1128
             S+ Q   +     V +FY G+PKKP+ F+QQT+ RFEK+L ECRQWVEELEQL+ LDSD+
Sbjct  232   SAGQQQAVTTTVQVSEFYRGVPKKPTVFLQQTVVRFEKYLNECRQWVEELEQLLALDSDK  291

Query  1127  KslnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFL  948
                +   SLL+SLP+VMSNVHDFFVHVAAKVES HQYIESM+T+YL DQRRRGE  DPFL
Sbjct  292   --YSRHASLLESLPKVMSNVHDFFVHVAAKVESFHQYIESMRTSYLADQRRRGECHDPFL  349

Query  947   EADRRETAKQEAAARRVHPTLHLP---AAPQPATQVTGLFPSSAAPGTSTAPQ  798
             EADRRETAKQEAAA+RVHPTLHLP   A+ QP+TQV GL  SSA PG S APQ
Sbjct  350   EADRRETAKQEAAAKRVHPTLHLPASTASTQPSTQVAGLITSSATPGASNAPQ  402


 Score =   142 bits (357),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K PA Y TKWADLHPDSQK+LLQIEEKILE+R ESQRLDQCSRLYDSSVS++G
Sbjct  91    LYLFTNDKAPANYSTKWADLHPDSQKLLLQIEEKILEHRSESQRLDQCSRLYDSSVSSEG  150

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+S  +QEL GI+T+M+RQK  +
Sbjct  151   FEFDASRIVQELGGINTAMDRQKAVL  176



>ref|XP_010446719.1| PREDICTED: putative mediator of RNA polymerase II transcription 
subunit 26 isoform X2 [Camelina sativa]
Length=510

 Score =   276 bits (705),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 175/233 (75%), Gaps = 10/233 (4%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLH---QNppasssatpsqaSGAIVAPT  1302
             +K++LHELM V KDMLRN E+AVRSFMM +PRF H        +  +  SQ  G   AP 
Sbjct  172   QKAVLHELMIVAKDMLRNAEIAVRSFMMQQPRFPHWKQGGGVVTVGSQTSQGQGTNPAPA  231

Query  1301  SSAQATTIPN-FPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDR  1128
             S+ Q   +     V +FY G+PKKP+ F+QQT+ RFEK+L ECRQWVEELEQL+ LDSD+
Sbjct  232   SAGQQQAVTTTVQVSEFYRGVPKKPTVFLQQTVVRFEKYLNECRQWVEELEQLLALDSDK  291

Query  1127  KslnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFL  948
                +   SLL+SLP+VMSNVHDFFVHVAAKVES HQYIESM+T+YL DQRRRGE  DPFL
Sbjct  292   --YSRHASLLESLPKVMSNVHDFFVHVAAKVESFHQYIESMRTSYLADQRRRGECHDPFL  349

Query  947   EADRRETAKQEAAARRVHPTLHLP---AAPQPATQVTGLFPSSAAPGTSTAPQ  798
             EADRRETAKQEAAA+RVHPTLHLP   A+ QP+TQV GL  SSA PG S APQ
Sbjct  350   EADRRETAKQEAAAKRVHPTLHLPASTASTQPSTQVAGLITSSATPGASNAPQ  402


 Score =   142 bits (357),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K PA Y TKWADLHPDSQK+LLQIEEKILE+R ESQRLDQCSRLYDSSVS++G
Sbjct  91    LYLFTNDKAPANYSTKWADLHPDSQKLLLQIEEKILEHRSESQRLDQCSRLYDSSVSSEG  150

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+S  +QEL GI+T+M+RQK  +
Sbjct  151   FEFDASRIVQELGGINTAMDRQKAVL  176



>ref|XP_002522356.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40040.1| conserved hypothetical protein [Ricinus communis]
Length=412

 Score =   269 bits (688),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/223 (71%), Positives = 183/223 (82%), Gaps = 2/223 (1%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLH-QNppasssatpsqaSGAIVAPTSS  1296
             +K++L ELM  VKDMLRNTE+A+RSFMMLRPRF       AS++A PSQ SGA  A  S+
Sbjct  145   QKTLLQELMVNVKDMLRNTEMAIRSFMMLRPRFFRPNAGGASNAAAPSQPSGAAAAAGST  204

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKsl  1119
              Q  +    PVFDFYSG+PKKPSPF+QQT+ARFEK+L ECRQW+EELEQL+L DSDR S 
Sbjct  205   GQTASASILPVFDFYSGLPKKPSPFLQQTVARFEKYLGECRQWIEELEQLLLLDSDRNSS  264

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             +   SLLQSLP+VM N+HDFFVHV +KVESIHQYIESM+TAYL DQRRRGE++DPFLEAD
Sbjct  265   HPGTSLLQSLPKVMENLHDFFVHVTSKVESIHQYIESMRTAYLADQRRRGELNDPFLEAD  324

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTS  810
             RRETAKQEAAA+RVHPTLHLP   QP+TQV GLF SSA PG S
Sbjct  325   RRETAKQEAAAKRVHPTLHLPPNSQPSTQVAGLFASSATPGAS  367


 Score =   144 bits (362),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             +LFTN K PA+Y TKWADLHPDSQK LLQIEE+ILEYRDESQRLDQCSRLYDS+ S +GF
Sbjct  65    YLFTNDKAPASYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCSRLYDSAFSYEGF  124

Query  1533  ELDSSHNIQELVGISTSMERQK  1468
             ELD+ H IQEL GISTSMERQK
Sbjct  125   ELDAGHIIQELGGISTSMERQK  146



>ref|XP_006856242.1| hypothetical protein AMTR_s00059p00214550 [Amborella trichopoda]
 gb|ERN17709.1| hypothetical protein AMTR_s00059p00214550 [Amborella trichopoda]
Length=492

 Score =   272 bits (696),  Expect(2) = 9e-105, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 170/220 (77%), Gaps = 2/220 (1%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K +L ELM+VVK M+RNTEVAV SFMML PRF+H     ++ ++    SGA+     + 
Sbjct  118   EKILLQELMSVVKGMMRNTEVAVWSFMMLHPRFVHTRGSTTTHSSTPPISGAMTHANPNT  177

Query  1292  QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL--DSDRKsl  1119
             Q       PV D+YSGIP++PSPF+Q T+ARFEK+LAECRQW+EELEQL+L    +  + 
Sbjct  178   QQKATSVVPVIDYYSGIPRRPSPFLQHTVARFEKYLAECRQWIEELEQLLLRGSDENGNG  237

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             N+ ++LL SLP VMSNVHDFFVHVAAKVE++HQ++ESM+ AYL DQRRRGE +DPFLEAD
Sbjct  238   NTDLTLLDSLPAVMSNVHDFFVHVAAKVETLHQHMESMRAAYLADQRRRGEGNDPFLEAD  297

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAP  819
             RRETAKQE AARRVHPTLHLP+ PQP TQV GLF  S+ P
Sbjct  298   RRETAKQEVAARRVHPTLHLPSLPQPLTQVAGLFACSSTP  337


 Score =   137 bits (346),  Expect(2) = 9e-105, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             ++LFTN K PA+Y T W+DLHP+SQK+LL+IEE+ILEYR ESQRLDQCSRLYD+SVSND 
Sbjct  37    MYLFTNEKAPASYQTTWSDLHPESQKLLLEIEERILEYRVESQRLDQCSRLYDTSVSNDA  96

Query  1536  FELDSSHNIQELVGISTSMERQK  1468
             FELD+ H IQEL GIST+MER+K
Sbjct  97    FELDACHIIQELGGISTAMEREK  119



>gb|KFK30341.1| hypothetical protein AALP_AA7G249000 [Arabis alpina]
Length=467

 Score =   273 bits (697),  Expect(2) = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 176/234 (75%), Gaps = 9/234 (4%)
 Frame = -1

Query  1478  NGKKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQN----ppasssatpsqaSGAIV  1311
             + +K++LHELM V KDMLRN E+AVRSFMM +PRF H            + PSQ  GA  
Sbjct  155   DRQKAVLHELMVVAKDMLRNAEIAVRSFMMFQPRFHHSKPGGVVVNGGGSQPSQIQGANP  214

Query  1310  APTSSAQATTIPNFPVF-DFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LD  1137
             A  SS Q           DFY GIPKKP+ F+QQT+ RFEK+L ECRQWVEELEQL+ LD
Sbjct  215   ALASSGQVQQQQAVVHVSDFYRGIPKKPTVFLQQTVVRFEKYLGECRQWVEELEQLLALD  274

Query  1136  SDRKslnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSD  957
             SD+   N   SLL+SLP+VMSNVHDFFVHVAAKVE+IHQYIESM+TAYL DQRRRGE +D
Sbjct  275   SDK--YNRHASLLESLPKVMSNVHDFFVHVAAKVENIHQYIESMRTAYLADQRRRGECND  332

Query  956   PFLEADRRETAKQEAAARRVHPTLHLPA-APQPATQVTGLFPSSAAPGTSTAPQ  798
             PFLEADRRETAKQEAAA+RVHPTLHLPA + Q +TQV GL  SSAAPG S APQ
Sbjct  333   PFLEADRRETAKQEAAAKRVHPTLHLPATSAQTSTQVAGLITSSAAPGASNAPQ  386


 Score =   132 bits (331),  Expect(2) = 4e-103, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN + PA Y TKW DLH DSQK+LLQIEEKILE R ESQRLDQC+RLYDSSVS++G
Sbjct  76    LYLFTNDRAPANYSTKWTDLHQDSQKVLLQIEEKILESRSESQRLDQCNRLYDSSVSSEG  135

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+S  +QEL GI+T+M+RQK  +
Sbjct  136   FEFDASRIVQELGGINTAMDRQKAVL  161



>emb|CDX75613.1| BnaA01g00890D [Brassica napus]
Length=487

 Score =   259 bits (662),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 230/318 (72%), Gaps = 23/318 (7%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQ----NppasssatpsqaSGAIVAP  1305
             +K++LHELM VVKDMLR++E+AVRSF+ML+PRF          A+ S +     GA  A 
Sbjct  148   QKAVLHELMVVVKDMLRDSEIAVRSFIMLQPRFPQSKPGGGGAATGSQSSQALQGANQAA  207

Query  1304  TSSA--QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDS  1134
              SS   Q        V DFY G+P+KP+ F+QQT+ARFEK+L ECRQWVEELEQL+ LDS
Sbjct  208   ASSGHQQQGVASIVQVSDFYRGVPRKPTVFLQQTVARFEKYLGECRQWVEELEQLLALDS  267

Query  1133  DRKslnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDP  954
             D+   +  VSLL+SLP+V+SNVHDFFVHVAAKVE+IHQYIESM+TAYL DQRRRGE  DP
Sbjct  268   DK--FSRHVSLLESLPKVISNVHDFFVHVAAKVENIHQYIESMRTAYLADQRRRGECHDP  325

Query  953   FLEADRRETAKQEAAARRVHPTLHLPA----APQPATQVTGLFPSSAAPGTSTAPQtsai  786
             FLEADRRETAKQEAAA+RVHPTLHLPA    + Q +TQV GL  SS AP TS+A      
Sbjct  326   FLEADRRETAKQEAAAKRVHPTLHLPANTATSTQTSTQVAGLITSSNAPPTSSA-----F  380

Query  785   lstssaasgsslfsTpaiaasssslfstptasapAVSLFGSGASP-QTSLFGFLATSSPA  609
              + + ++ G    STPA AA ++SLF+TP+++AP+ SLFG+  +P QT LFG  ++ SPA
Sbjct  381   PTPNPSSGGGLFLSTPASAAPATSLFATPSSAAPSSSLFGAATTPSQTPLFG--SSPSPA  438

Query  608   F-STPNLFGS-TPSSGVT  561
             F S P+LFG  TPS   T
Sbjct  439   FGSAPSLFGQPTPSIAAT  456


 Score =   143 bits (361),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K PA+YGTKWADLHPDSQK+LLQIE K+LEYR ESQRLDQCSRLYDSSVS +G
Sbjct  67    LYLFTNDKAPASYGTKWADLHPDSQKLLLQIEGKVLEYRSESQRLDQCSRLYDSSVSTEG  126

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+S  +QEL GI+T+M+RQK  +
Sbjct  127   FEFDASRIVQELGGINTTMDRQKAVL  152



>ref|XP_009140235.1| PREDICTED: uncharacterized protein LOC103864202 [Brassica rapa]
Length=487

 Score =   257 bits (657),  Expect(2) = 6e-102, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 228/318 (72%), Gaps = 23/318 (7%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQN----ppasssatpsqaSGAIVAP  1305
             +K++LHELM VVKDMLR++EVAVRSF+ML+PRF                   + GA  AP
Sbjct  148   QKAVLHELMVVVKDMLRDSEVAVRSFIMLQPRFPQSKPAGGGGVVGGGGSQSSQGANQAP  207

Query  1304  TSSA--QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDS  1134
              SS   Q        V DFY G+P+KP+ F+QQT+ARFEK+L ECRQWVEELEQL+ LDS
Sbjct  208   ASSGHQQQGVASVVQVSDFYRGVPRKPTVFLQQTVARFEKYLGECRQWVEELEQLLALDS  267

Query  1133  DRKslnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDP  954
             D+   +  VSLL+SLP+V+SNVHDFFVHVAAKVE+IHQYIESM+TAYL DQRRRGE  DP
Sbjct  268   DK--FSRHVSLLESLPKVISNVHDFFVHVAAKVENIHQYIESMRTAYLADQRRRGECHDP  325

Query  953   FLEADRRETAKQEAAARRVHPTLHLPA----APQPATQVTGLFPSSAAPGTSTAPQtsai  786
             FLEADRRETAKQEAAA+RVHPTLHLPA    + Q +TQV GL  SS AP TS+A      
Sbjct  326   FLEADRRETAKQEAAAKRVHPTLHLPANTATSTQTSTQVAGLITSSNAPPTSSA-----F  380

Query  785   lstssaasgsslfsTpaiaasssslfstptasapAVSLFGSGASP-QTSLFGFLATSSPA  609
              + + ++ G    STPA AA ++SLF+TP+++AP+ SLFG+  +P QT LFG  ++ +PA
Sbjct  381   PTPNPSSGGGLFLSTPASAAPATSLFATPSSAAPSSSLFGAATTPSQTPLFG--SSPAPA  438

Query  608   F-STPNLFGS-TPSSGVT  561
             F S P+LFG  TPS   T
Sbjct  439   FGSAPSLFGQPTPSIAAT  456


 Score =   143 bits (361),  Expect(2) = 6e-102, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K PA+YGTKWADLHPDSQK+LLQIE K+LEYR ESQRLDQCSRLYDSSVS +G
Sbjct  67    LYLFTNDKAPASYGTKWADLHPDSQKLLLQIEGKVLEYRSESQRLDQCSRLYDSSVSTEG  126

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+S  +QEL GI+T+M+RQK  +
Sbjct  127   FEFDASRIVQELGGINTTMDRQKAVL  152



>ref|XP_011039245.1| PREDICTED: nuclear pore complex protein NUP58 isoform X3 [Populus 
euphratica]
Length=499

 Score =   254 bits (648),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 195/314 (62%), Positives = 233/314 (74%), Gaps = 18/314 (6%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatp--sqaSGAIVAPTS  1299
             +K++L ELMT VKDMLRNTE+AVRSFM+L PRFLH N    +S     SQ+ G    P S
Sbjct  158   QKALLQELMTNVKDMLRNTEMAVRSFMILHPRFLHSNAGVGASNATAPSQSPGTTGIPGS  217

Query  1298  SAQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKs  1122
             ++Q T+    PVFDFYSG+PKKPSPF+QQT+ARFEK+L EC QW+EELEQL+L DS+R S
Sbjct  218   TSQPTSSSIVPVFDFYSGLPKKPSPFLQQTVARFEKYLGECSQWIEELEQLLLLDSERNS  277

Query  1121  lnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEA  942
              +   SLLQSLP+VMSNVHDFFVHVAAKVESIHQYIESMKTAYL DQRRRG+ +DPFLEA
Sbjct  278   SHPGSSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLVDQRRRGDGNDPFLEA  337

Query  941   DRRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaas  762
             DRRE A++EAAA+R HPTLHLPA  QP+TQ  GLF SSA    ST PQTS   + + A+S
Sbjct  338   DRRERARKEAAAKRAHPTLHLPANSQPSTQGAGLFASSATSSASTTPQTSTATAPAPASS  397

Query  761   gsslfsTpaiaasssslf----stptasapAVSLFGSGASPQTSLFGFLA------TSSP  612
             G++L      +  SSS+     +TPT SAPA +LFGS A+P  SLFG  A      +S+P
Sbjct  398   GNALSLFNTPSVPSSSMSSSLFATPTTSAPASNLFGSAATP--SLFGSAAQAFGASSSAP  455

Query  611   AF---STPNLFGST  579
             A    STP+LFGST
Sbjct  456   ALGSASTPSLFGST  469


 Score =   141 bits (355),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 76/90 (84%), Gaps = 4/90 (4%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K PA+Y TKW DLHPDSQK LLQIEE+ILEYRDES+RLDQC+RLYDSSVSN+G
Sbjct  73    LYLFTNDKAPASYSTKWEDLHPDSQKTLLQIEERILEYRDESKRLDQCNRLYDSSVSNEG  132

Query  1536  FELDSSHNI----QELVGISTSMERQKKYI  1459
             FELD+S  I    QEL GISTSMERQK  +
Sbjct  133   FELDASQIIQAYLQELGGISTSMERQKALL  162



>ref|XP_011039244.1| PREDICTED: nuclear pore complex protein NUP58 isoform X2 [Populus 
euphratica]
Length=505

 Score =   253 bits (646),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 197/314 (63%), Positives = 236/314 (75%), Gaps = 18/314 (6%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNpp--asssatpsqaSGAIVAPTS  1299
             +K++L ELMT VKDMLRNTE+AVRSFM+L PRFLH N    AS++  PSQ+ G    P S
Sbjct  158   QKALLQELMTNVKDMLRNTEMAVRSFMILHPRFLHSNAGVGASNATAPSQSPGTTGIPGS  217

Query  1298  SAQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKs  1122
             ++Q T+    PVFDFYSG+PKKPSPF+QQT+ARFEK+L EC QW+EELEQL+L DS+R S
Sbjct  218   TSQPTSSSIVPVFDFYSGLPKKPSPFLQQTVARFEKYLGECSQWIEELEQLLLLDSERNS  277

Query  1121  lnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEA  942
              +   SLLQSLP+VMSNVHDFFVHVAAKVESIHQYIESMKTAYL DQRRRG+ +DPFLEA
Sbjct  278   SHPGSSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIESMKTAYLVDQRRRGDGNDPFLEA  337

Query  941   DRRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaas  762
             DRRE A++EAAA+R HPTLHLPA  QP+TQ  GLF SSA    ST PQTS   + + A+S
Sbjct  338   DRRERARKEAAAKRAHPTLHLPANSQPSTQGAGLFASSATSSASTTPQTSTATAPAPASS  397

Query  761   gsslfsTpaiaasssslf----stptasapAVSLFGSGASPQTSLFGFLA------TSSP  612
             G++L      +  SSS+     +TPT SAPA +LFGS A+P  SLFG  A      +S+P
Sbjct  398   GNALSLFNTPSVPSSSMSSSLFATPTTSAPASNLFGSAATP--SLFGSAAQAFGASSSAP  455

Query  611   AF---STPNLFGST  579
             A    STP+LFGST
Sbjct  456   ALGSASTPSLFGST  469


 Score =   141 bits (355),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 76/90 (84%), Gaps = 4/90 (4%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K PA+Y TKW DLHPDSQK LLQIEE+ILEYRDES+RLDQC+RLYDSSVSN+G
Sbjct  73    LYLFTNDKAPASYSTKWEDLHPDSQKTLLQIEERILEYRDESKRLDQCNRLYDSSVSNEG  132

Query  1536  FELDSSHNI----QELVGISTSMERQKKYI  1459
             FELD+S  I    QEL GISTSMERQK  +
Sbjct  133   FELDASQIIQAYLQELGGISTSMERQKALL  162



>emb|CDX69263.1| BnaC01g01900D [Brassica napus]
Length=489

 Score =   246 bits (628),  Expect(2) = 9e-99, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 176/232 (76%), Gaps = 11/232 (5%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQN---ppasssatpsqaSGAIVAPT  1302
             +K++LHELM VVK MLR++EVAVRSF+ML+PRF          +++ + +Q +    A +
Sbjct  152   QKAVLHELMVVVKAMLRDSEVAVRSFIMLQPRFPQSKPAGGGGAAAGSEAQGANPAAASS  211

Query  1301  SSAQATTIPNF-PVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDR  1128
             S  Q   + +   V DFY G+P+KP+ F+QQT+ARFEK+L ECRQWVEELEQL+ LDSD+
Sbjct  212   SGHQQQGVASVVQVSDFYRGVPRKPTVFLQQTVARFEKYLGECRQWVEELEQLLALDSDK  271

Query  1127  KslnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFL  948
                +  VSLL+SLP+V+SNVHDFFVHVAAKVE+IHQYIESM+TAYL DQRRRGE  DPFL
Sbjct  272   --FSRRVSLLESLPKVISNVHDFFVHVAAKVENIHQYIESMRTAYLADQRRRGECHDPFL  329

Query  947   EADRRETAKQEAAARRVHPTLHLPA----APQPATQVTGLFPSSAAPGTSTA  804
             EADRRETAKQEAAA+RVHPTLHLPA      Q +TQV GL  SS AP  S A
Sbjct  330   EADRRETAKQEAAAKRVHPTLHLPANTTTVTQTSTQVAGLITSSNAPPASAA  381


 Score =   144 bits (362),  Expect(2) = 9e-99, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K PA+YGTKWADLHPDSQK+LLQIE KILEYR ESQRLDQCSRLYDSSVS +G
Sbjct  71    LYLFTNDKAPASYGTKWADLHPDSQKLLLQIEGKILEYRSESQRLDQCSRLYDSSVSTEG  130

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+S  +QEL GI+T+M+RQK  +
Sbjct  131   FEFDASRIVQELGGINTTMDRQKAVL  156



>ref|XP_009397295.1| PREDICTED: uncharacterized protein LOC103982182 [Musa acuminata 
subsp. malaccensis]
Length=504

 Score =   260 bits (664),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 162/315 (51%), Positives = 217/315 (69%), Gaps = 13/315 (4%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNp-passsatpsqaSGAIVAPTSS  1296
             +K  + ELM  V  M+ +TE A+RS+MMLRP+F  QN    ++ A+ SQ +G+ +A   +
Sbjct  158   EKVSIQELMASVNKMMWDTEFAIRSYMMLRPKFHRQNVPAITNVASGSQNTGSGIASNPT  217

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKsln  1116
              Q  T    PVFDFYSG+PK+PS FM+ T+ARFEK+L EC QW+EE+EQL++    K  +
Sbjct  218   NQLATGSVAPVFDFYSGLPKRPSIFMEHTVARFEKYLTECCQWIEEVEQLVMMDTSKMSS  277

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
             SS+  L   PQV+SNVHDFF+HVAAKVE++HQY+ESMKTAYL DQRRRG+ +DPFLEA+R
Sbjct  278   SSLEAL---PQVISNVHDFFIHVAAKVENLHQYVESMKTAYLADQRRRGDGNDPFLEANR  334

Query  935   RETAKQEAAARRVHPTLHLPA-APQPATQVTGLFPSSAAPGTSTAPQtsailstssaasg  759
             RE AKQEAAARRVHPTLHLPA + Q  TQV+G F SSA P +ST   + A  + SS    
Sbjct  335   REAAKQEAAARRVHPTLHLPAISAQSTTQVSGAFASSAIPVSSTLQPSGAPSAASSGGGF  394

Query  758   sslfsTpaiaasssslfstptasapAVSLFG-SGASPQTSLFG------FLATSSPA-FS  603
             S   +  +  A+SSS   +   ++   +LFG SG SPQ++ FG      F +T +P+ F+
Sbjct  395   SLFSTPSSAPAASSSSLFSTPTASAPSTLFGSSGFSPQSTPFGTPSASLFGSTQTPSGFA  454

Query  602   TPNLFGSTPSSGVTN  558
             T   FGSTP++G ++
Sbjct  455   TSTPFGSTPAAGSSS  469


 Score =   125 bits (315),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L L+T  + PA Y TKW DLHPDSQK+LLQIE +ILEY+DESQRLDQCSRLYDSS+S D 
Sbjct  77    LLLYTKDRAPAGYNTKWDDLHPDSQKLLLQIEVRILEYKDESQRLDQCSRLYDSSISGDS  136

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FEL +S  IQEL  IST+MER+K  I
Sbjct  137   FELTASRIIQELGVISTAMEREKVSI  162



>emb|CDY44056.1| BnaA08g15500D [Brassica napus]
Length=457

 Score =   255 bits (651),  Expect(2) = 6e-95, Method: Compositional matrix adjust.
 Identities = 144/238 (61%), Positives = 167/238 (70%), Gaps = 18/238 (8%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQN------------ppasssatpsq  1329
             +K++LHELM  VKDM RN+EVAV SFMML+PR                     S    +Q
Sbjct  140   QKAVLHELMLAVKDMFRNSEVAVGSFMMLQPRSRRSKPGGGGGRGAVVVSGGDSQQPQAQ  199

Query  1328  aSGAIVAPTSSAQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQ  1149
               G   AP SS +   +    V  FY GIPKKP+ F+ QT+ RFEK+L +CRQWVEELEQ
Sbjct  200   GQGVNSAPASSGEQQAV---QVSYFYRGIPKKPTAFLLQTVVRFEKYLGQCRQWVEELEQ  256

Query  1148  LI-LDSDRKslnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRR  972
             L+ LDSD+   N  V +L+SLP VMSNVH FFVHVAAKVE+IHQYIESM+TAYL DQRRR
Sbjct  257   LLALDSDK--YNRHVLVLESLPNVMSNVHAFFVHVAAKVENIHQYIESMRTAYLADQRRR  314

Query  971   GEVSDPFLEADRRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             GE +DPFLEADRRETAKQEAAA+RVHPTLHLP A    TQVTG   +SA PG+S APQ
Sbjct  315   GECNDPFLEADRRETAKQEAAAKRVHPTLHLPVATSTRTQVTGFINNSATPGSSNAPQ  372


 Score =   122 bits (306),  Expect(2) = 6e-95, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN + PA+Y T+W DLHPDSQK+LL+IE+KILEY  ESQRLDQC+RL DSS+S++G
Sbjct  59    LYLFTNDQAPASYSTEWTDLHPDSQKLLLEIEKKILEYSSESQRLDQCNRLDDSSLSSEG  118

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             F  D+S  +QEL GI+T+M+RQK  +
Sbjct  119   FGFDASRIVQELGGINTTMDRQKAVL  144



>ref|XP_009109352.1| PREDICTED: uncharacterized protein LOC103835013 [Brassica rapa]
Length=455

 Score =   256 bits (653),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 168/236 (71%), Gaps = 16/236 (7%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQN----------ppasssatpsqaS  1323
             +K++LHELM  VKDM RN+EVAV SFMML+PR                 +   +   QA 
Sbjct  140   QKAVLHELMLAVKDMFRNSEVAVGSFMMLQPRSRRSKPGGGGGRGAVVVSGGDSQQPQAQ  199

Query  1322  GAIVAPTSSAQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI  1143
             G   AP SS +   +    V  FY GIPKKP+ F+ QT+ RFEK+L +CRQWVEELEQL+
Sbjct  200   GVNSAPASSGEQQAVQ---VSYFYRGIPKKPTAFLLQTVVRFEKYLGQCRQWVEELEQLL  256

Query  1142  -LDSDRKslnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGE  966
              LDSD+   N  V +L+SLP VMSNVH FFVHVAAKVE+IHQYIESM+TAYL DQRRRGE
Sbjct  257   ALDSDK--YNRHVLVLESLPNVMSNVHAFFVHVAAKVENIHQYIESMRTAYLADQRRRGE  314

Query  965   VSDPFLEADRRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
              +DPFLEADRRETAKQEAAA+RVHPTLHLP A    TQVTG   +SA PG+S APQ
Sbjct  315   CNDPFLEADRRETAKQEAAAKRVHPTLHLPVATSTRTQVTGFINNSATPGSSNAPQ  370


 Score =   119 bits (299),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN + PA+Y T+W DLHPDSQK+LL+IE+KILEY  ESQRLDQC+RL D S+S++G
Sbjct  59    LYLFTNDQAPASYSTEWTDLHPDSQKLLLEIEKKILEYSSESQRLDQCNRLDDLSLSSEG  118

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             F  D+S  +QEL GI+T+M+RQK  +
Sbjct  119   FGFDASRIVQELGGINTTMDRQKAVL  144



>ref|XP_010263779.1| PREDICTED: uncharacterized protein LOC104601956 [Nelumbo nucifera]
Length=488

 Score =   308 bits (789),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 171/280 (61%), Positives = 207/280 (74%), Gaps = 14/280 (5%)
 Frame = -1

Query  1604  IEMRVNGLINVAGCMIHQCQMMGLSLILVIIFRNLLESAH---QWNG-------KKSILH  1455
             IE R+ G  + +   + QC  +  S +    F   LE++H   +  G       +K++L 
Sbjct  92    IEERILGYRDESE-RLDQCSRLYDSSVSSDGFE--LEASHIVQELGGISIAMEREKALLQ  148

Query  1454  ELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSSAQATTI  1278
             ELMTVVK M+RNTEVAVRSFMMLRPRFLH N  A+S+AT    + GA +AP +++Q  + 
Sbjct  149   ELMTVVKTMMRNTEVAVRSFMMLRPRFLHPNVGATSNATAPSQAPGATMAPNATSQPMST  208

Query  1277  PNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKslnssvsll  1098
                PVFDFYSGIPK+PS FMQ T+ARFEK+L EC QW+EELEQL+ DSD        SL+
Sbjct  209   SVVPVFDFYSGIPKRPSQFMQHTVARFEKYLGECCQWIEELEQLLSDSDGNPNGMDSSLV  268

Query  1097  qsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRRETAKQ  918
             QSLP+VMSNVHDFFVHVAAKVES+HQ+IESMKTAYL DQRRRG+ +DPFLEADRRETAKQ
Sbjct  269   QSLPKVMSNVHDFFVHVAAKVESLHQFIESMKTAYLADQRRRGDGNDPFLEADRRETAKQ  328

Query  917   EAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQ  798
             EAAA+RVHPTLHLP+  QP+TQV GLF SSA  G S+APQ
Sbjct  329   EAAAKRVHPTLHLPSISQPSTQVAGLFASSATGGPSSAPQ  368


 Score =   146 bits (369),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             +LFTN KTPA+Y TKWADLHPDSQK+LLQIEE+IL YRDES+RLDQCSRLYDSSVS+DGF
Sbjct  63    YLFTNDKTPASYNTKWADLHPDSQKVLLQIEERILGYRDESERLDQCSRLYDSSVSSDGF  122

Query  1533  ELDSSHNIQELVGISTSMERQKKYI  1459
             EL++SH +QEL GIS +MER+K  +
Sbjct  123   ELEASHIVQELGGISIAMEREKALL  147



>ref|XP_008440231.1| PREDICTED: uncharacterized protein DDB_G0271670 isoform X2 [Cucumis 
melo]
Length=402

 Score =   282 bits (721),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 225/307 (73%), Gaps = 7/307 (2%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTS-S  1296
             +K +L ELM   K+ML NTEVA+RSFMM+RPRFLHQ+   +S+ T          P   S
Sbjct  55    QKVMLQELMAAAKEMLWNTEVAIRSFMMIRPRFLHQSARGASNPTAPSQVSGATTPLGPS  114

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQL-ILDSDRKsl  1119
              Q T+    PVFDFYSG+P+KPSPF+QQT++RFEK+L ECRQW+E+LEQL ILDS+R + 
Sbjct  115   GQPTSTSIAPVFDFYSGLPRKPSPFLQQTVSRFEKYLGECRQWIEDLEQLLILDSNRSAS  174

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             NSS SL QSLP++MSNVH+FFVHVAAKVESIHQYIESMK+AYL DQRRRG+ ++PFLEAD
Sbjct  175   NSSSSLFQSLPKIMSNVHEFFVHVAAKVESIHQYIESMKSAYLADQRRRGDGNNPFLEAD  234

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsails-tssaas  762
             RRETA+QEAAA+R HPTLHLPA  QP+TQ  GL  +S   G ST  Q+S + +  SS   
Sbjct  235   RRETARQEAAAKRAHPTLHLPANSQPSTQAAGLLANSGNHGASTIQQSSTVATPASSGGG  294

Query  761   gsslfsTpaiaasssslfstptasapAVSLFGSGASPQTSLFGFLATSSPAFSTPNL-FG  585
              S   +  A + ++SSLF TPTAS    SLFGS ++   SLFG  ++S+P FS+ +  FG
Sbjct  295   LSLFSTPSAPSTTTSSLFMTPTASVQTSSLFGSSSAAAPSLFG--SSSAPLFSSASTPFG  352

Query  584   ST-PSSG  567
             ST PS G
Sbjct  353   STAPSFG  359


 Score = 90.1 bits (222),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -3

Query  1635  LLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGFELDSSHNIQELVGISTSMERQK  1468
             + +  E+ILEYRDESQRLDQCSRLYDSSVSNDGFELD+S  +QEL GIS S E QK
Sbjct  1     MRRYRERILEYRDESQRLDQCSRLYDSSVSNDGFELDASRIVQELGGISASTEHQK  56



>ref|XP_010941868.1| PREDICTED: nuclear pore complex protein NUP58 [Elaeis guineensis]
Length=499

 Score =   245 bits (625),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 166/215 (77%), Gaps = 7/215 (3%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAI-VAPTSS  1296
             +K  + ELM  V DM+ +TE AVRS++MLRPRFL QN PA+S  +P+  + ++ V    +
Sbjct  151   EKVSVQELMKNVNDMMWHTEFAVRSYVMLRPRFLRQNVPAASGVSPASQTVSVAVTSGQT  210

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQ-LILDSDRKsl  1119
              Q  T    P F+FYSGIPK+PS FMQ T ARFEK+L EC QW+EELEQ L++D+D+   
Sbjct  211   NQLMTSSISPSFEFYSGIPKRPSLFMQHTAARFEKYLTECCQWIEELEQVLLMDTDK---  267

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
              +S + L++LP+VMSNVHD+F+HVAAKVES+HQYIESMK AYL DQRRRG+ +DPF+EA 
Sbjct  268   -TSSNSLEALPKVMSNVHDYFIHVAAKVESLHQYIESMKMAYLADQRRRGDGNDPFIEAS  326

Query  938   RRETAKQEAAARRVHPTLHLPA-APQPATQVTGLF  837
             RRE AKQEAAARRVHPTLHLPA + QPATQ  G+F
Sbjct  327   RREAAKQEAAARRVHPTLHLPANSAQPATQAAGIF  361


 Score =   126 bits (317),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L LFT  ++PA Y TKW DLHPDSQK+LLQIEE+ILEY+ ESQ+LDQCSRLYDSSVS+D 
Sbjct  70    LLLFTVDRSPAGYNTKWEDLHPDSQKLLLQIEERILEYKYESQKLDQCSRLYDSSVSSDS  129

Query  1536  FELDSSHNIQELVGISTSMERQK  1468
             FE+D+S  +QEL GI+T++ER+K
Sbjct  130   FEIDASRILQELGGITTAIEREK  152



>emb|CDP02451.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   306 bits (783),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 215/373 (58%), Positives = 258/373 (69%), Gaps = 27/373 (7%)
 Frame = -1

Query  1538  GLSLILVIIFRNLLESAHQWNGKKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNp  1359
             G  L    IF+ L         +++I  ELM+V KDML NTEVAVRSFMMLRPRFLH N 
Sbjct  138   GFELDASRIFQELGGICTAMERERAICQELMSVAKDMLHNTEVAVRSFMMLRPRFLHSNV  197

Query  1358  passsatpsqaSGAIVAPTSSAQATTIPN-----------FPVFDFYSGIPKKPSPFMQQ  1212
                         GA  + T+ +QAT +              PVFDFYSG+P+KPSPF+QQ
Sbjct  198   ------------GAATSATAPSQATAVAQASSNQAAATSAVPVFDFYSGLPRKPSPFLQQ  245

Query  1211  TIARFEKHLAECRQWVEELEQLIL-DSDRKslnssvsllqsLPQVMSNVHDFFVHVAAKV  1035
             T+ARFEK++AECRQW+EELEQL+L D+DR SL+SS SLLQSLP+VM+NVH FFVHVAAK 
Sbjct  246   TVARFEKYIAECRQWIEELEQLLLLDADRNSLDSSSSLLQSLPKVMANVHAFFVHVAAKA  305

Query  1034  ESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRRETAKQEAAARRVHPTLHLPAAPQPAT  855
             ESIHQYIESMKTAYL DQRRRG+ +DPFLEADRRETAK EAAARRVHPTLHLPA  QP+T
Sbjct  306   ESIHQYIESMKTAYLADQRRRGDGNDPFLEADRRETAKLEAAARRVHPTLHLPAVSQPST  365

Query  854   QVTGLFPSSAAPGTSTAPQtsailstssaasgsslfsTpaiaasssslfstptasapAVS  675
             QV G F SS  PG  TA   ++   +S+++            A+SSS   +   ++  VS
Sbjct  366   QVAGAFSSSTMPGALTA-LPTSAAISSASSGSGLSLLGTPSGATSSSSLFSTPMTSVPVS  424

Query  674   LFG-SGASPQTSLFGFLATSSPAFS-TPNLFGSTPSSGVTNfstpfatgaatgsgssfgT  501
             LFG SGASP++S FG L+ S+P  S   +LFGSTPSS V+ F+TPF +G  TGSG SF T
Sbjct  425   LFGSSGASPESSPFGSLSASTPVVSGAASLFGSTPSSSVSAFTTPFPSGGLTGSGQSFNT  484

Query  500   LSKARAKSRPGRR  462
              S+ RAKSR GRR
Sbjct  485   ASRTRAKSRTGRR  497


 Score =   142 bits (358),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             FLFTN KTPATY TKWADLHPDSQK LLQIEE+ILEYRDESQRLDQCSRLYDSSV   GF
Sbjct  80    FLFTNDKTPATYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCSRLYDSSVFIGGF  139

Query  1533  ELDSSHNIQELVGISTSMERQK  1468
             ELD+S   QEL GI T+MER++
Sbjct  140   ELDASRIFQELGGICTAMERER  161



>ref|XP_008813222.1| PREDICTED: uncharacterized protein LOC103723909 [Phoenix dactylifera]
Length=491

 Score =   245 bits (625),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 165/224 (74%), Gaps = 7/224 (3%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssat-psqaSGAIVAPTSS  1296
             +K  + ELM  V DM+ +TE AVRS+MMLRPRFL QN PA+S     SQ  G  V    +
Sbjct  195   EKVSVQELMKNVNDMMWHTEFAVRSYMMLRPRFLRQNVPAASGVGPTSQTVGVAVTSGQT  254

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKsl  1119
             +Q  T    P FDFYSGIPK+PS FM  T ARFEK+L EC QW+EELEQL+L D+D+   
Sbjct  255   SQLMTSSISPSFDFYSGIPKRPSLFMHHTAARFEKYLTECCQWIEELEQLLLMDTDK---  311

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
              ++ S L++LP VMSNVHD+F+HVAAKVES+HQYIESMK AYL DQRRRG+ +DPF+EA+
Sbjct  312   -ATSSSLEALPTVMSNVHDYFIHVAAKVESLHQYIESMKMAYLADQRRRGDGNDPFIEAN  370

Query  938   RRETAKQEAAARRVHPTLHLPA-APQPATQVTGLFPSSAAPGTS  810
             RRE AKQEAAARRVHPTLHL A + QPATQ     PSS   G+S
Sbjct  371   RREAAKQEAAARRVHPTLHLAANSAQPATQAAASVPSSTLFGSS  414


 Score =   124 bits (311),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L LFT  ++PA Y TKW DLHPDSQK+LL+IEE+ILEY+ ESQRL+QCSRLYDSSVS+D 
Sbjct  114   LLLFTVDRSPAGYNTKWEDLHPDSQKLLLRIEERILEYKYESQRLEQCSRLYDSSVSSDS  173

Query  1536  FELDSSHNIQELVGISTSMERQK  1468
             FE D+S  +QEL GI+T++ER+K
Sbjct  174   FEFDASRILQELGGITTAIEREK  196



>emb|CDY62340.1| BnaCnng39960D [Brassica napus]
Length=448

 Score =   244 bits (622),  Expect(2) = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 168/233 (72%), Gaps = 24/233 (10%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K++LHELM VVKDM RN+EVAVRSFMML+PRF  ++ P           G   AP SS 
Sbjct  147   QKAVLHELMLVVKDMFRNSEVAVRSFMMLQPRF-RRSKPGGGGGGGGAPQGVNSAPASS-  204

Query  1292  QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDRKsln  1116
                      V  FY GIPKKP+ F+ QT+ RFEK+L ECRQWVEELEQL+ LDSD+   N
Sbjct  205   ---------VSYFYRGIPKKPTAFLLQTVVRFEKYLGECRQWVEELEQLLALDSDK--YN  253

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
               V +L+SLP+VMSNVH FFVHVAAKVE++HQYIES++TAYL DQRRRGE +DPFLEADR
Sbjct  254   RHVLVLESLPKVMSNVHAFFVHVAAKVENVHQYIESLRTAYLADQRRRGECNDPFLEADR  313

Query  935   RETAKQEAAARRVHPTLHLP-------AAPQPATQVTGLFPSSAAPGTSTAPQ  798
             RETAKQEAAA+RVHPTLHLP        + Q +TQV GL  SS   G S APQ
Sbjct  314   RETAKQEAAAKRVHPTLHLPATSTTTTTSAQTSTQVAGLITSS---GVSNAPQ  363


 Score =   124 bits (311),  Expect(2) = 3e-92, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN + PA+Y T+W+DLHPDSQK+LL+IE+KILEY  ES RLDQCSRLYDSS++ + 
Sbjct  66    LYLFTNDQAPASYSTEWSDLHPDSQKLLLEIEKKILEYSSESLRLDQCSRLYDSSIATES  125

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+S  +QEL GI+T+M RQK  +
Sbjct  126   FEFDASRIVQELGGINTTMGRQKAVL  151



>gb|KDO79366.1| hypothetical protein CISIN_1g015366mg [Citrus sinensis]
Length=346

 Score =   292 bits (748),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 198/310 (64%), Positives = 228/310 (74%), Gaps = 11/310 (4%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatp-sqaSGAIVAPTSS  1296
             +K+ L E M VVKDMLRNTE+AVRSFMMLRPRFLH N  ++SSAT  SQASGA  AP+S+
Sbjct  4     QKAQLQERMAVVKDMLRNTEIAVRSFMMLRPRFLHPNAGSASSATAPSQASGATAAPSST  63

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKsl  1119
              Q  +    PVFDFY G+PKKPS F+QQT+ARFEK+L E RQW+EELEQLIL D DR S 
Sbjct  64    GQPASSSVVPVFDFYRGLPKKPSAFLQQTVARFEKYLGEFRQWIEELEQLILLDPDRNSS  123

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             +   SLLQSLPQV+SNVH FFVHVAAK ESIHQY+E+MKTAYL DQRRRG+ SDPFLEAD
Sbjct  124   SHGSSLLQSLPQVISNVHIFFVHVAAKAESIHQYVETMKTAYLADQRRRGDGSDPFLEAD  183

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasg  759
             RRETA+QEAAA+RVHPTLHLP   QP+ QV G   ++ A G   APQTSA++S SS    
Sbjct  184   RRETARQEAAAKRVHPTLHLPVNSQPSAQVGGSL-TNTATGALVAPQTSAVISASSGGGL  242

Query  758   s--slfsTpaiaasssslfstptasapAVSLFGSGASPQTSLFGFLATSSPAFSTPNLFG  585
             S  S  S+   ++ SSSLF+TP  SA   SLFGSG SPQ S     A      ST +LFG
Sbjct  243   SLFSTPSSAPASSMSSSLFATPATSASPSSLFGSGVSPQMSSSSLFAA-----STLSLFG  297

Query  584   ST-PSSGVTN  558
             ST PS G T 
Sbjct  298   STVPSFGSTT  307



>gb|KDO79367.1| hypothetical protein CISIN_1g015366mg [Citrus sinensis]
Length=408

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 194/309 (63%), Positives = 224/309 (72%), Gaps = 11/309 (4%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatp-sqaSGAIVAPTSS  1296
             +K+ L E M VVKDMLRNTE+AVRSFMMLRPRFLH N  ++SSAT  SQASGA  AP+S+
Sbjct  4     QKAQLQERMAVVKDMLRNTEIAVRSFMMLRPRFLHPNAGSASSATAPSQASGATAAPSST  63

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKsl  1119
              Q  +    PVFDFY G+PKKPS F+QQT+ARFEK+L E RQW+EELEQLIL D DR S 
Sbjct  64    GQPASSSVVPVFDFYRGLPKKPSAFLQQTVARFEKYLGEFRQWIEELEQLILLDPDRNSS  123

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
             +   SLLQSLPQV+SNVH FFVHVAAK ESIHQY+E+MKTAYL DQRRRG+ SDPFLEAD
Sbjct  124   SHGSSLLQSLPQVISNVHIFFVHVAAKAESIHQYVETMKTAYLADQRRRGDGSDPFLEAD  183

Query  938   RRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasg  759
             RRETA+QEAAA+RVHPTLHLP   QP+ QV G   ++ A G   APQTSA++S SS    
Sbjct  184   RRETARQEAAAKRVHPTLHLPVNSQPSAQVGGSL-TNTATGALVAPQTSAVISASSGGGL  242

Query  758   sslfsTpaiaasssslfstp--tasapAVSLFGSGASPQTSLFGFLATSSPAFSTPNLFG  585
             S   +  +  ASS S         SA   SLFGSG SPQ S     ++S  A ST +LFG
Sbjct  243   SLFSTPSSAPASSMSSSLFATPATSASPSSLFGSGVSPQMS-----SSSLFAASTLSLFG  297

Query  584   ST-PSSGVT  561
             ST PS G T
Sbjct  298   STVPSFGST  306



>gb|EYU44345.1| hypothetical protein MIMGU_mgv1a004636mg [Erythranthe guttata]
Length=517

 Score =   291 bits (745),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 226/416 (54%), Positives = 269/416 (65%), Gaps = 55/416 (13%)
 Frame = -1

Query  1559  IHQCQMM--------GLSLILVIIFRNLLESAHQWNGKKSILHELMTVVKDMLRNTEVAV  1404
             + QC  +        G  L    I + L   +     +K+ L ELMTVVK+MLRNTEVAV
Sbjct  107   LDQCDRLYDSSVSNNGFELDASYIVQELGGISISMERQKATLQELMTVVKEMLRNTEVAV  166

Query  1403  RSFMMLRPRFLHQNppasssatpsqa-SGAIVAPTSSAQATTIPNFPVFDFYSGIPKKPS  1227
             RSFMMLRPRF+H+N  A+  A       GA    TSS Q       PV DFYSG+PKKPS
Sbjct  167   RSFMMLRPRFVHENKSAAGGAAAPPQPLGATTTQTSSGQPAANSMVPVLDFYSGLPKKPS  226

Query  1226  PFMQQTIARFEKHLAECRQWVEELEQLILD-SDRKslnssvsllqsLPQVMSNVHDFFVH  1050
             PFMQQT+ARFEK+L+ECRQW++ELEQL+L  S++ S NSS SLLQSLP+VM+NV+DFFVH
Sbjct  227   PFMQQTVARFEKYLSECRQWIDELEQLLLLDSEKNSFNSSSSLLQSLPKVMANVNDFFVH  286

Query  1049  VAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRRETAKQEAAARRVHPTLHLPAA  870
             VA+KVESIHQYIESMKTAYL DQRRRG+ ++PFLEADRRETAKQEAAARR+HPTL+LPA+
Sbjct  287   VASKVESIHQYIESMKTAYLADQRRRGDGNNPFLEADRRETAKQEAAARRIHPTLYLPAS  346

Query  869   PQPATQVTGLFPSS-AAPGTSTAPQtsailstssaasgsslfsTpaiaasssslfstpta  693
                  Q  G F +S AAPG STAP TSA  S SS +  S   +  A  +S  S  +  T+
Sbjct  347   SHSTAQTAGQFATSAAAPGASTAPNTSAAASASSGSGSSLFSTPAAATSSLFSTPAAATS  406

Query  692   sapAVSLFGSGASPQTSLFGFLA---TSSPAFSTPN------------------------  594
                  SLF + A+  +SLF   A   +S+P FSTP                         
Sbjct  407   -----SLFSTPAATTSSLFSTPAAATSSTPLFSTPTTGSTQFSSLLGSAVTPQSSAFGSL  461

Query  593   ------------LFGSTPSSGVTNfstpfatgaatgsgssfgTLSKARAKSRPGRR  462
                         LFGSTP+SGV+NFSTPFATGAA GSG+SFGT SKARAKSR GRR
Sbjct  462   SASPSPFGSSNPLFGSTPASGVSNFSTPFATGAAAGSGASFGTASKARAKSRTGRR  517


 Score =   152 bits (384),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K PATY TKWADLHPDSQK+LLQIE+KILEYRDESQRLDQC RLYDSSVSN+G
Sbjct  63    LYLFTNDKVPATYSTKWADLHPDSQKVLLQIEDKILEYRDESQRLDQCDRLYDSSVSNNG  122

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FELD+S+ +QEL GIS SMERQK  +
Sbjct  123   FELDASYIVQELGGISISMERQKATL  148



>ref|NP_001132589.1| nucleoporin p58/p45 [Zea mays]
 gb|ACF81503.1| unknown [Zea mays]
 gb|ACG25560.1| nucleoporin p58/p45 [Zea mays]
 tpg|DAA61741.1| TPA: nucleoporin p58/p45 [Zea mays]
Length=484

 Score =   225 bits (574),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 148/221 (67%), Gaps = 22/221 (10%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K+ + ELM VV +M+ NTE A+RS++MLRPRF                 G     +S+ 
Sbjct  170   EKASIQELMNVVNEMMWNTEFAIRSYLMLRPRFTRTGA------------GVANGGSSNP  217

Query  1292  QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKslns  1113
              A   PN PV DFYSG+PK+PS FMQ T+ RFE +LAEC +W+ ELEQL+     K  + 
Sbjct  218   SAGAPPNQPVLDFYSGVPKRPSIFMQHTVNRFECYLAECCKWIGELEQLVQIETNKISSD  277

Query  1112  svsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRR  933
             S+  L   P+VMSNVHD+F++VA+KVE++HQY+ESMK  YL +QRR G  S+PFLEA+RR
Sbjct  278   SLDSL---PKVMSNVHDYFIYVASKVENLHQYVESMKAEYLNEQRRNGNGSNPFLEANRR  334

Query  932   ETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTS  810
             E AKQEAAARRVHPTLHLPA  QP  Q+       AAP TS
Sbjct  335   EAAKQEAAARRVHPTLHLPAPAQPMPQI-------AAPATS  368


 Score =   113 bits (283),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L L+T    PA Y TKW +LH +SQK LLQIE+K+ +YRDE +RLDQCSRLYDSS+SN  
Sbjct  89    LMLYTTDMKPAGYNTKWEELHAESQKALLQIEDKVRDYRDECERLDQCSRLYDSSISNVN  148

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FELD+S  +QEL G +T MER+K  I
Sbjct  149   FELDASRIVQELGGTTTVMEREKASI  174



>ref|XP_008650940.1| PREDICTED: nucleoporin p58/p45 isoform X1 [Zea mays]
Length=485

 Score =   226 bits (575),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 148/221 (67%), Gaps = 22/221 (10%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K+ + ELM VV +M+ NTE A+RS++MLRPRF                 G     +S+ 
Sbjct  171   EKASIQELMNVVNEMMWNTEFAIRSYLMLRPRFTRTGA------------GVANGGSSNP  218

Query  1292  QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKslns  1113
              A   PN PV DFYSG+PK+PS FMQ T+ RFE +LAEC +W+ ELEQL+     K  + 
Sbjct  219   SAGAPPNQPVLDFYSGVPKRPSIFMQHTVNRFECYLAECCKWIGELEQLVQIETNKISSD  278

Query  1112  svsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRR  933
             S+  L   P+VMSNVHD+F++VA+KVE++HQY+ESMK  YL +QRR G  S+PFLEA+RR
Sbjct  279   SLDSL---PKVMSNVHDYFIYVASKVENLHQYVESMKAEYLNEQRRNGNGSNPFLEANRR  335

Query  932   ETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTS  810
             E AKQEAAARRVHPTLHLPA  QP  Q+       AAP TS
Sbjct  336   EAAKQEAAARRVHPTLHLPAPAQPMPQI-------AAPATS  369


 Score =   108 bits (271),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L L+T    PA Y TKW +LH +SQK LLQIE+K+ +YRDE +RLDQCSRLYDSS+SN  
Sbjct  89    LMLYTTDMKPAGYNTKWEELHAESQKALLQIEDKVRDYRDECERLDQCSRLYDSSISNVN  148

Query  1536  FELDSSHNI-QELVGISTSMERQKKYI  1459
             FELD+S  + QEL G +T MER+K  I
Sbjct  149   FELDASRIVQQELGGTTTVMEREKASI  175



>ref|XP_003632460.2| PREDICTED: nuclear pore complex protein NUP58-like [Vitis vinifera]
 emb|CBI40970.3| unnamed protein product [Vitis vinifera]
Length=307

 Score =   186 bits (473),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 123/156 (79%), Gaps = 1/156 (1%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaS-GAIVAPTSS  1296
             +K++L ELM VVKDMLRNTEVAVRSFMMLRPRFLH    A SSA     + GA V P++S
Sbjct  149   QKAVLQELMAVVKDMLRNTEVAVRSFMMLRPRFLHPGSGAVSSAPAPSQAPGATVVPSAS  208

Query  1295  AQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKsln  1116
             +Q T     PVFDFYSG+P+KPSPF+ QT+ARFEK+L ECRQW+EELEQL++D DR S N
Sbjct  209   SQLTVTSMAPVFDFYSGLPRKPSPFLLQTVARFEKYLGECRQWIEELEQLLIDFDRNSSN  268

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIES  1008
              S SLLQSLP+VMSNVHDFFVHVAAKV+    + ++
Sbjct  269   GSSSLLQSLPKVMSNVHDFFVHVAAKVKKTFLFFKT  304


 Score =   147 bits (371),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             +LFTN K PATY TKWADLHPDSQK LLQIEE+ILEYRDESQRLDQC RLYDSSVSND F
Sbjct  69    YLFTNDKAPATYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCGRLYDSSVSNDAF  128

Query  1533  ELDSSHNIQELVGISTSMERQKKYI  1459
             ELD+S  +QEL G+ST+MERQK  +
Sbjct  129   ELDASRIVQELGGVSTAMERQKAVL  153



>ref|NP_001149260.1| nucleoporin p58/p45 [Zea mays]
 gb|ACG34755.1| nucleoporin p58/p45 [Zea mays]
 gb|ACN26753.1| unknown [Zea mays]
 tpg|DAA40192.1| TPA: nucleoporin p58/p45 [Zea mays]
Length=469

 Score =   224 bits (571),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 155/222 (70%), Gaps = 24/222 (11%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K+ + ELM VV +M+ NTE  +RS++MLRPRF   +             G     +S+ 
Sbjct  154   EKASIQELMNVVNEMMWNTEFGIRSYLMLRPRFTRPSA------------GVANGGSSNP  201

Query  1292  QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDRKsln  1116
              A   PN PV DFYSG+PK+PS FMQ+T+ +FE +LAEC +W+ ELEQL+ ++++++S +
Sbjct  202   SAGAPPNQPVVDFYSGVPKRPSIFMQRTVNKFECYLAECCKWIGELEQLVQMETNKRSSD  261

Query  1115  ssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADR  936
             S  SL    P+VMSNVHD+F++VA+KVE++HQ++ESMKT YL +QRR G  SDPFLEA+R
Sbjct  262   SLESL----PKVMSNVHDYFIYVASKVENLHQHVESMKTEYLNEQRRTGNGSDPFLEANR  317

Query  935   RETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTS  810
             RE AKQEAAARRVHPTLHLP   QP  Q+       AAP TS
Sbjct  318   REAAKQEAAARRVHPTLHLPTPAQPTAQI-------AAPATS  352


 Score =   107 bits (267),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L L+T     A Y TKW +LH +SQK LLQIE+KI +Y+DE +RLDQCSRLYDSS+SN  
Sbjct  73    LMLYTTDMKSAGYSTKWEELHAESQKALLQIEDKIRDYKDECERLDQCSRLYDSSISNAN  132

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FELD+S   QEL G +T MER+K  I
Sbjct  133   FELDASRIAQELGGTTTVMEREKASI  158



>ref|XP_004956993.1| PREDICTED: nuclear pore complex protein Nup214-like isoform X1 
[Setaria italica]
Length=480

 Score =   207 bits (526),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 173/338 (51%), Positives = 223/338 (66%), Gaps = 25/338 (7%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K+ + ELMTVV +M+ NTE A+RS++MLRPRF+                G     +S+ 
Sbjct  167   EKASIQELMTVVNEMMWNTEFAMRSYLMLRPRFVRPGA------------GVANGGSSNP  214

Query  1292  QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKslns  1113
              A   PN PV DFYSG+PK+PS FMQ T+ RFE +LAEC +W+ ELEQL+   + K  + 
Sbjct  215   SAGAPPNQPVVDFYSGVPKRPSLFMQHTVNRFECYLAECCKWIGELEQLVQMENNKRSSD  274

Query  1112  svsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRR  933
             S+  L   P+VMSNVHD+F++VA+KVE++HQY+ESMKT YL +QR  G  +DPFLEA+RR
Sbjct  275   SLESL---PKVMSNVHDYFIYVASKVENLHQYVESMKTEYLNEQRHMGNGNDPFLEANRR  331

Query  932   ETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasgss  753
             E AKQEAAA+RVHPTLHLPA  QP TQ+       AAP  S  PQ S   S ++++SG S
Sbjct  332   EAAKQEAAAKRVHPTLHLPAPAQPTTQI-------AAPAASQ-PQQSFFPSGATSSSGFS  383

Query  752   lfsTpaiaasssslfstptasapAVSLFGSGASPQ-TSLFGFLATSSPAFSTPNLFGSTP  576
              FSTPA A SSSSLF+TPT  AP+  LFG+  S Q T+ FG  +T + A +    FG++ 
Sbjct  384   AFSTPAAAPSSSSLFATPTTPAPSGGLFGASGSAQLTTPFGTASTPTLASTPAPGFGTST  443

Query  575   SSGVTNfstpfatgaatgsgssfgTLSKARAKSRPGRR  462
             S G T+  +    G AT SGSSFG  SK R+K R GRR
Sbjct  444   SLGGTSLFSTPFGGGATASGSSFGGASKGRSKPR-GRR  480


 Score =   114 bits (285),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L L+T    PA Y TKW +LH +SQK LLQIE+KI EY+DES+RLDQCSRLYDSS+SN  
Sbjct  86    LMLYTTDMKPAGYNTKWEELHAESQKALLQIEDKIREYKDESERLDQCSRLYDSSISNVN  145

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FELD+S   QEL G +T MER+K  I
Sbjct  146   FELDASRIAQELGGTTTVMEREKASI  171



>gb|EMT16289.1| hypothetical protein F775_31538 [Aegilops tauschii]
Length=466

 Score =   197 bits (501),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 155/224 (69%), Gaps = 29/224 (13%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K+ + ELMTVV +M+ NTE A+RS+MMLRPRFL                 A  +   S 
Sbjct  164   EKASVQELMTVVNEMMWNTEFAIRSYMMLRPRFLK---------------SATGSSNPSG  208

Query  1292  QATTIPN--FPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDRKs  1122
              A  +PN   P  DFYSG+PK+PS FM QT+ +FEK+L EC +W+ ELEQL+ ++S+++S
Sbjct  209   PAGALPNQPGPTNDFYSGVPKRPSLFMLQTVNKFEKYLDECCKWITELEQLVQIESNKRS  268

Query  1121  lnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEA  942
              +S  SL    P+VMSNVHD+F++VA+KVE++HQY+ SMKT YL  QRR G  +DPFLEA
Sbjct  269   SSSVESL----PKVMSNVHDYFIYVASKVENLHQYVVSMKTEYLHGQRRLGNANDPFLEA  324

Query  941   DRRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTS  810
             +RRE AK+EAAA+RVHPTLHLPA  QP TQ+       AAP TS
Sbjct  325   NRREAAKEEAAAKRVHPTLHLPAPVQPTTQI-------AAPATS  361


 Score =   115 bits (288),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L L+T    PA Y TKW +LH DSQK LLQIE+KI EY+DES+RLDQCSRL+DSS+SN  
Sbjct  83    LMLYTKEGKPAGYNTKWDELHADSQKALLQIEDKIREYKDESERLDQCSRLHDSSISNVN  142

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FELD+SH  QEL G +T +ER+K  +
Sbjct  143   FELDASHIAQELAGTATIIEREKASV  168



>gb|EPS70070.1| hypothetical protein M569_04692, partial [Genlisea aurea]
Length=446

 Score =   254 bits (648),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 187/384 (49%), Positives = 240/384 (63%), Gaps = 23/384 (6%)
 Frame = -1

Query  1610  WNIEMRVNGLINVAGCMIHQCQMMGLSLILVIIFRNLLESAHQWNGKKSILHELMTVVKD  1431
             ++  +  NG    A  M+ +   +G+++                  +K  L EL++V++D
Sbjct  85    YDSSIGTNGFELSASSMVQELGGIGIAM----------------ERQKVTLKELVSVIRD  128

Query  1430  MLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSAQATTIPNFPVFDFY  1251
             MLR+TE+AVRSF+MLRPRF+HQN  A+ S T       +V  TSS+        P+ DFY
Sbjct  129   MLRHTELAVRSFVMLRPRFIHQNKLAAGSPTKPSQQ-LLVTQTSSSPPAANSIVPILDFY  187

Query  1250  SGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKslnssvsllqsLPQVMSN  1071
             SG+PKKPSPF+QQT+ARF+K L+ECRQ VEELEQL++     S   S SL QSLP+VM+N
Sbjct  188   SGLPKKPSPFLQQTVARFDKDLSECRQRVEELEQLLVLESENSYGRSSSLFQSLPKVMTN  247

Query  1070  VHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRRETAKQEAAARRVHP  891
             VHDFFVHVAAKVESIHQYIESMKTAYL DQR RG+ +DPFLEADRRETAKQEAAARR+HP
Sbjct  248   VHDFFVHVAAKVESIHQYIESMKTAYLADQRGRGDCNDPFLEADRRETAKQEAAARRIHP  307

Query  890   TLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasgsslfsTpaiaassssl  711
             TLHLPA  QP  Q  G   S A    S  P  +A   ++  ++ S+  S+      +S  
Sbjct  308   TLHLPAVSQPTGQAVG---SLAIGSPSVVP--TATNVSAPGSAMSASGSSLFSTPIASMT  362

Query  710   fstptasapAVSLFGSGASPQTSLFGFLATSSPAFSTPNLFGSTPSSGVTNfstp-fatg  534
                 +      S  G+ A+  +S F      S   S+  LFGSTP++G +  +      G
Sbjct  363   QPLFSTPLTGASSLGTAATQSSSPFNTTLLKSAFGSSTPLFGSTPAAGASALTASFGTVG  422

Query  533   aatgsgssfgTLSKARAKSRPGRR  462
             AA GSGSSFG+LSKAR+KSR GRR
Sbjct  423   AAAGSGSSFGSLSKARSKSRTGRR  446


 Score =   143 bits (360),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -3

Query  1713  FLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGF  1534
             FLFTN K PA+YGTKWADLHPDSQK LLQ+EEKI+EYRDESQRLDQCSRLYDSS+  +GF
Sbjct  35    FLFTNDKAPASYGTKWADLHPDSQKCLLQVEEKIMEYRDESQRLDQCSRLYDSSIGTNGF  94

Query  1533  ELDSSHNIQELVGISTSMERQK  1468
             EL +S  +QEL GI  +MERQK
Sbjct  95    ELSASSMVQELGGIGIAMERQK  116



>ref|XP_011039243.1| PREDICTED: nuclear pore complex protein NUP58 isoform X1 [Populus 
euphratica]
Length=510

 Score =   254 bits (648),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 201/351 (57%), Positives = 243/351 (69%), Gaps = 26/351 (7%)
 Frame = -1

Query  1559  IHQCQMM--------GLSLILVIIFRNLLESAHQWNGKKSILHELMTVVKDMLRNTEVAV  1404
             + QC  +        G  L    I + L   +     +K++L ELMT VKDMLRNTE+AV
Sbjct  117   LDQCNRLYDSSVSNEGFELDASQIIQELGGISTSMERQKALLQELMTNVKDMLRNTEMAV  176

Query  1403  RSFMMLRPRFLHQNppasssatp--sqaSGAIVAPTSSAQATTIPNFPVFDFYSGIPKKP  1230
             RSFM+L PRFLH N    +S     SQ+ G    P S++Q T+    PVFDFYSG+PKKP
Sbjct  177   RSFMILHPRFLHSNAGVGASNATAPSQSPGTTGIPGSTSQPTSSSIVPVFDFYSGLPKKP  236

Query  1229  SPFMQQTIARFEKHLAECRQWVEELEQLIL-DSDRKslnssvsllqsLPQVMSNVHDFFV  1053
             SPF+QQT+ARFEK+L EC QW+EELEQL+L DS+R S +   SLLQSLP+VMSNVHDFFV
Sbjct  237   SPFLQQTVARFEKYLGECSQWIEELEQLLLLDSERNSSHPGSSLLQSLPKVMSNVHDFFV  296

Query  1052  HVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRRETAKQEAAARRVHPTLHLPA  873
             HVAAKVESIHQYIESMKTAYL DQRRRG+ +DPFLEADRRE A++EAAA+R HPTLHLPA
Sbjct  297   HVAAKVESIHQYIESMKTAYLVDQRRRGDGNDPFLEADRRERARKEAAAKRAHPTLHLPA  356

Query  872   APQPATQVTGLFPSSAAPGTSTAPQtsailstssaasgsslfsTpaiaasssslf----s  705
               QP+TQ  GLF SSA    ST PQTS   + + A+SG++L      +  SSS+     +
Sbjct  357   NSQPSTQGAGLFASSATSSASTTPQTSTATAPAPASSGNALSLFNTPSVPSSSMSSSLFA  416

Query  704   tptasapAVSLFGSGASPQTSLFGFLA------TSSPAF---STPNLFGST  579
             TPT SAPA +LFGS A+P  SLFG  A      +S+PA    STP+LFGST
Sbjct  417   TPTTSAPASNLFGSAATP--SLFGSAAQAFGASSSAPALGSASTPSLFGST  465


 Score =   147 bits (371),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K PA+Y TKW DLHPDSQK LLQIEE+ILEYRDES+RLDQC+RLYDSSVSN+G
Sbjct  73    LYLFTNDKAPASYSTKWEDLHPDSQKTLLQIEERILEYRDESKRLDQCNRLYDSSVSNEG  132

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FELD+S  IQEL GISTSMERQK  +
Sbjct  133   FELDASQIIQELGGISTSMERQKALL  158



>ref|XP_002310761.2| hypothetical protein POPTR_0007s11760g [Populus trichocarpa]
 gb|EEE91211.2| hypothetical protein POPTR_0007s11760g [Populus trichocarpa]
Length=506

 Score =   250 bits (639),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 199/336 (59%), Positives = 239/336 (71%), Gaps = 18/336 (5%)
 Frame = -1

Query  1538  GLSLILVIIFRNLLESAHQWNGKKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNp  1359
             G  L    I + L   +     +K++L ELMT VKDMLRNTE+AVRSFMML PRFLH N 
Sbjct  143   GFELDASQIIQELGGISTSMERQKALLQELMTNVKDMLRNTEMAVRSFMMLHPRFLHSNA  202

Query  1358  passsatpsqaS--GAIVAPTSSAQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHL  1185
                +S   + +   G    P S++Q  +    PVFDFYSG+PKKPSPF+QQT+ARFEK+L
Sbjct  203   GGGASNATAPSQPPGTTGIPGSTSQPASSSIVPVFDFYSGLPKKPSPFLQQTVARFEKYL  262

Query  1184  AECRQWVEELEQLIL-DSDRKslnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIES  1008
              EC QW+EELEQL+L DS+R S +   SLLQSLP+VMSNVHDFFVHVAAKVESIHQYIES
Sbjct  263   GECSQWIEELEQLLLLDSERNSSHPGSSLLQSLPKVMSNVHDFFVHVAAKVESIHQYIES  322

Query  1007  MKTAYLTDQRRRGEVSDPFLEADRRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSS  828
             MKTAYL DQRRRG+ +DPFLEADRRE A++EAAA+R HPTLHLPA  QP+TQ  GLF SS
Sbjct  323   MKTAYLVDQRRRGDGNDPFLEADRRERARKEAAAKRAHPTLHLPANSQPSTQGAGLFASS  382

Query  827   AAPGTSTAPQtsailstssaasgss----lfsTpaiaasssslfstptasapAVSLFGSG  660
             A    STAPQ S   + + A+SG++       +   ++ SSSLF+TPT SAP  +LFGS 
Sbjct  383   ATSSASTAPQASTATAPAPASSGNAFSLFNTPSVPSSSMSSSLFATPTTSAPVSTLFGSA  442

Query  659   ASPQTSLFG-----FLATSS-PAF---STPNLFGST  579
             A+P  SLFG     F A+SS PA    STP+LFGST
Sbjct  443   ATP--SLFGSATQAFGASSSAPALGSASTPSLFGST  476


 Score =   148 bits (373),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+LFTN K PA+Y TKW DLHPDSQK LLQIEE+ILEYRDES+RLDQCSRLYDSSVSN+G
Sbjct  84    LYLFTNDKAPASYSTKWEDLHPDSQKTLLQIEERILEYRDESKRLDQCSRLYDSSVSNEG  143

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FELD+S  IQEL GISTSMERQK  +
Sbjct  144   FELDASQIIQELGGISTSMERQKALL  169



>gb|EEC84690.1| hypothetical protein OsI_31617 [Oryza sativa Indica Group]
Length=470

 Score =   236 bits (603),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 125/247 (51%), Positives = 163/247 (66%), Gaps = 17/247 (7%)
 Frame = -1

Query  1559  IHQCQMMGLSLILVIIFRN-LLESAHQWNG-------KKSILHELMTVVKDMLRNTEVAV  1404
             + QC  +  S I  + F N   E A +  G       +K+ + ELMTVV +M+RNTE A+
Sbjct  106   LDQCSRLHDSSISTVNFENDASEIAQELGGTTTMMEREKASVQELMTVVNEMMRNTEFAI  165

Query  1403  RSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSAQATTIPNFPVFDFYSGIPKKPSP  1224
             RS+MMLRPRF+     A+   +          P  +     +   P  DFYSGIPK+PS 
Sbjct  166   RSYMMLRPRFIRPGAGANGGGSNPS------GPAGAQSNQPVALAPTIDFYSGIPKRPSH  219

Query  1223  FMQQTIARFEKHLAECRQWVEELEQLILDSDRKslnssvsllqsLPQVMSNVHDFFVHVA  1044
             FMQQTI RFEK+L EC +W+ ELEQL+   + K  ++S+  L   P+VMSNVHD+F++VA
Sbjct  220   FMQQTINRFEKYLGECCKWIAELEQLVQMENNKRQSASLESL---PKVMSNVHDYFIYVA  276

Query  1043  AKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRRETAKQEAAARRVHPTLHLPAAPQ  864
             +KVE++HQY+ES+KT YL +QRR G  +DPFLEA+RRE AKQEAAARRVHPTLHLPA  Q
Sbjct  277   SKVENLHQYVESLKTEYLHEQRRLGNANDPFLEANRREAAKQEAAARRVHPTLHLPAPVQ  336

Query  863   PATQVTG  843
             P TQ+ G
Sbjct  337   PTTQIAG  343


 Score =   106 bits (265),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L L+T    PA Y TKW +LH +SQK LLQIE+K+ EYRDES+RLDQCSRL+DSS+S   
Sbjct  62    LMLYTTDGKPAGYNTKWEELHAESQKALLQIEDKLREYRDESERLDQCSRLHDSSISTVN  121

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+S   QEL G +T MER+K  +
Sbjct  122   FENDASEIAQELGGTTTMMEREKASV  147



>ref|NP_001063345.1| Os09g0453500 [Oryza sativa Japonica Group]
 dbj|BAD38027.1| putative nucleoporin p58; nucleoporin p45 [Oryza sativa Japonica 
Group]
 dbj|BAF25259.1| Os09g0453500 [Oryza sativa Japonica Group]
 dbj|BAG95901.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69836.1| hypothetical protein OsJ_29603 [Oryza sativa Japonica Group]
Length=467

 Score =   236 bits (603),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 125/247 (51%), Positives = 163/247 (66%), Gaps = 17/247 (7%)
 Frame = -1

Query  1559  IHQCQMMGLSLILVIIFRN-LLESAHQWNG-------KKSILHELMTVVKDMLRNTEVAV  1404
             + QC  +  S I  + F N   E A +  G       +K+ + ELMTVV +M+RNTE A+
Sbjct  103   LDQCSRLHDSSISTVNFENDASEIAQELGGTTTMMEREKASVQELMTVVNEMMRNTEFAI  162

Query  1403  RSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSAQATTIPNFPVFDFYSGIPKKPSP  1224
             RS+MMLRPRF+     A+   +          P  +     +   P  DFYSGIPK+PS 
Sbjct  163   RSYMMLRPRFIRPGAGANGGGSNPS------GPAGAQSNQPVALAPTIDFYSGIPKRPSH  216

Query  1223  FMQQTIARFEKHLAECRQWVEELEQLILDSDRKslnssvsllqsLPQVMSNVHDFFVHVA  1044
             FMQQTI RFEK+L EC +W+ ELEQL+   + K  ++S+  L   P+VMSNVHD+F++VA
Sbjct  217   FMQQTINRFEKYLGECCKWIAELEQLVQMENNKRQSASLESL---PKVMSNVHDYFIYVA  273

Query  1043  AKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRRETAKQEAAARRVHPTLHLPAAPQ  864
             +KVE++HQY+ES+KT YL +QRR G  +DPFLEA+RRE AKQEAAARRVHPTLHLPA  Q
Sbjct  274   SKVENLHQYVESLKTEYLHEQRRLGNANDPFLEANRREAAKQEAAARRVHPTLHLPAPVQ  333

Query  863   PATQVTG  843
             P TQ+ G
Sbjct  334   PTTQIAG  340


 Score =   107 bits (268),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L L+T    PA Y TKW +LH +SQK LLQIE+KI EYRDES+RLDQCSRL+DSS+S   
Sbjct  59    LMLYTTDGKPAGYNTKWEELHAESQKALLQIEDKIREYRDESERLDQCSRLHDSSISTVN  118

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+S   QEL G +T MER+K  +
Sbjct  119   FENDASEIAQELGGTTTMMEREKASV  144



>gb|EMS57385.1| hypothetical protein TRIUR3_04014 [Triticum urartu]
Length=499

 Score =   196 bits (499),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 155/224 (69%), Gaps = 29/224 (13%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K+ + ELMTVV +M+ NTE A+RS+MMLRPRFL                 A  +   S 
Sbjct  197   EKASVQELMTVVNEMMWNTEFAIRSYMMLRPRFLKS---------------ATGSSNPSG  241

Query  1292  QATTIPN--FPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDRKs  1122
              A  +PN   P  DFYSG+PK+PS FM QT+ +FEK+L EC +W+ ELEQL+ ++S+++S
Sbjct  242   PAGALPNQPGPTNDFYSGVPKRPSLFMLQTVNKFEKYLDECCKWITELEQLVQIESNKRS  301

Query  1121  lnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEA  942
              +S  SL    P+VMSNVHD+F++VA+KVE++HQY+ SMKT YL  QRR G  +DPFLEA
Sbjct  302   SSSVESL----PKVMSNVHDYFIYVASKVENLHQYVVSMKTEYLHGQRRLGNANDPFLEA  357

Query  941   DRRETAKQEAAARRVHPTLHLPAAPQPATQVTGLFPSSAAPGTS  810
             +RRE AK+EAAA+RVHPTLHLPA  QP TQV       AAP TS
Sbjct  358   NRREAAKEEAAAKRVHPTLHLPAPVQPTTQV-------AAPATS  394


 Score = 75.9 bits (185),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  1620  EKILEYRDESQRLDQCSRLYDSSVSNDGFELDSSHNIQELVGISTSMERQKKYI  1459
             +KI EY+DES+RLDQCSRL+DSS+SN  FELD+SH  QEL G +T +ER+K  +
Sbjct  148   DKIREYKDESERLDQCSRLHDSSISNVNFELDASHIAQELAGTATVIEREKASV  201



>ref|XP_004981650.1| PREDICTED: uncharacterized protein LOC101784961 [Setaria italica]
Length=559

 Score =   178 bits (451),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 134/201 (67%), Gaps = 11/201 (5%)
 Frame = -1

Query  1478  NGKKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTS  1299
             N +K  +  LMTV+K+++ NT  A+RS++ LRPRF+H       SA  +  SG+  A T 
Sbjct  243   NREKISIESLMTVIKEIMWNTGFAIRSYVKLRPRFVH------LSAGIANHSGSSGAQTD  296

Query  1298  SAQATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKsl  1119
              +Q  T    P F  YS   ++PSPF+Q TIARFE HL EC +W+ ELEQL+   + K+ 
Sbjct  297   FSQLLTTA--PSFHCYSSATRRPSPFVQHTIARFEDHLGECCKWILELEQLVQTKNDKTF  354

Query  1118  nssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEAD  939
               S+  L    +VMSNVHD+ +H+A+K E IHQ +E+MKT YL ++R RG++S+PFL+A+
Sbjct  355   AESLESLS---KVMSNVHDYLIHLASKAEHIHQSVETMKTQYLNNRRCRGDLSNPFLKAN  411

Query  938   RRETAKQEAAARRVHPTLHLP  876
             RRE AKQ+A AR  HP LHLP
Sbjct  412   RREEAKQQATARIKHPMLHLP  432


 Score = 84.3 bits (207),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 57/86 (66%), Gaps = 2/86 (2%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L L+T     A Y T+W +LHP SQ +LL+IE+ I EYRD+S+RLDQCSRL D  +S   
Sbjct  166   LMLYTVDGGAAGYETRWEELHPVSQGLLLRIEDNIREYRDDSERLDQCSRLDD--LSPFS  223

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D+    QE V IST+M R+K  I
Sbjct  224   FEFDAGQITQEAVSISTTMNREKISI  249



>gb|EEE59989.1| hypothetical protein OsJ_12705 [Oryza sativa Japonica Group]
Length=434

 Score =   166 bits (420),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 125/192 (65%), Gaps = 8/192 (4%)
 Frame = -1

Query  1460  LHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSAQATT  1281
             +  LM VV++M+RNT+ A+RS+  LRP F+ +    +++   +  +G   APT   Q + 
Sbjct  145   IRSLMAVVEEMMRNTDSAIRSYQKLRPNFIRR-YSGTANTGFAHHAGPSGAPTYFNQPSA  203

Query  1280  IPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDRKslnssvs  1104
             I   P FDFYSG+  +PSPFMQ T+++FE  L EC + V ELEQLI + +D+   N+  S
Sbjct  204   I--VPTFDFYSGVAMRPSPFMQHTVSKFENRLEECSRMVGELEQLIQIKNDKNYSNAFES  261

Query  1103  llqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRRETA  924
             L   +P    NV+D+ +HVA +VE++HQY E M+T Y    R  G+ SDPFLEADRRE A
Sbjct  262   LSTVVP----NVYDYLIHVATQVENLHQYAEVMRTHYRNAWRLMGDCSDPFLEADRREAA  317

Query  923   KQEAAARRVHPT  888
             KQEA AR VHPT
Sbjct  318   KQEATARIVHPT  329


 Score = 87.4 bits (215),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L L+T     A YGTKW +LHP SQ++LL IE K+ EY+ ES  LDQCSRLYD SVS+  
Sbjct  60    LRLYTVEGRAAGYGTKWVELHPQSQELLLHIENKMREYKHESDLLDQCSRLYDPSVSSRS  119

Query  1536  FELDSSHNIQELVGISTSMERQ  1471
             FEL ++   QE+   ST M+R+
Sbjct  120   FELYATQISQEIGSTSTIMDRE  141



>gb|EEC76237.1| hypothetical protein OsI_13655 [Oryza sativa Indica Group]
Length=585

 Score =   165 bits (418),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 125/192 (65%), Gaps = 8/192 (4%)
 Frame = -1

Query  1460  LHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSAQATT  1281
             +  LM VV++M+RNT+ A+RS+  LRP F+ +    +++   +  +G   APT   Q + 
Sbjct  296   IRSLMAVVEEMMRNTDSAIRSYQKLRPNFIRR-YSGTANTGFAHHAGPSGAPTYFNQPSA  354

Query  1280  IPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDRKslnssvs  1104
             I   P FDFYSG+  +PSPFMQ T+++FE  L EC + V ELEQLI + +D+   N+  S
Sbjct  355   I--VPTFDFYSGVAMRPSPFMQHTVSKFENRLEECSRMVGELEQLIQIKNDKNYSNAFES  412

Query  1103  llqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRRETA  924
             L   +P    NV+D+ +HVA +VE++HQY E M+T Y    R  G+ SDPFLEADRRE A
Sbjct  413   LSTVVP----NVYDYLIHVATQVENLHQYAEVMRTHYRNAWRLMGDCSDPFLEADRREAA  468

Query  923   KQEAAARRVHPT  888
             KQEA AR VHPT
Sbjct  469   KQEATARIVHPT  480


 Score = 87.8 bits (216),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L L+T     A YGTKW +LHP SQ++LL IE K+ EY+ ES  LDQCSRLYD SVS+  
Sbjct  211   LRLYTVEGRAAGYGTKWVELHPQSQELLLHIENKMREYKHESDLLDQCSRLYDPSVSSRS  270

Query  1536  FELDSSHNIQELVGISTSMERQ  1471
             FEL ++   QE+   ST M+R+
Sbjct  271   FELYATQISQEIGSTSTIMDRE  292



>ref|XP_003559394.2| PREDICTED: uncharacterized protein LOC100840866 [Brachypodium 
distachyon]
Length=454

 Score =   149 bits (376),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 130/206 (63%), Gaps = 8/206 (4%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K+ +  L  VV++M+R TE A+  F+ LRP F+ +    +++   ++A G+  AP  + 
Sbjct  254   EKASIQSLNAVVEEMMRYTEFAISLFVKLRPGFVKRGAGIANAGFANRA-GSSGAPAENN  312

Query  1292  QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKslns  1113
             Q  T+        Y G  ++PS FMQ T+ RFE+ + EC + +EELEQ I   + K+  S
Sbjct  313   QPLTLAQ--TTHSYCGFVRRPSFFMQHTVDRFEEKVEECCKCIEELEQFI---EMKNDKS  367

Query  1112  svsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRR  933
               + L+SLP+VMSN HD+F+HVA+KVES+HQY E+M+T  L  QR RG  +DPFLEA+R+
Sbjct  368   YAASLESLPKVMSNTHDYFIHVASKVESLHQYAETMRTRSLNSQRNRGSCNDPFLEANRK  427

Query  932   ETAKQEAAARRVHPTLHLPAAPQPAT  855
             +  KQE+ AR VHP    P   QP T
Sbjct  428   DAPKQESGARIVHPK--CPRWLQPKT  451


 Score = 99.8 bits (247),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L+L+T    PA Y TKW +LHP SQ+ LLQIEEKI E R  S++LDQCSRLYD S+S  G
Sbjct  173   LYLYTVEGNPAGYKTKWEELHPVSQEFLLQIEEKIGENRHASEQLDQCSRLYDRSLSYRG  232

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FELDSS   Q++  IST  ER+K  I
Sbjct  233   FELDSSQIAQDIGSISTIFEREKASI  258



>ref|XP_003578215.1| PREDICTED: uncharacterized protein YMR317W [Brachypodium distachyon]
Length=494

 Score =   201 bits (510),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 169/392 (43%), Positives = 229/392 (58%), Gaps = 48/392 (12%)
 Frame = -1

Query  1559  IHQCQMMGLSLILVIIFR-NLLESAHQWNGKKSIL-------HELMTVVKDMLRNTEVAV  1404
             + QC  +  S I  + F  +    A +  G  +IL        ELMTVV +M+ NTE A+
Sbjct  125   LDQCSRLHDSSISNVNFELDASRIAQELGGTATILEREKASVQELMTVVNEMMWNTEFAI  184

Query  1403  RSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSAQATTIPNFPVF-----DFYSGIP  1239
             RS+MMLRPRF                  A  +   S  A  + N PV      DFYSG+P
Sbjct  185   RSYMMLRPRFTK---------------SASGSSNPSGPAGALSNQPVALAPTNDFYSGVP  229

Query  1238  KKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDRKslnssvsllqsLPQVMSNVHD  1062
             K+PS FMQQT++RFEK+L EC +W+ ELEQL+ ++S+++S +S  SL    P+VMSNVHD
Sbjct  230   KRPSLFMQQTVSRFEKYLGECSKWIGELEQLVQMESNKRSSSSLESL----PKVMSNVHD  285

Query  1061  FFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRRETAKQEAAARRVHPTLH  882
             +F++VA+KVE++HQY+ +MKT YL  QRR G  +DPFLEA+RRE AK+EAAA+RVHPTLH
Sbjct  286   YFIYVASKVENLHQYVATMKTEYLHGQRRLGNANDPFLEANRREAAKEEAAAKRVHPTLH  345

Query  881   LPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasgsslfsTpai----aassss  714
             LPA  QP TQV+   P+++ P  S  P  +   S  +A S  +   + +       + + 
Sbjct  346   LPAPVQPTTQVSA--PATSQPQQSLLPSATNSSSAFAAFSTPASAPSTSSLFSTPTTPTL  403

Query  713   lfstptasapAVSLFGSGASPQTSL-FGFLAT----SSP---AFSTPNLFGSTPSSGVTN  558
               S  +  A   +LFGS  S Q S  FG  +T    S+P   AF +   F STP+ G T+
Sbjct  404   TSSLFSTPALTTNLFGSSGSAQLSTPFGTSSTPTLGSTPAPSAFGSTPSFASTPALGGTS  463

Query  557   fstpfatgaatgsgssfgTLSKARAKSRPGRR  462
               +    G AT SGSSFG  SK R+K+R GRR
Sbjct  464   LFSTPFGGGATASGSSFGGTSKGRSKAR-GRR  494


 Score =   110 bits (274),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L L+T    PA Y TKW +LH +SQK LLQIE+KI EY+DES+RLDQCSRL+DSS+SN  
Sbjct  81    LMLYTTEGKPAGYNTKWEELHTESQKALLQIEDKIREYKDESERLDQCSRLHDSSISNVN  140

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FELD+S   QEL G +T +ER+K  +
Sbjct  141   FELDASRIAQELGGTATILEREKASV  166



>ref|XP_001765100.1| predicted protein [Physcomitrella patens]
 gb|EDQ70095.1| predicted protein [Physcomitrella patens]
Length=388

 Score =   178 bits (452),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 120/289 (42%), Positives = 163/289 (56%), Gaps = 62/289 (21%)
 Frame = -1

Query  1430  MLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSAQATTIPNFPVFDFY  1251
             +LR+ E+AVRSF+ LRPRF+                        +AQA       ++DFY
Sbjct  124   LLRHAEMAVRSFLSLRPRFI------------------------AAQAQ------LYDFY  153

Query  1250  SGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKslnssvsll--qsLPQVM  1077
             SG+P +PSPF+QQT+ RFE  +AE RQ +EE+E+L+L +  K  +    L   QSLP VM
Sbjct  154   SGMPARPSPFLQQTVIRFENQMAEYRQRIEEMERLLLVNTEKENSYGSQLSLLQSLPSVM  213

Query  1076  SNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRRETAKQEAAARR-  900
             +NVHDFF+HVAA+VE +HQ+  +M+TA+L ++ RRG+ SDPF+EA+RR  A+++AAA+R 
Sbjct  214   TNVHDFFIHVAAEVEELHQHTGAMRTAFLQERHRRGDDSDPFVEAERRAIAQRDAAAKRI  273

Query  899   VHPTLHLPAAPQPATQVTGLFPSSAAPGTSTAPQtsailstssaasgsslfsTpaiaass  720
             VHPTLHLP APQ  T        +A  GT++ P              SS           
Sbjct  274   VHPTLHLP-APQTVT-------PTAPVGTTSTPGMFGGTQPGIFQIQSSTPVASQ-----  320

Query  719   sslfstptasapAVSLFGSGASPQTSLFGFLATSSPAF--STPNLFGST  579
                           SLFGS  +P T+LFG    S+  F  +TPNLF ST
Sbjct  321   --------------SLFGSTPTPSTNLFGSTTPSTNLFGSTTPNLFSST  355


 Score = 58.5 bits (140),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             + L TN K P +Y TKWAD+ P+SQ++LL IEE++ EYR+ES+RL+Q  +  DSSV +  
Sbjct  28    IHLLTNDKMPVSYQTKWADISPESQQLLLTIEERVREYREESRRLEQREQNTDSSVLHKS  87

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FE D++  +QEL  +  ++ER+   +
Sbjct  88    FEYDAARILQELSAVGGAIERETAGV  113



>dbj|BAK04506.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=502

 Score =   196 bits (498),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 163/260 (63%), Gaps = 35/260 (13%)
 Frame = -1

Query  1559  IHQCQMMGLSLILVIIF--------RNLLESAHQWNGKKSILHELMTVVKDMLRNTEVAV  1404
             + QC  +  S I  + F        + L  +A     +K+ + ELMTVV +M+ NTE A+
Sbjct  144   LDQCSRLHDSSISNVNFELDASHIAQELAGTATVIEREKASVQELMTVVNEMMWNTEFAI  203

Query  1403  RSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSAQATTIPN--FPVFDFYSGIPKKP  1230
             RS+MMLRPRFL                 A  +   S  A  +PN   P  DFYSG+PK+P
Sbjct  204   RSYMMLRPRFLKS---------------ATGSSNPSGPAGVLPNQPGPTNDFYSGVPKRP  248

Query  1229  SPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKslnssvsllqsLPQVMSNVHDFFVH  1050
             S FM QT+ +FEK+L EC +W+ ELEQL+   + K  +SSV  L   P+VMSNVHD+F++
Sbjct  249   SLFMLQTVNKFEKYLDECCKWITELEQLVQIENNKRSSSSVESL---PKVMSNVHDYFIY  305

Query  1049  VAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRRETAKQEAAARRVHPTLHLPAA  870
             VA+KVE++HQY+ SMKT YL  QRR G  +DPFLEA+RRE AK+EAAA+RVHPTLHLPA 
Sbjct  306   VASKVENLHQYVVSMKTEYLHGQRRLGNANDPFLEANRREAAKEEAAAKRVHPTLHLPAP  365

Query  869   PQPATQVTGLFPSSAAPGTS  810
              QP TQ       +AAP TS
Sbjct  366   AQPTTQ-------TAAPATS  378


 Score =   115 bits (289),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDG  1537
             L L+T    PA Y TKW +LH DSQK LLQIE+KI EY+DES+RLDQCSRL+DSS+SN  
Sbjct  100   LMLYTKEGKPAGYNTKWDELHADSQKALLQIEDKIREYKDESERLDQCSRLHDSSISNVN  159

Query  1536  FELDSSHNIQELVGISTSMERQKKYI  1459
             FELD+SH  QEL G +T +ER+K  +
Sbjct  160   FELDASHIAQELAGTATVIEREKASV  185



>gb|AAP50947.1| hypothetical protein [Oryza sativa Japonica Group]
Length=658

 Score =   165 bits (417),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 125/192 (65%), Gaps = 8/192 (4%)
 Frame = -1

Query  1460  LHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSAQATT  1281
             +  LM VV++M+RNT+ A+RS+  LRP F+ +    +++   +  +G   APT   Q + 
Sbjct  339   IRSLMAVVEEMMRNTDSAIRSYQKLRPNFIRR-YSGTANTGFAHHAGPSGAPTYFNQPSA  397

Query  1280  IPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDRKslnssvs  1104
             I   P FDFYSG+  +PSPFMQ T+++FE  L EC + V ELEQLI + +D+   N+  S
Sbjct  398   I--VPTFDFYSGVAMRPSPFMQHTVSKFENRLEECSRMVGELEQLIQIKNDKNYSNAFES  455

Query  1103  llqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRRETA  924
             L   +P    NV+D+ +HVA +VE++HQY E M+T Y    R  G+ SDPFLEADRRE A
Sbjct  456   LSTVVP----NVYDYLIHVATQVENLHQYAEVMRTHYRNAWRLMGDCSDPFLEADRREAA  511

Query  923   KQEAAARRVHPT  888
             KQEA AR VHPT
Sbjct  512   KQEATARIVHPT  523


 Score = 66.6 bits (161),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 56/125 (45%), Gaps = 43/125 (34%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIE----------------------------  1621
             L L+T     A YGTKW +LHP SQ++LL IE                            
Sbjct  211   LRLYTVEGRAAGYGTKWVELHPQSQELLLHIEYGLLRILDLLLGDWGDVHRVLHFWGNPS  270

Query  1620  ---------------EKILEYRDESQRLDQCSRLYDSSVSNDGFELDSSHNIQELVGIST  1486
                             K+ EY+ ES  LDQCSRLYD SVS+  FEL ++   QE+   ST
Sbjct  271   WGSLSRLPCIFPFFRNKMREYKHESDLLDQCSRLYDPSVSSRSFELYATQISQEIGSTST  330

Query  1485  SMERQ  1471
              M+R+
Sbjct  331   IMDRE  335



>gb|ABF99044.1| nucleoporin, putative, expressed [Oryza sativa Japonica Group]
Length=674

 Score =   155 bits (393),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 125/208 (60%), Gaps = 24/208 (12%)
 Frame = -1

Query  1460  LHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSAQATT  1281
             +  LM VV++M+RNT+ A+RS+  LRP F+ +    +++   +  +G   APT   Q + 
Sbjct  339   IRSLMAVVEEMMRNTDSAIRSYQKLRPNFI-RRYSGTANTGFAHHAGPSGAPTYFNQPSA  397

Query  1280  IPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLI-LDSDRKslnssvs  1104
             I   P FDFYSG+  +PSPFMQ T+++FE  L EC + V ELEQLI + +D+   N+  S
Sbjct  398   I--VPTFDFYSGVAMRPSPFMQHTVSKFENRLEECSRMVGELEQLIQIKNDKNYSNAFES  455

Query  1103  llqsLPQVMSNVHDFFVHVAA----------------KVESIHQYIESMKTAYLTDQRRR  972
             L   +P    NV+D+ +HVA                 KVE++HQY E M+T Y    R  
Sbjct  456   LSTVVP----NVYDYLIHVATQIHSEVVQFKFVIKVVKVENLHQYAEVMRTHYRNAWRLM  511

Query  971   GEVSDPFLEADRRETAKQEAAARRVHPT  888
             G+ SDPFLEADRRE AKQEA AR VHPT
Sbjct  512   GDCSDPFLEADRREAAKQEATARIVHPT  539


 Score = 66.6 bits (161),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 56/125 (45%), Gaps = 43/125 (34%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIE----------------------------  1621
             L L+T     A YGTKW +LHP SQ++LL IE                            
Sbjct  211   LRLYTVEGRAAGYGTKWVELHPQSQELLLHIEYGLLRILDLLLGDWGDVHRVLHFWGNPS  270

Query  1620  ---------------EKILEYRDESQRLDQCSRLYDSSVSNDGFELDSSHNIQELVGIST  1486
                             K+ EY+ ES  LDQCSRLYD SVS+  FEL ++   QE+   ST
Sbjct  271   WGSLSRLPCIFPFFRNKMREYKHESDLLDQCSRLYDPSVSSRSFELYATQISQEIGSTST  330

Query  1485  SMERQ  1471
              M+R+
Sbjct  331   IMDRE  335



>tpg|DAA51590.1| TPA: hypothetical protein ZEAMMB73_978488 [Zea mays]
Length=441

 Score =   153 bits (386),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 138/212 (65%), Gaps = 11/212 (5%)
 Frame = -1

Query  1478  NGKKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTS  1299
             N +K+ +  LMTV+++++RNTE A+RS++ LR RF++ +  +++S   + + G+  A T 
Sbjct  68    NREKNSIECLMTVIREIMRNTEFAIRSYVQLRARFVYPSAESANSGFSNHS-GSSGAQTD  126

Query  1298  SAQ--ATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRK  1125
               Q  ATT    P F  YS   ++PSPF+QQT+ARFE     C + + ELEQL+   D K
Sbjct  127   FHQLLATT----PRFRCYSSAARRPSPFVQQTVARFEDDFGYCCKLILELEQLLQMKDGK  182

Query  1124  slnssvsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLE  945
             +   S+  L     V+SNVHD+ +HVA+KVE  HQY+E++KT YL D+RRRG++S+PFLE
Sbjct  183   TFAESLKSLS---NVVSNVHDYLIHVASKVEHFHQYVETVKTQYLNDRRRRGDLSNPFLE  239

Query  944   ADRRETAKQEAAARRVHPTLHLPAAPQPATQV  849
             A+ RE  KQ A  R +HP LHL    QP T V
Sbjct  240   ANNREAVKQ-ATDRIIHPMLHLAPPCQPTTLV  270


 Score = 53.1 bits (126),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  1617  KILEYRDESQRLDQCSRLYDSSVSNDGFELDSSHNIQELVGISTSMERQKKYI  1459
             +I E+RD+S++LDQC R  D S+ N  FEL +S   QE V IST M R+K  I
Sbjct  22    RIREHRDDSEQLDQCRRFDDLSLCNISFELKASQITQEAVSISTIMNREKNSI  74



>ref|XP_008666876.1| PREDICTED: uncharacterized protein LOC103645634 [Zea mays]
Length=353

 Score =   156 bits (395),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 102/244 (42%), Positives = 148/244 (61%), Gaps = 26/244 (11%)
 Frame = -1

Query  1568  GCMIHQCQMMGLSLILVIIFRNLLESAHQWNGKKSILHELMTVVKDMLRNTEVAVRSFMM  1389
             GC   QC+ + +S I+              N +K+ +  LMTV+++++RNTE A+RS++ 
Sbjct  16    GCFA-QCEAVSISTIM--------------NREKNSIECLMTVIREIMRNTEFAIRSYVQ  60

Query  1388  LRPRFLHQNppasssatpsqaSGAIVAPTSSAQ--ATTIPNFPVFDFYSGIPKKPSPFMQ  1215
             LR RF++ +  +++S   + + G+  A T   Q  ATT    P F  YS   ++PSPF+Q
Sbjct  61    LRARFVYPSAESANSGFSNHS-GSSGAQTDFHQLLATT----PRFRCYSSAARRPSPFVQ  115

Query  1214  QTIARFEKHLAECRQWVEELEQLILDSDRKslnssvsllqsLPQVMSNVHDFFVHVAAKV  1035
             QT+ARFE     C + + ELEQL+   D K+   S+  L     V+SNVHD+ +HVA+KV
Sbjct  116   QTVARFEDDFGYCCKLILELEQLLQMKDGKTFAESLKSLS---NVVSNVHDYLIHVASKV  172

Query  1034  ESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRRETAKQEAAARRVHPTLHLPAAPQPAT  855
             E  HQY+E++KT YL D+RRRG++S+PFLEA+ RE  KQ A  R +HP LHL    QP T
Sbjct  173   EHFHQYVETVKTQYLNDRRRRGDLSNPFLEANNREAVKQ-ATDRIIHPMLHLAPPCQPTT  231

Query  854   QVTG  843
              V  
Sbjct  232   LVVA  235



>gb|EMT25811.1| hypothetical protein F775_23907 [Aegilops tauschii]
Length=349

 Score =   116 bits (290),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 121/196 (62%), Gaps = 11/196 (6%)
 Frame = -1

Query  1472  KKSILHELMTVVKDMLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSSA  1293
             +K+ +  LM  +++++ + + A+ ++  +R RF+      +  A      G+  APT  +
Sbjct  63    EKAPIQSLMADIREIMSHVDFAICAYAEVRRRFVRGGAELAYCA------GSSSAPTDFS  116

Query  1292  QATTIPNFPVFDFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKslns  1113
             + +T+     F    G   +PS FMQ  + RFEK L EC + + ELEQL+   + K+  +
Sbjct  117   RHSTMAR--TFRNCYGSVYRPSLFMQHIVERFEKQLEECCKSIGELEQLVQTKNDKTHPA  174

Query  1112  svsllqsLPQVMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRR  933
             S+  L   P+VMSNVHD+ ++ A+KVE++HQ+ E+++T YL D R  G  +DPF+EADR+
Sbjct  175   SLKSL---PKVMSNVHDYLMYAASKVENLHQHAETIRTQYLNDLRNSGNWNDPFVEADRK  231

Query  932   ETAKQEAAARRVHPTL  885
             E AKQEAAAR VHPTL
Sbjct  232   EAAKQEAAARIVHPTL  247


 Score = 49.3 bits (116),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  1620  EKILEYRDESQRLDQCSRLYDSSVSNDGFELDSSHNIQELVGISTSMERQKKYI  1459
             +KI + R   ++L+QC RL D SVSN GFELD+    QE+  IST ++R+K  I
Sbjct  14    DKIRDERHACEQLEQCRRLSDPSVSNKGFELDARQITQEIGLISTIIDREKAPI  67



>gb|EMS46427.1| hypothetical protein TRIUR3_01275 [Triticum urartu]
Length=294

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 77/106 (73%), Gaps = 3/106 (3%)
 Frame = -1

Query  1202  RFEKHLAECRQWVEELEQLILDSDRKslnssvsllqsLPQVMSNVHDFFVHVAAKVESIH  1023
             RFEK L EC + + ELEQL+   + K+   S+  L   P+VMSNVHD+ + VA+KVE++H
Sbjct  108   RFEKQLEECCKLIGELEQLVKTKNDKTHPGSLKSL---PKVMSNVHDYLIFVASKVENLH  164

Query  1022  QYIESMKTAYLTDQRRRGEVSDPFLEADRRETAKQEAAARRVHPTL  885
             Q+ E+++T YL D R  G  +DPF+EADR+E AKQEAAAR VHPTL
Sbjct  165   QHAETIRTQYLNDLRNSGNWNDPFVEADRKEAAKQEAAARIVHPTL  210



>ref|XP_008380789.1| PREDICTED: putative GATA zinc finger domain-containing protein 
25 [Malus domestica]
Length=96

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  1716  LFLFTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQR  1585
             L+LFTN KTPA+YGTKW DLHPDSQKILLQIEE++L YRDESQR
Sbjct  48    LYLFTNDKTPASYGTKWGDLHPDSQKILLQIEERVLGYRDESQR  91



>emb|CDY08623.1| BnaC04g19320D [Brassica napus]
Length=80

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 59/97 (61%), Gaps = 20/97 (21%)
 Frame = -1

Query  1430  MLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSS--AQATTIPNF-PVF  1260
             MLRNT++ +  FM+LR                S  SGA   P SS     T + +F PV 
Sbjct  1     MLRNTKMEL--FMVLR---------------VSVNSGAGRNPDSSFLWSTTRVTSFVPVS  43

Query  1259  DFYSGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQ  1149
             DFYSGIP+KP+ F+QQT+ARFE +L E RQWVEELEQ
Sbjct  44    DFYSGIPRKPTDFLQQTVARFENYLGESRQWVEELEQ  80



>ref|XP_008665480.1| PREDICTED: uncharacterized protein LOC103644062 [Zea mays]
Length=227

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -3

Query  1707  FTNSKTPATYGTKWADLHPDSQKILLQIEEKILEYRDESQRLDQCSRLYDSSVSNDGFEL  1528
             +T     A+Y TKW +LHP SQ +LLQIE +I E+RD+S++LDQC R  D S+ N  FEL
Sbjct  142   YTVDGRAASYETKWDELHPVSQMLLLQIEGRIREHRDDSEQLDQCRRFDDLSLCNISFEL  201

Query  1527  DSSHNIQ  1507
              +S   Q
Sbjct  202   KASQITQ  208



>emb|CDY61927.1| BnaCnng38700D [Brassica napus]
Length=81

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 54/98 (55%), Gaps = 21/98 (21%)
 Frame = -1

Query  1430  MLRNTEVAVRSFMMLRPRFLHQNppasssatpsqaSGAIVAPTSS--AQATTIPNF-PVF  1260
             MLRNT++    FM+LR                S  SGA   P SS     T + +F PV 
Sbjct  1     MLRNTKME--PFMVLR---------------VSVNSGAGRNPDSSFLWSTTRVTSFVPVS  43

Query  1259  DFYSGIPKKPSP-FMQQTIARFEKHLAECRQWVEELEQ  1149
             DFY GI    +P F+QQT+ARFE +L E RQWVEELEQ
Sbjct  44    DFYRGIRAVLTPYFLQQTVARFENYLGESRQWVEELEQ  81



>ref|XP_005850499.1| hypothetical protein CHLNCDRAFT_56832 [Chlorella variabilis]
 gb|EFN58397.1| hypothetical protein CHLNCDRAFT_56832 [Chlorella variabilis]
Length=441

 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 61/117 (52%), Gaps = 10/117 (9%)
 Frame = -1

Query  1250  SGIPKKPSPFMQQTIARFEKHLAECRQWVEELEQLILDSDRKslnssvsllqsLPQ----  1083
             +G P  P+ F+++ +A F   L + +  V ELEQ++L S         +   +       
Sbjct  231   AGPPVLPAQFLREAVAMFLDRLKQHQAAVAELEQVLLASGATGQMLRRASGGNGSHPADG  290

Query  1082  ------VMSNVHDFFVHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRRE  930
                    ++NVHDF +H AA+++++   + + + A+L  +R  G+ SDPF E +RR+
Sbjct  291   LAALQAALTNVHDFLIHTAARLQALDDRVAAAREAFLARRRAAGDSSDPFAEEERRQ  347



>ref|XP_002952378.1| hypothetical protein VOLCADRAFT_105503 [Volvox carteri f. nagariensis]
 gb|EFJ46521.1| hypothetical protein VOLCADRAFT_105503 [Volvox carteri f. nagariensis]
Length=486

 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 63/123 (51%), Gaps = 16/123 (13%)
 Frame = -1

Query  1232  PSPFMQQTIARFEKHLAECRQWVEELEQLILDSD-RKslnssvsllqsLPQVMSNVHDFF  1056
             P+P++   +  F   + +    + ELE+++  S          + + +LP ++S++H++F
Sbjct  276   PNPYLGLAVRGFSAAIEQYHSCISELERVMQASAVGYGGTDEATAILNLPTLVSHMHNYF  335

Query  1055  VHVAAKVESIHQYIESMKTAYLTDQRRRGEVSDPFLEADRRETAKQEAAARRVHPTLHLP  876
             VHVAA++E +H  +   + AYL  QR RG+ S+PF EA                P  H+P
Sbjct  336   VHVAARMERLHGEVARAREAYLAQQRARGDYSNPFAEA---------------RPLHHIP  380

Query  875   AAP  867
             A P
Sbjct  381   AGP  383



>sp|P84752.1|PERA_ALOVR RecName: Full=Peroxidase A, partial [Aloe vera]
Length=361

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  1085  QVMSNVHDFFVHVAAKVESIHQYIESMKTAYLT  987
             +VMSNVHDFFVHVAAKVESIHQYIESM+   L+
Sbjct  79    RVMSNVHDFFVHVAAKVESIHQYIESMRYGSLS  111



>gb|AFK48117.1| unknown [Medicago truncatula]
Length=57

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  917   LVWLFPVDQLQERDH*PPHVDADQ*GMQFSWIQCIDECSPPLLQHEQKNH  1066
             LV  F  DQ  E DH PP   ADQ GM FSWI C  ECSPPL   EQK+H
Sbjct  4     LVLQFLADQPLEMDHSPPLDGADQLGMLFSWIPCTGECSPPLQPREQKSH  53



>ref|XP_002307490.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE94486.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=52

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  1007  MKTAYLTDQRRRGEVSDPFLEADRRETAKQEAAARRVHPTLH  882
             MKTA L DQRRRG+ +DPFLEADRRE A++EAAA+R HPTLH
Sbjct  1     MKTACLVDQRRRGDGNDPFLEADRRERARKEAAAKRAHPTLH  42



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5062430735620