BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15478_g2_i1 len=958 path=[972:0-803 38:804-957]

Length=958
                                                                      Score     E

ref|XP_009587217.1|  PREDICTED: transcription factor MYB24-like         128   8e-31   
emb|CDP00641.1|  unnamed protein product                                126   3e-30   
ref|XP_009626235.1|  PREDICTED: transcription factor MYB108-like        124   2e-29   
ref|XP_009797951.1|  PREDICTED: transcription factor MYB108-like        116   9e-27   
ref|XP_006344301.1|  PREDICTED: transcription factor MYB48-like         115   3e-26   
ref|XP_011076599.1|  PREDICTED: transcription factor MYB108-like        112   3e-25   
ref|XP_004239413.2|  PREDICTED: transcription factor MYB108             110   2e-24   
ref|XP_011070788.1|  PREDICTED: transcription factor MYB24              107   3e-23   
ref|XP_010265100.1|  PREDICTED: myb-related protein MYBAS2-like         106   5e-23   
gb|KDP29432.1|  hypothetical protein JCGZ_18353                         105   9e-23   
ref|XP_007044287.1|  Myb domain protein 62, putative                    105   1e-22   
ref|XP_006448450.1|  hypothetical protein CICLE_v10015986mg             103   4e-22   
ref|XP_002315935.1|  hypothetical protein POPTR_0010s13290g             102   1e-21   Populus trichocarpa [western balsam poplar]
gb|AAC83619.1|  putative transcription factor                           100   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006468714.1|  PREDICTED: transcription factor MYB108-like        102   2e-21   
ref|XP_009778774.1|  PREDICTED: transcription factor MYB24-like         100   3e-21   
gb|AGN52055.1|  MYB-related transcription factor                        100   6e-21   
ref|XP_010511820.1|  PREDICTED: transcription factor MYB21-like       99.8    9e-21   
ref|NP_176999.1|  R2R3-MYB transcription  family                      99.8    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532345.1|  PREDICTED: myb-related protein 340-like          99.8    1e-20   
ref|XP_010551244.1|  PREDICTED: myb-related protein 305-like          99.0    1e-20   
ref|XP_003592641.1|  R2R3-MYB transcription factor                    99.0    2e-20   
ref|XP_010470777.1|  PREDICTED: myb-related protein 340-like          98.2    3e-20   
ref|XP_007160381.1|  hypothetical protein PHAVU_002G317000g           98.6    3e-20   
ref|XP_010099251.1|  Transcription factor                             98.6    3e-20   
gb|AGN52122.1|  MYB-related transcription factor                      97.1    4e-20   
ref|XP_007223176.1|  hypothetical protein PRUPE_ppa009143mg           98.2    4e-20   
ref|XP_011007699.1|  PREDICTED: transcription factor MYB24            98.2    5e-20   
ref|XP_002311464.2|  hypothetical protein POPTR_0008s12130g           97.8    5e-20   Populus trichocarpa [western balsam poplar]
ref|XP_011022276.1|  PREDICTED: transcription factor MYB108           97.1    1e-19   
ref|XP_010264231.1|  PREDICTED: transcription factor MYB108-like      96.7    1e-19   
ref|XP_002276526.3|  PREDICTED: transcription factor MYB108           95.9    3e-19   Vitis vinifera
ref|XP_009356946.1|  PREDICTED: transcription factor MYB21-like       95.1    3e-19   
emb|CBI15464.3|  unnamed protein product                              95.5    3e-19   
ref|XP_010415449.1|  PREDICTED: myb-related protein 305               95.1    4e-19   
emb|CDY54094.1|  BnaC02g46060D                                        94.7    4e-19   
ref|XP_008243255.1|  PREDICTED: transcription factor MYB21            94.7    5e-19   
ref|XP_010094742.1|  Transcription factor                             94.4    7e-19   
emb|CDY01906.1|  BnaC06g29460D                                        94.4    7e-19   
ref|XP_008389270.1|  PREDICTED: myb-related protein 305               92.8    2e-18   
ref|XP_002887176.1|  hypothetical protein ARALYDRAFT_339072           92.4    2e-18   
emb|CAN76459.1|  hypothetical protein VITISV_010827                   91.7    3e-18   Vitis vinifera
ref|XP_008797802.1|  PREDICTED: transcription factor MYB108-like      92.4    3e-18   
ref|XP_009127621.1|  PREDICTED: transcription factor MYB24-like       92.0    4e-18   
ref|XP_002279433.1|  PREDICTED: transcription factor MYB24            92.0    4e-18   Vitis vinifera
emb|CBI27001.3|  unnamed protein product                              91.7    5e-18   
gb|EYU40768.1|  hypothetical protein MIMGU_mgv1a023443mg              90.1    1e-17   
gb|ADF43752.1|  MYB                                                   90.5    2e-17   
ref|XP_002318546.1|  hypothetical protein POPTR_0012s05200g           90.5    2e-17   Populus trichocarpa [western balsam poplar]
gb|ACP30364.1|  MYB protein                                           90.1    2e-17   Malus hybrid cultivar
ref|XP_009105377.1|  PREDICTED: transcription factor MYB24-like       89.7    2e-17   
ref|XP_010044254.1|  PREDICTED: transcription factor MYB24-like       90.1    2e-17   
emb|CDY12705.1|  BnaA02g13730D                                        89.7    2e-17   
emb|CDX96033.1|  BnaA07g26980D                                        89.7    2e-17   
ref|XP_004497077.1|  PREDICTED: transcription factor MYB21-like       90.1    2e-17   
ref|XP_011045847.1|  PREDICTED: myb-related protein Zm38-like         89.7    3e-17   
ref|XP_006301020.1|  hypothetical protein CARUB_v10021411mg           89.0    4e-17   
ref|XP_010916405.1|  PREDICTED: transcription factor MYB21-like       89.0    5e-17   
ref|NP_001280981.1|  transcription factor MYB21                       89.0    5e-17   
emb|CDX84981.1|  BnaC05g20740D                                        88.6    6e-17   
emb|CCC14989.1|  Myb transcription factor                             89.0    9e-17   
ref|XP_009356251.1|  PREDICTED: transcription factor MYB108-like      87.8    1e-16   
ref|XP_011011974.1|  PREDICTED: myb-related protein Myb4-like         88.2    1e-16   
ref|NP_001235789.1|  MYB transcription factor MYB84                   87.8    2e-16   
ref|XP_007142925.1|  hypothetical protein PHAVU_007G028700g           87.4    2e-16   
gb|KFK41242.1|  hypothetical protein AALP_AA2G104300                  87.4    2e-16   
ref|XP_004299054.1|  PREDICTED: transcription factor WER-like         87.0    2e-16   
gb|KHN11407.1|  Transcription factor MYB21                            87.0    3e-16   
ref|XP_009105051.1|  PREDICTED: transcription factor MYB21-like       86.3    3e-16   
emb|CDY69953.1|  BnaAnng32120D                                        86.3    3e-16   
emb|CDY69488.1|  BnaCnng63810D                                        85.9    4e-16   
ref|XP_002321477.2|  hypothetical protein POPTR_0015s03770g           86.7    4e-16   Populus trichocarpa [western balsam poplar]
ref|XP_003535723.1|  PREDICTED: transcription factor MYB108-like      86.3    4e-16   
emb|CDY58600.1|  BnaA07g36950D                                        86.3    5e-16   
gb|ADG56766.1|  putative MYB transcription factor                     85.9    5e-16   
ref|XP_006391151.1|  hypothetical protein EUTSA_v10018962mg           85.5    6e-16   
ref|XP_007036545.1|  Myb domain protein 62, putative                  85.5    7e-16   
ref|XP_003555909.1|  PREDICTED: transcription factor MYB108-like      84.7    1e-15   
ref|XP_010681493.1|  PREDICTED: transcription factor MYB108 isofo...  84.7    1e-15   
ref|XP_010681494.1|  PREDICTED: transcription factor MYB108 isofo...  84.3    2e-15   
gb|KHN16570.1|  Transcription factor MYB21                            84.3    2e-15   
ref|XP_006584643.1|  PREDICTED: MYB transcription factor MYB184 i...  84.3    2e-15   
gb|ADR63291.1|  MYB146                                                83.6    3e-15   
gb|ACU18510.1|  unknown                                               84.0    3e-15   Glycine max [soybeans]
gb|KFK44510.1|  hypothetical protein AALP_AA1G266100                  83.2    4e-15   
gb|ACU20373.1|  unknown                                               83.6    4e-15   Glycine max [soybeans]
gb|AGL81356.1|  R2R3 MYB transcription factor 3                       82.0    6e-15   
ref|XP_006303509.1|  hypothetical protein CARUB_v10010865mg           82.4    7e-15   
ref|XP_010477944.1|  PREDICTED: transcription factor MYB108-like ...  82.4    8e-15   
ref|XP_010477945.1|  PREDICTED: transcription factor MYB108-like ...  82.4    8e-15   
gb|AIU39030.1|  myb transcription factor 1                            82.0    9e-15   
ref|XP_010499121.1|  PREDICTED: myb-related protein 305-like          82.0    1e-14   
ref|XP_009103061.1|  PREDICTED: transcription factor MYB24-like       82.0    1e-14   
emb|CDY03859.1|  BnaC07g10840D                                        81.6    1e-14   
emb|CDY42115.1|  BnaA09g28450D                                        81.3    2e-14   
ref|XP_009115302.1|  PREDICTED: transcription factor MYB57            81.3    2e-14   
ref|XP_004140978.1|  PREDICTED: transcription factor MYB3-like        81.3    2e-14   
dbj|BAB18296.1|  putative dehydration-induced myb-related protein...  81.6    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004137477.1|  PREDICTED: transcription factor MYB3-like        80.9    3e-14   
ref|XP_004160829.1|  PREDICTED: transcription factor MYB3-like        80.9    3e-14   
gb|EEC69869.1|  hypothetical protein OsI_00232                        81.6    3e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_009380293.1|  PREDICTED: myb-related protein P-like            81.3    3e-14   
ref|NP_001041908.1|  Os01g0128000                                     81.6    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006643700.1|  PREDICTED: transcription repressor MYB4-like     81.6    3e-14   
ref|XP_006415860.1|  hypothetical protein EUTSA_v10008403mg           80.5    3e-14   
ref|XP_004165379.1|  PREDICTED: transcription factor MYB3-like        80.5    4e-14   
ref|XP_010926026.1|  PREDICTED: myb-related protein 305-like isof...  80.5    4e-14   
ref|XP_004968076.1|  PREDICTED: myb-related protein P-like            81.3    4e-14   
ref|XP_002455261.1|  hypothetical protein SORBIDRAFT_03g007360        81.6    5e-14   Sorghum bicolor [broomcorn]
ref|XP_010926024.1|  PREDICTED: myb-related protein 305-like isof...  80.5    5e-14   
ref|NP_001031091.1|  putative transcription factor (MYB116)           79.7    6e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28415.1|  unknown                                               79.7    6e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564230.1|  putative transcription factor (MYB116)              79.7    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001141174.1|  MYB transcription factor                         80.5    8e-14   Zea mays [maize]
ref|XP_009403972.1|  PREDICTED: transcription factor MYB108-like ...  79.7    1e-13   
ref|XP_008801769.1|  PREDICTED: transcription factor RAX1-like        78.2    1e-13   
ref|XP_006485803.1|  PREDICTED: transcription factor MYB108-like      79.7    1e-13   
ref|XP_006440994.1|  hypothetical protein CICLE_v10021157mg           79.7    1e-13   
ref|XP_009403971.1|  PREDICTED: transcription factor MYB108-like ...  79.7    1e-13   
gb|EPS73052.1|  hypothetical protein M569_01708                       76.3    1e-13   
emb|CDP19695.1|  unnamed protein product                              79.3    1e-13   
ref|XP_008807088.1|  PREDICTED: transcription factor MYB108-like      79.0    2e-13   
ref|XP_009383607.1|  PREDICTED: transcription factor MYB108-like      79.0    2e-13   
gb|KDP20133.1|  hypothetical protein JCGZ_05902                       78.6    2e-13   
ref|XP_009390937.1|  PREDICTED: myb-related protein 305-like          78.2    2e-13   
ref|XP_002534590.1|  DNA binding protein, putative                    77.8    2e-13   Ricinus communis
emb|CDM80629.1|  unnamed protein product                              78.2    5e-13   
gb|EMT11819.1|  Transcription factor MYB21                            78.2    5e-13   
ref|XP_008445685.1|  PREDICTED: transcription factor MYB108-like      77.0    5e-13   
gb|EMS46598.1|  Transcription factor MYB21                            77.8    6e-13   
ref|XP_010914654.1|  PREDICTED: transcription factor MYB108-like      76.6    7e-13   
ref|XP_008672180.1|  PREDICTED: putative MYB DNA-binding domain s...  78.2    7e-13   
ref|XP_002515235.1|  r2r3-myb transcription factor, putative          76.3    9e-13   Ricinus communis
gb|ABH02893.1|  MYB transcription factor MYB100                       74.3    1e-12   Glycine max [soybeans]
ref|NP_001235837.1|  MYB transcription factor MYB184                  75.9    1e-12   
ref|XP_008381542.1|  PREDICTED: transcription factor MYB108-like      74.3    2e-12   
ref|XP_008461407.1|  PREDICTED: transcription factor MYB108-like      75.5    2e-12   
gb|KDO60685.1|  hypothetical protein CISIN_1g0201971mg                75.1    2e-12   
ref|XP_006597689.1|  PREDICTED: transcription factor MYB108 isofo...  76.3    2e-12   
ref|XP_003569075.1|  PREDICTED: protein ODORANT1-like                 75.9    3e-12   
ref|XP_003546301.1|  PREDICTED: transcription factor MYB108 isofo...  75.9    3e-12   
gb|AFM77857.1|  myb domain protein                                    75.5    3e-12   
ref|XP_006466563.1|  PREDICTED: protein ODORANT1-like                 75.9    3e-12   
ref|XP_010024826.1|  PREDICTED: transcription factor MYB108-like      75.9    4e-12   
ref|XP_004300516.1|  PREDICTED: transcription factor TT2-like         74.7    4e-12   
emb|CAM58451.1|  myb factor                                           74.7    4e-12   Humulus lupulus [common hop]
ref|XP_009367189.1|  PREDICTED: transcription factor MYB108-like      75.1    4e-12   
dbj|BAJ61447.1|  R2R3-MYB transcription factor                        74.3    4e-12   
ref|XP_009363103.1|  PREDICTED: transcription factor MYB108           74.7    5e-12   
ref|XP_006341595.1|  PREDICTED: myb-related protein 305-like          74.3    5e-12   
ref|XP_010094412.1|  Myb-related protein 305                          74.7    5e-12   
gb|KDP28297.1|  hypothetical protein JCGZ_14068                       74.3    5e-12   
emb|CAN66274.1|  hypothetical protein VITISV_009676                   73.6    5e-12   Vitis vinifera
gb|ABX26092.1|  myb-like transcription factor 5                       72.8    6e-12   Gossypium hirsutum [American cotton]
ref|XP_008227817.1|  PREDICTED: transcription factor MYB108           74.7    6e-12   
gb|ABX26094.1|  myb-like transcription factor 5                       72.8    6e-12   Gossypium barbadense [Egyptian cotton]
ref|XP_008348686.1|  PREDICTED: transcription factor MYB108-like      74.3    6e-12   
emb|CBI36992.3|  unnamed protein product                              73.9    6e-12   
ref|XP_011100718.1|  PREDICTED: transcription factor MYB108-like      74.7    6e-12   
ref|XP_008343185.1|  PREDICTED: transcription factor MYB108-like      74.3    6e-12   
ref|XP_004136147.1|  PREDICTED: transcription factor MYB75-like       73.9    6e-12   
ref|XP_007209375.1|  hypothetical protein PRUPE_ppa008877mg           74.7    6e-12   
ref|XP_008458430.1|  PREDICTED: transcription factor MYB108-like      74.3    6e-12   
ref|XP_008240255.1|  PREDICTED: transcription factor MYB108-like      74.7    7e-12   
ref|XP_007145122.1|  hypothetical protein PHAVU_007G211900g           73.9    7e-12   
gb|ABX26097.1|  myb-like transcription factor 5                       72.8    7e-12   Gossypium hirsutum [American cotton]
ref|XP_007221521.1|  hypothetical protein PRUPE_ppa015973mg           74.3    8e-12   
ref|XP_010666321.1|  PREDICTED: transcription factor MYB108-like      74.3    9e-12   
ref|XP_007147396.1|  hypothetical protein PHAVU_006G120800g           74.3    9e-12   
emb|CDP20749.1|  unnamed protein product                              73.9    9e-12   
gb|KCW61339.1|  hypothetical protein EUGRSUZ_H04082                   75.1    1e-11   
gb|ACI16512.1|  myb-like transcription factor Myb5                    71.2    1e-11   Cucumis sativus [cucumbers]
ref|XP_006654961.1|  PREDICTED: transcription factor MYB108-like      73.6    1e-11   
gb|KGN45040.1|  hypothetical protein Csa_7G413890                     73.6    1e-11   
ref|XP_010045365.1|  PREDICTED: transcription factor MYB108           74.3    1e-11   
ref|XP_004486524.1|  PREDICTED: myb-related protein 330-like          73.9    1e-11   
ref|XP_003533124.1|  PREDICTED: transcription factor MYB108-like      74.3    1e-11   
gb|ABR28334.1|  MYB transcription factor MYB39                        73.9    1e-11   
ref|XP_003594670.1|  Myb-like transcription factor                    73.9    1e-11   
ref|XP_004150815.1|  PREDICTED: transcription repressor MYB6-like     72.8    1e-11   
gb|AAC83631.1|  putative transcription factor                         72.4    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004165513.1|  PREDICTED: transcription repressor MYB6-like     72.8    1e-11   
ref|XP_008340570.1|  PREDICTED: transcription factor MYB108           73.6    1e-11   
gb|EEE62225.1|  hypothetical protein OsJ_17012                        73.6    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011071358.1|  PREDICTED: transcription factor MYB108-like      73.6    1e-11   
ref|XP_008447462.1|  PREDICTED: transcription factor MYB108           72.4    2e-11   
ref|XP_004236420.2|  PREDICTED: transcription factor MYB108-like      73.2    2e-11   
ref|XP_009413670.1|  PREDICTED: transcription factor MYB108-like      72.4    2e-11   
gb|KDO86883.1|  hypothetical protein CISIN_1g043269mg                 71.6    2e-11   
gb|KHG22187.1|  Myb-related protein                                   73.2    2e-11   
ref|XP_004164405.1|  PREDICTED: transcription factor MYB21-like       72.0    2e-11   
ref|XP_003565287.1|  PREDICTED: transcription factor MYB24-like       72.8    2e-11   
gb|KGN57183.1|  hypothetical protein Csa_3G168940                     73.2    2e-11   
ref|XP_011027944.1|  PREDICTED: transcription factor MYB108-like      73.6    2e-11   
ref|XP_004150903.1|  PREDICTED: transcription factor MYB12-like       72.0    2e-11   
emb|CBI22842.3|  unnamed protein product                              73.2    2e-11   
ref|XP_004295042.1|  PREDICTED: uncharacterized protein LOC101295899  73.6    2e-11   
ref|XP_008438973.1|  PREDICTED: transcription factor MYB108           73.2    2e-11   
ref|XP_004963430.1|  PREDICTED: transcription repressor MYB5-like     73.6    2e-11   
ref|XP_011010946.1|  PREDICTED: transcription factor MYB108-like      73.2    2e-11   
emb|CCA29096.1|  putative MYB transcription factor                    73.6    2e-11   
emb|CAN63179.1|  hypothetical protein VITISV_029107                   73.2    2e-11   Vitis vinifera
ref|XP_007227100.1|  hypothetical protein PRUPE_ppa025672mg           73.6    2e-11   
ref|NP_001267991.1|  R2R3 transcription factor MYB108-like protein 1  73.2    2e-11   
ref|XP_002320278.2|  putative MYB transcription factor family pro...  72.8    2e-11   Populus trichocarpa [western balsam poplar]
gb|EAY96442.1|  hypothetical protein OsI_18339                        73.2    2e-11   Oryza sativa Indica Group [Indian rice]
gb|AGN52033.1|  MYB-related transcription factor                      72.4    2e-11   
ref|XP_008390410.1|  PREDICTED: transcription factor MYB108-like      73.6    2e-11   
ref|XP_009799771.1|  PREDICTED: transcription factor MYB108-like      72.8    2e-11   
gb|KDO72049.1|  hypothetical protein CISIN_1g019911mg                 73.2    2e-11   
gb|EYU33077.1|  hypothetical protein MIMGU_mgv1a010262mg              73.2    2e-11   
ref|XP_006488792.1|  PREDICTED: transcription factor MYB108-like      73.2    2e-11   
ref|XP_011016230.1|  PREDICTED: transcription factor MYB108-like      73.2    2e-11   
ref|XP_009595257.1|  PREDICTED: transcription factor MYB108-like      72.4    3e-11   
ref|XP_002316060.2|  hypothetical protein POPTR_0010s15970g           73.2    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_006419304.1|  hypothetical protein CICLE_v10005387mg           73.2    3e-11   
ref|XP_010486159.1|  PREDICTED: transcription factor MYB108-like      73.2    3e-11   
gb|EPS64015.1|  hypothetical protein M569_10766                       72.4    3e-11   
ref|XP_009372081.1|  PREDICTED: transcription factor MYB108           73.2    3e-11   
gb|EAZ19253.1|  hypothetical protein OsJ_34790                        70.9    3e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EYU45477.1|  hypothetical protein MIMGU_mgv1a009198mg              73.2    3e-11   
ref|XP_007158818.1|  hypothetical protein PHAVU_002G184600g           72.4    3e-11   
ref|XP_008223427.1|  PREDICTED: transcription factor MYB108           73.2    3e-11   
ref|XP_009620712.1|  PREDICTED: transcription factor MYB108-like      72.4    3e-11   
ref|XP_006663109.1|  PREDICTED: transcription factor MYB108-like      72.4    3e-11   
ref|XP_009621085.1|  PREDICTED: transcription factor MYB108-like      72.8    3e-11   
ref|XP_010314657.1|  PREDICTED: ABA-induced MYB transcription fac...  71.6    3e-11   
gb|AAB58313.1|  Cpm5                                                  73.2    3e-11   Craterostigma plantagineum
gb|AAM43912.1|AF510112_1  MYB transcription factor                    72.8    3e-11   Craterostigma plantagineum
gb|ABH02873.1|  MYB transcription factor MYB111                       70.5    3e-11   Glycine max [soybeans]
ref|XP_009383942.1|  PREDICTED: transcription factor MYB108-like      72.0    3e-11   
ref|XP_009591106.1|  PREDICTED: transcription factor MYB57-like       72.4    3e-11   
gb|AAB58314.1|  Cpm7                                                  72.8    3e-11   Craterostigma plantagineum
ref|XP_007163206.1|  hypothetical protein PHAVU_001G215100g           71.6    3e-11   
ref|XP_010314656.1|  PREDICTED: ABA-induced MYB transcription fac...  71.6    3e-11   
ref|XP_010546950.1|  PREDICTED: transcription factor MYB108           72.8    3e-11   
ref|NP_001239915.1|  uncharacterized protein LOC100791349             72.8    3e-11   
ref|XP_006349959.1|  PREDICTED: myb-related protein 315-like          70.5    4e-11   
ref|NP_001267917.1|  R2R3 transcription factor MYB108-like protein 2  72.0    4e-11   
ref|XP_003550902.1|  PREDICTED: transcription factor MYB108           72.8    4e-11   
ref|XP_009390416.1|  PREDICTED: transcription factor MYB57            72.4    4e-11   
gb|KEH32365.1|  myb transcription factor                              72.4    4e-11   
ref|XP_010558458.1|  PREDICTED: transcription factor MYB108-like      72.8    4e-11   
ref|XP_007051208.1|  Myb domain protein 2, putative                   72.4    4e-11   
ref|XP_004229031.1|  PREDICTED: transcription factor MYB108-like      72.0    4e-11   
ref|XP_006337993.1|  PREDICTED: myb-related protein 305-like          72.4    4e-11   
ref|XP_006355725.1|  PREDICTED: transcription factor MYB21-like       72.4    4e-11   
ref|XP_011040784.1|  PREDICTED: transcription factor MYB108-like      72.0    4e-11   
ref|XP_009612140.1|  PREDICTED: transcription factor MYB108-like      72.0    4e-11   
ref|XP_010461601.1|  PREDICTED: myb-related protein 340               71.6    4e-11   
gb|AAG51527.1|AC051631_7  myb-related transcription factor (cpm10...  70.9    4e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006649985.1|  PREDICTED: myb-related protein MYBAS1-like       72.4    4e-11   
gb|KDP27970.1|  hypothetical protein JCGZ_19050                       72.4    4e-11   
ref|XP_006305561.1|  hypothetical protein CARUB_v10010143mg           71.2    4e-11   
emb|CDX80085.1|  BnaA05g00710D                                        70.5    4e-11   
ref|XP_002311369.1|  GmMYB12 family protein                           72.4    4e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010524743.1|  PREDICTED: transcription factor MYB108-like      72.4    5e-11   
ref|XP_010102909.1|  Myb-related protein 305                          72.4    5e-11   
gb|EMT33189.1|  Myb-related protein 305                               72.0    5e-11   
ref|XP_009784472.1|  PREDICTED: transcription factor MYB108-like      72.0    5e-11   
gb|AAN28280.1|  myb-like transcription factor 5                       71.6    5e-11   Gossypium hirsutum [American cotton]
gb|AAN28283.1|  myb-like transcription factor 5                       71.6    5e-11   Gossypium herbaceum [Arabian cotton]
ref|NP_564519.1|  myb domain protein 112                              70.9    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001140397.1|  putative MYB DNA-binding domain superfamily ...  72.4    5e-11   Zea mays [maize]
ref|XP_007163207.1|  hypothetical protein PHAVU_001G215200g           71.2    5e-11   
gb|AAN28281.1|  myb-like transcription factor 5                       71.6    6e-11   Gossypium hirsutum [American cotton]
ref|XP_002882474.1|  botrytis-susceptible1, myb domain protein 108    72.0    6e-11   
gb|AAK57699.1|AF377317_1  myb-like transcription factor Myb 5         71.6    6e-11   Gossypium hirsutum [American cotton]
gb|AAK57700.1|AF377318_1  recombinant myb-like transcription fact...  71.6    6e-11   
gb|AAK57698.1|AF377316_1  myb-like transcription factor Myb 5         71.6    6e-11   Gossypium hirsutum [American cotton]
emb|CDY34949.1|  BnaA01g32800D                                        72.0    6e-11   
gb|AFK29428.1|  R2R3MYB transcription factor                          69.7    6e-11   
ref|XP_003536859.1|  PREDICTED: transcription factor MYB108           70.9    6e-11   
ref|XP_010441042.1|  PREDICTED: transcription factor MYB108-like      72.0    6e-11   
gb|AAL84762.1|AF474129_1  typical P-type R2R3 Myb protein             69.7    6e-11   Sorghum bicolor [broomcorn]
ref|XP_002465358.1|  hypothetical protein SORBIDRAFT_01g037110        72.0    6e-11   Sorghum bicolor [broomcorn]
ref|XP_006492457.1|  PREDICTED: transcription factor MYB108-like      71.6    6e-11   
ref|XP_006444559.1|  hypothetical protein CICLE_v10021479mg           71.6    7e-11   
ref|XP_009386341.1|  PREDICTED: transcription factor MYB108-like      71.2    7e-11   
ref|XP_009124852.1|  PREDICTED: transcription factor MYB108           72.0    7e-11   
ref|XP_004239882.1|  PREDICTED: transcription factor MYB108-like      71.6    7e-11   
ref|XP_009799769.1|  PREDICTED: transcription factor MYB108-like      70.5    7e-11   
ref|XP_010500311.1|  PREDICTED: transcription factor MYB108-like      70.5    7e-11   
ref|XP_008781174.1|  PREDICTED: transcription factor MYB108           71.6    7e-11   
ref|XP_006349849.1|  PREDICTED: transcription factor MYB21-like       71.6    7e-11   
ref|XP_007035893.1|  Myb domain protein 112 isoform 2                 70.9    7e-11   
ref|NP_187301.1|  putative transcription factor MYB108                72.0    7e-11   
ref|XP_002865745.1|  AtMYB78                                          71.6    7e-11   
gb|KHN00328.1|  Myb-related protein 305                               70.5    7e-11   
gb|KHN14148.1|  Transcription factor MYB21                            70.5    7e-11   
ref|XP_006407939.1|  hypothetical protein EUTSA_v10021126mg           72.0    7e-11   
ref|XP_009134904.1|  PREDICTED: transcription factor MYB108-like ...  70.9    7e-11   
ref|XP_010464223.1|  PREDICTED: transcription factor MYB108           71.6    7e-11   
ref|XP_006298146.1|  hypothetical protein CARUB_v10014195mg           71.6    8e-11   
gb|EMT01874.1|  Myb-related protein 305                               71.6    8e-11   
gb|AAS10054.1|  MYB transcription factor                              71.6    8e-11   
ref|XP_011002746.1|  PREDICTED: transcription factor MYB108-like      71.2    8e-11   
ref|XP_009147158.1|  PREDICTED: transcription factor MYB108-like      71.6    8e-11   
emb|CDY05270.1|  BnaC05g45330D                                        71.6    8e-11   
ref|XP_009398691.1|  PREDICTED: transcription factor MYB108-like      70.5    8e-11   
emb|CDY24688.1|  BnaA05g30870D                                        71.6    8e-11   
gb|AAC04719.1|  MYB-like DNA-binding domain protein                   71.2    8e-11   
ref|XP_003591359.1|  MYB transcription factor                         70.9    8e-11   
ref|XP_002894088.1|  hypothetical protein ARALYDRAFT_473935           70.1    8e-11   
ref|NP_199773.1|  myb domain protein 78                               71.2    8e-11   
ref|XP_004252934.1|  PREDICTED: transcription factor MYB108-like      71.2    8e-11   
ref|NP_001190502.1|  myb domain protein 78                            71.6    9e-11   
gb|AHY94990.1|  MYB2                                                  70.9    9e-11   
ref|XP_004984581.1|  PREDICTED: myb-related protein P-like            71.6    9e-11   
ref|NP_001068466.2|  Os11g0684000                                     70.9    9e-11   
ref|NP_001234125.1|  ABA-induced MYB transcription factor             70.5    9e-11   
dbj|BAH83498.1|  MYB12 transcription factor a                         70.1    9e-11   
gb|AIB05776.1|  MYB transcription factor                              71.6    9e-11   
ref|XP_006349850.1|  PREDICTED: myb-related protein 305-like          70.5    9e-11   
ref|XP_008793362.1|  PREDICTED: transcription factor MYB108-like      70.9    1e-10   
ref|NP_001141891.1|  putative MYB DNA-binding domain superfamily ...  71.6    1e-10   
ref|NP_001049937.1|  Os03g0315400                                     71.6    1e-10   
ref|XP_010276490.1|  PREDICTED: transcription factor MYB108-like      71.2    1e-10   
ref|XP_009392050.1|  PREDICTED: transcription factor MYB108-like      70.5    1e-10   
ref|XP_009799770.1|  PREDICTED: transcription factor MYB108-like      70.9    1e-10   
gb|EAY89765.1|  hypothetical protein OsI_11306                        71.2    1e-10   
ref|XP_009411608.1|  PREDICTED: transcription factor MYB108           70.5    1e-10   
ref|XP_003536860.1|  PREDICTED: transcription factor MYB108-like      70.9    1e-10   
ref|XP_010938192.1|  PREDICTED: transcription factor MYB108-like      70.9    1e-10   
ref|XP_006393501.1|  hypothetical protein EUTSA_v10012051mg           70.1    1e-10   
gb|AIU39733.1|  MYB transcription factor 108-2                        70.9    1e-10   
emb|CDY70282.1|  BnaCnng67570D                                        70.9    1e-10   
ref|XP_009416464.1|  PREDICTED: myb-related protein 305-like          70.5    1e-10   
ref|XP_010941513.1|  PREDICTED: transcription factor MYB108-like      70.1    1e-10   
emb|CDX95420.1|  BnaC04g27380D                                        69.7    1e-10   
ref|XP_009417759.1|  PREDICTED: transcription factor MYB108-like      70.1    1e-10   
ref|XP_009415657.1|  PREDICTED: transcription factor MYB108-like      70.1    1e-10   
gb|EEE58945.1|  hypothetical protein OsJ_10621                        70.9    1e-10   
ref|XP_009134903.1|  PREDICTED: transcription factor MYB108-like ...  70.9    1e-10   
gb|ABR28342.1|  MYB transcription factor MYB61                        70.5    1e-10   
gb|KFK36115.1|  hypothetical protein AALP_AA4G080100                  69.3    1e-10   
ref|XP_010440825.1|  PREDICTED: transcription factor MYB108-like      70.9    1e-10   
ref|XP_003591357.1|  Myb-like transcription factor                    70.1    1e-10   
ref|XP_004495882.1|  PREDICTED: protein ODORANT1-like                 70.5    1e-10   
emb|CBH32532.1|  Myb-like DNA-binding domain containing protein,e...  70.9    1e-10   
gb|AIU39732.1|  MYB transcription factor 108-1                        70.9    1e-10   
ref|XP_007035892.1|  Myb domain protein 112 isoform 1                 70.9    1e-10   
ref|XP_006349958.1|  PREDICTED: transcription factor MYB21-like       69.7    1e-10   
ref|XP_010270853.1|  PREDICTED: transcription factor MYB108           70.5    1e-10   
ref|XP_004495885.1|  PREDICTED: transcription factor WER-like         70.1    1e-10   
gb|AEV91149.1|  R2R3-MYB protein                                      70.9    1e-10   
ref|XP_009151285.1|  PREDICTED: transcription factor MYB108-like      70.9    2e-10   
emb|CDX74100.1|  BnaA03g29470D                                        70.9    2e-10   
ref|XP_010482240.1|  PREDICTED: transcription factor MYB108-like      70.5    2e-10   
ref|XP_003561685.1|  PREDICTED: myb-related protein P-like            70.9    2e-10   
ref|XP_010442426.1|  PREDICTED: transcription factor MYB108-like      70.1    2e-10   
ref|NP_001042810.1|  Os01g0298400                                     70.5    2e-10   
ref|XP_002302787.1|  putative MYB transcription factor family pro...  70.5    2e-10   
ref|NP_001242391.1|  MYB12 protein                                    69.3    2e-10   
ref|XP_009804370.1|  PREDICTED: transcription factor MYB57-like       70.1    2e-10   
gb|AAN28284.1|  myb-like transcription factor 5                       70.1    2e-10   
ref|XP_008351918.1|  PREDICTED: myb-related protein P-like            68.9    2e-10   
emb|CDX85422.1|  BnaC07g27330D                                        68.6    2e-10   
emb|CDX86220.1|  BnaA06g29370D                                        68.6    2e-10   
ref|XP_009142557.1|  PREDICTED: transcription factor MYB108           69.7    2e-10   
ref|XP_007145121.1|  hypothetical protein PHAVU_007G211800g           69.7    2e-10   
ref|XP_009402050.1|  PREDICTED: transcription factor MYB108-like      69.3    2e-10   
emb|CAD23156.1|  putative Cpm10 protein                               67.8    2e-10   
dbj|BAB62111.1|  MYB transcription factor Atmyb2                      68.9    2e-10   
ref|XP_008667098.1|  PREDICTED: putative MYB DNA-binding domain s...  70.5    2e-10   
ref|NP_001131296.1|  putative MYB DNA-binding domain superfamily ...  70.5    2e-10   
gb|ABU93236.1|  R2R3 Myb-like protein                                 70.5    2e-10   
ref|XP_009394051.1|  PREDICTED: transcription factor MYB108-like      70.1    2e-10   
gb|AAL84765.1|AF474132_1  typical P-type R2R3 Myb protein             68.2    2e-10   
gb|AFR67332.1|  R2R3 MYB protein                                      70.1    3e-10   
ref|XP_008662919.1|  PREDICTED: myb-like protein AA                   70.9    3e-10   
ref|XP_006841613.1|  hypothetical protein AMTR_s00003p00219710        69.3    3e-10   
ref|NP_001152038.1|  cpm7                                             70.1    3e-10   
ref|XP_009384442.1|  PREDICTED: transcription factor MYB108-like      70.1    3e-10   
ref|XP_004958743.1|  PREDICTED: myb-related protein 330-like          70.1    3e-10   
ref|XP_003520762.1|  PREDICTED: transcription factor MYB108-like      69.3    3e-10   
ref|XP_002451276.1|  hypothetical protein SORBIDRAFT_05g026820        70.5    3e-10   
tpg|DAA54318.1|  TPA: putative MYB DNA-binding domain superfamily...  69.7    3e-10   
ref|XP_009385372.1|  PREDICTED: transcription factor MYB108-like      68.6    3e-10   
ref|XP_002455504.1|  hypothetical protein SORBIDRAFT_03g012310        69.7    3e-10   
ref|XP_010506747.1|  PREDICTED: transcription factor MYB108-like      69.3    3e-10   
gb|EMT31736.1|  Myb-related protein 305                               70.1    3e-10   
ref|XP_010507918.1|  PREDICTED: transcription factor MYB108-like      69.3    3e-10   
ref|XP_004508108.1|  PREDICTED: transcription factor MYB21-like       69.7    3e-10   
ref|XP_010518412.1|  PREDICTED: transcription factor MYB108-like      69.3    3e-10   
gb|KHN00223.1|  Myb-related protein 305                               68.6    3e-10   
ref|XP_009791846.1|  PREDICTED: transcription factor MYB108-like      69.3    3e-10   
gb|AFW60134.1|  putative MYB DNA-binding domain superfamily protein   70.1    4e-10   
dbj|BAH83499.1|  MYB12 transcription factor b                         68.9    4e-10   
ref|XP_008677864.1|  PREDICTED: transcription factor MYB108-like      70.1    4e-10   
gb|KFK37485.1|  hypothetical protein AALP_AA4G263500                  68.9    4e-10   
ref|XP_006280880.1|  hypothetical protein CARUB_v10026871mg           69.3    4e-10   
gb|KHN43434.1|  Transcription factor MYB21                            68.6    4e-10   
dbj|BAB62110.1|  MYB transcription factor Atmyb2                      68.9    4e-10   
ref|XP_009360147.1|  PREDICTED: transcription factor MYB108-like      69.3    4e-10   
ref|XP_009129805.1|  PREDICTED: transcription factor MYB108-like      69.7    4e-10   
ref|XP_002880286.1|  MYB transcription factor Atmyb2                  68.9    4e-10   
ref|NP_001235761.1|  MYB transcription factor MYB76                   68.9    4e-10   
ref|XP_006397911.1|  hypothetical protein EUTSA_v10001584mg           68.9    4e-10   
ref|XP_009409973.1|  PREDICTED: transcription factor MYB108-like      69.3    4e-10   
dbj|BAB62114.1|  MYB transcription factor Atmyb2                      68.9    4e-10   
emb|CDY05611.1|  BnaC02g39260D                                        69.7    4e-10   
dbj|BAB62121.1|  MYB transcription factor Atmyb2                      68.9    4e-10   
dbj|BAB62112.1|  MYB transcription factor Atmyb2                      68.9    4e-10   
dbj|BAB62119.1|  MYB transcription factor Atmyb2                      68.9    4e-10   
ref|NP_182241.1|  R2R3 MYB DNA binding domain transcription factor    68.9    4e-10   
dbj|BAB62118.1|  MYB transcription factor Atmyb2                      68.9    4e-10   
ref|XP_009118865.1|  PREDICTED: transcription factor MYB108-like      68.9    5e-10   
emb|CDY27504.1|  BnaC04g51450D                                        68.9    5e-10   
ref|XP_006644098.1|  PREDICTED: transcription factor MYB108-like      69.3    5e-10   
gb|AHW45787.1|  MYB transcription factor                              68.6    5e-10   
gb|EMS61349.1|  Transcription factor MYB21                            67.8    6e-10   
gb|KHN43433.1|  Transcription factor MYB21                            67.8    6e-10   
ref|XP_004967585.1|  PREDICTED: myb-related protein Myb4-like         68.9    6e-10   
gb|EMT25040.1|  Transcription factor MYB21                            68.2    7e-10   
ref|XP_003579302.1|  PREDICTED: transcription factor MYB108-like ...  68.6    7e-10   
ref|XP_003553674.1|  PREDICTED: transcription factor MYB108-like      67.8    7e-10   
dbj|BAJ99893.1|  predicted protein                                    68.9    8e-10   
ref|XP_010237154.1|  PREDICTED: transcription factor MYB108-like ...  68.2    8e-10   
dbj|BAJ91760.1|  predicted protein                                    68.2    8e-10   
ref|XP_009392103.1|  PREDICTED: protein ODORANT1-like                 68.9    9e-10   
ref|NP_001241924.1|  uncharacterized LOC100819467                     67.8    1e-09   
ref|XP_006294780.1|  hypothetical protein CARUB_v10023831mg           67.8    1e-09   
ref|XP_008367580.1|  PREDICTED: transcription factor MYB108-like      68.2    1e-09   
ref|XP_010921398.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  68.2    1e-09   
ref|XP_006395046.1|  hypothetical protein EUTSA_v10004588mg           68.2    1e-09   
gb|EMT04483.1|  Transcription factor MYB21                            67.8    1e-09   
ref|XP_010038307.1|  PREDICTED: transcription factor MYB108-like      67.4    1e-09   
gb|KDP40980.1|  hypothetical protein JCGZ_24979                       67.8    1e-09   
ref|XP_002440534.1|  hypothetical protein SORBIDRAFT_09g002675        68.6    2e-09   
ref|XP_009387805.1|  PREDICTED: transcription factor MYB57-like       67.4    2e-09   
ref|XP_002440535.1|  hypothetical protein SORBIDRAFT_09g002680        68.2    2e-09   
gb|ABH02913.1|  MYB transcription factor MYB72                        65.5    2e-09   
dbj|BAB62115.1|  MYB transcription factor Atmyb2                      67.0    2e-09   
ref|XP_008655821.1|  PREDICTED: transcription factor MYB108-like      67.8    2e-09   
ref|XP_002443369.1|  hypothetical protein SORBIDRAFT_08g018370        67.8    2e-09   
gb|AGH20617.1|  transcription factor MYB76                            66.6    2e-09   
gb|EAY83532.1|  hypothetical protein OsI_38744                        67.0    2e-09   
gb|ABA98967.1|  Myb-like DNA-binding domain containing protein, e...  67.0    3e-09   
ref|XP_010237394.1|  PREDICTED: transcription factor MYB108           65.9    3e-09   
ref|XP_010523903.1|  PREDICTED: transcription factor MYB108-like      66.2    3e-09   
ref|NP_001060700.1|  Os07g0688200                                     67.0    3e-09   
dbj|BAC21351.1|  putative typical P-type R2R3 Myb protein             67.0    3e-09   
ref|XP_004979993.1|  PREDICTED: myb-related protein Zm38-like         67.4    3e-09   
ref|NP_001182983.1|  putative MYB DNA-binding domain superfamily ...  67.4    3e-09   
ref|XP_003565694.1|  PREDICTED: transcription factor MYB108-like      66.6    4e-09   
ref|NP_001170329.1|  putative MYB DNA-binding domain superfamily ...  67.0    4e-09   
ref|XP_006658986.1|  PREDICTED: transcription factor MYB108-like      64.7    4e-09   
tpg|DAA47022.1|  TPA: putative MYB DNA-binding domain superfamily...  67.0    4e-09   
ref|XP_008374762.1|  PREDICTED: transcription factor WER-like         66.2    4e-09   
ref|XP_008453409.1|  PREDICTED: transcription factor MYB24-like       65.9    5e-09   
ref|XP_008674336.1|  PREDICTED: myb-related protein 305               66.2    6e-09   
ref|XP_006664647.1|  PREDICTED: transcription factor MYB108-like      66.2    6e-09   
gb|ACF22737.1|  Myb                                                   65.9    7e-09   
ref|XP_010679505.1|  PREDICTED: transcription factor MYB108-like      65.9    8e-09   
ref|XP_006842316.1|  hypothetical protein AMTR_s00079p00140660        65.5    8e-09   
ref|XP_009382479.1|  PREDICTED: transcription factor MYB108-like      65.1    8e-09   
ref|XP_009347244.1|  PREDICTED: transcription factor WER-like         65.5    8e-09   
ref|XP_004962755.1|  PREDICTED: transcription repressor MYB5-like     65.5    9e-09   
ref|XP_010544950.1|  PREDICTED: transcription factor MYB108-like      65.1    9e-09   
gb|AFW82705.1|  putative MYB DNA-binding domain superfamily protein   65.9    1e-08   
ref|XP_004137543.1|  PREDICTED: myb-related protein 305-like          64.7    1e-08   
gb|KCW58192.1|  hypothetical protein EUGRSUZ_H00907                   64.3    2e-08   
ref|XP_002526991.1|  r2r3-myb transcription factor, putative          64.7    2e-08   
gb|ACM62750.1|  MYB7                                                  64.3    2e-08   
ref|XP_010069752.1|  PREDICTED: transcription factor MYB108-like      63.9    3e-08   
ref|XP_010026086.1|  PREDICTED: uncharacterized protein LOC104416384  65.1    3e-08   
ref|XP_008457536.1|  PREDICTED: myb-related protein 305-like          62.8    6e-08   
ref|XP_004151034.1|  PREDICTED: myb-related protein 305-like          62.4    7e-08   
ref|XP_004169379.1|  PREDICTED: transcription factor MYB21-like       62.4    8e-08   
ref|XP_009778880.1|  PREDICTED: transcription factor MYB24-like       58.5    8e-07   
gb|KDP40983.1|  hypothetical protein JCGZ_24982                       59.3    1e-06   
ref|XP_009631883.1|  PREDICTED: transcription factor MYB108-like ...  58.2    2e-06   
ref|XP_003534166.2|  PREDICTED: transcription repressor MYB6-like     55.1    3e-05   
gb|KHN32052.1|  Myb-related protein 305                               55.1    3e-05   
ref|XP_009779065.1|  PREDICTED: transcription factor MYB21-like       52.8    3e-05   
ref|XP_007154150.1|  hypothetical protein PHAVU_003G094600g           52.4    2e-04   
gb|AGN52105.1|  MYB-related transcription factor                      52.0    2e-04   
ref|XP_004512906.1|  PREDICTED: transcription factor MYB21-like       50.8    5e-04   
gb|EMS64823.1|  Transcription factor MYB21                            50.8    6e-04   
ref|XP_004240646.2|  PREDICTED: transcription factor MYB108-like      50.1    0.001   



>ref|XP_009587217.1| PREDICTED: transcription factor MYB24-like [Nicotiana tomentosiformis]
Length=303

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 116/202 (57%), Gaps = 23/202 (11%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQLK+DSNS KF+EA++ FW+PRL+EKMEQ          SS 
Sbjct  110  TDNEIKNYWRTRVQKQARQLKVDSNSTKFLEAIRSFWIPRLLEKMEQ------YCPSSSS  163

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYL-PSSPTLQE------PPKTDNSENENLNI  341
             S SS S +EKQ S   +SL +   + Q+ + P   T QE       P++ +      + 
Sbjct  164  PSFSSFSDIEKQNSALPSSLINEQESLQSLINPKPNTCQEISPRFYSPESKSMAENATSF  223

Query  342  CSTDSFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAPDDWFSN  521
                 +     +DCYH+E   +S Y  E+    P  SA ES+D+S+ E    A  +WF+ 
Sbjct  224  TGNSVYSNSTQEDCYHLET--SSSYFEEQ----PYFSALESQDMSISEYNGMAEANWFT-  276

Query  522  DVADSLWNIDESWQYRKLEDFG  587
               D LWNIDE WQ+R + D G
Sbjct  277  ---DQLWNIDEFWQFRNIGDVG  295



>emb|CDP00641.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 116/196 (59%), Gaps = 32/196 (16%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL +DSNSKKF+EA+K FWMPRL+EKMEQ             
Sbjct  112  TDNEIKNYWRTRVQKQARQLNVDSNSKKFLEAIKCFWMPRLLEKMEQ------------S  159

Query  183  sssssistMEKQQSPPINSLPSPH-PTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSF  359
            SS SS S++    +P  ++  SP   T++T L SS  L +  K           CS+DS 
Sbjct  160  SSLSSSSSISSISTPDNHNSASPSLATNKTPLASSSPLADSKK-----------CSSDS-  207

Query  360  QLHHDDDCYHVEIMGNSCYGGEEAFGHPAMS--AFESRDISMLECQLAAPDDWFSNDV-A  530
                ++   +  I G+SCY     +  P MS  A ES D++  ECQ++  D+WF++D+ A
Sbjct  208  ----NNSACNNSIEGDSCYHIFSHYQPPEMSAEAMESPDMNFSECQISEADNWFNDDMSA  263

Query  531  DSLWNIDESWQYRKLE  578
             + WN DE W +RK E
Sbjct  264  GAFWNTDELWHFRKPE  279



>ref|XP_009626235.1| PREDICTED: transcription factor MYB108-like [Nicotiana tomentosiformis]
Length=277

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 112/204 (55%), Gaps = 47/204 (23%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQLK+DSNSKKF+EA+K  WMPRL+EKMEQ+            
Sbjct  109  TDNEIKNYWRTRVQKQARQLKVDSNSKKFVEAIKSLWMPRLLEKMEQS------------  156

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEP-PKTDNSENENLNICSTDSF  359
                             +S+   +P+  T L ++   QEP  K   S  EN  I STDS 
Sbjct  157  -----------------SSIEKHNPSLITPLINN---QEPYDKAKTSSFENSRIYSTDSM  196

Query  360  --------QLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAPDDWF  515
                    ++  D   Y+  +  N CY  E     P    F S+++S+ EC++A    WF
Sbjct  197  NMLKLQPNEMTQDFTIYNNSVQ-NECYHVESLSQQP---HFSSQEMSISECEVAEA-HWF  251

Query  516  SNDV-ADSLWNIDESWQYRKLEDF  584
            S+++ A SLWN+DE WQ+RKL D 
Sbjct  252  SDEMAAASLWNMDEFWQFRKLGDI  275



>ref|XP_009797951.1| PREDICTED: transcription factor MYB108-like [Nicotiana sylvestris]
Length=271

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 110/198 (56%), Gaps = 41/198 (21%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQLK+D NSK F+EA+K  W+PRL+EKMEQ+            
Sbjct  109  TDNEIKNYWRTRVQKQARQLKVDCNSKIFVEAIKSLWVPRLLEKMEQS------------  156

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSE---NENLNICSTD  353
                             +S+   +P+  T L ++   QEP   +NS     +++N+   +
Sbjct  157  -----------------SSIEKHNPSLITPLINN---QEPYDKENSRMYSTDSMNMLKLE  196

Query  354  SFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAPDDWFSNDV-A  530
              ++  D   Y+  +  N CY  E     P    F S+++S+ EC++A    WFS+++ A
Sbjct  197  PHEMTQDFTIYNNSVQ-NECYHVESLSQQP---DFSSQEMSISECEVAEA-HWFSDEMAA  251

Query  531  DSLWNIDESWQYRKLEDF  584
             SLWN+DE WQ+RKL D 
Sbjct  252  TSLWNMDEFWQFRKLGDI  269



>ref|XP_006344301.1| PREDICTED: transcription factor MYB48-like [Solanum tuberosum]
Length=273

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/203 (40%), Positives = 109/203 (54%), Gaps = 47/203 (23%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQLK+DSNSKKF+EA+K  W+PRL+EKMEQ             
Sbjct  107  TDNEIKNYWRTRVQKQARQLKVDSNSKKFVEAIKNLWVPRLLEKMEQ-------------  153

Query  183  sssssistMEKQ--QSPPINSLPSP-------HPTHQTYLPSSPTLQEPPKTDNSENENL  335
                S S++EK+    P IN+   P       H T+  +  +  +L+    + N  NENL
Sbjct  154  ---CSSSSIEKKLPNLPLINNNQEPCTKHNKSHDTNNNHNTTWGSLENSLDSMNVLNENL  210

Query  336  NICSTDSFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAPDDWF  515
            N        +  DD+CYHV                P    ++   IS  EC++A   +W 
Sbjct  211  N-------SILQDDECYHVGSF----------IQQPEHLTYQEMSIS--ECEVAEA-NWL  250

Query  516  SNDVADSLWNIDESWQYRKLEDF  584
            +++   SLWN+DE WQ++KL D 
Sbjct  251  NDE--GSLWNMDELWQFKKLGDV  271



>ref|XP_011076599.1| PREDICTED: transcription factor MYB108-like [Sesamum indicum]
Length=303

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 111/211 (53%), Gaps = 45/211 (21%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQLK+DSNSKKF+EA++ +WMPRL+EKMEQ       +   + 
Sbjct  116  TDNEIKNYWRTRVQKQARQLKVDSNSKKFLEAIRMYWMPRLLEKMEQ------KNASVTS  169

Query  183  sssssistMEKQQ----SPPINS--LPSPHPTHQTY-----------LPSSPTLQEPPKT  311
            S SSSIST+E Q+    SP  N   LPS  P   T            +P    L  PP  
Sbjct  170  SPSSSISTLETQKFTAPSPVFNQAPLPSSCPPPGTMVAHSDSNSCPEIPEISGLLTPPGG  229

Query  312  DNSENENLNICSTDSFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISML-EC  488
                      CS  S      DDCY V+++ +             M  F S+DI  L EC
Sbjct  230  QP--------CSKISCSKSTQDDCYRVDMIPSY-----------DMQEF-SQDIPDLSEC  269

Query  489  QLAAPDDWFSNDVADSLWNIDESWQYRKLED  581
             +A   DWF  D+  + W  D+ WQ+RK ED
Sbjct  270  HVAEV-DWFGEDLGSTFWETDDLWQFRKGED  299



>ref|XP_004239413.2| PREDICTED: transcription factor MYB108 [Solanum lycopersicum]
Length=274

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 108/197 (55%), Gaps = 33/197 (17%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQLK+DSNSKKF+EA+K  W+PRL+EKMEQ             
Sbjct  106  TDNEIKNYWRTRVQKQARQLKVDSNSKKFVEAIKNLWVPRLLEKMEQ-------------  152

Query  183  sssssistMEKQ--QSPPINSLPSPHPTH-QTYLPSSPTLQEPPKTDNSENENLNICSTD  353
               SS S++EK+    P IN+   P   H +++  ++        +  S  +++++ + +
Sbjct  153  --CSSSSSIEKKLPNLPLINNNQEPCTKHNKSHDIAANNNNTTWGSQESSLDSMHVLNEN  210

Query  354  SFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAPDDWFSNDVAD  533
                H  D+CYHV                P    ++   IS  EC +A   DW +++   
Sbjct  211  MNSTHQYDECYHVGSF----------IQQPEHLTYQEMSIS--ECDVAEA-DWLNDE--G  255

Query  534  SLWNIDESWQYRKLEDF  584
            SLWN+DE WQ++KL D 
Sbjct  256  SLWNMDEFWQFKKLGDV  272



>ref|XP_011070788.1| PREDICTED: transcription factor MYB24 [Sesamum indicum]
Length=283

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 111/208 (53%), Gaps = 52/208 (25%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQLK+DSNSKKF+EA++ FWMPRL+EKMEQ           + 
Sbjct  110  TDNEIKNYWRTRVQKQARQLKVDSNSKKFLEAIRTFWMPRLMEKMEQ-------DSSLTS  162

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNI-------  341
            S SSSIS+ME Q      + PSP  + Q   PSS    +P    NS + N +        
Sbjct  163  SPSSSISSMETQNF----TAPSP-VSSQVPQPSS----KPGNGVNSSDSNYSAKISPLPA  213

Query  342  --CSTDSFQLHH--DDDCYHVEIMGNSCYGGEEAFGHPA--MSAFESRDISMLECQLAAP  503
                T   Q  +  +D+ Y+V              G P+  M   E++DIS+ EC +A  
Sbjct  214  ESLVTGKIQSENSLEDNYYYV--------------GSPSYDMQELEAQDISLSECHVAEI  259

Query  504  DDWFSNDVADSLWNIDESWQYRKLEDFG  587
             DWF        WN DE WQ+RK  + G
Sbjct  260  -DWF--------WNTDELWQFRKPGEVG  278



>ref|XP_010265100.1| PREDICTED: myb-related protein MYBAS2-like [Nelumbo nucifera]
Length=303

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 107/219 (49%), Gaps = 45/219 (21%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQAR LKID+NS +F +A++ FWMPRL++K+E +     +      
Sbjct  105  TDNEIKNYWRTRVQKQARHLKIDANSARFRDAIRCFWMPRLLQKIEDSSLAMINQ-----  159

Query  183  sssssistMEKQQSP-PINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENEN---------  332
                         SP P+N               S ++ EP  + N + +N         
Sbjct  160  ---------NSSSSPIPLNLQIPQPSPLPPPPEVSLSVSEPTDSINLQEKNCTSPSISSS  210

Query  333  --LNIC---------STDSFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMS---AFESRD  470
              +NI          +T S  LH   +  +   + NS Y  ++ F    MS    +E+ D
Sbjct  211  DSMNISKFPEFSEYPTTSSLLLHDFGNIVYNPYVDNSSYDMDD-FNTSVMSLQGGYEASD  269

Query  471  ISMLECQLAAPDDWFSNDVADSLWNIDESWQYRKLEDFG  587
              M      A  +W  NDVA+S+W+IDE WQ+RKL+D G
Sbjct  270  CHM------AESNWVGNDVAESIWSIDELWQFRKLQDRG  302



>gb|KDP29432.1| hypothetical protein JCGZ_18353 [Jatropha curcas]
 gb|AIT52318.1| MYB family protein [Jatropha curcas]
Length=311

 Score =   105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 104/200 (52%), Gaps = 18/200 (9%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQ+QARQL I+SNSK+F++AV+ FWMPRL++K+EQ  + + S      
Sbjct  118  TDNEIKNYWRTRVQRQARQLNIESNSKRFLDAVRCFWMPRLLQKVEQ--ANSCSFSPLKT  175

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSFQ  362
               S    +     P  NS P  +P  +   P+S  +   P    +   N +      +Q
Sbjct  176  LQDSETHELANFTLPDNNSFPQQYPILENESPTS--VYHLPTITGTTTTNPDSTEISQYQ  233

Query  363  LH----------HDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAPDDW  512
                         D++ Y+  IM  S Y  E     P +  F     S  ECQ+   ++W
Sbjct  234  PEILENRASPPLLDENVYNNLIMNESYYDMEGFNPMPEIGTFHD---STKECQMEESNNW  290

Query  513  -FSNDVADSLWNIDESWQYR  569
             F + +AD+LWN+D+ WQ+R
Sbjct  291  AFDDGMADTLWNMDDIWQFR  310



>ref|XP_007044287.1| Myb domain protein 62, putative [Theobroma cacao]
 gb|EOY00119.1| Myb domain protein 62, putative [Theobroma cacao]
Length=317

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 113/224 (50%), Gaps = 44/224 (20%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNSKKF+EAV+ FWMPRL +K+EQ             
Sbjct  110  TDNEIKNYWRTRVQKQARQLNIESNSKKFLEAVRCFWMPRLRQKVEQ------------T  157

Query  183  sssssistMEKQQSPPINSLP-SPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSF  359
            SSSSS+  M  Q S P + L     P+  T+   SP   +     N   EN +  +T S 
Sbjct  158  SSSSSLKEMSSQSSAPSDQLSDCAIPSLSTF---SPLPNKITDRSNHSFENSSSVTTQSL  214

Query  360  ---------------------QLHHDDDCYHVEIMGNSCYGGE------EAFGHPAMSAF  458
                                  ++     Y+   + N+ Y  +      E F   +MSA 
Sbjct  215  YPTDFINISEQTEIPEHLTSPNVYGHTTVYNNNQIVNASYNIDSSGYDIEGFSLASMSAV  274

Query  459  ESRDISMLECQLAAPDDWFSNDVADSLWNIDESWQYRKLEDFGD  590
             S + S  ECQ+    +W  N++ D+LWN+D+ WQ+R+L +  +
Sbjct  275  GSYEGSPSECQMGE-GNWICNEMTDTLWNLDDIWQFRELGELAN  317



>ref|XP_006448450.1| hypothetical protein CICLE_v10015986mg [Citrus clementina]
 gb|ESR61690.1| hypothetical protein CICLE_v10015986mg [Citrus clementina]
Length=316

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 110/216 (51%), Gaps = 39/216 (18%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS+ F EAV+ +WMPRL++KMEQ  ++  +   +S 
Sbjct  114  TDNEIKNYWRTRVQKQARQLNIESNSETFFEAVRCYWMPRLLQKMEQNSASPNTLLTNSS  173

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSEN------------  326
            + SS+ S +     P ++S             S+ T+ E   ++ S N            
Sbjct  174  AQSSNFSII-----PSVSSSTLSPLPSTILYNSNQTINENSSSETSPNFFPGDFSKISQL  228

Query  327  --------------ENLNICSTDSFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFES  464
                             N+CS         +D Y+V+  G    G         MS++  
Sbjct  229  QQPGITQQPTSPHAYGNNVCSNQIV----PNDSYYVDCCGFDMEGYSLTDPIAEMSSY--  282

Query  465  RDISMLECQLAAPDDWFSNDVADSLWNIDESWQYRK  572
             DIS  ECQ+A   DW SND++D+LWN+D+ WQ R+
Sbjct  283  -DISSSECQMAEA-DWMSNDMSDALWNMDDIWQLRE  316



>ref|XP_002315935.1| hypothetical protein POPTR_0010s13290g [Populus trichocarpa]
 gb|EEF02106.1| hypothetical protein POPTR_0010s13290g [Populus trichocarpa]
Length=319

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 116/225 (52%), Gaps = 46/225 (20%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRT+VQK+ARQL I+++S KF++AV+ FWMPRL +KMEQ   +++S+ + S 
Sbjct  110  TDNEIKNYWRTKVQKEARQLNIEASSTKFLDAVRSFWMPRLPQKMEQASYSSSSTTLDS-  168

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSS-PTLQEPPKTDNSENENLN-------  338
                     + Q    + S     P+  + +PSS  TL  PP++  +   NL        
Sbjct  169  ---------QSQADHGVRS-----PSSNSTVPSSLSTLLCPPESKLAHYSNLGSENSSPV  214

Query  339  ----ICSTDSFQLH--------------HDDDCYHVEIMGNSCYGGEEAFG----HPAMS  452
                + S +S  +               H D  Y+  I+ ++CY     +     + A +
Sbjct  215  TSPHVLSANSDTISPQPEILENPTCSPLHGDTFYNNLILSDTCYEEGSCYDLDGFNQASA  274

Query  453  AFESRDISMLECQLAAPDDWFSNDVADSLWNIDESWQYRKLEDFG  587
               + D S LECQ+A   +W  +   D++W++D+ WQ+R L + G
Sbjct  275  GMGTYDNSPLECQMAG-GNWVFDSRVDTIWDMDDMWQFRDLRETG  318



>gb|AAC83619.1| putative transcription factor, partial [Arabidopsis thaliana]
Length=204

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 104/202 (51%), Gaps = 34/202 (17%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS KF +AV+ FW+PRLIEKMEQ  STTT+      
Sbjct  25   TDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFWVPRLIEKMEQNSSTTTTYCCP--  82

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSFQ  362
                        Q+   NSL  P  +H        +L      D S   N++  S+ S  
Sbjct  83   ------------QNNNNNSLLLPSQSHD-------SLSMQKDIDYSGFSNIDGSSSTSTC  123

Query  363  LHHDDDCYHVE-------IMGNSCY--GGEEAFGH--PAMSAF-ESRDISMLECQLAAPD  506
            + H     H         I G+ C+  G  + FG   P M  +  + DISM EC +A   
Sbjct  124  MSHLTTVPHFMDQSNTNIIDGSMCFHEGNVQEFGGYVPGMEDYMVNSDISM-ECHVADGY  182

Query  507  DWFSNDVADSLWNIDESWQYRK  572
              + +   D +WN+D+ WQ+R+
Sbjct  183  SAYEDVTQDPMWNVDDIWQFRE  204



>ref|XP_006468714.1| PREDICTED: transcription factor MYB108-like [Citrus sinensis]
 gb|KDO76970.1| hypothetical protein CISIN_1g021188mg [Citrus sinensis]
Length=316

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 110/216 (51%), Gaps = 39/216 (18%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS+ F EAV+ +WMPRL++KMEQ  ++  +   +S 
Sbjct  114  TDNEIKNYWRTRVQKQARQLNIESNSETFFEAVRCYWMPRLLQKMEQNSASPNTLLTNSS  173

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSEN------------  326
            + SS+ S +     P ++S             S+ T+ E   ++ S N            
Sbjct  174  AQSSNFSII-----PSVSSSTLSPLPSTILYNSNQTINENSSSETSPNFFPGDFSKISQL  228

Query  327  --------------ENLNICSTDSFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFES  464
                             N+CS         +D Y+V+  G    G         MS++  
Sbjct  229  QQPGITQQPTSPHAYGNNVCSNQIV----PNDSYYVDCCGFDMEGYSLTDPIAEMSSY--  282

Query  465  RDISMLECQLAAPDDWFSNDVADSLWNIDESWQYRK  572
             DIS  ECQ+A   DW SND++D+LW++D+ WQ R+
Sbjct  283  -DISSSECQMAEA-DWMSNDMSDALWSMDDIWQLRE  316



>ref|XP_009778774.1| PREDICTED: transcription factor MYB24-like [Nicotiana sylvestris]
Length=262

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 98/167 (59%), Gaps = 26/167 (16%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQLK+DSNS KF+EA++ FW+PRL+EKMEQ          SSP
Sbjct  110  TDNEIKNYWRTRVQKQARQLKVDSNSTKFLEAIRGFWIPRLLEKMEQ-----YCPSSSSP  164

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPS-------SPTLQEPPKTDNSENE---N  332
            +SSSS  T+EKQ S   +SL +   + Q+  P        SP    P     +EN    N
Sbjct  165  TSSSSTITIEKQNSALHSSLINEQESLQSLNPKPNTCEEISPRFYSPESNSMAENATGFN  224

Query  333  LNICSTDSFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDI  473
             N   ++S Q    +DCYH+E    S Y  E+    P  SA ES+DI
Sbjct  225  GNSVYSNSTQ----EDCYHLET---SSYFEEQ----PYFSALESQDI  260



>gb|AGN52055.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52165.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=271

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 105/196 (54%), Gaps = 36/196 (18%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQLK+DSNSKKF+EA++ FWMPRL+EKMEQ   +T SS  SS 
Sbjct  106  TDNEIKNYWRTRVQKQARQLKVDSNSKKFLEAIRTFWMPRLMEKMEQNSPSTASSPSSSI  165

Query  183  sssssistMEKQQSP------PINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNIC  344
            +++ S   + +   P      P+N+  S    +  ++ SS           S + NL   
Sbjct  166  AAAPSSPAISQLAPPDSLCPNPVNNSNSDGNNYDIFVSSS-----------SPSVNLTAV  214

Query  345  STDSFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAPDDWFSND  524
               + ++  ++  Y+V   G  CY   +  G           IS  EC +A   DWF  D
Sbjct  215  KNQT-EIPIEESYYNVGFPG--CYDDMQVQG-----------ISPPECHVAEI-DWFGED  259

Query  525  VADSLWNIDESWQYRK  572
                 WN DE WQ+RK
Sbjct  260  ----FWNTDELWQFRK  271



>ref|XP_010511820.1| PREDICTED: transcription factor MYB21-like [Camelina sativa]
Length=287

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 110/198 (56%), Gaps = 27/198 (14%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS KF +AV+ FW+PRLIEKMEQ  STTT       
Sbjct  107  TDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFWVPRLIEKMEQNSSTTTYCC----  162

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPK--TDNSENENLNICSTDS  356
                       Q +   NSL  P  +  + +    ++Q+  +  + N    N++  ST +
Sbjct  163  ----------PQNNNNNNSLLVPSQSQDSMM----SIQKDTEFSSQNLSFSNMDGSSTST  208

Query  357  FQLHHDDDCYHVEIM-GNSCY--GGEEAFGH--PAMSAF-ESRDISMLECQLAAPDDWFS  518
            + + H  D  +  I+ G+ C+  G ++  G   P M  +  + DISM +C +A     + 
Sbjct  209  WTVPHLMDHNNTNIVDGSMCFHEGNDQELGGYVPGMEDYMRNSDISM-QCHVADGYSAYE  267

Query  519  NDVADSLWNIDESWQYRK  572
            +   D +WNID+ WQ+R+
Sbjct  268  DVTQDPMWNIDDIWQFRE  285



>ref|NP_176999.1| R2R3-MYB transcription  family [Arabidopsis thaliana]
 gb|AAG52612.1|AC016447_21 putative transcription factor; 40023-38981 [Arabidopsis thaliana]
 gb|AAS10038.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE34781.1| R2R3-MYB transcription family [Arabidopsis thaliana]
Length=286

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 104/202 (51%), Gaps = 34/202 (17%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS KF +AV+ FW+PRLIEKMEQ  STTT+      
Sbjct  107  TDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFWVPRLIEKMEQNSSTTTTYCCP--  164

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSFQ  362
                        Q+   NSL  P  +H        +L      D S   N++  S+ S  
Sbjct  165  ------------QNNNNNSLLLPSQSHD-------SLSMQKDIDYSGFSNIDGSSSTSTC  205

Query  363  LHHDDDCYHVE-------IMGNSCY--GGEEAFGH--PAMSAF-ESRDISMLECQLAAPD  506
            + H     H         I G+ C+  G  + FG   P M  +  + DISM EC +A   
Sbjct  206  MSHLTTVPHFMDQSNTNIIDGSMCFHEGNVQEFGGYVPGMEDYMVNSDISM-ECHVADGY  264

Query  507  DWFSNDVADSLWNIDESWQYRK  572
              + +   D +WN+D+ WQ+R+
Sbjct  265  SAYEDVTQDPMWNVDDIWQFRE  286



>ref|XP_010532345.1| PREDICTED: myb-related protein 340-like [Tarenaya hassleriana]
Length=301

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/205 (36%), Positives = 105/205 (51%), Gaps = 25/205 (12%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS+KF +AV+ FWMPRL+EKMEQ  S+ +++  SS 
Sbjct  107  TDNEIKNYWRTRVQKQARQLNIESNSEKFFDAVRSFWMPRLVEKMEQNSSSNSAASCSSQ  166

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLP----------SSPTLQEPPKTDNSENEN  332
             +S++ +T+   +     SL +         P          SS        T   +  +
Sbjct  167  LNSNNANTINGPEFLSSESLMNSVRPDSDGFPNDSGFSDINCSSSMADLVAITRLMDMSD  226

Query  333  LNICSTDSFQLHHDDDCYHVEIMGNSCYGGEEAFGH-----PAMSAFESRDISMLECQLA  497
             N   +  FQLH           G+ C   EE +GH       M++  + DIS     +A
Sbjct  227  QNTAGSVQFQLHG----------GSQCVSEEEEYGHFHGFDDYMASMGNLDISSAGYHVA  276

Query  498  APDDWFSNDVADSLWNIDESWQYRK  572
              D  + +   D +WN+D+ W +R+
Sbjct  277  NADSMYEDVTQDPMWNMDDIWHFRE  301



>ref|XP_010551244.1| PREDICTED: myb-related protein 305-like [Tarenaya hassleriana]
Length=282

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 103/192 (54%), Gaps = 14/192 (7%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS+KF +AV+ FWMPRL+EKMEQ  S++ S+  SS 
Sbjct  103  TDNEIKNYWRTRVQKQARQLNIESNSEKFFDAVRSFWMPRLLEKMEQQNSSSDSASCSSR  162

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSFQ  362
             S +     +    P  +  P+ H +      S+P  +  P+  +  ++NL        Q
Sbjct  163  PSDNCPRGSDDLLLPSQSLNPNEHCS-----SSTPDFETVPQLMDLSDQNL-------MQ  210

Query  363  LHHDDDCYHVEIMGNSCYGGEEAFGHPAM-SAFESRDISMLECQLAAPDDWFSNDVA-DS  536
             H    C   E  G   +          M S+  + DIS LEC +   D     DV  D 
Sbjct  211  FHGGSQCVSEEEYGYGHHHHHFHGFEDYMASSMGNLDISPLECHVEDGDSMMYEDVTQDP  270

Query  537  LWNIDESWQYRK  572
            +WN+D+ WQ+R+
Sbjct  271  MWNMDDIWQFRE  282



>ref|XP_003592641.1| R2R3-MYB transcription factor [Medicago truncatula]
 gb|AES62892.1| myb transcription factor [Medicago truncatula]
Length=311

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 106/207 (51%), Gaps = 35/207 (17%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+S SK+FI+AVK FWMPRL++KMEQ  S +  +  S  
Sbjct  114  TDNEIKNYWRTRVQKQARQLNIESGSKRFIDAVKCFWMPRLLQKMEQNTSPSFDNSSSMT  173

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICST----  350
            + ++  +++E   S   N +PS  P+      S P   +    D S   +L+  ST    
Sbjct  174  NMNNFGNSIEASTSNSFN-IPSMSPS------SYP---QRGFIDASNGNHLSTMSTSFNN  223

Query  351  ---DSFQLHH------------DDDCYHVEIMGNSCYG-----GEEAFGHPAMSAFESRD  470
               D FQ               +++ Y+  I  N C       G E      MS+ E+ D
Sbjct  224  PSLDFFQFSQPLENSKSAPNVFENNFYNGPIQDNFCIDDTNNYGLEGLNLDPMSSMETYD  283

Query  471  ISMLECQLAAPDDWFSNDVADSLWNID  551
             S  + Q      W  +++A++LWN+D
Sbjct  284  FSQFDLQ-TTESGWMLDNMANTLWNMD  309



>ref|XP_010470777.1| PREDICTED: myb-related protein 340-like [Camelina sativa]
Length=289

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 107/196 (55%), Gaps = 21/196 (11%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS KF +AV+ FW+PRLIEKMEQ  STTT     + 
Sbjct  107  TDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFWVPRLIEKMEQNSSTTTYCCPQNN  166

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSFQ  362
            +++++ S +          LPS      T +           + N    N++  ST ++ 
Sbjct  167  NNNNNNSLL----------LPSQSQDSMTSIQKDTQF----SSQNLSISNMDSSSTSTWT  212

Query  363  LHHDDDCYHVEIMGNS-CY--GGEEAFGH--PAMS-AFESRDISMLECQLAAPDDWFSND  524
            L H  D  +  I  +S C+  G ++  G   P M     + DISM +C +A     + + 
Sbjct  213  LPHFMDHNNTNIADSSMCFHEGNDQELGGYIPGMEDCMRNSDISM-QCHVADGYSAYEDV  271

Query  525  VADSLWNIDESWQYRK  572
              D +WNID+ WQ+R+
Sbjct  272  TQDPMWNIDDIWQFRE  287



>ref|XP_007160381.1| hypothetical protein PHAVU_002G317000g [Phaseolus vulgaris]
 gb|ESW32375.1| hypothetical protein PHAVU_002G317000g [Phaseolus vulgaris]
Length=319

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 111/215 (52%), Gaps = 27/215 (13%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTR+QKQAR LKID++S++F E V+RFWMPRL++K +++ S+++S      
Sbjct  105  TDNEIKNYWRTRIQKQARHLKIDTDSREFQELVRRFWMPRLLQKAKESSSSSSSVMPIQN  164

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSE---------NENL  335
             +   +      Q   + S+P   P       SS  +++  +  +SE         +E+ 
Sbjct  165  QAIPLLLDDGVSQQSTVGSIPWQGPCMSMNGGSSTYMEQHEQNSDSEHNSGSCISFSESA  224

Query  336  NICSTDSFQLHHDDDCYHVEIMGNSCYGGEEAFGHPA------MSAFESRDISMLE----  485
            NI    S    H  D +H   + N+ +G     G+        M+ F++    + +    
Sbjct  225  NIPKV-SQHFGHTMDQFHG--LSNNEFGSFSYDGYHVNDNAYEMNTFKTTTARVAQDFQY  281

Query  486  ----CQLAAPDDWFSNDVADSLWNIDESWQYRKLE  578
                CQ AA   W SND A ++WN DE WQ+ KL+
Sbjct  282  PVGDCQTAAT-GWLSNDFACTMWNTDELWQFSKLQ  315



>ref|XP_010099251.1| Transcription factor [Morus notabilis]
 gb|EXB77515.1| Transcription factor [Morus notabilis]
Length=327

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 81/220 (37%), Positives = 112/220 (51%), Gaps = 38/220 (17%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNSK+F+EAV+ FWMPRL++KMEQT +++TS+  S  
Sbjct  109  TDNEIKNYWRTRVQKQARQLNIESNSKRFLEAVRCFWMPRLLQKMEQTSNSSTSTNSSPS  168

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTL-QEPPKTDNSEN-------ENLN  338
            + ++ I + +  +  P + +P    T      SS  L  +P    N  N        N N
Sbjct  169  TLTTIIPSAQDCELVPNDFVPPNSTTFPALSDSSSILPNKPIPGSNHSNGCLNYAFTNQN  228

Query  339  ICSTDSF----------------------------QLHHDDDCYHVEIMGNSCYGGEEAF  434
            I STDS                              L H+ +   V  + +S YG  E  
Sbjct  229  ILSTDSIITSLFPQVEEHPKTYTFSNGIEKTDPISGLDHESNS-SVHYVDSSSYGF-EGL  286

Query  435  GHPAMSAFESRDISMLECQLAAPDDWFSNDVADSLWNIDE  554
               ++  FE+ D+S L C +A  D    +  AD+LWN+ E
Sbjct  287  NLDSILEFEAFDVSGLNCHVAESDWALGDMAADALWNMGE  326



>gb|AGN52122.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52232.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=232

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 87/193 (45%), Gaps = 75/193 (39%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQLK+D NS KF+EAV+ +WMPRL+EKMEQ             
Sbjct  110  TDNEIKNYWRTRVQKQARQLKLDCNSTKFLEAVRLYWMPRLLEKMEQ-------------  156

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSFQ  362
                           P +  P+  P+H  +LP                 ++ I ST    
Sbjct  157  ------------HKSPSSQTPNLAPSHNPFLP-----------------DMEIISTS---  184

Query  363  LHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAPDDWFSNDVA-DSL  539
                    H+   G   YG +E+  H                  AA  DWF  ++   S 
Sbjct  185  --------HLSFDG---YGMQESDCH------------------AADVDWFGEEIGMTSF  215

Query  540  WNIDESWQYRKLE  578
            WN DE WQ+RK++
Sbjct  216  WNSDELWQFRKVD  228



>ref|XP_007223176.1| hypothetical protein PRUPE_ppa009143mg [Prunus persica]
 gb|EMJ24375.1| hypothetical protein PRUPE_ppa009143mg [Prunus persica]
Length=305

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 110/207 (53%), Gaps = 33/207 (16%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNSK+F++AV+ FWMP L++KMEQ  S+++    +  
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIESNSKRFLDAVRCFWMPTLLQKMEQ--SSSSYLPTTLS  163

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSF-  359
            S +S+  ++    S P  SLP+  P+  + +        P   ++S   + +I S+DS  
Sbjct  164  SQNSASPSLSPNCSAPSISLPTSPPSKVSQI-----FDHPINGNSSSVTSPSIFSSDSLI  218

Query  360  -QL-----------HHDD-----------DCYHVEIMGNSCYGGEEAFGHPAMSAFESRD  470
             QL           H  D           DCY+V+      Y  E     PA SA    D
Sbjct  219  SQLPQTSERLTSPTHAFDHTVYSSSPALNDCYYVDTSSGYAYDMEGPNLDPA-SAICDFD  277

Query  471  ISMLECQLAAPDDWFSNDVADSLWNID  551
                +CQ+ A  DW  +++ D+LWN++
Sbjct  278  NQQFDCQMTA-GDWMLDNMTDTLWNME  303



>ref|XP_011007699.1| PREDICTED: transcription factor MYB24 [Populus euphratica]
Length=325

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 75/216 (35%), Positives = 113/216 (52%), Gaps = 28/216 (13%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRT+VQK+ARQL ++++S KF++AV+ FWMPRL++KMEQ   ++  + + S 
Sbjct  110  TDNEIKNYWRTKVQKEARQLNMEASSTKFLDAVRSFWMPRLLQKMEQASYSSYLTTLDSQ  169

Query  183  sss----ssistMEKQQSPPINSLPSPHPTHQTYL----PSSPTLQEP-----------P  305
            S +     S S+     S    SL  P      YL     +S ++  P           P
Sbjct  170  SQADHGVRSPSSNSPVPSSLSTSLCPPESRLAHYLNLGSENSSSVTSPHVLSANSDTISP  229

Query  306  KTDNSENENLNICSTDSF--QLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISM  479
            + +  EN   +    D+F   L   D CY       SCY  +    + A +   + D S 
Sbjct  230  QPEILENPTCSSLHGDTFYSNLILSDTCYEE----GSCY--DPVGFNQASAGMGTYDNSP  283

Query  480  LECQLAAPDDWFSNDVADSLWNIDESWQYRKLEDFG  587
            LECQ+A   +W  + + D+LW++D+ WQ+R L + G
Sbjct  284  LECQMAG-GNWVFDSMEDTLWDMDDMWQFRDLRETG  318



>ref|XP_002311464.2| hypothetical protein POPTR_0008s12130g [Populus trichocarpa]
 gb|EEE88831.2| hypothetical protein POPTR_0008s12130g [Populus trichocarpa]
Length=319

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 117/227 (52%), Gaps = 55/227 (24%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRT+VQK+ARQL I++NSK+F++AV+ +WMPRLI+K+EQ             
Sbjct  106  TDNEIKNYWRTKVQKEARQLNIEANSKRFLDAVRSYWMPRLIQKIEQ------------A  153

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKT-----DNSENENL----  335
            S SSS++T++      + S  S  P H     SSPTL  PP++      N  +EN     
Sbjct  154  SYSSSLTTLDSPADREVRSTSSNPPVHN----SSPTLLCPPESRFTHCSNPGSENSFSFT  209

Query  336  --NICSTDSFQLHHDDDCYHVEIMGN-SC-----------------YGGEEA-----FGH  440
               + ST+S  +    D    EI+ N SC                 Y  E +       +
Sbjct  210  SPYLLSTNSNTISQQPD----EILENPSCSPLLGDTVCNNLILSDTYNKEGSSYDMDVFN  265

Query  441  PAMSAFESRDISMLECQLAAPDDWFSNDVADSLWNIDESWQYRKLED  581
             A +   + D S LECQ+A   +W  + V D+LWN+D+ W +R L +
Sbjct  266  VASAGMGTHDNSPLECQVAE-GNWVFDSVEDTLWNMDDMWVFRDLRE  311



>ref|XP_011022276.1| PREDICTED: transcription factor MYB108 [Populus euphratica]
Length=314

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 76/226 (34%), Positives = 116/226 (51%), Gaps = 49/226 (22%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRT+VQK+ARQL I++NSK+F++AV+ +WMPRLI+K+EQ             
Sbjct  106  TDNEIKNYWRTKVQKEARQLNIEANSKRFLDAVRSYWMPRLIQKIEQ------------A  153

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTD-------NSENE----  329
            S SSS++T++      + S  S  P H     S PTL  PP++        +SEN     
Sbjct  154  SYSSSLTTLDSLADREVRSTSSNPPVHN----SLPTLLCPPESRFTHYSNPDSENSFSVT  209

Query  330  -------NLNICSTDSFQLHHDDDCYHV-------EIMGNSCYGGE------EAFGHPAM  449
                   N N      +++  +  C  +        ++ +  Y  E      + F + A 
Sbjct  210  SPYLLSTNSNTIPQQPYEILENPSCSPLPGDTVCNNLILSDTYNKEGSSYDIDGF-NVAS  268

Query  450  SAFESRDISMLECQLAAPDDWFSNDVADSLWNIDESWQYRKLEDFG  587
            +   + D S LECQ+A   +W  + + D+LWN+D+ W +R L + G
Sbjct  269  AGMGTHDNSPLECQVAE-GNWVFDSMEDTLWNMDDMWVFRDLRETG  313



>ref|XP_010264231.1| PREDICTED: transcription factor MYB108-like [Nelumbo nucifera]
Length=320

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 80/218 (37%), Positives = 114/218 (52%), Gaps = 31/218 (14%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQAR LKID+NS  F +A++ FWMPRL++KME++ S   +   S+P
Sbjct  106  TDNEIKNYWRTRVQKQARHLKIDANSMMFRDAIRCFWMPRLLQKMEESSSAMKTQNSSTP  165

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENL----NICST  350
             S+      +  Q+  +   P P P  +  L  S  +       NS   N     +I S+
Sbjct  166  PSTPLN---QTSQASALPPPPPPPPPLEGSLRISKAINSFDHEKNSNPGNYCTSPSIFSS  222

Query  351  DSFQ---------------LHHDDDCYHVEIMGNSCY----GGEEA--FGHPAMSAFESR  467
            DS                 LH+ D+  +   + +S Y    G  +   F   AMS     
Sbjct  223  DSMMSISKFPEISDYPATSLHNFDNSDYNPFLRSSFYVDNCGSYDMDDFNMSAMSVMGGY  282

Query  468  DISMLECQLAAPDDWFSNDVADSLWNIDESWQYRKLED  581
            + S  +C +A   +W  +D+A+S+WNIDE WQ+RKL+D
Sbjct  283  ETS--DCHMAE-SNWAYDDMAESIWNIDELWQFRKLQD  317



>ref|XP_002276526.3| PREDICTED: transcription factor MYB108 [Vitis vinifera]
Length=332

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 117/224 (52%), Gaps = 38/224 (17%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQAR LKIDSNS+ F + ++  WMPRL++K+E + ST++++   S 
Sbjct  110  TDNEIKNYWRTRVQKQARHLKIDSNSRAFQDVIRCVWMPRLLQKIEGSSSTSSTTSQVSI  169

Query  183  sssssistMEKQQS---PPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSEN-ENLNICST  350
               S      +Q S   PP     +P     +   +   L+   K  +SEN  + +ICS+
Sbjct  170  IPQSLNHADSQQHSAAAPPPVVAQAPVQGPLSINETINNLEHNEKNSSSENCTSPSICSS  229

Query  351  DS----------------FQLHHDDDCYHVEIMG-----NSCYGGEEAFGHPAMSA----  455
            +S                FQ   + D Y   + G     NS Y   E F   +MSA    
Sbjct  230  ESMNISQISQIPDYPTSPFQAMSNSDDYSTLLKGYYNVDNSNY-EMETFNLASMSAPQGD  288

Query  456  FES--RDISMLECQLAAPDDWFSNDVADSLWNIDESWQYRKLED  581
            FE+   D  M+E       +W  +D+ADSLWN+DE WQ+ KL++
Sbjct  289  FENPVGDCPMVE------SNWVDSDLADSLWNMDELWQFWKLQE  326



>ref|XP_009356946.1| PREDICTED: transcription factor MYB21-like [Pyrus x bretschneideri]
Length=298

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 81/219 (37%), Positives = 106/219 (48%), Gaps = 59/219 (27%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS++F++AV+ FW+P L++KMEQ             
Sbjct  101  TDNEIKNYWRTRVQKQARQLNIESNSEQFLDAVRGFWVPTLLQKMEQ------------S  148

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKT-----DN---SENENL-  335
            SSS S +    Q S    + P   P H    PS P    PP       DN   S N NL 
Sbjct  149  SSSCSSTLSTSQNS----AYPCLSPNHAA--PSVPLSTSPPSNATNMLDNYHISGNSNLA  202

Query  336  ----NICSTDSFQLH-----------------------HDDDCYHVEIMGNSCYGGEEAF  434
                NI S DSF  H                         D  Y+V+   +S Y  E   
Sbjct  203  TLPSNILSADSFSPHVPQMAEPSTSLPPASYRLGYSSLSPDGSYYVD---SSSYDVEGLS  259

Query  435  GHPAMSAFESRDISMLECQLAAPDDWFSNDVADSLWNID  551
              P +SA  +   S+ +CQ+   DDW  +++ D++WN+D
Sbjct  260  LDP-VSAMGNLGNSLFDCQMGG-DDWMLDNLTDNIWNMD  296



>emb|CBI15464.3| unnamed protein product [Vitis vinifera]
Length=328

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 117/224 (52%), Gaps = 38/224 (17%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQAR LKIDSNS+ F + ++  WMPRL++K+E + ST++++   S 
Sbjct  106  TDNEIKNYWRTRVQKQARHLKIDSNSRAFQDVIRCVWMPRLLQKIEGSSSTSSTTSQVSI  165

Query  183  sssssistMEKQQS---PPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSEN-ENLNICST  350
               S      +Q S   PP     +P     +   +   L+   K  +SEN  + +ICS+
Sbjct  166  IPQSLNHADSQQHSAAAPPPVVAQAPVQGPLSINETINNLEHNEKNSSSENCTSPSICSS  225

Query  351  DS----------------FQLHHDDDCYHVEIMG-----NSCYGGEEAFGHPAMSA----  455
            +S                FQ   + D Y   + G     NS Y   E F   +MSA    
Sbjct  226  ESMNISQISQIPDYPTSPFQAMSNSDDYSTLLKGYYNVDNSNY-EMETFNLASMSAPQGD  284

Query  456  FES--RDISMLECQLAAPDDWFSNDVADSLWNIDESWQYRKLED  581
            FE+   D  M+E       +W  +D+ADSLWN+DE WQ+ KL++
Sbjct  285  FENPVGDCPMVE------SNWVDSDLADSLWNMDELWQFWKLQE  322



>ref|XP_010415449.1| PREDICTED: myb-related protein 305 [Camelina sativa]
Length=289

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 107/198 (54%), Gaps = 25/198 (13%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS KF +AV+ FW+PRLIEKMEQ  STTT       
Sbjct  107  TDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFWVPRLIEKMEQNSSTTTYCCP---  163

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPK--TDNSENENLNICSTDS  356
                     +   +   NSL  P  +  + +    ++Q+  +  + N    N++  ST +
Sbjct  164  ---------QNNNNNNNNSLLLPSQSQDSMM----SIQKDTEFSSQNLSISNMDGSSTST  210

Query  357  FQLHHDDDCYHVEIMGNSCY---GGEEAFGH--PAMSAF-ESRDISMLECQLAAPDDWFS  518
            + + H  D  +  I+  S     G ++  G   P M  +  + DISM +C +A     + 
Sbjct  211  WTVPHFMDHNNTNIVDGSMSFHEGNDQELGGYVPGMEDYMRNSDISM-QCHVADGYSAYE  269

Query  519  NDVADSLWNIDESWQYRK  572
            +   D +WNID+ WQ+R+
Sbjct  270  DVTQDPMWNIDDIWQFRE  287



>emb|CDY54094.1| BnaC02g46060D [Brassica napus]
Length=285

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 108/196 (55%), Gaps = 24/196 (12%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS KF +AV+ FW+PRLIEKMEQ  S T     ++ 
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFWVPRLIEKMEQNPSNTYCCPQNNN  165

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSFQ  362
            ++++S+        PP  S  S   + QTY   S        TD S +   ++   D   
Sbjct  166  NNNNSLL-------PPSQSYDS--MSKQTYTDISGKNLGISNTDGSASSTTSM--PDLMT  214

Query  363  LHHDDDCYHVEIMGNS-CY---GGEEAFGH-PAMSAFESR--DISMLECQLAAPDDWFSN  521
            + H  D  H  I+ +S CY    G+E  G+ P M  +  R  DIS  +C +A     + +
Sbjct  215  VPHFMD--HNTIIDSSMCYHEGNGQELGGYIPGMEEYYMRNSDIST-DCHVAEA---YED  268

Query  522  DVADSLWNIDESWQYR  569
               D +WN+D+ WQ+R
Sbjct  269  VTQDPMWNVDDIWQFR  284



>ref|XP_008243255.1| PREDICTED: transcription factor MYB21 [Prunus mume]
Length=305

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 110/207 (53%), Gaps = 33/207 (16%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNSK+F++AV+ FWMP L++KMEQ  S+++    +  
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIESNSKRFLDAVRCFWMPTLLQKMEQ--SSSSYLPTTLS  163

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSF-  359
            S +S+  ++    S P  SL +  P+  + +      + P   ++S   + +I S+DS  
Sbjct  164  SQNSASPSLSPNCSAPSISLSTSPPSKVSQI-----FEHPINGNSSSVRSPSIFSSDSLI  218

Query  360  -QL-----------HHDD-----------DCYHVEIMGNSCYGGEEAFGHPAMSAFESRD  470
             QL           H  D           DCY+V+      Y  E     PA SA    +
Sbjct  219  SQLPQTSERLTSPTHAFDHTVYSSSPALNDCYYVDTSSGYAYDMEGLNLDPA-SAICDFN  277

Query  471  ISMLECQLAAPDDWFSNDVADSLWNID  551
                +CQ+ A  DW  +++ D+LWN++
Sbjct  278  NQQFDCQMTA-GDWMLDNMTDTLWNME  303



>ref|XP_010094742.1| Transcription factor [Morus notabilis]
 gb|EXB56907.1| Transcription factor [Morus notabilis]
Length=299

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 64/207 (31%), Positives = 102/207 (49%), Gaps = 37/207 (18%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQA+ LKID  S  F + ++RFWMPRLI+K+E +  + T+      
Sbjct  109  TDNEIKNYWRTRVQKQAKHLKIDIGSAAFQDIIRRFWMPRLIQKIEGSTFSGTAI-----  163

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPS----SPTLQEPPKTDNSENENLNICST  350
                        Q+ P    P    + Q++ P+    S + Q+      ++N ++N+   
Sbjct  164  ------------QNNPTAPTPIHIASQQSHSPTIAENSSSSQKVVSGHGNQNISINMSHI  211

Query  351  DSFQLHHD---------DDCYHVEIMGNSCYGGEE------AFGHPAMSAFESRDISMLE  485
              F  + +         ++ Y+   +    YGG++       F   ++SA       +  
Sbjct  212  SHFSEYPNSAFPQPMALNNDYNTTFVEGCSYGGDKNDYDMCVFNQTSVSADGVLQNPVGG  271

Query  486  CQLAAPDDWFSNDVADSLWNIDESWQY  566
            C +A   +W  ND++ S+WN+DE WQY
Sbjct  272  CHVAG-SNWAENDISASMWNMDELWQY  297



>emb|CDY01906.1| BnaC06g29460D [Brassica napus]
Length=285

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 102/198 (52%), Gaps = 26/198 (13%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS KF +AV+ FW+PRLIEKMEQ  STT +   +  
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFWVPRLIEKMEQNSSTTYACPQN--  163

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICST-DSF  359
                         +   +SL  P  T ++   S+ T Q+     N +  + +     D  
Sbjct  164  ---------NNNNNNNNSSLLPPSQTFESM--STQTYQDLSGLSNMDGSSSSSAFMPDLM  212

Query  360  QLHHDDDCYHVEIMGNSCYGGEEA-------FGHPAMSAFESRDISMLECQLAAPDDWFS  518
             + H  D   + I G+ CY  + A        G       E+ DIS  ECQ+A     + 
Sbjct  213  TVPHFMDPNTI-IDGSMCYHEDNAQELSGYILGTEEYYYMENSDIST-ECQVAEA---YE  267

Query  519  NDVADSLWNIDESWQYRK  572
            N   D +WN+D+ WQ+R+
Sbjct  268  NVTQDPMWNMDDIWQFRE  285



>ref|XP_008389270.1| PREDICTED: myb-related protein 305 [Malus domestica]
Length=296

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 105/214 (49%), Gaps = 51/214 (24%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS +F++AV+ FWMP L++KM+Q+  ++T S     
Sbjct  101  TDNEIKNYWRTRVQKQARQLNIESNSVQFLDAVRGFWMPILLQKMKQSSRSSTLSPS---  157

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDN---SENENL-----N  338
                     +   SP   SL   H      LP+SP        DN   S N NL     N
Sbjct  158  ---------QNSASP---SLSPNHTVPSVPLPTSPPGNVTNMFDNYHMSGNSNLATVPSN  205

Query  339  ICSTDSF-----QLHHD------------------DDCYHVEIMGNSCYGGEEAFGHPAM  449
            I S++S      Q+                     D  Y+V+   NS Y  E     P +
Sbjct  206  ILSSESLISQVPQMAEQSTSLYPAFDHIGYXSLSPDGSYYVD---NSSYDMEGLSLDP-V  261

Query  450  SAFESRDISMLECQLAAPDDWFSNDVADSLWNID  551
            SA  + D S  +CQ+   +DW  + + D+LWN+D
Sbjct  262  SAMGNYDNSQFDCQMVG-NDWVLDTITDNLWNMD  294



>ref|XP_002887176.1| hypothetical protein ARALYDRAFT_339072 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63435.1| hypothetical protein ARALYDRAFT_339072 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 101/197 (51%), Gaps = 27/197 (14%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtisttts------  164
            TDNEIKNYWRTRVQKQARQL I+SNS KF +AV+ FW+PRLIEKMEQ  STTT+      
Sbjct  107  TDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFWVPRLIEKMEQNSSTTTTYCCPQN  166

Query  165  sfisspsssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNIC  344
            +  S    S S  +M  Q+    +   +   +  T    S     P   D +   N NI 
Sbjct  167  NNNSLNLPSQSHDSMNMQKDIDYSGFSNIDGSSSTSTFMSHLTTVPHSMDQN---NTNII  223

Query  345  STDSFQLHHDDDCYHVEIMGNSCYGGEEAFGH-PAMSAF-ESRDISMLECQLAAPDDWFS  518
                        C+H    GN     +E  G+ P M  +  + DISM EC +A     + 
Sbjct  224  DVSM--------CFHE---GNV----QELGGYVPGMEDYMVNSDISM-ECHMADDYSAYE  267

Query  519  NDVADSLWNIDESWQYR  569
            +   D +WN+D+ WQ+R
Sbjct  268  DVTQDPMWNVDDIWQFR  284



>emb|CAN76459.1| hypothetical protein VITISV_010827 [Vitis vinifera]
Length=249

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQ  143
            TDNEIKNYWRTRVQKQARQLKI+S+SK+FI+AV+RFWMPRL++KMEQ
Sbjct  105  TDNEIKNYWRTRVQKQARQLKIESDSKRFIDAVRRFWMPRLLQKMEQ  151



>ref|XP_008797802.1| PREDICTED: transcription factor MYB108-like [Phoenix dactylifera]
Length=306

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 111/215 (52%), Gaps = 31/215 (14%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQLKID+NS  F +AV+ +WMPRL+E M    S+ +   +   
Sbjct  105  TDNEIKNYWRTRVQKQARQLKIDANSSMFRDAVRCYWMPRLLENM---GSSQSMPSLVDS  161

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDN------SENENL-NI  341
            +++++   ME+    P N   +P P H+ +   S +  EPP ++N      S +  L  +
Sbjct  162  NATTTAGMMEQTPHGPPNQFSNP-PMHRPF--ESCSSYEPPGSENHSPSTSSRSMALPQL  218

Query  342  CSTDSFQLHHDDDCYHVEI-------MGNSCYGGEEAFGHPAMSA----FESRDISMLEC  488
             +   F     D+   V           N+ YG +     P +SA    F   D +M   
Sbjct  219  PNLSEFSSGPPDNYSGVSFNPFMTGHFVNNSYGLDAMDLDPVVSAAQLGFSVSDYTM---  275

Query  489  QLAAPDDWFSNDVADSLWNIDESWQYRKLEDFGDL  593
                 D+   +++ D+LWN+DE W  RKL ++G +
Sbjct  276  ----ADNNCVDNIGDALWNMDELWYARKLNEWGGI  306



>ref|XP_009127621.1| PREDICTED: transcription factor MYB24-like [Brassica rapa]
Length=285

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 107/196 (55%), Gaps = 24/196 (12%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS KF +AV+ FW+PRLIEKMEQ  S T     ++ 
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFWVPRLIEKMEQNPSNTYCCPQNNN  165

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSFQ  362
            ++++S+        PP  S  S   + QTY   S        TD S + +  +   D   
Sbjct  166  NNNNSLL-------PPSQSYDS--MSKQTYTDISGKNPGISNTDGSASSSTFM--PDLMT  214

Query  363  LHHDDDCYHVEIMGNS-CY--GGEEAFGH--PAMSAFESR--DISMLECQLAAPDDWFSN  521
            + H  D  H  I+ +S CY  G ++  G   P M  +  R  DIS  +C +A     + +
Sbjct  215  VPHFMD--HNTIIDSSMCYHEGNDQELGGYIPGMEEYYMRNSDIST-DCHVAEA---YED  268

Query  522  DVADSLWNIDESWQYR  569
               D +WN+D+ WQ+R
Sbjct  269  VTQDPMWNVDDVWQFR  284



>ref|XP_002279433.1| PREDICTED: transcription factor MYB24 [Vitis vinifera]
Length=288

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQ  143
            TDNEIKNYWRTRVQKQARQLKI+S+SK+FI+AV+RFWMPRL++KMEQ
Sbjct  105  TDNEIKNYWRTRVQKQARQLKIESDSKRFIDAVRRFWMPRLLQKMEQ  151



>emb|CBI27001.3| unnamed protein product [Vitis vinifera]
Length=295

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQ  143
            TDNEIKNYWRTRVQKQARQLKI+S+SK+FI+AV+RFWMPRL++KMEQ
Sbjct  105  TDNEIKNYWRTRVQKQARQLKIESDSKRFIDAVRRFWMPRLLQKMEQ  151



>gb|EYU40768.1| hypothetical protein MIMGU_mgv1a023443mg, partial [Erythranthe 
guttata]
Length=235

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQ  143
            TDNEIKNYWRTRVQKQARQLKIDSNSKKF+EA++  WMPRL+EK+EQ
Sbjct  118  TDNEIKNYWRTRVQKQARQLKIDSNSKKFLEAIRMHWMPRLLEKIEQ  164



>gb|ADF43752.1| MYB [Camellia sinensis]
Length=310

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/215 (34%), Positives = 109/215 (51%), Gaps = 31/215 (14%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQAR LKID NS  F E ++ FWMPRLI+K+  + S ++     + 
Sbjct  106  TDNEIKNYWRTRVQKQARHLKIDPNSAAFQEVIRCFWMPRLIQKIRGSSSPSSVILSQNL  165

Query  183  sssss----istMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICST  350
            + +S      S++  Q SP  N   S    +  +   + +L+       S +E++NI   
Sbjct  166  AIASRPLINHSSLPPQVSPQENVYTSETTNNLDHHVKNSSLEHSTSPSVSSSESMNISHM  225

Query  351  DSFQLHHDDDCYHVEIMGNS----------CYGGE------EAFGHPAMSAFESRDISML  482
                       Y +E MGNS          CY  +      E F   ++  FE+   S+ 
Sbjct  226  TQV------SEYPIEAMGNSHDYNTFLKGGCYNVDNISYDMETFNISSVE-FEN---SIG  275

Query  483  ECQLAAPDDWFSNDVADSLWNIDESWQYRKLEDFG  587
             C ++   +W  N+  DS WN+DE WQ+++L++ G
Sbjct  276  GCHVSQ-SNWIDNEFGDSFWNMDELWQFKQLQERG  309



>ref|XP_002318546.1| hypothetical protein POPTR_0012s05200g [Populus trichocarpa]
 gb|EEE96766.1| hypothetical protein POPTR_0012s05200g [Populus trichocarpa]
Length=327

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/234 (30%), Positives = 109/234 (47%), Gaps = 62/234 (26%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQAR L+ID+NS  F + ++R WMPRL++K+  + +++++      
Sbjct  110  TDNEIKNYWRTRVQKQARHLRIDANSTAFQDIIRRSWMPRLLQKIGGSSTSSSAMTC---  166

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSS---PTLQEPP--------------KT  311
                        QSP ++ L   +    +  P++   P  QE P              +T
Sbjct  167  ------------QSPAVSQLIPNYAPQLSAFPTALPPPQQQEAPLDMSVMMHCMEHREQT  214

Query  312  DNSEN---------ENLNICSTDS--------FQLHHDD--------DCYHVEIMGNSCY  416
             +SE+         E++N+             FQ   ++        DCY+V+    S +
Sbjct  215  SDSEHGTSSCISSAESMNVSQMSHLSEYPKSPFQAMGNNGDYSTLVKDCYYVD----SNF  270

Query  417  GGEEAFGHPAMSAFESRDISMLECQLAAPDDWFSNDVADSLWNIDESWQYRKLE  578
               EA     MS      IS ++  +    DW   D  D++WN+DE WQ+R L+
Sbjct  271  YDMEAINLATMSVPGELGISAVDRHM-GDGDWAGYDFGDTVWNMDELWQFRNLQ  323



>gb|ACP30364.1| MYB protein [Malus hybrid cultivar]
Length=303

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 107/214 (50%), Gaps = 49/214 (23%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            T+NEIKNYWRTRVQKQARQL I+SNS++F++AV+ FW+P L++KMEQ          SS 
Sbjct  106  TNNEIKNYWRTRVQKQARQLNIESNSEQFLDAVRGFWVPTLLQKMEQ----------SSS  155

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDN---SENENL-----N  338
            S SS++ST +   SP    L   H      L +SP        DN   S N NL     N
Sbjct  156  SCSSTLSTSQNSASP---CLSPNHAALSVPLSTSPPSNATNVLDNYHISGNSNLATVPSN  212

Query  339  ICSTDSFQLH-----------------------HDDDCYHVEIMGNSCYGGEEAFGHPAM  449
            I S DSF  H                         D  ++V+   +S Y  E     P +
Sbjct  213  ILSADSFVSHVPQMAEPSTSFPPAYYRLGYSSLSPDGSHYVD---SSSYDVEGLSLDP-V  268

Query  450  SAFESRDISMLECQLAAPDDWFSNDVADSLWNID  551
            SA  +   S  +CQ+   +DW  ++V DSLWN+D
Sbjct  269  SAMGNLGNSQFDCQMGG-NDWMLDNVTDSLWNMD  301



>ref|XP_009105377.1| PREDICTED: transcription factor MYB24-like [Brassica rapa]
Length=284

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 107/198 (54%), Gaps = 27/198 (14%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS KF +AV+ FW+PRLIEKMEQ  S + +   ++ 
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFWVPRLIEKMEQNSSASYACPQNNN  165

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICST-DSF  359
            S++++ S +     PP  +  S          S+ T Q+     N +  + +     D  
Sbjct  166  SNNNNSSLL-----PPSQTFES---------MSTQTYQDLSGLSNMDGSSSSSAFMPDLM  211

Query  360  QLHHDDDCYHVEIMGNSCY---GGEEAFGH-PAMSAF---ESRDISMLECQLAAPDDWFS  518
             + H  D   + I G+ CY     +E  G+ P    +    + DIS  ECQ+A     + 
Sbjct  212  TVPHFMDPNTI-IDGSMCYHEDNAQELSGYIPGTEEYYYMGNSDIST-ECQVAEA---YE  266

Query  519  NDVADSLWNIDESWQYRK  572
            N   D +WN+D+ WQ+R+
Sbjct  267  NVTQDPMWNMDDIWQFRE  284



>ref|XP_010044254.1| PREDICTED: transcription factor MYB24-like [Eucalyptus grandis]
 gb|KCW86316.1| hypothetical protein EUGRSUZ_B03006 [Eucalyptus grandis]
Length=305

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/221 (30%), Positives = 103/221 (47%), Gaps = 56/221 (25%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+S+S++F++AV+  WMPRL++KMEQ  S+  ++     
Sbjct  108  TDNEIKNYWRTRVQKQARQLNIESDSERFLDAVRHIWMPRLLQKMEQASSSDQTT-----  162

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSFQ  362
                      +     +N   S  P H  Y PS+ +   P K   + N ++ +    S+ 
Sbjct  163  ----------RTSDMSMNCSVSASPVH--YPPSTSS---PSKLTQNSNSSMEVS---SYT  204

Query  363  LHHDDDCYHVEIMG-----------------------NSCYGGEEAFG---------HPA  446
            +   D   +  I G                       N    G+  FG         +  
Sbjct  205  MADADISPNFPITGQTPEIPEAFSNADVVGFGNSTAYNPLLAGDGYFGDGTSYDVNDYAT  264

Query  447  MSAFESRDISMLECQLAAPDDWFSNDVADSLWNIDESWQYR  569
            MSA  + +   L+  +    +W  +DVAD+ W +D+ W++R
Sbjct  265  MSALSACNGFPLQGHVEG-GNWAVDDVADACWTVDDIWKFR  304



>emb|CDY12705.1| BnaA02g13730D [Brassica napus]
Length=285

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 108/196 (55%), Gaps = 24/196 (12%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS +F +AV+ FW+PRLIEKMEQ  S T     ++ 
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIESNSDRFFDAVRSFWVPRLIEKMEQNPSNTYCCPQNNN  165

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSFQ  362
            ++++S+        PP  S  S   + QTY   S   + P  ++   + + +    D   
Sbjct  166  NNNNSLL-------PPSQSYDS--MSKQTYTDISG--KNPGISNTDVSASSSTFMPDLMT  214

Query  363  LHHDDDCYHVEIMGNS-CY--GGEEAFGH--PAMSAFESR--DISMLECQLAAPDDWFSN  521
            + H  D  H  I+ +S CY  G ++  G   P M  +  R  DIS  +C +A     + +
Sbjct  215  VPHFMD--HNTIIDSSMCYHEGNDQELGGYIPGMEEYYMRNSDIST-DCHVAEA---YED  268

Query  522  DVADSLWNIDESWQYR  569
               D +WN+D+ WQ+R
Sbjct  269  VTQDPMWNVDDIWQFR  284



>emb|CDX96033.1| BnaA07g26980D [Brassica napus]
Length=284

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 107/198 (54%), Gaps = 27/198 (14%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS KF +AV+ FW+PRLIEKMEQ  S + +   ++ 
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFWVPRLIEKMEQNSSASYACPQNNN  165

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICST-DSF  359
            S++++ S +     PP  +  S          S+ T Q+     N +  + +     D  
Sbjct  166  SNNNNSSLL-----PPSQTFES---------MSTQTYQDLSGLSNMDGSSSSSAFMPDLM  211

Query  360  QLHHDDDCYHVEIMGNSCY---GGEEAFGH-PAMSAF---ESRDISMLECQLAAPDDWFS  518
             + H  D   + I G+ CY     +E  G+ P    +    + DIS  ECQ+A     + 
Sbjct  212  TVPHFMDPNTI-IDGSMCYHEDNAQELSGYIPGTEEYYYMGNSDIST-ECQVAEA---YE  266

Query  519  NDVADSLWNIDESWQYRK  572
            N   D +WN+D+ WQ+R+
Sbjct  267  NVTQDPMWNMDDIWQFRE  284



>ref|XP_004497077.1| PREDICTED: transcription factor MYB21-like [Cicer arietinum]
Length=314

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 105/203 (52%), Gaps = 25/203 (12%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+S SK+FI+AVK FWMPRL++KMEQ  S ++    S  
Sbjct  115  TDNEIKNYWRTRVQKQARQLNIESGSKRFIDAVKCFWMPRLLQKMEQNTSPSSHHHSSIT  174

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENEN-LNICSTDSF  359
            ++ + ++++E   S    +  +      +       L      D+S +EN L+  S D F
Sbjct  175  TNMNFVNSIEASTSSMSTTSFNVPSMSPSSSHPQSGL----FIDSSSSENHLSNPSLDFF  230

Query  360  Q----LHHDDDCYHVEIMGNSCYG---------------GEEAFGHPAMSAFESRDISML  482
            Q    L   ++     ++ N+ Y                G E      +S+ E+ D S  
Sbjct  231  QFSQPLEISENSSAPNVLDNTVYSCPIQNNYNIDDTNNYGLEGLNFDPLSSMETYDFSQF  290

Query  483  ECQLAAPDDWFSNDVADSLWNID  551
            + Q +    W  +++A++LWN+D
Sbjct  291  DFQ-SGGSGWMLDNMANTLWNMD  312



>ref|XP_011045847.1| PREDICTED: myb-related protein Zm38-like [Populus euphratica]
Length=327

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 107/234 (46%), Gaps = 62/234 (26%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQAR L+ID+NS  F + ++R WMPRL++K+  + + +++      
Sbjct  110  TDNEIKNYWRTRVQKQARHLRIDANSTAFQDIIRRSWMPRLLQKIGGSSTFSSAMTC---  166

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSS---PTLQEPP--------------KT  311
                        QSP ++ L   +    +  P++   P  QE P              +T
Sbjct  167  ------------QSPAVSQLIPNYAPQLSAFPTALPPPQQQEAPLDMSVVMHCMEHREQT  214

Query  312  DNSENENLN-ICSTDSF---QLHH---------------------DDDCYHVEIMGNSCY  416
             +SE+   + I S +S    Q+ H                       DCY+V+    S +
Sbjct  215  SDSEHGTSSCISSAESMNVSQMSHLSEYPKSPYQAMGNNGDYSTLVKDCYYVD----SNF  270

Query  417  GGEEAFGHPAMSAFESRDISMLECQLAAPDDWFSNDVADSLWNIDESWQYRKLE  578
               EA     MS      IS ++  +    DW   D  D++WN+DE WQ+R L+
Sbjct  271  YDMEAINFATMSVPGELGISAVDRHM-GDGDWAGYDYGDTVWNMDELWQFRNLQ  323



>ref|XP_006301020.1| hypothetical protein CARUB_v10021411mg [Capsella rubella]
 gb|EOA33918.1| hypothetical protein CARUB_v10021411mg [Capsella rubella]
Length=291

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 106/197 (54%), Gaps = 22/197 (11%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS KF +AV+ FW+PRL+EKMEQ  STTT       
Sbjct  110  TDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFWVPRLMEKMEQNSSTTTYCC----  165

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSFQ  362
                       Q +   NSL  P  +  + + S+    +   + N    N++  ST ++ 
Sbjct  166  ----------PQSNNNNNSLLLPSQSQDSMMSSTIQKDKDFSSQNLSLSNMDSSSTSTWA  215

Query  363  LHHDDDCYHVEIMGNS-CY--GGEEAFGHPAMSAFE----SRDISMLECQLAAPDDWFSN  521
            + H  D  +  I+ +S C+  G ++  G       E    + DISM EC +A     + +
Sbjct  216  VPHFMDHNNTNIIDSSMCFHQGNDQELGGYVPIGMENYLGNSDISM-ECHVADGYSTYED  274

Query  522  DVADSLWNIDESWQYRK  572
               D +WN+D+ WQ+R+
Sbjct  275  VTQDPMWNMDDIWQFRE  291



>ref|XP_010916405.1| PREDICTED: transcription factor MYB21-like [Elaeis guineensis]
Length=309

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 67/212 (32%), Positives = 102/212 (48%), Gaps = 22/212 (10%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQLKID+NS  F +A++ +WMPRL+EKM  + S  + +  ++ 
Sbjct  105  TDNEIKNYWRTRVQKQARQLKIDANSAMFRDAIRCYWMPRLLEKMGSSQSMPSLTDSNAT  164

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLP-SSPTLQEPPKTDNSENENLNICSTDSF  359
            +++ ++  M     PP    P  +P    Y P    +  +PP ++N         S+ S 
Sbjct  165  TTAGTMEQMITPHGPP---QPFSNPAMHYYYPFEGCSSYDPPGSENHS----PTTSSASM  217

Query  360  QLHHDDDCYHVEIMGNSCYGGEE----AFGH-----PAMSAFESRDISMLECQLAAPDDW  512
             L    +           Y G        GH       + A +   +S  +   +  D  
Sbjct  218  PLPQLPNLSEFSSGPPDNYSGASFNPFTSGHCVDNSYGLDAMDLDPVSATQLGFSVSDYT  277

Query  513  FSN-----DVADSLWNIDESWQYRKLEDFGDL  593
              N     ++ D LWN++E W  RKL ++G +
Sbjct  278  MGNNNCVDNLGDGLWNMNELWYVRKLNEWGGI  309



>ref|NP_001280981.1| transcription factor MYB21 [Malus domestica]
 gb|AAZ20430.1| MYB7 [Malus domestica]
Length=298

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 108/219 (49%), Gaps = 59/219 (27%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            T NEIKNYWRTRVQKQARQL I+SNS++F++AV+ FW+P L++KMEQ          SS 
Sbjct  101  TGNEIKNYWRTRVQKQARQLNIESNSEQFLDAVRGFWVPTLLQKMEQ----------SSS  150

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKT-----DN---SENENL-  335
            S SS++ST +   SP ++      P H    PS P    PP       DN   S N NL 
Sbjct  151  SCSSTLSTSQNSASPCLS------PNHAA--PSVPLSTSPPSNATNVLDNYHISGNSNLA  202

Query  336  ----NICSTDSFQLH-----------------------HDDDCYHVEIMGNSCYGGEEAF  434
                NI S DSF  H                         D  ++V+   +S Y  E   
Sbjct  203  TVPSNILSADSFVSHVPQMAEPSTSFPPAYYRLGYSSLSPDGSHYVD---SSSYDVEGLS  259

Query  435  GHPAMSAFESRDISMLECQLAAPDDWFSNDVADSLWNID  551
              P +S   +   S  +CQ+   +DW  ++V DSLWN+D
Sbjct  260  LDP-VSPMGNLGNSQFDCQMGG-NDWMLDNVTDSLWNMD  296



>emb|CDX84981.1| BnaC05g20740D [Brassica napus]
Length=288

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 103/201 (51%), Gaps = 26/201 (13%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL IDS+S +F+EAV+ FW+PRLI KM+   +T T +     
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIDSSSHQFLEAVRSFWVPRLIHKMKDNSNTNTKTPHPDS  165

Query  183  sssssistMEKQQSPPINSL-PSPHPTHQTYLPSSPTLQEPPKTDNSENENL-NICSTDS  356
                           P++SL P  H +    +  S ++ +   T  S+  +L ++ +T+S
Sbjct  166  LG-------------PVDSLGPVSHDSGFNNMGCSTSMSKELTTKMSQFMDLSDLETTNS  212

Query  357  FQLHH----DDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAPDDWFSND  524
              L       + C   +     C   EE +  P M    S  +   +C +A  D  +  D
Sbjct  213  MSLKGSRGSSNQCVSEDYCSLPCL--EEEYMVPTMG--NSDILPFKDCHVA--DSSYEED  266

Query  525  VA-DSLWNIDESWQYRKLEDF  584
            V  DS+WN+D+ WQ+ +   F
Sbjct  267  VTQDSMWNMDDIWQFEEYAHF  287



>emb|CCC14989.1| Myb transcription factor [Humulus lupulus]
Length=365

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQ  143
            TDNEIKNYWRTRVQKQARQL I+SNS+  +EAV+RFWMPRL++KMEQ
Sbjct  103  TDNEIKNYWRTRVQKQARQLNIESNSRTLLEAVRRFWMPRLLQKMEQ  149



>ref|XP_009356251.1| PREDICTED: transcription factor MYB108-like [Pyrus x bretschneideri]
Length=296

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 73/210 (35%), Positives = 98/210 (47%), Gaps = 43/210 (20%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS +F++AV+ FWMP L++KM+Q+  ++T S     
Sbjct  101  TDNEIKNYWRTRVQKQARQLNIESNSVQFLDAVRGFWMPILLQKMKQSSCSSTLSPS---  157

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDN---SENENL-----N  338
                     +   SP   SL   H      LP+SP        DN   S   NL     N
Sbjct  158  ---------QNSASP---SLSPNHTVPSVPLPTSPPGNVTNMFDNYHMSGTSNLATVPSN  205

Query  339  ICSTDSF------QLHHDDDCY----HVEIMGNSCYGGE---------EAFGHPAMSAFE  461
            I S++S               Y    H+   G S  G           E      +S   
Sbjct  206  ILSSESLISQVPQMAEQSTSLYPAFDHIGYGGLSPDGSYYVDSSSYDMEGLNLDPVSGMG  265

Query  462  SRDISMLECQLAAPDDWFSNDVADSLWNID  551
            + D S  +CQ+   +DW  + + D+LWN+D
Sbjct  266  NYDNSQFDCQMVG-NDWMLDTITDNLWNMD  294



>ref|XP_011011974.1| PREDICTED: myb-related protein Myb4-like [Populus euphratica]
 ref|XP_011013824.1| PREDICTED: myb-related protein Myb4-like [Populus euphratica]
Length=329

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 101/216 (47%), Gaps = 26/216 (12%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQAR LKID+NS  F   ++ FWMPRL++K+  + +++++     P
Sbjct  112  TDNEIKNYWRTRVQKQARHLKIDANSTAFQNIIRWFWMPRLLQKIGGSSTSSSAMPSQRP  171

Query  183  sssssistMEKQQS------PPINSLPSP----------HPTHQTY---LPSSPTLQEPP  305
            + S        Q S      PP+    +P           P  QT    L +S  +    
Sbjct  172  AVSQPNLIYAPQLSTFPPALPPVQQQEAPLDMSVTMHCLEPHEQTSDSELGTSSCISSAE  231

Query  306  KTDNSENENLNICSTDSFQLHHDDDCYHVEIMG-----NSCYGGEEAFGHPAMSAFESRD  470
              + S+   L+   T +FQ       Y   + G     ++CY   EA     M       
Sbjct  232  SMNVSQMSQLSEYPTSNFQAMGSSSEYSTLVKGCYYVDSNCY-DMEAINLATMPVPGELG  290

Query  471  ISMLECQLAAPDDWFSNDVADSLWNIDESWQYRKLE  578
            IS  +  +    DW   D  D++WN+DE WQ+R L+
Sbjct  291  ISAGDRHI-EDGDWGEYDFGDTMWNMDELWQFRNLQ  325



>ref|NP_001235789.1| MYB transcription factor MYB84 [Glycine max]
 gb|ABH02839.1| MYB transcription factor MYB84 [Glycine max]
 gb|KHN21571.1| Transcription factor MYB21 [Glycine soja]
Length=317

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 105/228 (46%), Gaps = 52/228 (23%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTR+QKQAR LKID++S++F E V+RFWMPRL++K ++             
Sbjct  105  TDNEIKNYWRTRIQKQARHLKIDTDSREFQELVRRFWMPRLLQKAKE-------------  151

Query  183  sssssistMEKQQSP-PINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSF  359
             SSSS  +++ Q +P P + + S H T  T    S T  + P  + +    ++    +S 
Sbjct  152  -SSSSAMSIQNQATPMPFDGV-SQHSTVGTIPSHSHTPWQGPCMNEAGPTYMDQHEQNSD  209

Query  360  QLHHDDDC-----------------------YHV---EIMGNSCYGGEEA---------F  434
              H++  C                       YH       G   Y G            F
Sbjct  210  SEHNNGSCISLSESANFPKVPQHFGRTTITQYHALNNNDFGTFTYDGYNVSNNVYEMDNF  269

Query  435  GHPAMSAFESRDISMLECQLAAPDDWFSNDVADSLWNIDESWQYRKLE  578
              P     E       +CQ+    +W ++D A ++WN+DE WQ+ KL+
Sbjct  270  KTPTTRVAEDAQYPTGDCQMVG-SNWVNSDFACNMWNMDELWQFSKLQ  316



>ref|XP_007142925.1| hypothetical protein PHAVU_007G028700g [Phaseolus vulgaris]
 gb|ESW14919.1| hypothetical protein PHAVU_007G028700g [Phaseolus vulgaris]
Length=305

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 101/204 (50%), Gaps = 27/204 (13%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+S SK+FI+AVK FWMPRL++KMEQ  S +  S ++S 
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIESGSKRFIDAVKCFWMPRLLQKMEQNNSPSPHSSMTSM  165

Query  183  sssssistMEKQQSPPINSLP---SPHPTHQTYLPSSP----TLQEP--PKTDNSENENL  335
             +  +        +    ++P   S  P  + ++        T+  P  P  D+     L
Sbjct  166  MNLGNSGEASMSSTSSSFNIPSMFSSSPPQREFIMDGANHFSTMSNPINPSPDSFPFSQL  225

Query  336  -----------NICSTDSFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISML  482
                       N+   + +     D+CY      ++   G EA     +SAF + D    
Sbjct  226  LEISEHPKSPPNVLENNVYSYPIQDNCY-----ADTNNYGMEALNMDPLSAFGTYDFPQF  280

Query  483  ECQLAAPDDWFSNDVAD-SLWNID  551
            + Q A  + W  + + D +LWN+D
Sbjct  281  DFQTAG-NGWMLDSMEDTTLWNMD  303



>gb|KFK41242.1| hypothetical protein AALP_AA2G104300 [Arabis alpina]
Length=287

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 101/192 (53%), Gaps = 14/192 (7%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS KF +AV+ FW+PRLIEKMEQ  S+TT+      
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFWVPRLIEKMEQNSSSTTNYCCPQN  165

Query  183  sssssistMEKQQSPPINSLPSPH-PTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSF  359
             ++++  ++     PP  S  S    T+  +   +  L     + +S     ++ +   F
Sbjct  166  INTNNNDSL----LPPSQSHDSKSIQTYTDFSGQNICLSNIDGSTSSSTFMSDLTTVPHF  221

Query  360  QLHHDDDCYHVEIMGNSCY--GGEEAFGHPAMSAFESRDISMLECQLAAPDDWFSNDVAD  533
              H++         G+ C+  G ++  G   +   E   +   EC +A     + +   D
Sbjct  222  MDHNN------FTDGSLCFHEGYDQELG-GYIPGMEDDYMGNQECHVADGYSVYEDVTQD  274

Query  534  SLWNIDESWQYR  569
             +WN+D+ WQ+R
Sbjct  275  PMWNMDDIWQFR  286



>ref|XP_004299054.1| PREDICTED: transcription factor WER-like [Fragaria vesca subsp. 
vesca]
Length=283

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/195 (37%), Positives = 98/195 (50%), Gaps = 34/195 (17%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNS++F++AV+ FWMP L +KMEQT  +   S   S 
Sbjct  107  TDNEIKNYWRTRVQKQARQLNIESNSQRFLDAVRCFWMPTLRQKMEQTSLSLDPSPSPSS  166

Query  183  sssssistMEKQQ------------SPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSEN  326
              +S IS                  S   NS PS +   ++ +   P + E P + +   
Sbjct  167  YLTSHISAAPTPPPPSKMVSHVSDYSLIGNSCPSHNSPSESLISQLPQIPEQPASSSYAF  226

Query  327  ENLNICSTDSFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAPD  506
            E LN    DS+ + +D        MG              +S   S D S  +CQ+    
Sbjct  227  EALN----DSYYVDYD--------MG--------GLVLDPVSEMASFDASQFDCQM-TES  265

Query  507  DWFSND-VADSLWNI  548
            DW SN+ + D+LWN+
Sbjct  266  DWMSNNYMTDTLWNM  280



>gb|KHN11407.1| Transcription factor MYB21 [Glycine soja]
Length=307

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQ  143
            TDNEIKNYWRTRVQKQARQL I+S SK+FI+AVK FWMPRL++KMEQ
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIESGSKRFIDAVKCFWMPRLLQKMEQ  152



>ref|XP_009105051.1| PREDICTED: transcription factor MYB21-like [Brassica rapa]
Length=282

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQ  143
            TDNEIKNYWRTRVQKQARQL I+SNS KF +AV+ FW+PRLIEKMEQ
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFWVPRLIEKMEQ  152



>emb|CDY69953.1| BnaAnng32120D [Brassica napus]
Length=282

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQ  143
            TDNEIKNYWRTRVQKQARQL I+SNS KF +AV+ FW+PRLIEKMEQ
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFWVPRLIEKMEQ  152



>emb|CDY69488.1| BnaCnng63810D [Brassica napus]
Length=277

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQ  143
            TDNEIKNYWRTRVQKQARQL I+SNS KF +AV+ FW+PRLIEKMEQ
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFWVPRLIEKMEQ  152



>ref|XP_002321477.2| hypothetical protein POPTR_0015s03770g [Populus trichocarpa]
 gb|EEF05604.2| hypothetical protein POPTR_0015s03770g [Populus trichocarpa]
Length=332

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 70/222 (32%), Positives = 108/222 (49%), Gaps = 35/222 (16%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQAR LKID+NS  F   ++ FWMPRL++K+  + +++++     P
Sbjct  112  TDNEIKNYWRTRVQKQARHLKIDANSTAFQNIIRWFWMPRLLQKIGGSSTSSSAMPSQRP  171

Query  183  sssssist---------------MEKQQSPPINSLPSPH---PTHQTY---LPSSPTLQE  299
            +  S  +                + +QQ  P++   + H   P  QT    L +S  +  
Sbjct  172  AVVSQPNLNYAPQFSTFPPALPPLVQQQEAPLDMSVTMHYLEPHEQTSDSELGTSSCISS  231

Query  300  PPKTDNSENENLNICSTDSFQLHHDD---------DCYHVEIMGNSCYGGEEAFGHPAMS  452
                + S+   L+   T  FQ   ++          CY+V+   ++CY   EA     M 
Sbjct  232  AESMNVSQMSQLSEYPTSPFQAIGNNSSEYSTLAKGCYYVD---SNCY-DMEAINLATMP  287

Query  453  AFESRDISMLECQLAAPDDWFSNDVADSLWNIDESWQYRKLE  578
                  IS  +  +    DW + D  D++WN+DE WQ+R L+
Sbjct  288  VPGELGISAGDRHM-EDGDWGAYDFGDTMWNMDELWQFRNLQ  328



>ref|XP_003535723.1| PREDICTED: transcription factor MYB108-like [Glycine max]
 gb|KHN05558.1| Transcription factor MYB21 [Glycine soja]
Length=308

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQ  143
            TDNEIKNYWRTR+QKQARQL I+S SK+FI+AVK FWMPRL++KMEQ
Sbjct  106  TDNEIKNYWRTRIQKQARQLNIESGSKRFIDAVKCFWMPRLLQKMEQ  152



>emb|CDY58600.1| BnaA07g36950D [Brassica napus]
Length=323

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 66/213 (31%), Positives = 97/213 (46%), Gaps = 52/213 (24%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL IDS+S +F+E V+ FW+PRLI KM+   +T         
Sbjct  143  TDNEIKNYWRTRVQKQARQLNIDSSSHQFLEVVRSFWVPRLIHKMKDYSNT---------  193

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICST----  350
                        ++PP +SL              P +Q+   + NS   N++ CST    
Sbjct  194  ----------NSKAPPTDSL-------------GPVVQDNNFSHNSGLNNID-CSTSMSQ  229

Query  351  DSFQLHHDDDCYHVEIMGNSCYGGEEAFGHP-------------AMSAFESRDISMLE-C  488
            D  ++    D   +E   + C  G     +               ++   + DI  L+ C
Sbjct  230  DLAKISQLMDLSDLETTNSMCLEGSRGSSNQYVNEDHRCLEEEYIVTTMGNSDILPLQDC  289

Query  489  QLAAPDDWFSNDVA-DSLWNIDESWQYRKLEDF  584
             +      +  DV  D +WN+D+ WQ+ +   F
Sbjct  290  HVGVAYSTYEEDVTQDPMWNMDDIWQFEEYAPF  322



>gb|ADG56766.1| putative MYB transcription factor [Rosa rugosa]
Length=299

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 101/191 (53%), Gaps = 10/191 (5%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL I+SNSK+F++AV+ FWMP L +KMEQT S +     SS 
Sbjct  107  TDNEIKNYWRTRVQKQARQLNIESNSKRFLDAVRCFWMPTLRQKMEQTSSLSLDPPSSSS  166

Query  183  sssssistM-----EKQQSPPINSLPSPHPTHQTYLPS--SPTLQEPPKTDNSENENLNI  341
            S S+ +++          SP   S+PS  P+      S  SP     P  ++  +++L I
Sbjct  167  SHSNYLTSQISIAPSLSTSPQTCSVPSSPPSKVVSHVSDYSPIGTSSPSHNSLSSDSL-I  225

Query  342  CSTDSFQLHHDDDCYHVEIMGNSCYGGE--EAFGHPAMSAFESRDISMLECQLAAPDDWF  515
                          Y  E + ++ Y     E F    +S   + D S  +CQ+A  D   
Sbjct  226  SQLPQITEQPASSSYAFEALNDNYYVDYDMEGFSLDPVSEMATFDTSQFDCQMAESDWIP  285

Query  516  SNDVADSLWNI  548
            SN + D+LWN+
Sbjct  286  SNYMTDTLWNM  296



>ref|XP_006391151.1| hypothetical protein EUTSA_v10018962mg [Eutrema salsugineum]
 gb|ESQ28437.1| hypothetical protein EUTSA_v10018962mg [Eutrema salsugineum]
Length=287

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQ  143
            TDNEIKNYWRTRVQKQARQL I+SNS KF +AV+ FW+PRL+EKMEQ
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFWVPRLMEKMEQ  152



>ref|XP_007036545.1| Myb domain protein 62, putative [Theobroma cacao]
 gb|EOY21046.1| Myb domain protein 62, putative [Theobroma cacao]
Length=311

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 67/212 (32%), Positives = 101/212 (48%), Gaps = 29/212 (14%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQAR LK+D+NS  F   ++ +W+PRL++KME + S ++ +  +S 
Sbjct  107  TDNEIKNYWRTRVQKQARHLKVDANSTAFQNVIRCYWIPRLLQKMEGSSSFSSMASENST  166

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENL---------  335
               S     + Q    +  +P   P + +    +   QE     NS++E+          
Sbjct  167  VPQSLDQASQHQALMTLQQVPGQGPGNLSEAVQNLDHQE----QNSDSEHCASSCVSSSE  222

Query  336  ---NICSTDSFQLHHDDDCYHVEIMGNS---------CYGGEEAFGHPAMSAFESRDISM  479
               NI     F  +         I+GN+         CY   EA    + SA       +
Sbjct  223  SMNNISQISQFAEYQTSP---FRIIGNNDYNNTLAKDCYYDMEAINLASTSAPGDFANPV  279

Query  480  LECQLAAPDDWFSNDVADSLWNIDESWQYRKL  575
             +C +   ++WFSN  AD LW++ E W+ R L
Sbjct  280  GDCHM-PENNWFSNGFADDLWSMGELWELRNL  310



>ref|XP_003555909.1| PREDICTED: transcription factor MYB108-like [Glycine max]
Length=307

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQARQL I+S SK+FI+AVK FWMPRL++KME
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIESGSKRFIDAVKCFWMPRLLQKME  151



>ref|XP_010681493.1| PREDICTED: transcription factor MYB108 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=293

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 105/207 (51%), Gaps = 40/207 (19%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQA+QL ++ NS+ FIEA++ ++MPRL++K+EQ  +  TS      
Sbjct  110  TDNEIKNYWRTRVQKQAKQLNMECNSQSFIEAIRCYYMPRLVQKIEQNSADLTSLNTD--  167

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSS---------------PTLQEPPKTDN  317
                       Q +P  +S  +   T   ++ S                P  Q+ P +  
Sbjct  168  -----------QIAPVSHSYMASSSTKLEHINSESTKNTSSSNTSYSSIPEFQDLPTSST  216

Query  318  SENENLNICSTD-SFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQL  494
            S   +  + S + S  L+++  C     + +SC      +    +S   S++    EC +
Sbjct  217  SLAYDKAVKSKENSVLLNNNTHC----TINSSCNN----YDMDLISMTASKN-PFAECHV  267

Query  495  AAPDDWFSNDVA-DSLWNIDESWQYRK  572
               +DWF ND+A D++W++D  WQ+RK
Sbjct  268  E-ENDWFGNDMAGDAMWDMDALWQFRK  293



>ref|XP_010681494.1| PREDICTED: transcription factor MYB108 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=288

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 105/207 (51%), Gaps = 40/207 (19%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQA+QL ++ NS+ FIEA++ ++MPRL++K+EQ  +  TS      
Sbjct  105  TDNEIKNYWRTRVQKQAKQLNMECNSQSFIEAIRCYYMPRLVQKIEQNSADLTSLNTD--  162

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSS---------------PTLQEPPKTDN  317
                       Q +P  +S  +   T   ++ S                P  Q+ P +  
Sbjct  163  -----------QIAPVSHSYMASSSTKLEHINSESTKNTSSSNTSYSSIPEFQDLPTSST  211

Query  318  SENENLNICSTD-SFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQL  494
            S   +  + S + S  L+++  C     + +SC      +    +S   S++    EC +
Sbjct  212  SLAYDKAVKSKENSVLLNNNTHC----TINSSCNN----YDMDLISMTASKN-PFAECHV  262

Query  495  AAPDDWFSNDVA-DSLWNIDESWQYRK  572
               +DWF ND+A D++W++D  WQ+RK
Sbjct  263  E-ENDWFGNDMAGDAMWDMDALWQFRK  288



>gb|KHN16570.1| Transcription factor MYB21 [Glycine soja]
Length=312

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 71/222 (32%), Positives = 100/222 (45%), Gaps = 45/222 (20%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTR+QKQAR LKI ++S++F E V+RFWMPRL++K ++             
Sbjct  105  TDNEIKNYWRTRIQKQARHLKIYTDSREFQELVRRFWMPRLLQKAKE-------------  151

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLP--------SSPTL--QEPPKTDNSENEN  332
             SSSS  +++ Q  P      S H T  T  P        + PT   Q    +D+  N  
Sbjct  152  -SSSSNMSIQNQAIPMPFDYVSQHLTVGTIPPWQGPCMNEAGPTYMDQHEQNSDSEHNNG  210

Query  333  LNICSTDSFQL--------HHDDDCYH---VEIMGNSCYGGEEA---------FGHPAMS  452
              I  ++S  +        H     +H       G   Y G            F      
Sbjct  211  SCISLSESANIPKVPQHFGHTTITQFHALNTNDFGTFTYEGYNVNNNVYEMDNFKTTTTR  270

Query  453  AFESRDISMLECQLAAPDDWFSNDVADSLWNIDESWQYRKLE  578
              E     + +CQ+    +W  ND A ++WN+DE WQ+ KL+
Sbjct  271  VAEDAQYPIGDCQMVG-SNWVDNDFACNMWNMDELWQFSKLQ  311



>ref|XP_006584643.1| PREDICTED: MYB transcription factor MYB184 isoform X1 [Glycine 
max]
 gb|AFQ93673.1| Myb transcription factor [Glycine max]
Length=312

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 71/222 (32%), Positives = 101/222 (45%), Gaps = 45/222 (20%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTR+QKQAR LKI ++S++F E V+RFWMPRL++K ++             
Sbjct  105  TDNEIKNYWRTRIQKQARHLKIYTDSREFQELVRRFWMPRLLQKAKE-------------  151

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLP--------SSPTL--QEPPKTDNSENEN  332
             SSSS  +++ Q  P      S H T  T  P        + PT   Q    +D+  N  
Sbjct  152  -SSSSNMSIQNQAIPMPFDYVSQHLTVGTIPPWQGPCMNEAGPTYMDQHEQNSDSEHNNG  210

Query  333  LNICSTDSFQL--------HHDDDCYH---VEIMGNSCYGGEEA---------FGHPAMS  452
              I  ++S  +        H     +H       G   Y G            F      
Sbjct  211  SCISLSESANIPKVPQHFGHTTITQFHALNTNDFGTFTYEGYNVNNNVYEMDNFKTTTTW  270

Query  453  AFESRDISMLECQLAAPDDWFSNDVADSLWNIDESWQYRKLE  578
              E     + +CQ+    +W +ND A ++WN+DE WQ+ KL+
Sbjct  271  VAEDAQYPIGDCQMVG-SNWVNNDFACNMWNMDELWQFSKLQ  311



>gb|ADR63291.1| MYB146 [Gossypium hirsutum]
Length=292

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 92/201 (46%), Gaps = 43/201 (21%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL ID+NS  F   ++ +WMPRL++KM               
Sbjct  119  TDNEIKNYWRTRVQKQARQLNIDANSAAFKNILRYYWMPRLVQKM---------------  163

Query  183  sssssistMEKQQSPPINS---LPSPHPTHQT-YLPSSPTLQEPPKTDNSENENLNI---  341
                      K+ S P  S   +P   P  +T Y+  +  +      D+ +     I   
Sbjct  164  ----------KELSSPCFSTTVIPRNQPLMKTDYVDGNSCVSSLEHVDDMKMSQFGIFGS  213

Query  342  --CSTDSFQLHHDDDCY-HVEIMGNSCYGGEEAFGHPAMSAF--ESRDISMLECQLAAPD  506
              C++++       D Y +V   G+ C+ G E     + SA   E       +C L A D
Sbjct  214  NDCNSNALA----KDWYGYVGDNGSYCH-GMETINMASTSALVGEGFPTPAADCHL-ADD  267

Query  507  DWFSNDVADSLWNIDESWQYR  569
            +W  +   D +W++ E W+ R
Sbjct  268  NWVDDGFVDGIWSMGELWELR  288



>gb|ACU18510.1| unknown [Glycine max]
Length=312

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 71/222 (32%), Positives = 101/222 (45%), Gaps = 45/222 (20%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTR+QKQAR LKI ++S++F E V+RFWMPRL++K ++             
Sbjct  105  TDNEIKNYWRTRIQKQARHLKIYTDSREFQEPVRRFWMPRLLQKAKE-------------  151

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLP--------SSPTL--QEPPKTDNSENEN  332
             SSSS  +++ Q  P      S H T  T  P        + PT   Q    +D+  N  
Sbjct  152  -SSSSNMSIQNQAIPMPFDYVSQHLTVGTIPPWQGPCMNEAGPTYMDQHEQNSDSEHNNG  210

Query  333  LNICSTDSFQL--------HHDDDCYH---VEIMGNSCYGGEEA---------FGHPAMS  452
              I  ++S  +        H     +H       G   Y G            F      
Sbjct  211  SCISLSESANIPKVPQHFGHTTITQFHALNTNDFGTFTYEGYNVNNNVYEMDNFKTTTTW  270

Query  453  AFESRDISMLECQLAAPDDWFSNDVADSLWNIDESWQYRKLE  578
              E     + +CQ+    +W +ND A ++WN+DE WQ+ KL+
Sbjct  271  VAEDAQYPIGDCQMVG-SNWVNNDFACNMWNMDELWQFSKLQ  311



>gb|KFK44510.1| hypothetical protein AALP_AA1G266100 [Arabis alpina]
Length=285

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 67/208 (32%), Positives = 99/208 (48%), Gaps = 51/208 (25%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL IDSNS KF+EAV+  W+PRLI KM+   +T T+      
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIDSNSHKFLEAVRSLWVPRLIHKMKDNSNTNTT------  159

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSFQ  362
                       + SPP +SL +              L++   +  S   N++  ++ S  
Sbjct  160  -----------KASPP-DSLVA-------------VLRDKDVSHESGYNNIDCSTSMSQD  194

Query  363  LHHDDDCYHVEIMGNSCYGGEEAF----------------GHPAMSAFESRDI-SMLECQ  491
            LH   D   +E   +  + G +                  G   ++   + DI  M +C 
Sbjct  195  LHKFMDLSDLETTCSLNFDGSQGTSSQCVSEDYSSFPCLEGEYMVATMGNSDILQMQDCY  254

Query  492  LAAPDDWFSNDVA-DSLWNIDESWQYRK  572
            +A     +  DV  D +WN+D+ WQ+++
Sbjct  255  MAGST--YEEDVTQDPMWNMDDIWQFKE  280



>gb|ACU20373.1| unknown [Glycine max]
Length=317

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 70/228 (31%), Positives = 103/228 (45%), Gaps = 52/228 (23%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTR+QKQA  LKID++S++F E V+RFWMPRL++K ++             
Sbjct  105  TDNEIKNYWRTRIQKQAGHLKIDTDSREFQELVRRFWMPRLLQKAKE-------------  151

Query  183  sssssistMEKQQSP-PINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSF  359
             SSSS  +++ Q +P P + + S H T  T    S T  + P  + +    ++    +S 
Sbjct  152  -SSSSAMSIQNQATPMPFDGV-SQHSTVGTIPLHSHTPWQGPCMNEAGPTYMDQHEQNSD  209

Query  360  QLHHDDDC-----------------------YHV---EIMGNSCYGGEEA---------F  434
              H +  C                       YH       G   Y G            F
Sbjct  210  SEHDNGSCISLSESANFPKVPQHFGRTTITQYHALNNNDFGTFTYDGYNVSNNVYEMDNF  269

Query  435  GHPAMSAFESRDISMLECQLAAPDDWFSNDVADSLWNIDESWQYRKLE  578
              P     E       +CQ+    +W ++D A ++WN+DE WQ+ KL+
Sbjct  270  KTPTTRVAEDAQYPTGDCQMVG-SNWVNSDFACNMWNMDELWQFSKLQ  316



>gb|AGL81356.1| R2R3 MYB transcription factor 3, partial [Pyrus communis]
Length=227

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQ  143
            TDNEIKNYWRTRVQKQARQL I+SNS++F++AV+ FW+P L++KMEQ
Sbjct  101  TDNEIKNYWRTRVQKQARQLNIESNSEQFLDAVRGFWVPTLLQKMEQ  147



>ref|XP_006303509.1| hypothetical protein CARUB_v10010865mg [Capsella rubella]
 gb|EOA36407.1| hypothetical protein CARUB_v10010865mg [Capsella rubella]
Length=284

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDN+IKNYWRTRVQKQARQL IDSNS KF+E V+ FW+PRLI KM+
Sbjct  102  TDNDIKNYWRTRVQKQARQLNIDSNSHKFLEVVRSFWVPRLIHKMK  147



>ref|XP_010477944.1| PREDICTED: transcription factor MYB108-like isoform X1 [Camelina 
sativa]
Length=283

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDN+IKNYWRTRVQKQARQL IDSNS KF+E V+ FW+PRLI KM+
Sbjct  105  TDNDIKNYWRTRVQKQARQLNIDSNSHKFLEVVRSFWVPRLIHKMK  150



>ref|XP_010477945.1| PREDICTED: transcription factor MYB108-like isoform X2 [Camelina 
sativa]
Length=282

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDN+IKNYWRTRVQKQARQL IDSNS KF+E V+ FW+PRLI KM+
Sbjct  104  TDNDIKNYWRTRVQKQARQLNIDSNSHKFLEVVRSFWVPRLIHKMK  149



>gb|AIU39030.1| myb transcription factor 1 [Narcissus tazetta var. chinensis]
Length=272

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 89/200 (45%), Gaps = 33/200 (17%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQLKID+NS  F +A++ +WMPRL+EK+               
Sbjct  102  TDNEIKNYWRTRVQKQARQLKIDANSSTFQDAIRCYWMPRLLEKI---------------  146

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQ---EPPKTDNSENENLNICSTD  353
                  ++   Q + PIN      P+  + + S  T Q   EP    NS +   +  ++ 
Sbjct  147  ------ASTSNQSTQPIN------PSTASPILSQSTQQIHPEPQGYLNSGSSTSHCFNSG  194

Query  354  SFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAPDDWFSNDVAD  533
            S   H     Y         Y G        + A      SM E   ++P ++      D
Sbjct  195  SNTTHSG---YDFTQSAPCTYNGTPFQNSYDLDALNLAMTSMSEIGYSSPSEYMEEGSID  251

Query  534  SLWNIDESWQYRKLEDFGDL  593
              W+  E WQ +K  ++  +
Sbjct  252  EFWSQGELWQVKKQNEWSGI  271



>ref|XP_010499121.1| PREDICTED: myb-related protein 305-like [Camelina sativa]
Length=283

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDN+IKNYWRTRVQKQARQL IDSNS KF+E V+ FW+PRLI KM
Sbjct  104  TDNDIKNYWRTRVQKQARQLNIDSNSHKFLEVVRSFWVPRLIHKM  148



>ref|XP_009103061.1| PREDICTED: transcription factor MYB24-like [Brassica rapa]
Length=284

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 98/213 (46%), Gaps = 54/213 (25%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL IDS+S +F+E V+ FW+PRLI KM+   +T         
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIDSSSHQFLEVVRSFWVPRLIHKMKDYSNT---------  156

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICST----  350
                        ++PP +SL              P +Q+   + NS   N++ CST    
Sbjct  157  ----------NSKAPPTDSL-------------GPVVQDNNFSHNSGLNNID-CSTSMSQ  192

Query  351  DSFQLHHDDDCYHVEIMGNSCYGGEEAFGHP-------------AMSAFESRDISMLE-C  488
            D  ++    D   +E   + C  G     +               ++   + DI  L+ C
Sbjct  193  DLAKISQLMDLSDLETTNSMCLEGSRGSSNQYVNEDHRCLEEEYIVTTMGNSDILPLQDC  252

Query  489  QLAAPDDWFSNDVA-DSLWNIDESWQYRKLEDF  584
             +A     +  DV  D +WN+D+ WQ+ +   F
Sbjct  253  HVAYST--YEEDVTQDPMWNMDDIWQFEEYAPF  283



>emb|CDY03859.1| BnaC07g10840D [Brassica napus]
Length=287

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/222 (32%), Positives = 99/222 (45%), Gaps = 69/222 (31%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL IDS+S +F+E V+ FW+PRLI K++   +T         
Sbjct  106  TDNEIKNYWRTRVQKQARQLNIDSSSHQFLEVVRSFWVPRLIHKIKDNTNT---------  156

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNI----CST  350
                        ++PP +SL              P LQ     DN+ + NL +    CST
Sbjct  157  ----------NTRAPPTDSL-------------GPVLQ-----DNNFSHNLGLNNIDCST  188

Query  351  ----DSFQLHHDDDCYHVEIMGNSCYGG-------------------EEAFGHPAMSAFE  461
                D  ++    D   +E   + C  G                   EE +  P M    
Sbjct  189  SMSQDLAKISQLMDLSDLETTSSVCLEGSRGSSNQYVNEDSRYFHCLEEEYIFPTMG--N  246

Query  462  SRDISMLECQLAAPDDWFSNDVA-DSLWNIDESWQYRKLEDF  584
            S  + + +C +A  D  +  DV  D +WN+D+ W + +   F
Sbjct  247  SDILPLQDCHVA--DSTYEEDVTQDPMWNMDDIWHFEEYAPF  286



>emb|CDY42115.1| BnaA09g28450D [Brassica napus]
Length=277

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQARQL IDS+S +F+EAV+ FW+PRLI KM+
Sbjct  102  TDNEIKNYWRTRVQKQARQLNIDSSSHQFLEAVRSFWVPRLIHKMK  147



>ref|XP_009115302.1| PREDICTED: transcription factor MYB57 [Brassica rapa]
Length=277

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQARQL IDS+S +F+EAV+ FW+PRLI KM+
Sbjct  102  TDNEIKNYWRTRVQKQARQLNIDSSSHQFLEAVRSFWVPRLIHKMK  147



>ref|XP_004140978.1| PREDICTED: transcription factor MYB3-like [Cucumis sativus]
Length=279

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 98/195 (50%), Gaps = 35/195 (18%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRV+KQA+QL I+SNSKKF+E V+  W+PRL++KM+Q  S+  SS  S P
Sbjct  107  TDNEIKNYWRTRVEKQAKQLNIESNSKKFLETVRDLWIPRLLQKMDQKSSSPNSSNYSPP  166

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKT---------DNSENENL  335
             S         Q S   +S  +     QT + S     + P++         +NS+ + L
Sbjct  167  PSLEETFY---QNSCGSSSSEATIEAKQTSIQSCGGYYQWPESSERASEEFGNNSDVQPL  223

Query  336  NICSTDSFQLHHDDDCYHVE----IMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAP  503
            N  +   F LH D     ++    ++G +C G E                   + Q+AA 
Sbjct  224  NNNNNGEF-LHVDQLQIQLQHPFSLLGATCGGAE------------------FDGQMAAS  264

Query  504  DDWFSNDVADSLWNI  548
            D    +D ++SLWN 
Sbjct  265  DWVLQDDKSESLWNF  279



>dbj|BAB18296.1| putative dehydration-induced myb-related protein Cpm7 [Oryza 
sativa Japonica Group]
Length=341

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQARQLK+D+NS  F +AV+ +WMPRL+EKM
Sbjct  107  TDNEIKNYWRTRVQKQARQLKVDANSTVFRDAVRCYWMPRLLEKM  151



>ref|XP_004137477.1| PREDICTED: transcription factor MYB3-like [Cucumis sativus]
Length=288

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 86/188 (46%), Gaps = 13/188 (7%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQAR L ID+NS+ F + ++ +WMPRL++K+ Q+  +         
Sbjct  114  TDNEIKNYWRTRVQKQARHLNIDTNSEAFQQIIRSYWMPRLLQKINQSPPSELPITSPPE  173

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSFQ  362
             +S +    E     P  ++  P        P+   LQ       S   +  I    S+Q
Sbjct  174  MASQTSFGFEA----PTTAVTQP--------PAMTPLQIGGDLMGSSCTSSQITQISSYQ  221

Query  363  LHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAPDDWFSNDVADSLW  542
             + +   +  +   +  +GG E       +        +  C +A  ++W   D    + 
Sbjct  222  NYENYAPFVKDYCHDGGHGGGEMLNWTTTAVAGDSGYPVSHCHVAE-NNWMDGDFTGYMS  280

Query  543  NIDESWQY  566
            N+DE WQ+
Sbjct  281  NVDELWQF  288



>ref|XP_004160829.1| PREDICTED: transcription factor MYB3-like [Cucumis sativus]
 gb|KGN45977.1| hypothetical protein Csa_6G040640 [Cucumis sativus]
Length=286

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 98/195 (50%), Gaps = 35/195 (18%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRV+KQA+QL I+SNSKKF+E V+  W+PRL++KM+Q  S+  SS  S P
Sbjct  114  TDNEIKNYWRTRVEKQAKQLNIESNSKKFLETVRDLWIPRLLQKMDQKSSSPNSSNYSPP  173

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKT---------DNSENENL  335
             S         Q S   +S  +     QT + S     + P++         +NS+ + L
Sbjct  174  PSLEETFY---QNSCGSSSSEATIEAKQTSIQSCGGYYQWPESSERASEEFGNNSDVQPL  230

Query  336  NICSTDSFQLHHDDDCYHVE----IMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAP  503
            N  +   F LH D     ++    ++G +C G E                   + Q+AA 
Sbjct  231  NNNNNGEF-LHVDQLQIQLQHPFSLLGATCGGAE------------------FDGQMAAS  271

Query  504  DDWFSNDVADSLWNI  548
            D    +D ++SLWN 
Sbjct  272  DWVLQDDKSESLWNF  286



>gb|EEC69869.1| hypothetical protein OsI_00232 [Oryza sativa Indica Group]
Length=350

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQARQLK+D+NS  F +AV+ +WMPRL+EKM
Sbjct  116  TDNEIKNYWRTRVQKQARQLKVDANSTVFRDAVRCYWMPRLLEKM  160



>ref|XP_009380293.1| PREDICTED: myb-related protein P-like [Musa acuminata subsp. 
malaccensis]
Length=312

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQARQLK+D+NS  F +AV+ +WMPRL+EKM
Sbjct  104  TDNEIKNYWRTRVQKQARQLKVDANSAMFRDAVRCYWMPRLLEKM  148



>ref|NP_001041908.1| Os01g0128000 [Oryza sativa Japonica Group]
 dbj|BAF03822.1| Os01g0128000 [Oryza sativa Japonica Group]
 gb|EEE53799.1| hypothetical protein OsJ_00224 [Oryza sativa Japonica Group]
Length=350

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQARQLK+D+NS  F +AV+ +WMPRL+EKM
Sbjct  116  TDNEIKNYWRTRVQKQARQLKVDANSTVFRDAVRCYWMPRLLEKM  160



>ref|XP_006643700.1| PREDICTED: transcription repressor MYB4-like [Oryza brachyantha]
Length=358

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQARQLK+D+NS  F +AV+ +WMPRL+EKM
Sbjct  117  TDNEIKNYWRTRVQKQARQLKVDANSTVFRDAVRCYWMPRLLEKM  161



>ref|XP_006415860.1| hypothetical protein EUTSA_v10008403mg [Eutrema salsugineum]
 gb|ESQ34213.1| hypothetical protein EUTSA_v10008403mg [Eutrema salsugineum]
Length=284

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 70/208 (34%), Positives = 98/208 (47%), Gaps = 39/208 (19%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQL IDS+S KF+E V+ FW+PRLI K +    T         
Sbjct  101  TDNEIKNYWRTRVQKQARQLNIDSSSHKFLEVVRSFWVPRLIHKTKDNSDT---------  151

Query  183  sssssistMEKQQSPPINSLP--------SPHPTHQTYLPSSPTLQEPPKTDNSENENLN  338
                        ++PP +SL         S  P       S+   Q+  K   SE  +L+
Sbjct  152  ----------NTKAPPPDSLGPVIRDTDFSQEPGFNMDCSSTTMSQDLKKI--SEFMDLS  199

Query  339  ICSTDSFQLHHDDDCYHVEIMG----NSCYGGEEAFGHPAMSAFESRDISML-ECQLAAP  503
               T S  ++ D              +SC+   E  G   ++   + DI  L +C +A  
Sbjct  200  DLETSSSSMYLDGSRGSSSQSVSENYSSCFPCIE--GDYTVATMGNSDILPLHDCHIA--  255

Query  504  DDWFSNDVA-DSLWNIDESWQYRKLEDF  584
            D  +  DV  D +WN+D+ WQ+++   F
Sbjct  256  DSAYEEDVTQDPMWNMDDIWQFKEYAYF  283



>ref|XP_004165379.1| PREDICTED: transcription factor MYB3-like [Cucumis sativus]
Length=288

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 86/188 (46%), Gaps = 13/188 (7%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQAR L ID+NS+ F + ++ +WMPRL++K+ Q+  +         
Sbjct  114  TDNEIKNYWRTRVQKQARHLNIDTNSEAFQQIIRSYWMPRLLQKINQSPPSELPITSPPE  173

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDSFQ  362
             +S +    E     P  ++  P        P+   LQ       S   +  I    S+Q
Sbjct  174  MASQTSFCFEA----PTTAVTQP--------PAMTPLQIGGDLMGSSCTSSQITQISSYQ  221

Query  363  LHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAPDDWFSNDVADSLW  542
             + +   +  +   +  +GG E       +        +  C +A  ++W   D    + 
Sbjct  222  NYENYAPFVKDYCHDGGHGGGEMLNWTTTAVAGDSGYPVSHCHVAE-NNWMDGDFTGYMS  280

Query  543  NIDESWQY  566
            N+DE WQ+
Sbjct  281  NVDELWQF  288



>ref|XP_010926026.1| PREDICTED: myb-related protein 305-like isoform X2 [Elaeis guineensis]
Length=300

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 97/202 (48%), Gaps = 23/202 (11%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQLKID+NS  F +A++  WMPRL+EKM  + S       ++ 
Sbjct  99   TDNEIKNYWRTRVQKQARQLKIDANSATFRDAIRCSWMPRLLEKMGSSQSMPPLIDSNAT  158

Query  183  sssssistMEKQQSPPINSLPSPHPTHQ-------TYLPSSPTLQEPPKTDNSENENLNI  341
            +++  I        PP    P  +P  Q       +Y PSS +    P T ++      +
Sbjct  159  ATAGMIDQTPHGGRPP---QPFSNPAMQHPFENCSSYDPSS-SENHSPSTSSASMALPKL  214

Query  342  CSTDSFQLHHDDDCYHV----EIMGNSC-----YGGEEAFGHPAMSAFESRDISMLECQL  494
                 F   +  + YH       MG  C     YG +     PA ++     +S     +
Sbjct  215  PYLSEFS-SNPANSYHGFTFNPFMGGHCIDHSGYGLDTMDPAPASASQLGSSVSEYNYSM  273

Query  495  AAPDDWFSNDVADSLWNIDESW  560
            AA +    +++ D LWN+DE W
Sbjct  274  AANN--CVDNIGDGLWNMDELW  293



>ref|XP_004968076.1| PREDICTED: myb-related protein P-like [Setaria italica]
Length=359

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQARQL++D+NS  F +AV+ +WMPRL+EKM
Sbjct  112  TDNEIKNYWRTRVQKQARQLRVDANSAVFRDAVRCYWMPRLLEKM  156



>ref|XP_002455261.1| hypothetical protein SORBIDRAFT_03g007360 [Sorghum bicolor]
 gb|EES00381.1| hypothetical protein SORBIDRAFT_03g007360 [Sorghum bicolor]
Length=389

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQARQL++D+NS  F +AV+ +WMPRL+EKM
Sbjct  116  TDNEIKNYWRTRVQKQARQLRVDANSAVFRDAVRCYWMPRLLEKM  160



>ref|XP_010926024.1| PREDICTED: myb-related protein 305-like isoform X1 [Elaeis guineensis]
Length=304

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 97/202 (48%), Gaps = 23/202 (11%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQARQLKID+NS  F +A++  WMPRL+EKM  + S       ++ 
Sbjct  103  TDNEIKNYWRTRVQKQARQLKIDANSATFRDAIRCSWMPRLLEKMGSSQSMPPLIDSNAT  162

Query  183  sssssistMEKQQSPPINSLPSPHPTHQ-------TYLPSSPTLQEPPKTDNSENENLNI  341
            +++  I        PP    P  +P  Q       +Y PSS +    P T ++      +
Sbjct  163  ATAGMIDQTPHGGRPP---QPFSNPAMQHPFENCSSYDPSS-SENHSPSTSSASMALPKL  218

Query  342  CSTDSFQLHHDDDCYHV----EIMGNSC-----YGGEEAFGHPAMSAFESRDISMLECQL  494
                 F   +  + YH       MG  C     YG +     PA ++     +S     +
Sbjct  219  PYLSEFS-SNPANSYHGFTFNPFMGGHCIDHSGYGLDTMDPAPASASQLGSSVSEYNYSM  277

Query  495  AAPDDWFSNDVADSLWNIDESW  560
            AA +    +++ D LWN+DE W
Sbjct  278  AANN--CVDNIGDGLWNMDELW  297



>ref|NP_001031091.1| putative transcription factor (MYB116) [Arabidopsis thaliana]
 gb|AAG28818.1|AC079374_21 myb-related transcription factor (cpm7), putative [Arabidopsis 
thaliana]
 gb|AEE30609.1| putative transcription factor (MYB116) [Arabidopsis thaliana]
Length=278

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDN+IKNYWRTRVQKQARQL IDSNS KFIE V+ FW PRLI +++
Sbjct  101  TDNDIKNYWRTRVQKQARQLNIDSNSHKFIEVVRSFWFPRLINEIK  146



>gb|ABK28415.1| unknown [Arabidopsis thaliana]
Length=284

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDN+IKNYWRTRVQKQARQL IDSNS KFIE V+ FW PRLI +++
Sbjct  106  TDNDIKNYWRTRVQKQARQLNIDSNSHKFIEVVRSFWFPRLINEIK  151



>ref|NP_564230.1| putative transcription factor (MYB116) [Arabidopsis thaliana]
 gb|AAK25748.2|AF334815_1 putative transcription factor MYB116 [Arabidopsis thaliana]
 gb|AAS10028.1| MYB transcription factor [Arabidopsis thaliana]
 gb|ABE65655.1| myb family transcription factor [Arabidopsis thaliana]
 gb|AEE30608.1| putative transcription factor (MYB116) [Arabidopsis thaliana]
Length=283

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDN+IKNYWRTRVQKQARQL IDSNS KFIE V+ FW PRLI +++
Sbjct  106  TDNDIKNYWRTRVQKQARQLNIDSNSHKFIEVVRSFWFPRLINEIK  151



>ref|NP_001141174.1| MYB transcription factor [Zea mays]
 gb|ACF85620.1| unknown [Zea mays]
 gb|ADX60093.1| MYB transcription factor [Zea mays]
 gb|AFW79924.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=362

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQARQL++D+NS  F +AV+ +WMPRL+EKM
Sbjct  116  TDNEIKNYWRTRVQKQARQLRVDANSAVFRDAVRCYWMPRLLEKM  160



>ref|XP_009403972.1| PREDICTED: transcription factor MYB108-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=308

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQARQLK+D+NS KF +AV+ +WMPRL++K 
Sbjct  105  TDNEIKNYWRTRVQKQARQLKVDANSSKFRDAVRCYWMPRLLQKF  149



>ref|XP_008801769.1| PREDICTED: transcription factor RAX1-like [Phoenix dactylifera]
Length=235

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 89/191 (47%), Gaps = 35/191 (18%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQA+QL+ D NSKKF +A++  WMPRL+E++     ++        
Sbjct  69   TDNEIKNYWRTRVQKQAKQLQCDVNSKKFKDAMRYIWMPRLVERIRAASGSSL-------  121

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICS---TD  353
                       Q S P+   P+  P      P S +   P  +++S++   +  S   +D
Sbjct  122  -----------QASNPLPDCPTEQPGQAWPCPES-SASAPAGSNSSDSVVTHFSSPPASD  169

Query  354  SFQ--LHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAPDDWFSNDV  527
            SF    H+   C           GGE   G    + F   D    E +     D+     
Sbjct  170  SFTGDYHNYPGCIQ---------GGENKSGDGIQAGFAQLDGGWYENREMF--DFEQGGW  218

Query  528  ADSLWNIDESW  560
             ++LWN++++W
Sbjct  219  GENLWNLEDNW  229



>ref|XP_006485803.1| PREDICTED: transcription factor MYB108-like [Citrus sinensis]
Length=324

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 54/87 (62%), Gaps = 15/87 (17%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQAR LKID+NS  F E ++ FWMPRL++KM+              
Sbjct  109  TDNEIKNYWRTRVQKQARHLKIDANSTTFQEIIRCFWMPRLLQKMD--------------  154

Query  183  sssssistMEKQQSPPINSLPSPHPTH  263
             +SSS S     Q+P INS P  H  H
Sbjct  155  -TSSSSSPSALSQNPTINSQPFDHAFH  180



>ref|XP_006440994.1| hypothetical protein CICLE_v10021157mg [Citrus clementina]
 ref|XP_006440995.1| hypothetical protein CICLE_v10021157mg [Citrus clementina]
 gb|ESR54234.1| hypothetical protein CICLE_v10021157mg [Citrus clementina]
 gb|ESR54235.1| hypothetical protein CICLE_v10021157mg [Citrus clementina]
 gb|KDO57473.1| hypothetical protein CISIN_1g020603mg [Citrus sinensis]
Length=324

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 54/87 (62%), Gaps = 15/87 (17%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQAR LKID+NS  F E ++ FWMPRL++KM+              
Sbjct  109  TDNEIKNYWRTRVQKQARHLKIDANSTTFQEIIRCFWMPRLLQKMD--------------  154

Query  183  sssssistMEKQQSPPINSLPSPHPTH  263
             +SSS S     Q+P INS P  H  H
Sbjct  155  -TSSSSSPSALSQNPTINSQPFDHAFH  180



>ref|XP_009403971.1| PREDICTED: transcription factor MYB108-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=334

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQARQLK+D+NS KF +AV+ +WMPRL++K 
Sbjct  131  TDNEIKNYWRTRVQKQARQLKVDANSSKFRDAVRCYWMPRLLQKF  175



>gb|EPS73052.1| hypothetical protein M569_01708, partial [Genlisea aurea]
Length=140

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRF-WMPRLIEKMEQ  143
            TDNEIKNYWRTRVQKQAR+L+ DSNS +F+EA++R  WMP L+EKM Q
Sbjct  90   TDNEIKNYWRTRVQKQARRLQADSNSGEFLEAIRRLQWMPGLVEKMNQ  137



>emb|CDP19695.1| unnamed protein product [Coffea canephora]
Length=315

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 98/203 (48%), Gaps = 19/203 (9%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQt-----istttss  167
            TDNEIKNYWRTRVQKQAR LKIDSNS +F E V+R W+PRL++K++        S   + 
Sbjct  111  TDNEIKNYWRTRVQKQARHLKIDSNSSEFQELVRRVWIPRLLQKVQGNIAYWDSSEHDNL  170

Query  168  fisspsssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQE--------PPKTDNSE  323
                 + S+S++  + QQ P   S P  H  +      S             P  ++  E
Sbjct  171  AEIQAAVSNSMAAKQPQQVP--YSFPDSHQRNMISSSPSSMSSSESTNISPVPQFSEYIE  228

Query  324  NENLNICSTDSFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAP  503
            N   ++   +S+  H  ++CY+V+   ++ Y   E     A                 A 
Sbjct  229  NPFYDMAPNNSYG-HSQNECYNVD---STSYQDMENLSSAAPVTAMGGSTGPAGDNYCAQ  284

Query  504  DDWFSNDVADSLWNIDESWQYRK  572
            ++W S+D+   LWN+D+  Q ++
Sbjct  285  NNWLSDDLGYCLWNMDDLCQLKQ  307



>ref|XP_008807088.1| PREDICTED: transcription factor MYB108-like [Phoenix dactylifera]
Length=300

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQARQLKID+NS  F +A++  WMPRL+EKM
Sbjct  103  TDNEIKNYWRTRVQKQARQLKIDANSAMFRDAIRCSWMPRLLEKM  147



>ref|XP_009383607.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=309

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEK  134
            TDNEIKNYWRTRVQKQARQLKID+NS  F +A++ +WMPRL+EK
Sbjct  104  TDNEIKNYWRTRVQKQARQLKIDANSAMFRDAIRCYWMPRLLEK  147



>gb|KDP20133.1| hypothetical protein JCGZ_05902 [Jatropha curcas]
 gb|AIT52246.1| MYB family protein [Jatropha curcas]
Length=287

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQAR LK+D+NS+ F + ++ FWMPRLI+K+E
Sbjct  112  TDNEIKNYWRTRVQKQARHLKVDANSRAFQDIIRYFWMPRLIQKIE  157



>ref|XP_009390937.1| PREDICTED: myb-related protein 305-like [Musa acuminata subsp. 
malaccensis]
Length=279

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQARQLK+D+NS  F +AV+ +WMPRL+  M+
Sbjct  96   TDNEIKNYWRTRVQKQARQLKVDANSATFRDAVRCYWMPRLLANMD  141



>ref|XP_002534590.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF27793.1| DNA binding protein, putative [Ricinus communis]
Length=260

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQAR LKID+NS  F E V+ FW+PRL++K+E
Sbjct  114  TDNEIKNYWRTRVQKQARHLKIDANSTAFQEIVRCFWIPRLLQKIE  159



>emb|CDM80629.1| unnamed protein product [Triticum aestivum]
Length=335

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEK  134
            TDNEIKNYWRTRVQKQARQLK+D+NS  F +AV+ +WMPRL++K
Sbjct  101  TDNEIKNYWRTRVQKQARQLKVDANSAVFRDAVRCYWMPRLLDK  144



>gb|EMT11819.1| Transcription factor MYB21 [Aegilops tauschii]
Length=329

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEK  134
            TDNEIKNYWRTRVQKQARQLK+D+NS  F +AV+ +WMPRL++K
Sbjct  101  TDNEIKNYWRTRVQKQARQLKVDANSAVFRDAVRCYWMPRLLDK  144



>ref|XP_008445685.1| PREDICTED: transcription factor MYB108-like [Cucumis melo]
Length=275

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQ  143
            TDNEIKNYWRTRV+KQA+QL I+SNSKKF+E V+  W+P L++KM+Q
Sbjct  111  TDNEIKNYWRTRVEKQAKQLNIESNSKKFLETVRDLWIPMLLQKMDQ  157



>gb|EMS46598.1| Transcription factor MYB21 [Triticum urartu]
Length=346

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEK  134
            TDNEIKNYWRTRVQKQARQLK+D+NS  F +AV+ +WMPRL++K
Sbjct  118  TDNEIKNYWRTRVQKQARQLKVDANSAVFRDAVRCYWMPRLLDK  161



>ref|XP_010914654.1| PREDICTED: transcription factor MYB108-like [Elaeis guineensis]
Length=275

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QL+ D NSKKF +A++  WMPRLIE+++
Sbjct  108  TDNEIKNYWRTRVQKQAKQLQCDVNSKKFKDAMRYLWMPRLIERIQ  153



>ref|XP_008672180.1| PREDICTED: putative MYB DNA-binding domain superfamily protein 
isoform X1 [Zea mays]
 gb|ACN28126.1| unknown [Zea mays]
 tpg|DAA53655.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05070.1| MYB transcription factor, partial [Zea mays]
Length=362

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEK  134
            TDNEIKNYWRTRVQKQARQL++D+NS  F +AV+ +WMPRL+EK
Sbjct  113  TDNEIKNYWRTRVQKQARQLRVDANSAVFRDAVRCYWMPRLLEK  156



>ref|XP_002515235.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF47219.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=264

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QLK D NSK+F +A++  WMPRLIE+++
Sbjct  109  TDNEIKNYWRTRVQKQAKQLKCDVNSKQFRDAMRYIWMPRLIERIQ  154



>gb|ABH02893.1| MYB transcription factor MYB100 [Glycine max]
Length=163

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QLK D NSK+F +A++  WMPRL+E+++
Sbjct  66   TDNEIKNYWRTRVQKQAKQLKCDVNSKQFKDAMRYLWMPRLVERIQ  111



>ref|NP_001235837.1| MYB transcription factor MYB184 [Glycine max]
 gb|ABH02842.1| MYB transcription factor MYB184 [Glycine max]
Length=264

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQ  143
            TDNEIKNYWRTR+QKQAR LKI ++S++F E V+RFWMPRL++K ++
Sbjct  105  TDNEIKNYWRTRIQKQARHLKIYTDSREFQELVRRFWMPRLLQKAKE  151



>ref|XP_008381542.1| PREDICTED: transcription factor MYB108-like [Malus domestica]
Length=200

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQA+QLK D NSK+F +A++  W+PRLIE++
Sbjct  33   TDNEIKNYWRTRVQKQAKQLKCDVNSKQFQDAMRYVWIPRLIERI  77



>ref|XP_008461407.1| PREDICTED: transcription factor MYB108-like [Cucumis melo]
Length=280

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 78/149 (52%), Gaps = 8/149 (5%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQA+QL  D NSK+F +A++  WMPRL+E+++ +  +T ++     
Sbjct  113  TDNEIKNYWRTRVQKQAKQLNCDVNSKQFRDAMRYVWMPRLLERIQASTDSTATTVDVIQ  172

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPSS----PTLQEPPKTDNSENENL-NICS  347
             S   +     Q SP  +S  +PH    T    S      LQ  P +D  EN N+ +   
Sbjct  173  PSHPPLEL--TQSSPSGSSWVNPHVAPTTSSSDSIFDQVQLQVSPVSDVVENFNMVDTTE  230

Query  348  TDSFQLHHDDDCYHVEIMGNSCYGGEEAF  434
             D   +  +  C  VE   N   GGEE  
Sbjct  231  EDRVVMLMEHGC-DVEEAMNEWIGGEELL  258



>gb|KDO60685.1| hypothetical protein CISIN_1g0201971mg, partial [Citrus sinensis]
Length=262

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QLK D NSK+F + V+  WMPRLIE+++
Sbjct  129  TDNEIKNYWRTRVQKQAKQLKCDVNSKQFKDTVRYLWMPRLIERIQ  174



>ref|XP_006597689.1| PREDICTED: transcription factor MYB108 isoform X2 [Glycine max]
Length=330

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QLK D NSK+F +A++  WMPRL+E+++
Sbjct  102  TDNEIKNYWRTRVQKQAKQLKCDVNSKQFKDAMRYLWMPRLVERIQ  147



>ref|XP_003569075.1| PREDICTED: protein ODORANT1-like [Brachypodium distachyon]
Length=326

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQK ARQL+ D NS++F + V+  WMPRLIE+M
Sbjct  128  TDNEIKNYWRTRVQKHARQLRCDVNSRQFRDVVRLVWMPRLIERM  172



>ref|XP_003546301.1| PREDICTED: transcription factor MYB108 isoform X1 [Glycine max]
 gb|KHN14265.1| Myb-related protein 305 [Glycine soja]
Length=341

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QLK D NSK+F +A++  WMPRL+E+++
Sbjct  113  TDNEIKNYWRTRVQKQAKQLKCDVNSKQFKDAMRYLWMPRLVERIQ  158



>gb|AFM77857.1| myb domain protein [Hevea brasiliensis]
Length=314

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQAR LK+D+NS  F + +K FW+PRL++K+E
Sbjct  114  TDNEIKNYWRTRVQKQARHLKVDANSTAFQDIIKCFWIPRLLQKIE  159



>ref|XP_006466563.1| PREDICTED: protein ODORANT1-like [Citrus sinensis]
Length=361

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QLK D NSK+F + V+  WMPRLIE+++
Sbjct  239  TDNEIKNYWRTRVQKQAKQLKCDVNSKQFKDTVRYLWMPRLIERIQ  284



>ref|XP_010024826.1| PREDICTED: transcription factor MYB108-like [Eucalyptus grandis]
Length=343

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F +A+K  WMPRL+E+++
Sbjct  121  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDAMKYLWMPRLVERIQ  166



>ref|XP_004300516.1| PREDICTED: transcription factor TT2-like [Fragaria vesca subsp. 
vesca]
Length=284

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQAR LKID+NS +F   ++ FWMPRL++K+
Sbjct  107  TDNEIKNYWRTRVQKQARHLKIDTNSTEFQNIIRCFWMPRLLQKI  151



>emb|CAM58451.1| myb factor [Humulus lupulus]
Length=269

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QLK D NSK+F +A++  W+PRL+E+++
Sbjct  119  TDNEIKNYWRTRVQKQAKQLKCDVNSKQFQDAMRYVWIPRLVERIQ  164



>ref|XP_009367189.1| PREDICTED: transcription factor MYB108-like [Pyrus x bretschneideri]
Length=289

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQA+QLK D NSK+F +A++  W+PRLIE++
Sbjct  121  TDNEIKNYWRTRVQKQAKQLKCDVNSKQFQDAMRYIWIPRLIERI  165



>dbj|BAJ61447.1| R2R3-MYB transcription factor [Lupinus albus]
Length=250

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F +A++  WMPRL+E+++
Sbjct  43   TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDAMRYLWMPRLMERIQ  88



>ref|XP_009363103.1| PREDICTED: transcription factor MYB108 [Pyrus x bretschneideri]
Length=291

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQA+QLK D NSK+F +A++  W+PRLIE++
Sbjct  122  TDNEIKNYWRTRVQKQAKQLKCDVNSKQFQDAMRYVWIPRLIERI  166



>ref|XP_006341595.1| PREDICTED: myb-related protein 305-like [Solanum tuberosum]
Length=278

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQAR LKIDSNS  F E ++  W+PRL++K++
Sbjct  111  TDNEIKNYWRTRVQKQARNLKIDSNSAAFQEMIRSLWIPRLLQKIQ  156



>ref|XP_010094412.1| Myb-related protein 305 [Morus notabilis]
 gb|EXB55993.1| Myb-related protein 305 [Morus notabilis]
Length=290

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QLK D NSK+F +A++  W+PRL+E+++
Sbjct  113  TDNEIKNYWRTRVQKQAKQLKCDVNSKQFQDAMRYVWIPRLVERIQ  158



>gb|KDP28297.1| hypothetical protein JCGZ_14068 [Jatropha curcas]
 gb|AIT52244.1| MYB family protein [Jatropha curcas]
Length=271

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQA+QLK D NSK+F +A++  W+PRLIE++
Sbjct  110  TDNEIKNYWRTRVQKQAKQLKCDVNSKQFRDAMRYIWIPRLIERI  154



>emb|CAN66274.1| hypothetical protein VITISV_009676 [Vitis vinifera]
Length=243

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  93   TDNEIKNYWRTRVQKQAKQLKCDVNSKQFRDTMRYVWMPRLVERIK  138



>gb|ABX26092.1| myb-like transcription factor 5 [Gossypium hirsutum]
 gb|ABX26093.1| myb-like transcription factor 5 [Gossypium hirsutum]
Length=190

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQA+QL  D NSK+F +A++  W+PRL+E++
Sbjct  12   TDNEIKNYWRTRVQKQAKQLNCDVNSKQFKDAMRYVWIPRLVERI  56



>ref|XP_008227817.1| PREDICTED: transcription factor MYB108 [Prunus mume]
Length=298

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QLK D NSK+F +A++  W+PRLIE+++
Sbjct  126  TDNEIKNYWRTRVQKQAKQLKCDVNSKQFQDAMRYVWIPRLIERIQ  171



>gb|ABX26094.1| myb-like transcription factor 5 [Gossypium barbadense]
 gb|ABX26095.1| myb-like transcription factor 5 [Gossypium mustelinum]
 gb|ABX26096.1| myb-like transcription factor 5 [Gossypium tomentosum]
Length=190

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQA+QL  D NSK+F +A++  W+PRL+E++
Sbjct  12   TDNEIKNYWRTRVQKQAKQLNCDVNSKQFKDAMRYVWIPRLVERI  56



>ref|XP_008348686.1| PREDICTED: transcription factor MYB108-like [Malus domestica]
Length=289

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQA+QLK D NSK+F +A++  W+PRLIE++
Sbjct  122  TDNEIKNYWRTRVQKQAKQLKCDVNSKQFQDAMRYVWIPRLIERI  166



>emb|CBI36992.3| unnamed protein product [Vitis vinifera]
Length=272

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  93   TDNEIKNYWRTRVQKQAKQLKCDVNSKQFRDTMRYVWMPRLVERIK  138



>ref|XP_011100718.1| PREDICTED: transcription factor MYB108-like [Sesamum indicum]
Length=321

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 105/206 (51%), Gaps = 19/206 (9%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME------------Qt  146
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++              
Sbjct  119  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQAAAASSSGGGTTAA  178

Query  147  istttssfisspsssssistMEKQQSPPINSLPSPHPTHQTYLPSSPTLQEPPKTDNSEN  326
            +++++++  +   ++ + +T     S  IN+L  P+    T  P + +      +  +  
Sbjct  179  VASSSTNTSAYLFNNQNSTTTLDMGSSTINTLGQPN----TLTPENSSAAASSDSLGTPV  234

Query  327  ENLNICSTDSFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAPD  506
              L  C  +   ++++ D +      +  Y G+++   P  + + S+ +  +E      D
Sbjct  235  SELTECYNNYPVVNNNQDYFPGNQNMSYSY-GDQSLTSPTTAGYFSQGLEFMEQNSEWMD  293

Query  507  DWFSNDVADSLWNIDESWQYRKLEDF  584
               ++D  DSLWN+D+ W  ++ + F
Sbjct  294  G--ADDGLDSLWNVDDMWFLQQQQQF  317



>ref|XP_008343185.1| PREDICTED: transcription factor MYB108-like [Malus domestica]
Length=290

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQA+QLK D NSK+F +A++  W+PRLIE++
Sbjct  121  TDNEIKNYWRTRVQKQAKQLKCDVNSKQFQDAMRYVWIPRLIERI  165



>ref|XP_004136147.1| PREDICTED: transcription factor MYB75-like [Cucumis sativus]
 ref|XP_004169875.1| PREDICTED: transcription factor MYB75-like [Cucumis sativus]
Length=258

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 77/150 (51%), Gaps = 10/150 (7%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQA+QL  D NSK+F +A++  WMPRL+E+++   ++T S+     
Sbjct  91   TDNEIKNYWRTRVQKQAKQLNCDVNSKQFRDAMRYVWMPRLLERIQ---ASTDSTTTIVD  147

Query  183  sssssistMEKQQSPP-----INSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENL-NIC  344
                    +E  QS P     +N   +P  +    +     LQ  P +D +EN N+ +  
Sbjct  148  VIQPPHPPLELTQSSPSGSSWVNPHVAPTTSSSDSISDQVQLQVSPVSDMTENFNMVDKS  207

Query  345  STDSFQLHHDDDCYHVEIMGNSCYGGEEAF  434
              D   +  +  C   E M N   GG E  
Sbjct  208  EEDGMMMLMEHGC-DGEAMINEWIGGGEVL  236



>ref|XP_007209375.1| hypothetical protein PRUPE_ppa008877mg [Prunus persica]
 gb|EMJ10574.1| hypothetical protein PRUPE_ppa008877mg [Prunus persica]
Length=316

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQAR LK+D+NS +F   ++ FWMPRL++K+
Sbjct  108  TDNEIKNYWRTRVQKQARHLKVDTNSTEFQNIIRCFWMPRLLQKI  152



>ref|XP_008458430.1| PREDICTED: transcription factor MYB108-like [Cucumis melo]
Length=291

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQ  143
            TDNEIKNYWRTRVQKQAR L ID+NS+ F + ++ +W+PRLI+K+ Q
Sbjct  114  TDNEIKNYWRTRVQKQARHLNIDTNSEAFQQIIRSYWIPRLIQKINQ  160



>ref|XP_008240255.1| PREDICTED: transcription factor MYB108-like [Prunus mume]
Length=316

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQAR LK+D+NS +F   ++ FWMPRL++K+
Sbjct  108  TDNEIKNYWRTRVQKQARHLKVDTNSTEFQNIIRCFWMPRLLQKI  152



>ref|XP_007145122.1| hypothetical protein PHAVU_007G211900g [Phaseolus vulgaris]
 gb|ESW17116.1| hypothetical protein PHAVU_007G211900g [Phaseolus vulgaris]
Length=281

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRV KQA+QLK D NSK+F +AV+  WMPRL+E+++
Sbjct  117  TDNEIKNYWRTRVVKQAKQLKCDVNSKQFRDAVRFVWMPRLMERIQ  162



>gb|ABX26097.1| myb-like transcription factor 5 [Gossypium hirsutum]
 gb|ABX26098.1| myb-like transcription factor 5 [Gossypium hirsutum]
 gb|ABX26099.1| myb-like transcription factor 5 [Gossypium barbadense]
 gb|ABX26100.1| myb-like transcription factor 5 [Gossypium mustelinum]
 gb|ABX26101.1| myb-like transcription factor 5 [Gossypium tomentosum]
Length=190

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQA+QL  D NSK+F +A++  W+PRL+E++
Sbjct  12   TDNEIKNYWRTRVQKQAKQLNCDVNSKQFKDAMRYVWIPRLVERI  56



>ref|XP_007221521.1| hypothetical protein PRUPE_ppa015973mg [Prunus persica]
 gb|EMJ22720.1| hypothetical protein PRUPE_ppa015973mg [Prunus persica]
Length=298

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QLK D NSK+F +A++  W+PRLIE+++
Sbjct  126  TDNEIKNYWRTRVQKQAKQLKCDVNSKQFQDAMRYVWIPRLIERIQ  171



>ref|XP_010666321.1| PREDICTED: transcription factor MYB108-like [Beta vulgaris subsp. 
vulgaris]
Length=310

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 91/207 (44%), Gaps = 44/207 (21%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++              
Sbjct  114  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQAANGV---------  164

Query  183  sssssistMEKQQSPPINSLPSPHPTHQTYLPS---SPTLQEPPKTDNSENENLNICSTD  353
                       Q +   ++      T  T  P+   S      P   N   EN +  S++
Sbjct  165  -----------QPTATASTSGGSSITTATGRPAMGYSENFIHAPVNSNFTPEN-SANSSE  212

Query  354  SF--QLHHDDDCYHVEIMGNSC-----------YGGEEAFGHPAMS-------AFESRDI  473
            SF  Q+    D Y + +   S            YGG+ +   P  +       +F+S D 
Sbjct  213  SFGNQVSDFGDYYGIPVNNQSVSQDYFQGEQVGYGGDYSLTSPNCAYLNNQGMSFQSVDN  272

Query  474  SMLECQLAAPDDWFSNDVADSLWNIDE  554
             M +      D++   D  D+LWN+D+
Sbjct  273  VMDQNNQQQWDNFGLGDTTDNLWNVDD  299



>ref|XP_007147396.1| hypothetical protein PHAVU_006G120800g [Phaseolus vulgaris]
 gb|ESW19390.1| hypothetical protein PHAVU_006G120800g [Phaseolus vulgaris]
Length=329

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F +A++  WMPRL+E+++
Sbjct  111  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDAMRYLWMPRLVERIQ  156



>emb|CDP20749.1| unnamed protein product [Coffea canephora]
Length=286

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 99/199 (50%), Gaps = 22/199 (11%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME-----Qtistttss  167
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++        S+T + 
Sbjct  93   TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQAAAAAGANSSTAAR  152

Query  168  fisspsssssistMEKQQSPPINSLPSPH----PTHQTYLPSSPTLQEPPKTDNSENENL  335
              ++ ++++S S   +  +  +  + S      P   TY   S T Q  P +D      L
Sbjct  153  ATAATATTTSNSNYHQGNTSMVADVGSGGQVILPQASTYGGHSFTAQFSPVSD------L  206

Query  336  NICSTDSFQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLAAPDDWF  515
              C     +  ++ D Y         YG  E    P     ++ D  ++E   A  D   
Sbjct  207  TDCYNYPVKQSNNQDYYQAN--NQLSYG--ETLTSPTGYFNQALDFHLMEQNNAWMD---  259

Query  516  SNDVADSLWNIDESWQYRK  572
              DV+D+LWN +++W +++
Sbjct  260  GGDVSDNLWNDEDAWFFQQ  278



>gb|KCW61339.1| hypothetical protein EUGRSUZ_H04082 [Eucalyptus grandis]
Length=401

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F +A+K  WMPRL+E+++
Sbjct  92   TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDAMKYLWMPRLVERIQ  137



>gb|ACI16512.1| myb-like transcription factor Myb5 [Cucumis sativus]
Length=149

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QL  D NSK+F +A++  WMPRL+E+++
Sbjct  91   TDNEIKNYWRTRVQKQAKQLNCDVNSKQFRDAMRYVWMPRLLERIQ  136



>ref|XP_006654961.1| PREDICTED: transcription factor MYB108-like [Oryza brachyantha]
Length=277

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QL+ D NSK+F + V+  WMPRL+E+++
Sbjct  119  TDNEIKNYWRTRVQKHAKQLRCDVNSKQFRDVVRHVWMPRLVERIQ  164



>gb|KGN45040.1| hypothetical protein Csa_7G413890 [Cucumis sativus]
Length=276

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 77/150 (51%), Gaps = 10/150 (7%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQKQA+QL  D NSK+F +A++  WMPRL+E+++   ++T S+     
Sbjct  109  TDNEIKNYWRTRVQKQAKQLNCDVNSKQFRDAMRYVWMPRLLERIQ---ASTDSTTTIVD  165

Query  183  sssssistMEKQQSPP-----INSLPSPHPTHQTYLPSSPTLQEPPKTDNSENENL-NIC  344
                    +E  QS P     +N   +P  +    +     LQ  P +D +EN N+ +  
Sbjct  166  VIQPPHPPLELTQSSPSGSSWVNPHVAPTTSSSDSISDQVQLQVSPVSDMTENFNMVDKS  225

Query  345  STDSFQLHHDDDCYHVEIMGNSCYGGEEAF  434
              D   +  +  C   E M N   GG E  
Sbjct  226  EEDGMMMLMEHGC-DGEAMINEWIGGGEVL  254



>ref|XP_010045365.1| PREDICTED: transcription factor MYB108 [Eucalyptus grandis]
 gb|KCW87539.1| hypothetical protein EUGRSUZ_B03985 [Eucalyptus grandis]
Length=343

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F +A++  WMPRL+E+++
Sbjct  110  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDAMRYLWMPRLVERIQ  155



>ref|XP_004486524.1| PREDICTED: myb-related protein 330-like [Cicer arietinum]
Length=322

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F +A++  WMPRL+E+++
Sbjct  112  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDAMRYLWMPRLVERIQ  157



>ref|XP_003533124.1| PREDICTED: transcription factor MYB108-like [Glycine max]
Length=340

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F +A++  WMPRL+E+++
Sbjct  114  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDAMRYLWMPRLVERIQ  159



>gb|ABR28334.1| MYB transcription factor MYB39 [Medicago truncatula]
Length=329

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F +A++  WMPRL+E+++
Sbjct  112  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDAMRYLWMPRLVERIQ  157



>ref|XP_003594670.1| Myb-like transcription factor [Medicago truncatula]
 gb|AES64921.1| myb transcription factor [Medicago truncatula]
Length=329

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F +A++  WMPRL+E+++
Sbjct  112  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDAMRYLWMPRLVERIQ  157



>ref|XP_004150815.1| PREDICTED: transcription repressor MYB6-like [Cucumis sativus]
Length=263

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  111  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  156



>gb|AAC83631.1| putative transcription factor, partial [Arabidopsis thaliana]
Length=218

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NS++F + +K  WMPRL+E+++
Sbjct  25   TDNEIKNYWRTRVQKHAKQLKCDVNSQQFKDTMKYLWMPRLVERIQ  70



>ref|XP_004165513.1| PREDICTED: transcription repressor MYB6-like [Cucumis sativus]
Length=263

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  111  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  156



>ref|XP_008340570.1| PREDICTED: transcription factor MYB108 [Malus domestica]
Length=296

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  75   TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYIWMPRLVERIQ  120



>gb|EEE62225.1| hypothetical protein OsJ_17012 [Oryza sativa Japonica Group]
Length=310

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QL+ D NSK+F + V+  WMPRLIE+++
Sbjct  115  TDNEIKNYWRTRVQKHAKQLRCDVNSKEFRDVVRHVWMPRLIERIQ  160



>ref|XP_011071358.1| PREDICTED: transcription factor MYB108-like [Sesamum indicum]
Length=309

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/197 (28%), Positives = 99/197 (50%), Gaps = 22/197 (11%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++        +  +S 
Sbjct  113  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQA-------AAAASS  165

Query  183  sssssistMEKQQSPPI----NSLPSPHPTH----QTYLPSSPTLQEPPKTDNSENENLN  338
            +++++   +  Q S  +    N +  PHP +     TY P + +     ++  +    L 
Sbjct  166  TTATTTYHINNQNSSNLNMGQNQILLPHPNNIGGVHTYTPENSSAAASSESFGTPVSELT  225

Query  339  ICSTDSFQLHHDDDCYHVEIM--GNSCYGGEEAFGHPAMSAFESRDISMLECQLAAPDDW  512
             C  +   +H+ ++  + +     N    G+++   P      ++ +  +E       +W
Sbjct  226  ECYNNYPAVHNSNNQGNNQDYYPANQLSYGDQSLTSPTAGYNFNQGLDFME----QNSEW  281

Query  513  F-SNDVADSLWNIDESW  560
                D +D+LWN+D+ W
Sbjct  282  MEGGDGSDNLWNVDDMW  298



>ref|XP_008447462.1| PREDICTED: transcription factor MYB108 [Cucumis melo]
Length=228

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QL  D NS++F +A++  W+PRL+E++E
Sbjct  95   TDNEIKNYWRTRVQKQAKQLNCDVNSQRFRDAMRLVWIPRLVERIE  140



>ref|XP_004236420.2| PREDICTED: transcription factor MYB108-like [Solanum lycopersicum]
Length=280

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQAR LKIDSNS  F E ++  W+PRL++K+
Sbjct  111  TDNEIKNYWRTRVQKQARNLKIDSNSAAFQEMIRSLWIPRLLQKI  155



>ref|XP_009413670.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=249

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQARQ+K+D+NS  F +A++  W PRL+EK+
Sbjct  91   TDNEIKNYWRTRVQKQARQMKVDANSTMFRDALRCHWTPRLLEKI  135



>gb|KDO86883.1| hypothetical protein CISIN_1g043269mg, partial [Citrus sinensis]
Length=191

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F +A++  W+PRLIE+++
Sbjct  112  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFRDAMRFVWVPRLIERIQ  157



>gb|KHG22187.1| Myb-related protein [Gossypium arboreum]
Length=282

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  91   TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  136



>ref|XP_004164405.1| PREDICTED: transcription factor MYB21-like [Cucumis sativus]
 gb|KGN58125.1| hypothetical protein Csa_3G535090 [Cucumis sativus]
Length=224

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QL  D NS++F +A++  W+PRL+E++E
Sbjct  95   TDNEIKNYWRTRVQKQAKQLNCDVNSQRFRDAMRLVWIPRLVERIE  140



>ref|XP_003565287.1| PREDICTED: transcription factor MYB24-like [Brachypodium distachyon]
Length=276

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIE  131
            TDNEIKNYWRTRVQKQARQL +D+NS  F +AV+ +WMPRL++
Sbjct  106  TDNEIKNYWRTRVQKQARQLNVDANSPVFRDAVRCYWMPRLLD  148



>gb|KGN57183.1| hypothetical protein Csa_3G168940 [Cucumis sativus]
Length=305

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  111  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  156



>ref|XP_011027944.1| PREDICTED: transcription factor MYB108-like [Populus euphratica]
Length=312

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRLIE+++
Sbjct  115  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLIERIQ  160



>ref|XP_004150903.1| PREDICTED: transcription factor MYB12-like, partial [Cucumis 
sativus]
Length=232

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QL  D NS++F +A++  W+PRL+E++E
Sbjct  103  TDNEIKNYWRTRVQKQAKQLNCDVNSQRFRDAMRLVWIPRLVERIE  148



>emb|CBI22842.3| unnamed protein product [Vitis vinifera]
Length=306

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  108  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  153



>ref|XP_004295042.1| PREDICTED: uncharacterized protein LOC101295899 [Fragaria vesca 
subsp. vesca]
Length=340

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  117  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  162



>ref|XP_008438973.1| PREDICTED: transcription factor MYB108 [Cucumis melo]
Length=310

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  111  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  156



>ref|XP_004963430.1| PREDICTED: transcription repressor MYB5-like [Setaria italica]
Length=326

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QL+ D NS++F + V+  WMPRL+E+++
Sbjct  111  TDNEIKNYWRTRVQKHAKQLRCDVNSRQFRDVVRHVWMPRLVERIQ  156



>ref|XP_011010946.1| PREDICTED: transcription factor MYB108-like [Populus euphratica]
Length=315

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRLIE+++
Sbjct  115  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLIERIQ  160



>emb|CCA29096.1| putative MYB transcription factor [Rosa rugosa]
Length=343

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  115  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  160



>emb|CAN63179.1| hypothetical protein VITISV_029107 [Vitis vinifera]
Length=306

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  108  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  153



>ref|XP_007227100.1| hypothetical protein PRUPE_ppa025672mg [Prunus persica]
 gb|EMJ28299.1| hypothetical protein PRUPE_ppa025672mg [Prunus persica]
Length=343

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  123  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  168



>ref|NP_001267991.1| R2R3 transcription factor MYB108-like protein 1 [Vitis vinifera]
 gb|ACQ42220.1| R2R3 transcription factor MYB108-like protein 1 [Vitis vinifera]
Length=306

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  108  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  153



>ref|XP_002320278.2| putative MYB transcription factor family protein [Populus trichocarpa]
 gb|EEE98593.2| putative MYB transcription factor family protein [Populus trichocarpa]
Length=287

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QLK D NSK+F + ++  W+PRLIE+++
Sbjct  108  TDNEIKNYWRTRVQKQAKQLKCDVNSKQFRDTMRYAWIPRLIERIQ  153



>gb|EAY96442.1| hypothetical protein OsI_18339 [Oryza sativa Indica Group]
Length=311

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QL+ D NSK+F + V+  WMPRL+E+++
Sbjct  115  TDNEIKNYWRTRVQKHAKQLRCDVNSKEFRDVVRHVWMPRLVERIQ  160



>gb|AGN52033.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52143.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=261

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  109  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  154



>ref|XP_008390410.1| PREDICTED: transcription factor MYB108-like [Malus domestica]
Length=353

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  128  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  173



>ref|XP_009799771.1| PREDICTED: transcription factor MYB108-like [Nicotiana sylvestris]
Length=294

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRLIE+++
Sbjct  121  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTLRYLWMPRLIERIQ  166



>gb|KDO72049.1| hypothetical protein CISIN_1g019911mg [Citrus sinensis]
Length=334

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRLIE+++
Sbjct  116  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLIERIQ  161



>gb|EYU33077.1| hypothetical protein MIMGU_mgv1a010262mg [Erythranthe guttata]
Length=317

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  92   TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  137



>ref|XP_006488792.1| PREDICTED: transcription factor MYB108-like [Citrus sinensis]
Length=334

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRLIE+++
Sbjct  116  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLIERIQ  161



>ref|XP_011016230.1| PREDICTED: transcription factor MYB108-like [Populus euphratica]
Length=321

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRLIE+++
Sbjct  115  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLIERIQ  160



>ref|XP_009595257.1| PREDICTED: transcription factor MYB108-like [Nicotiana tomentosiformis]
Length=263

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRLIE+++
Sbjct  91   TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTLRYLWMPRLIERIQ  136



>ref|XP_002316060.2| hypothetical protein POPTR_0010s15970g [Populus trichocarpa]
 gb|EEF02231.2| hypothetical protein POPTR_0010s15970g [Populus trichocarpa]
Length=317

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRLIE+++
Sbjct  113  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLIERIQ  158



>ref|XP_006419304.1| hypothetical protein CICLE_v10005387mg [Citrus clementina]
 gb|ESR32544.1| hypothetical protein CICLE_v10005387mg [Citrus clementina]
Length=334

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRLIE+++
Sbjct  116  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLIERIQ  161



>ref|XP_010486159.1| PREDICTED: transcription factor MYB108-like [Camelina sativa]
Length=334

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK ARQLK D NS++F + +K  WMPRL+E+++
Sbjct  115  TDNEIKNYWRTRVQKHARQLKCDVNSQQFKDTMKYLWMPRLVERIQ  160



>gb|EPS64015.1| hypothetical protein M569_10766 [Genlisea aurea]
Length=282

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F +A++  W+PRL+EK++
Sbjct  107  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDAMRYLWIPRLMEKIQ  152



>ref|XP_009372081.1| PREDICTED: transcription factor MYB108 [Pyrus x bretschneideri]
Length=354

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  128  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  173



>gb|EAZ19253.1| hypothetical protein OsJ_34790 [Oryza sativa Japonica Group]
Length=184

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQK A+QL  D NSK+F +A+K  WMPRL E++
Sbjct  117  TDNEIKNYWRTRVQKHAKQLNCDVNSKRFKDAMKYLWMPRLAERI  161



>gb|EYU45477.1| hypothetical protein MIMGU_mgv1a009198mg [Erythranthe guttata]
Length=349

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  119  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  164



>ref|XP_007158818.1| hypothetical protein PHAVU_002G184600g [Phaseolus vulgaris]
 gb|ESW30812.1| hypothetical protein PHAVU_002G184600g [Phaseolus vulgaris]
Length=292

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  162  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  207



>ref|XP_008223427.1| PREDICTED: transcription factor MYB108 [Prunus mume]
Length=343

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  123  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  168



>ref|XP_009620712.1| PREDICTED: transcription factor MYB108-like [Nicotiana tomentosiformis]
Length=275

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  100  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTLRYLWMPRLVERIQ  145



>ref|XP_006663109.1| PREDICTED: transcription factor MYB108-like [Oryza brachyantha]
Length=296

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQK A+QL  D NSK+F +A+K  WMPRL+E++
Sbjct  120  TDNEIKNYWRTRVQKHAKQLNCDINSKRFKDAMKYLWMPRLVERI  164



>ref|XP_009621085.1| PREDICTED: transcription factor MYB108-like [Nicotiana tomentosiformis]
Length=315

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + +K  WMPRL+E+++
Sbjct  111  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMKYLWMPRLVERIQ  156



>ref|XP_010314657.1| PREDICTED: ABA-induced MYB transcription factor isoform X2 [Solanum 
lycopersicum]
Length=235

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  W+PRL+E++E
Sbjct  106  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTLRYLWIPRLVERIE  151



>gb|AAB58313.1| Cpm5 [Craterostigma plantagineum]
Length=333

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  115  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  160



>gb|AAM43912.1|AF510112_1 MYB transcription factor [Craterostigma plantagineum]
 gb|AAC13876.1| myb-related transcription factor Cpm10 [Craterostigma plantagineum]
Length=333

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  115  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  160



>gb|ABH02873.1| MYB transcription factor MYB111 [Glycine max]
Length=170

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRV KQA+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  48   TDNEIKNYWRTRVIKQAKQLKCDVNSKQFRDTLRYVWMPRLLERLQ  93



>ref|XP_009383942.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=262

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRLIE++ 
Sbjct  105  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDVMRYLWMPRLIERIR  150



>ref|XP_009591106.1| PREDICTED: transcription factor MYB57-like [Nicotiana tomentosiformis]
Length=293

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQAR LKIDSNS  F   ++  W+PRL++K++
Sbjct  110  TDNEIKNYWRTRVQKQARHLKIDSNSAAFQHMIRCLWIPRLLQKIQ  155



>gb|AAB58314.1| Cpm7 [Craterostigma plantagineum]
Length=335

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQ  143
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E++++
Sbjct  114  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQR  160



>ref|XP_007163206.1| hypothetical protein PHAVU_001G215100g [Phaseolus vulgaris]
 gb|ESW35200.1| hypothetical protein PHAVU_001G215100g [Phaseolus vulgaris]
Length=253

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 82/167 (49%), Gaps = 29/167 (17%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRV KQA+QLK D NSK+F + ++  WMPR++E+++   S++  +  +  
Sbjct  111  TDNEIKNYWRTRVVKQAKQLKCDVNSKQFRDTLRFVWMPRMLERIQAQASSSGQAQTTLT  170

Query  183  sssssistMEKQQSPPIN--SLPSPHPTHQTYLPSSPTLQEPPKTDNSENENLNICSTDS  356
            S         + QS P    +  + +P   +   S+  + E   +D+  + +L  C +  
Sbjct  171  SKV-------QAQSDPCGGATATASNPGLLSEASSAVDVHEASLSDSGASYSLMGCGS--  221

Query  357  FQLHHDDDCYHVEIMGNSCYGGEEAFGHPAMSAFESRDISMLECQLA  497
                             S YG EE +G   +  +   +I  L+ QLA
Sbjct  222  ----------------WSSYGAEEGYG--GVDLWTDENIWFLQQQLA  250



>ref|XP_010314656.1| PREDICTED: ABA-induced MYB transcription factor isoform X1 [Solanum 
lycopersicum]
Length=247

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  W+PRL+E++E
Sbjct  106  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFQDTLRYLWIPRLVERIE  151



>ref|XP_010546950.1| PREDICTED: transcription factor MYB108 [Tarenaya hassleriana]
Length=334

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  112  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  157



>ref|NP_001239915.1| uncharacterized protein LOC100791349 [Glycine max]
 gb|ACU18067.1| unknown [Glycine max]
 gb|KHN28197.1| Myb-related protein 305 [Glycine soja]
Length=325

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  109  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYIWMPRLVERIQ  154



>ref|XP_006349959.1| PREDICTED: myb-related protein 315-like [Solanum tuberosum]
Length=175

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  W+PRL+E+++
Sbjct  20   TDNEIKNYWRTRVQKHAKQLKCDVNSKQFQDTLRYLWIPRLVERIQ  65



>ref|NP_001267917.1| R2R3 transcription factor MYB108-like protein 2 [Vitis vinifera]
 gb|ACM46018.1| R2R3 transcription factor MYB108-like protein 2 [Vitis vinifera]
Length=286

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQKQA+QLK D NSK+F + ++  W+PRL+E+++
Sbjct  106  TDNEIKNYWRTRVQKQAKQLKCDVNSKQFRDTMRYVWIPRLVERIK  151



>ref|XP_003550902.1| PREDICTED: transcription factor MYB108 [Glycine max]
Length=322

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  109  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  154



>ref|XP_009390416.1| PREDICTED: transcription factor MYB57 [Musa acuminata subsp. 
malaccensis]
Length=292

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEK  134
            TDNEIKNYWRTRVQKQARQLKID++S  F +AV+ + MPRL+E+
Sbjct  108  TDNEIKNYWRTRVQKQARQLKIDADSTTFRDAVRCYLMPRLLER  151



>gb|KEH32365.1| myb transcription factor [Medicago truncatula]
Length=315

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  112  TDNEIKNYWRTRVQKLAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  157



>ref|XP_010558458.1| PREDICTED: transcription factor MYB108-like [Tarenaya hassleriana]
Length=341

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  115  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  160



>ref|XP_007051208.1| Myb domain protein 2, putative [Theobroma cacao]
 gb|EOX95365.1| Myb domain protein 2, putative [Theobroma cacao]
Length=297

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQA+QLK + NSK+F +A++  W+PRLIE++
Sbjct  109  TDNEIKNYWRTRVQKQAKQLKCEVNSKQFRDAMRYVWIPRLIERI  153



>ref|XP_004229031.1| PREDICTED: transcription factor MYB108-like [Solanum lycopersicum]
Length=287

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  113  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  158



>ref|XP_006337993.1| PREDICTED: myb-related protein 305-like [Solanum tuberosum]
Length=297

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  112  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLVERIQ  157



>ref|XP_006355725.1| PREDICTED: transcription factor MYB21-like [Solanum tuberosum]
Length=324

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 8/134 (6%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKMEQtistttssfissp  182
            TDNEIKNYWRTRVQK A+QLK D NSK+F + +K  WMPRL E+++ T + T++   +S 
Sbjct  127  TDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMKYLWMPRLAERIQATAAATSNPTAASS  186

Query  183  sssssistMEKQQSPPINSLPSPHPTHQT--YLPSSPTLQEPPKTDNSENENLNICSTDS  356
            S  ++ +T  + Q       P P+  H    YLP    L    KT NS N +    S+D+
Sbjct  187  SGPTATTTYIQNQEI---QHPLPNMNHHVPEYLPIQ--LMNIEKT-NSLNYSATSASSDN  240

Query  357  FQLHHDDDCYHVEI  398
            +     D CY+  I
Sbjct  241  YSSDLTDGCYNFPI  254



>ref|XP_011040784.1| PREDICTED: transcription factor MYB108-like [Populus euphratica]
Length=287

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQKQA+QLK D NSK+F + ++  W+PRLIE++
Sbjct  108  TDNEIKNYWRTRVQKQAKQLKCDVNSKQFRDTMRYAWIPRLIERI  152



>ref|XP_009612140.1| PREDICTED: transcription factor MYB108-like [Nicotiana tomentosiformis]
Length=295

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKME  140
            TDNEIKNYWRTRVQK A+QLK D NSK+F + ++  WMPRL+E+++
Sbjct  120  TDNEIKNYWRTRVQKHAKQLKCDMNSKQFKDTMRYLWMPRLVERIQ  165



>ref|XP_010461601.1| PREDICTED: myb-related protein 340 [Camelina sativa]
Length=271

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +3

Query  3    TDNEIKNYWRTRVQKQARQLKIDSNSKKFIEAVKRFWMPRLIEKM  137
            TDNEIKNYWRTRVQK A+ LK D NSK+F + +K +WMPRL+E++
Sbjct  149  TDNEIKNYWRTRVQKHAKLLKCDVNSKQFKDIIKHYWMPRLVERI  193



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2060434175780