BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15455_g1_i3 len=1016 path=[1073:0-512 1586:513-831 40:832-1015]

Length=1016
                                                                      Score     E

ref|XP_009777545.1|  PREDICTED: putative SNAP25 homologous protei...    335   1e-110   
ref|XP_009600214.1|  PREDICTED: putative SNAP25 homologous protei...    332   3e-109   
ref|XP_004239070.1|  PREDICTED: putative SNAP25 homologous protei...    330   2e-108   
ref|XP_011075579.1|  PREDICTED: putative SNAP25 homologous protei...    327   2e-107   
ref|XP_006348809.1|  PREDICTED: putative SNAP25 homologous protei...    323   4e-106   
gb|EYU28841.1|  hypothetical protein MIMGU_mgv1a011448mg                319   3e-104   
emb|CDP00411.1|  unnamed protein product                                309   3e-100   
gb|EPS65928.1|  hypothetical protein M569_08848                         305   6e-100   
ref|XP_008446422.1|  PREDICTED: putative SNAP25 homologous protei...    305   2e-98    
ref|XP_004135151.1|  PREDICTED: putative SNAP25 homologous protei...    305   3e-98    
ref|XP_010680731.1|  PREDICTED: putative SNAP25 homologous protei...    302   5e-98    
ref|NP_172842.1|  N-ethylmaleimide-sensitive factor adaptor prote...    302   1e-97    Arabidopsis thaliana [mouse-ear cress]
gb|KDP41280.1|  hypothetical protein JCGZ_15687                         301   1e-97    
ref|XP_006306393.1|  hypothetical protein CARUB_v10012302mg             301   2e-97    
ref|XP_010523484.1|  PREDICTED: putative SNAP25 homologous protei...    300   3e-97    
ref|XP_009356376.1|  PREDICTED: putative SNAP25 homologous protei...    300   5e-97    
ref|XP_008389414.1|  PREDICTED: putative SNAP25 homologous protei...    297   7e-96    
ref|XP_008361774.1|  PREDICTED: putative SNAP25 homologous protei...    296   1e-95    
ref|XP_011018220.1|  PREDICTED: putative SNAP25 homologous protei...    295   1e-94    
ref|XP_002890026.1|  synaptosomal-associated protein 30                 293   2e-94    
ref|XP_010527952.1|  PREDICTED: putative SNAP25 homologous protei...    293   3e-94    
ref|XP_004490150.1|  PREDICTED: putative SNAP25 homologous protei...    294   3e-94    
ref|XP_006438803.1|  hypothetical protein CICLE_v10033712mg             291   1e-93    
ref|XP_009117957.1|  PREDICTED: putative SNAP25 homologous protei...    290   4e-93    
ref|XP_003517824.1|  PREDICTED: putative SNAP25 homologous protei...    290   5e-93    
ref|XP_003614024.1|  SNAP25 homologous protein SNAP33                   289   1e-92    
ref|XP_003520109.1|  PREDICTED: putative SNAP25 homologous protei...    287   8e-92    
ref|XP_007045922.1|  Soluble N-ethylmaleimide-sensitive factor ad...    286   2e-91    
ref|XP_011015772.1|  PREDICTED: putative SNAP25 homologous protei...    281   7e-90    
ref|XP_007157584.1|  hypothetical protein PHAVU_002G081500g             281   3e-89    
ref|XP_004298390.1|  PREDICTED: putative SNAP25 homologous protei...    281   3e-89    
ref|XP_002312278.1|  SNAP25 homologous protein SNAP30                   280   4e-89    Populus trichocarpa [western balsam poplar]
ref|XP_010476417.1|  PREDICTED: putative SNAP25 homologous protei...    279   1e-88    
ref|XP_006417081.1|  hypothetical protein EUTSA_v10008501mg             279   1e-88    
ref|XP_010495643.1|  PREDICTED: putative SNAP25 homologous protei...    278   1e-88    
gb|KDO83098.1|  hypothetical protein CISIN_1g023155mg                   278   3e-88    
ref|XP_010458853.1|  PREDICTED: putative SNAP25 homologous protei...    276   2e-87    
ref|XP_007227456.1|  hypothetical protein PRUPE_ppa009702mg             275   3e-87    
ref|XP_008221529.1|  PREDICTED: putative SNAP25 homologous protei...    275   5e-87    
ref|XP_010259208.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    274   2e-86    
ref|XP_009623745.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    273   4e-86    
emb|CBI27272.3|  unnamed protein product                                271   5e-86    
ref|XP_010649550.1|  PREDICTED: putative SNAP25 homologous protei...    272   1e-85    
ref|XP_009761175.1|  PREDICTED: SNAP25 homologous protein SNAP33        272   1e-85    
ref|XP_010107458.1|  Putative SNAP25-like protein                       270   5e-85    
ref|XP_002514694.1|  synaptosomal associated protein, putative          269   3e-84    Ricinus communis
ref|XP_002512109.1|  synaptosomal associated protein, putative          265   6e-84    Ricinus communis
ref|XP_010096581.1|  Putative SNAP25-like protein                       266   2e-83    
ref|XP_003575060.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    265   3e-83    
ref|NP_001047013.1|  Os02g0529500                                       264   4e-83    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ23291.1|  hypothetical protein OsJ_06988                          264   5e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010044425.1|  PREDICTED: putative SNAP25 homologous protei...    265   6e-83    
gb|EYU23575.1|  hypothetical protein MIMGU_mgv1a010387mg                266   7e-83    
ref|XP_007045921.1|  Soluble N-ethylmaleimide-sensitive factor ad...    266   7e-83    
ref|XP_004236003.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    266   1e-82    
gb|KDP31313.1|  hypothetical protein JCGZ_11689                         264   2e-82    
ref|XP_009405997.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    262   2e-82    
ref|XP_009405995.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    261   8e-82    
ref|XP_011013081.1|  PREDICTED: SNAP25 homologous protein SNAP33        263   8e-82    
ref|XP_010546183.1|  PREDICTED: SNAP25 homologous protein SNAP33        262   1e-81    
ref|XP_002452196.1|  hypothetical protein SORBIDRAFT_04g021560          259   4e-81    Sorghum bicolor [broomcorn]
gb|AEB71568.1|  SNAP33                                                  260   5e-81    
ref|XP_002322041.1|  hypothetical protein POPTR_0015s03450g             260   6e-81    Populus trichocarpa [western balsam poplar]
ref|XP_010037206.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    260   6e-81    
emb|CDP17499.1|  unnamed protein product                                260   7e-81    
ref|XP_008239879.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    259   1e-80    
ref|XP_006345160.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    259   1e-80    
ref|XP_004952631.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    257   2e-80    
gb|KEH31992.1|  soluble N-ethylmaleimide-sensitive factor adaptor...    258   3e-80    
ref|XP_011072852.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    259   3e-80    
ref|XP_007037493.1|  Synaptosomal associated protein, putative          258   3e-80    
ref|XP_006648688.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    258   5e-80    
ref|XP_008645745.1|  PREDICTED: SNAP25 homologous protein SNAP33        256   8e-80    
ref|XP_010258125.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    256   2e-79    
ref|XP_008393203.1|  PREDICTED: SNAP25 homologous protein SNAP33        254   6e-79    
ref|XP_003524667.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    255   7e-79    
ref|XP_004508695.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    254   2e-78    
gb|KHG22115.1|  SNAP25 ous SNAP33 -like protein                         253   2e-78    
ref|XP_009338645.1|  PREDICTED: SNAP25 homologous protein SNAP33        252   4e-78    
ref|NP_001241533.1|  uncharacterized protein LOC100793323               252   6e-78    
ref|XP_011087328.1|  PREDICTED: SNAP25 homologous protein SNAP33        252   7e-78    
ref|XP_009801843.1|  PREDICTED: SNAP25 homologous protein SNAP33        252   8e-78    
gb|KHG01928.1|  SNAP25 ous SNAP33 -like protein                         251   2e-77    
ref|XP_008792740.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    249   3e-77    
ref|XP_009595358.1|  PREDICTED: SNAP25 homologous protein SNAP33        250   4e-77    
ref|XP_008805102.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    249   5e-77    
ref|XP_010904957.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    249   6e-77    
ref|XP_010904956.1|  PREDICTED: putative SNAP25 homologous protei...    250   1e-76    
gb|AFK41395.1|  unknown                                                 249   2e-76    
ref|XP_006281801.1|  hypothetical protein CARUB_v10027974mg             248   5e-76    
ref|XP_008777761.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    247   7e-76    
ref|XP_010322574.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    247   7e-76    
ref|XP_007155259.1|  hypothetical protein PHAVU_003G186500g             247   8e-76    
ref|XP_006354763.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    246   2e-75    
gb|AAM62553.1|  snap25a                                                 246   2e-75    Arabidopsis thaliana [mouse-ear cress]
ref|NP_200929.1|  soluble N-ethylmaleimide-sensitive factor adapt...    246   2e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864724.1|  synaptosomal-associated protein 33                 246   2e-75    
ref|XP_010106653.1|  SNAP25-like protein                                245   3e-75    
ref|XP_010678419.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    245   5e-75    
ref|XP_010443936.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    245   6e-75    
ref|XP_010483785.1|  PREDICTED: SNAP25 homologous protein SNAP33        244   7e-75    
gb|AFK39371.1|  unknown                                                 244   7e-75    
ref|XP_010939205.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    244   9e-75    
ref|XP_008453247.1|  PREDICTED: putative SNAP25 homologous protei...    244   1e-74    
ref|XP_010457045.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    244   1e-74    
ref|XP_002284486.1|  PREDICTED: SNAP25 homologous protein SNAP33        244   1e-74    Vitis vinifera
gb|KCW83692.1|  hypothetical protein EUGRSUZ_B00569                     241   2e-74    
gb|EYU29393.1|  hypothetical protein MIMGU_mgv1a010876mg                243   2e-74    
ref|NP_001241453.1|  uncharacterized protein LOC100794076               243   2e-74    
ref|XP_003562758.1|  PREDICTED: SNAP25 homologous protein SNAP33        242   2e-74    
gb|KHN48757.1|  SNAP25 like protein SNAP33                              243   2e-74    
emb|CDY02165.1|  BnaA03g40020D                                          243   3e-74    
ref|XP_003527100.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    242   4e-74    
ref|XP_004138184.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    243   4e-74    
ref|XP_007157643.1|  hypothetical protein PHAVU_002G087000g             242   5e-74    
ref|XP_003627345.1|  SNAP25 homologous protein SNAP33                   239   5e-74    
ref|XP_008374599.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    241   6e-74    
emb|CDY23079.1|  BnaC07g31080D                                          242   6e-74    
ref|XP_006394530.1|  hypothetical protein EUTSA_v10004672mg             242   9e-74    
ref|XP_009136443.1|  PREDICTED: SNAP25 homologous protein SNAP33        241   1e-73    
ref|XP_010030467.1|  PREDICTED: SNAP25 homologous protein SNAP33        241   1e-73    
ref|XP_004299325.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    241   1e-73    
gb|ACU18010.1|  unknown                                                 241   2e-73    Glycine max [soybeans]
ref|XP_010527948.1|  PREDICTED: putative SNAP25 homologous protei...    239   4e-73    
gb|EPS65203.1|  hypothetical protein M569_09573                         238   8e-73    
ref|XP_009339111.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    238   8e-73    
gb|EPS61222.1|  hypothetical protein M569_13575                         236   9e-73    
ref|XP_002317966.1|  hypothetical protein POPTR_0012s06830g             238   2e-72    Populus trichocarpa [western balsam poplar]
ref|XP_009398274.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    238   3e-72    
ref|XP_011010042.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    238   3e-72    
ref|XP_004499490.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    237   4e-72    
ref|XP_011010041.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    238   5e-72    
ref|XP_010936394.1|  PREDICTED: LOW QUALITY PROTEIN: SNAP25 homol...    235   6e-72    
gb|EMS63818.1|  SNAP25 homologous protein SNAP33                        238   9e-72    
ref|XP_008447897.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    236   1e-71    
gb|KEH33105.1|  soluble N-ethylmaleimide-sensitive factor adaptor...    235   2e-71    
gb|EEC74748.1|  hypothetical protein OsI_10502                          233   6e-71    Oryza sativa Indica Group [Indian rice]
gb|ABF94609.1|  SNARE domain containing protein, expressed              232   8e-71    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049355.2|  Os03g0212400                                       232   9e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004137424.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    233   2e-70    
emb|CDX78314.1|  BnaA03g02260D                                          232   4e-70    
emb|CDY42860.1|  BnaAnng06850D                                          231   6e-70    
gb|EMT24031.1|  hypothetical protein F775_02522                         244   6e-70    
ref|XP_009130158.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    231   1e-69    
ref|XP_006649622.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    228   5e-69    
ref|XP_010491406.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    228   5e-69    
ref|XP_010452752.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    227   9e-69    
ref|XP_004952388.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    228   9e-69    
ref|XP_002316150.2|  hypothetical protein POPTR_0010s16780g             226   2e-68    Populus trichocarpa [western balsam poplar]
ref|XP_010423160.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    226   3e-68    
ref|XP_006647232.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    226   9e-68    
emb|CDY47025.1|  BnaC02g42100D                                          225   1e-67    
ref|XP_006477622.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    226   2e-67    
ref|XP_006837079.1|  hypothetical protein AMTR_s00110p00096490          229   2e-67    
emb|CDX99033.1|  BnaC09g48020D                                          227   2e-67    
ref|NP_001046737.2|  Os02g0437200                                       224   2e-67    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008651019.1|  PREDICTED: hypothetical protein isoform X1         223   6e-67    
ref|XP_003573114.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    224   6e-67    
ref|XP_009131020.1|  PREDICTED: SNAP25 homologous protein SNAP33        224   7e-67    
gb|AAW82752.1|  SNAP1                                                   223   8e-67    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006286625.1|  hypothetical protein CARUB_v10002435mg             222   9e-67    
gb|KDO54588.1|  hypothetical protein CISIN_1g021914mg                   223   1e-66    
ref|XP_006440694.1|  hypothetical protein CICLE_v10021320mg             223   1e-66    
ref|XP_006399270.1|  hypothetical protein EUTSA_v10014162mg             223   1e-66    
gb|KCW48875.1|  hypothetical protein EUGRSUZ_K02499                     221   3e-66    
emb|CDX69988.1|  BnaA10g23370D                                          223   3e-66    
ref|XP_008785958.1|  PREDICTED: SNAP25 homologous protein SNAP33        222   4e-66    
gb|ACG41627.1|  SNAP25 homologous protein SNAP30                        221   5e-66    Zea mays [maize]
ref|XP_004985220.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    220   5e-66    
gb|EMS62124.1|  SNAP25 homologous protein SNAP33                        219   6e-66    
dbj|BAK02929.1|  predicted protein                                      221   9e-66    
gb|AAP79417.1|  SNAP-34                                                 221   1e-65    Hordeum vulgare subsp. vulgare [barley]
gb|AAP79418.1|  SNAP-28                                                 218   2e-65    Hordeum vulgare subsp. vulgare [barley]
gb|AFQ60149.1|  SNAP34                                                  220   2e-65    
gb|EMT01836.1|  hypothetical protein F775_27154                         218   2e-65    
ref|XP_009122403.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    220   2e-65    
gb|ABR17810.1|  unknown                                                 224   4e-65    Picea sitchensis
emb|CDM84857.1|  unnamed protein product                                218   6e-65    
gb|EMS47805.1|  SNAP25 homologous protein SNAP33                        221   1e-64    
gb|EMT27772.1|  hypothetical protein F775_19680                         219   3e-64    
gb|EMT02830.1|  hypothetical protein F775_27735                         218   3e-64    
ref|XP_008646186.1|  PREDICTED: hypothetical protein isoform X1         214   9e-64    
gb|ACG28612.1|  SNAP25 homologous protein SNAP29                        213   1e-63    Zea mays [maize]
ref|XP_002468291.1|  hypothetical protein SORBIDRAFT_01g043090          213   3e-63    Sorghum bicolor [broomcorn]
gb|KCW86520.1|  hypothetical protein EUGRSUZ_B03169                     210   7e-63    
ref|XP_003558507.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    211   9e-63    
ref|XP_009399114.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    208   4e-61    
ref|XP_007157645.1|  hypothetical protein PHAVU_002G087000g             207   8e-61    
ref|XP_002873328.1|  hypothetical protein ARALYDRAFT_487619             205   5e-60    
ref|NP_196405.1|  SNAP25-like protein SNAP29                            204   9e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002961143.1|  hypothetical protein SELMODRAFT_35623              196   2e-57    
ref|XP_002966868.1|  hypothetical protein SELMODRAFT_86628              197   3e-57    
ref|NP_001137110.1|  hypothetical protein                               188   2e-53    Zea mays [maize]
ref|XP_009136084.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    177   1e-48    
ref|XP_002972466.1|  hypothetical protein SELMODRAFT_36509              172   4e-48    
ref|XP_007209588.1|  hypothetical protein PRUPE_ppa011254mg             172   5e-48    
ref|XP_009129438.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    176   1e-47    
emb|CBI15159.3|  unnamed protein product                                164   9e-46    
ref|XP_001774080.1|  Qb+Qc-SNARE, SNAP33-family                         164   2e-44    
ref|XP_002984296.1|  hypothetical protein SELMODRAFT_36511              162   2e-44    
emb|CDX73442.1|  BnaC08g25610D                                          161   6e-44    
ref|XP_001778372.1|  Qb+Qc-SNARE, SNAP33-family                         162   1e-43    
ref|XP_006376804.1|  hypothetical protein POPTR_0012s06830g             157   7e-42    
gb|KEH33106.1|  soluble N-ethylmaleimide-sensitive factor adaptor...    155   5e-41    
ref|NP_001131677.1|  hypothetical protein                               131   6e-33    Zea mays [maize]
tpg|DAA44048.1|  TPA: hypothetical protein ZEAMMB73_589554              118   2e-28    
ref|XP_004155053.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    115   8e-28    
ref|XP_004172346.1|  PREDICTED: SNAP25 homologous protein SNAP33-...    115   6e-27    
gb|AAP79419.1|  SNAP25-like protein C                                   102   2e-23    Hordeum vulgare subsp. vulgare [barley]
ref|XP_009148798.1|  PREDICTED: putative SNAP25 homologous protei...    102   7e-23    
ref|XP_002107867.1|  SNAP25.2                                         92.8    1e-18    Trichoplax adhaerens
ref|XP_007244732.1|  PREDICTED: synaptosomal-associated protein 2...  91.3    5e-18    
ref|XP_007244733.1|  PREDICTED: synaptosomal-associated protein 2...  90.5    6e-18    
gb|KFK25932.1|  hypothetical protein AALP_AA8G181900                  87.4    1e-15    
ref|XP_009066358.1|  hypothetical protein LOTGIDRAFT_197810           83.2    2e-15    
ref|XP_010895574.1|  PREDICTED: synaptosomal-associated protein 2...  83.2    3e-15    
ref|XP_004540251.1|  PREDICTED: synaptosomal-associated protein 2...  82.8    4e-15    
ref|XP_006810171.1|  PREDICTED: synaptosomal-associated protein 2...  82.8    4e-15    
ref|XP_004540250.1|  PREDICTED: synaptosomal-associated protein 2...  82.8    4e-15    
ref|XP_006810170.1|  PREDICTED: synaptosomal-associated protein 2...  82.4    5e-15    
ref|XP_005158781.1|  PREDICTED: synaptosomal-associated protein 2...  82.4    5e-15    
ref|XP_010895573.1|  PREDICTED: synaptosomal-associated protein 2...  81.6    8e-15    
ref|XP_001994750.1|  GH14348                                          81.3    9e-15    Drosophila grimshawi
ref|XP_005477352.1|  PREDICTED: synaptosomal-associated protein 2...  81.6    1e-14    
ref|XP_005477351.1|  PREDICTED: synaptosomal-associated protein 2...  81.6    1e-14    
gb|EKC25321.1|  Synaptosomal-associated protein 25                    80.9    1e-14    
ref|NP_956484.1|  synaptosomal-associated protein 23                  80.9    1e-14    Danio rerio [leopard danio]
ref|XP_005175414.1|  PREDICTED: synaptosomal-associated protein 2...  80.9    2e-14    
ref|XP_004540252.1|  PREDICTED: synaptosomal-associated protein 2...  80.5    2e-14    
ref|XP_006810172.1|  PREDICTED: synaptosomal-associated protein 2...  80.5    2e-14    
emb|CDQ81912.1|  unnamed protein product                              80.1    2e-14    
ref|XP_002000068.1|  GI24884                                          79.7    4e-14    Drosophila mojavensis
ref|XP_009028652.1|  hypothetical protein HELRODRAFT_155336           79.3    4e-14    
ref|XP_003442937.1|  PREDICTED: synaptosomal-associated protein 2...  79.3    5e-14    
ref|XP_002054565.1|  GJ24526                                          79.3    6e-14    Drosophila virilis
ref|XP_001635030.1|  predicted protein                                78.6    6e-14    Nematostella vectensis
ref|XP_010731393.1|  PREDICTED: synaptosomal-associated protein 2...  78.2    1e-13    
ref|XP_010877747.1|  PREDICTED: synaptosomal-associated protein 2...  78.2    1e-13    
ref|XP_001964463.1|  GF23192                                          78.2    1e-13    Drosophila ananassae
emb|CAH92726.1|  hypothetical protein                                 77.8    1e-13    Pongo abelii [orang utan]
gb|ERE71497.1|  synaptosomal-associated protein 25                    78.2    2e-13    
ref|XP_003969482.1|  PREDICTED: synaptosomal-associated protein 2...  77.4    2e-13    
ref|XP_003962445.1|  PREDICTED: synaptosomal-associated protein 2...  78.2    2e-13    
ref|XP_008309039.1|  PREDICTED: synaptosomal-associated protein 2...  77.4    2e-13    
ref|NP_524298.1|  Synaptosomal-associated protein 24kDa               77.4    2e-13    Drosophila melanogaster
ref|XP_003437735.1|  PREDICTED: synaptosomal-associated protein 2...  77.4    2e-13    
ref|XP_004539800.1|  PREDICTED: synaptosomal-associated protein 2...  77.0    3e-13    
ref|XP_008397391.1|  PREDICTED: synaptosomal-associated protein 2...  77.4    3e-13    
ref|XP_004082207.1|  PREDICTED: synaptosomal-associated protein 2...  77.8    3e-13    
ref|XP_001980757.1|  GG17329                                          77.0    3e-13    Drosophila erecta
dbj|BAD97337.1|  synaptosomal-associated protein 25 isoform SNAP2...  77.0    3e-13    Homo sapiens [man]
gb|ERE71496.1|  synaptosomal-associated protein 25                    77.4    4e-13    
gb|ABP38355.1|  SNAP-23                                               77.0    4e-13    Lateolabrax japonicus [Japanese seabass]
ref|XP_001358590.1|  GA21816                                          76.6    4e-13    Drosophila pseudoobscura pseudoobscura
ref|XP_003476612.1|  PREDICTED: synaptosomal-associated protein 25    76.3    4e-13    
ref|XP_002070265.1|  GK11126                                          76.6    5e-13    Drosophila willistoni
ref|XP_010163765.1|  PREDICTED: synaptosomal-associated protein 2...  76.3    5e-13    
ref|NP_035558.1|  synaptosomal-associated protein 25 isoform a        76.3    5e-13    Mus musculus [mouse]
ref|XP_007569282.1|  PREDICTED: synaptosomal-associated protein 2...  76.3    5e-13    
ref|XP_010022661.1|  PREDICTED: synaptosomal-associated protein 2...  76.3    6e-13    
ref|XP_008403722.1|  PREDICTED: synaptosomal-associated protein 2...  76.3    6e-13    
ref|NP_003072.2|  synaptosomal-associated protein 25 isoform SNAP25A  76.3    6e-13    Homo sapiens [man]
gb|AAV38489.1|  synaptosomal-associated protein, 25kDa                75.9    7e-13    
ref|XP_010163773.1|  PREDICTED: synaptosomal-associated protein 2...  75.9    7e-13    
sp|P36977.1|SN25A_CARAU  RecName: Full=Synaptosomal-associated pr...  75.9    7e-13    Carassius auratus
dbj|BAE01879.1|  unnamed protein product                              75.9    7e-13    Macaca fascicularis [crab eating macaque]
ref|XP_008309652.1|  PREDICTED: synaptosomal-associated protein 2...  76.6    7e-13    
ref|XP_006030177.1|  PREDICTED: synaptosomal-associated protein 25    75.9    8e-13    
gb|ACO10166.1|  Synaptosomal-associated protein 25A                   75.9    8e-13    Osmerus mordax
ref|XP_010022662.1|  PREDICTED: synaptosomal-associated protein 2...  75.5    9e-13    
ref|XP_004083719.1|  PREDICTED: synaptosomal-associated protein 2...  75.5    1e-12    
ref|XP_005287463.1|  PREDICTED: synaptosomal-associated protein 2...  75.5    1e-12    
ref|XP_008397392.1|  PREDICTED: synaptosomal-associated protein 2...  75.1    1e-12    
ref|XP_005287464.1|  PREDICTED: synaptosomal-associated protein 2...  75.1    1e-12    
ref|XP_003971518.1|  PREDICTED: synaptosomal-associated protein 2...  75.1    1e-12    
ref|XP_008637701.1|  PREDICTED: synaptosomal-associated protein 2...  75.1    1e-12    
gb|ABD76554.1|  25 kDa synaptosomal-associated protein                75.1    1e-12    Scophthalmus maximus
ref|XP_010898914.1|  PREDICTED: synaptosomal-associated protein 2...  75.1    2e-12    
sp|Q5TZ66.1|SN25A_DANRE  RecName: Full=Synaptosomal-associated pr...  75.1    2e-12    Danio rerio [leopard danio]
ref|XP_004082206.1|  PREDICTED: synaptosomal-associated protein 2...  75.1    2e-12    
ref|XP_002613470.1|  hypothetical protein BRAFLDRAFT_208390           74.7    2e-12    
emb|CAF04071.1|  synaptosomal-associated protein 25                   74.7    2e-12    
ref|XP_009073719.1|  PREDICTED: synaptosomal-associated protein 2...  74.7    2e-12    
ref|XP_004524357.1|  PREDICTED: synaptosomal-associated protein 2...  74.7    2e-12    
emb|CAH93161.1|  hypothetical protein                                 74.7    2e-12    
ref|NP_001167420.1|  Synaptosomal-associated protein 25-A             74.7    2e-12    
ref|XP_009073720.1|  PREDICTED: synaptosomal-associated protein 2...  74.7    2e-12    
ref|XP_007903663.1|  PREDICTED: synaptosomal-associated protein 2...  74.3    3e-12    
ref|XP_010469128.1|  PREDICTED: uncharacterized protein LOC104749233  73.6    3e-12    
ref|XP_006010378.1|  PREDICTED: synaptosomal-associated protein 2...  74.3    3e-12    
ref|XP_006010379.1|  PREDICTED: synaptosomal-associated protein 2...  73.9    4e-12    
ref|XP_009897257.1|  PREDICTED: synaptosomal-associated protein 2...  73.9    4e-12    
ref|NP_571510.1|  synaptosomal-associated protein 25-A                73.9    4e-12    
ref|XP_006632625.1|  PREDICTED: synaptosomal-associated protein 2...  72.8    5e-12    
ref|NP_001127109.1|  synaptosomal-associated protein 25               73.6    5e-12    
emb|CAH92513.1|  hypothetical protein                                 73.6    5e-12    
ref|XP_007245416.1|  PREDICTED: synaptosomal-associated protein 2...  73.6    6e-12    
ref|XP_003756099.1|  PREDICTED: synaptosomal-associated protein 23    73.6    6e-12    
ref|XP_006627668.1|  PREDICTED: synaptosomal-associated protein 2...  73.6    6e-12    
ref|XP_006201761.1|  PREDICTED: synaptosomal-associated protein 2...  73.6    6e-12    
ref|XP_005812630.1|  PREDICTED: synaptosomal-associated protein 2...  73.2    6e-12    
ref|XP_008275507.1|  PREDICTED: synaptosomal-associated protein 2...  73.6    7e-12    
ref|XP_008275508.1|  PREDICTED: synaptosomal-associated protein 2...  73.6    7e-12    
ref|XP_003440758.1|  PREDICTED: synaptosomal-associated protein 2...  73.2    7e-12    
ref|XP_006778107.1|  PREDICTED: synaptosomal-associated protein 2...  73.2    8e-12    
ref|XP_009682954.1|  PREDICTED: synaptosomal-associated protein 23    72.8    1e-11    
ref|XP_002107866.1|  SNAP25.1                                         72.8    1e-11    
ref|XP_005860372.1|  PREDICTED: synaptosomal-associated protein 23    72.8    1e-11    
ref|XP_010158709.1|  PREDICTED: synaptosomal-associated protein 2...  72.4    1e-11    
ref|XP_006625751.1|  PREDICTED: synaptosomal-associated protein 2...  72.4    1e-11    
gb|AAH82475.1|  Unknown (protein for MGC:84437)                       72.4    1e-11    
gb|AAO83846.1|AF484089_1  synaptosomal-associated 25 protein isof...  72.4    1e-11    
ref|XP_007903664.1|  PREDICTED: synaptosomal-associated protein 2...  72.4    1e-11    
ref|XP_005047063.1|  PREDICTED: synaptosomal-associated protein 23    72.4    2e-11    
ref|XP_005522559.1|  PREDICTED: synaptosomal-associated protein 2...  72.0    2e-11    
ref|XP_005926081.1|  PREDICTED: synaptosomal-associated protein 2...  71.6    2e-11    
ref|XP_008335385.1|  PREDICTED: synaptosomal-associated protein 25    71.6    2e-11    
ref|XP_009922436.1|  PREDICTED: synaptosomal-associated protein 23    72.0    2e-11    
gb|ACO51956.1|  Synaptosomal-associated protein 25                    72.0    2e-11    
ref|XP_009931398.1|  PREDICTED: synaptosomal-associated protein 2...  72.0    2e-11    
ref|XP_007238437.1|  PREDICTED: synaptosomal-associated protein 2...  71.6    2e-11    
dbj|BAC45225.1|  synaptosome-associated protein of 25 kDa             71.6    2e-11    
ref|XP_006793012.1|  PREDICTED: synaptosomal-associated protein 2...  71.2    3e-11    
ref|XP_009568351.1|  PREDICTED: synaptosomal-associated protein 2...  71.6    3e-11    
gb|ACO51897.1|  Synaptosomal-associated protein 23                    71.6    3e-11    
ref|XP_003215353.1|  PREDICTED: synaptosomal-associated protein 25    71.6    3e-11    
ref|XP_002200354.1|  PREDICTED: synaptosomal-associated protein 2...  71.6    3e-11    
ref|XP_005480051.1|  PREDICTED: synaptosomal-associated protein 23    71.6    3e-11    
ref|XP_008196404.1|  PREDICTED: synaptosomal-associated protein 2...  71.2    3e-11    
ref|XP_005419454.1|  PREDICTED: synaptosomal-associated protein 2...  71.2    3e-11    
ref|XP_008275509.1|  PREDICTED: synaptosomal-associated protein 2...  71.2    4e-11    
ref|XP_004383113.1|  PREDICTED: synaptosomal-associated protein 2...  70.5    4e-11    
ref|XP_010215519.1|  PREDICTED: synaptosomal-associated protein 23    71.2    4e-11    
ref|XP_010193018.1|  PREDICTED: synaptosomal-associated protein 2...  71.2    4e-11    
gb|ETE71074.1|  Synaptosomal-associated protein 25                    70.9    4e-11    
ref|XP_003248287.1|  PREDICTED: synaptosomal-associated protein 2...  71.2    4e-11    
emb|CBY36941.1|  unnamed protein product                              70.9    5e-11    
ref|XP_008498514.1|  PREDICTED: synaptosomal-associated protein 2...  70.9    5e-11    
gb|EUB56377.1|  Synaptosomal-associated protein 25-A                  71.2    5e-11    
ref|XP_009031214.1|  hypothetical protein HELRODRAFT_71107            70.9    6e-11    
ref|XP_009476816.1|  PREDICTED: synaptosomal-associated protein 2...  70.5    6e-11    
ref|XP_006625752.1|  PREDICTED: synaptosomal-associated protein 2...  70.5    6e-11    
ref|XP_002613462.1|  hypothetical protein BRAFLDRAFT_119861           70.5    6e-11    
ref|XP_004383114.1|  PREDICTED: synaptosomal-associated protein 2...  70.1    6e-11    
ref|XP_009100290.1|  PREDICTED: synaptosomal-associated protein 2...  70.5    6e-11    
emb|CDS23787.1|  synaptosomal associated protein                      70.9    6e-11    
ref|XP_005160680.1|  PREDICTED: synaptosomal-associated protein 2...  70.5    6e-11    
ref|XP_004273993.1|  PREDICTED: synaptosomal-associated protein 2...  70.5    6e-11    
ref|XP_006178931.1|  PREDICTED: synaptosomal-associated protein 2...  70.5    6e-11    
ref|XP_010898915.1|  PREDICTED: synaptosomal-associated protein 2...  70.5    7e-11    
ref|XP_003971519.1|  PREDICTED: synaptosomal-associated protein 2...  70.5    7e-11    
ref|XP_010129806.1|  PREDICTED: synaptosomal-associated protein 2...  70.5    7e-11    
ref|NP_001016501.1|  synaptosomal-associated protein, 25kDa           70.5    7e-11    
ref|XP_004578199.1|  PREDICTED: synaptosomal-associated protein 2...  70.5    7e-11    
ref|NP_001083880.1|  SNAP25a                                          70.5    7e-11    
ref|XP_008550507.1|  PREDICTED: synaptosomal-associated protein 2...  70.5    7e-11    
ref|XP_009512730.1|  PREDICTED: synaptosomal-associated protein 2...  70.5    8e-11    
ref|XP_008396390.1|  PREDICTED: synaptosomal-associated protein 25    70.1    8e-11    
ref|XP_002126408.2|  PREDICTED: synaptosomal-associated protein 25    70.1    8e-11    
gb|ACO10275.1|  Synaptosomal-associated protein 25                    70.1    8e-11    
ref|XP_009070521.1|  PREDICTED: synaptosomal-associated protein 2...  70.1    9e-11    
emb|CDI99610.1|  synaptosomal associated protein                      70.5    9e-11    
ref|XP_005978464.1|  PREDICTED: synaptosomal-associated protein 2...  69.7    1e-10    
ref|XP_004751256.1|  PREDICTED: synaptosomal-associated protein 2...  69.7    1e-10    
sp|Q6PC54.1|SN25B_DANRE  RecName: Full=Synaptosomal-associated pr...  69.7    1e-10    
ref|XP_009638532.1|  PREDICTED: synaptosomal-associated protein 2...  69.7    1e-10    
ref|XP_009886269.1|  PREDICTED: synaptosomal-associated protein 2...  69.7    1e-10    
sp|P36978.1|SN25B_CARAU  RecName: Full=Synaptosomal-associated pr...  69.7    1e-10    
ref|XP_005021730.1|  PREDICTED: synaptosomal-associated protein 2...  69.7    1e-10    
ref|XP_009862784.1|  PREDICTED: synaptosomal-associated protein 2...  69.7    1e-10    
ref|NP_001186595.1|  synaptosomal-associated protein 23               69.7    1e-10    
ref|XP_005281138.1|  PREDICTED: synaptosomal-associated protein 29    70.5    1e-10    
ref|XP_009100291.1|  PREDICTED: synaptosomal-associated protein 2...  69.7    1e-10    
ref|XP_003206524.1|  PREDICTED: synaptosomal-associated protein 23    69.7    1e-10    
ref|XP_006158704.1|  PREDICTED: synaptosomal-associated protein 2...  69.7    1e-10    
ref|XP_006731758.1|  PREDICTED: synaptosomal-associated protein 2...  69.7    1e-10    
ref|XP_010303040.1|  PREDICTED: synaptosomal-associated protein 2...  69.7    1e-10    
ref|XP_004010530.1|  PREDICTED: synaptosomal-associated protein 2...  69.7    1e-10    
ref|XP_010126626.1|  PREDICTED: synaptosomal-associated protein 2...  69.3    1e-10    
dbj|BAC45226.1|  synaptosome-associated protein of 25 kDa             69.3    2e-10    
ref|XP_009976129.1|  PREDICTED: synaptosomal-associated protein 2...  69.3    2e-10    
ref|XP_008942139.1|  PREDICTED: synaptosomal-associated protein 2...  69.3    2e-10    
ref|XP_009586046.1|  PREDICTED: synaptosomal-associated protein 2...  69.3    2e-10    
ref|XP_004368292.1|  C2 domain containing protein                     71.6    2e-10    
ref|XP_008205568.1|  PREDICTED: synaptosomal-associated protein 2...  69.3    2e-10    
ref|XP_009472030.1|  PREDICTED: synaptosomal-associated protein 2...  69.3    2e-10    
ref|XP_001606157.2|  PREDICTED: synaptosomal-associated protein 2...  69.3    2e-10    
ref|XP_008550508.1|  PREDICTED: synaptosomal-associated protein 2...  69.3    2e-10    
ref|XP_010081284.1|  PREDICTED: synaptosomal-associated protein 2...  68.9    2e-10    
dbj|BAE47569.1|  synaptosomal-associated protein, 25 kDa              68.9    2e-10    
ref|XP_005316522.1|  PREDICTED: synaptosomal-associated protein 23    68.9    2e-10    
ref|XP_007173663.1|  PREDICTED: synaptosomal-associated protein 2...  68.9    2e-10    
ref|XP_006567717.1|  PREDICTED: synaptosomal-associated protein 2...  68.9    2e-10    
ref|XP_009817572.1|  PREDICTED: synaptosomal-associated protein 2...  68.9    2e-10    
ref|XP_007460189.1|  PREDICTED: synaptosomal-associated protein 2...  68.9    2e-10    
ref|XP_003696604.1|  PREDICTED: synaptosomal-associated protein 2...  68.9    2e-10    
ref|NP_001107340.1|  synaptosomal-associated protein, 23kDa           68.9    2e-10    
ref|XP_002070231.1|  GK11144                                          68.9    2e-10    
ref|XP_005449915.1|  PREDICTED: synaptosomal-associated protein 2...  68.6    3e-10    
ref|XP_008550505.1|  PREDICTED: synaptosomal-associated protein 2...  68.9    3e-10    
ref|XP_007173661.1|  PREDICTED: synaptosomal-associated protein 2...  68.9    3e-10    
ref|XP_010289855.1|  PREDICTED: synaptosomal-associated protein 2...  68.6    3e-10    
ref|NP_001080510.1|  synaptosomal-associated protein, 25kDa           68.6    3e-10    
ref|XP_001990837.1|  GH19583                                          68.9    3e-10    
ref|XP_007245417.1|  PREDICTED: synaptosomal-associated protein 2...  68.6    3e-10    
ref|XP_009971546.1|  PREDICTED: synaptosomal-associated protein 2...  68.6    3e-10    
ref|NP_001036641.1|  Synaptosomal-associated protein 25kDa, isofo...  68.6    3e-10    
ref|XP_001973806.1|  GG13148                                          68.6    3e-10    
ref|NP_571509.1|  synaptosomal-associated protein 25-B                68.6    3e-10    
ref|XP_010022688.1|  PREDICTED: synaptosomal-associated protein 2...  68.6    3e-10    
ref|XP_005502272.1|  PREDICTED: synaptosomal-associated protein 2...  68.6    3e-10    
ref|XP_010195368.1|  PREDICTED: synaptosomal-associated protein 2...  68.6    3e-10    
ref|XP_007104930.1|  PREDICTED: synaptosomal-associated protein 2...  68.6    4e-10    
ref|XP_002429982.1|  synaptosomal-associated protein, putative        68.6    4e-10    
ref|XP_009995274.1|  PREDICTED: synaptosomal-associated protein 2...  68.2    4e-10    
ref|XP_001509046.1|  PREDICTED: synaptosomal-associated protein 23    68.2    4e-10    
ref|NP_001020729.1|  synaptosomal-associated protein 25               68.2    4e-10    
gb|KFP22179.1|  Synaptosomal-associated protein 25                    67.8    4e-10    
ref|NP_001069299.1|  synaptosomal-associated protein 23               68.2    4e-10    
emb|CDS34308.1|  expressed protein                                    71.2    4e-10    
ref|XP_006004818.1|  PREDICTED: synaptosomal-associated protein 23    67.4    4e-10    
ref|XP_008267013.1|  PREDICTED: synaptosomal-associated protein 2...  68.6    4e-10    
ref|NP_001182767.1|  synaptosomal-associated protein 23               68.2    4e-10    
ref|XP_006567720.1|  PREDICTED: synaptosomal-associated protein 2...  68.2    4e-10    
gb|AAM18191.1|  SNAP25 fusion protein                                 68.2    4e-10    
ref|XP_007426860.1|  PREDICTED: synaptosomal-associated protein 25    68.2    5e-10    
gb|KFZ66844.1|  Synaptosomal-associated protein 23                    68.2    5e-10    
ref|XP_008924924.1|  PREDICTED: synaptosomal-associated protein 2...  68.2    5e-10    
ref|XP_002913240.1|  PREDICTED: synaptosomal-associated protein 2...  68.2    5e-10    
gb|AFK10698.1|  synaptosomal-associated protein 23                    67.8    5e-10    
ref|XP_006158706.1|  PREDICTED: synaptosomal-associated protein 2...  68.2    5e-10    
ref|XP_005441106.1|  PREDICTED: synaptosomal-associated protein 2...  67.8    5e-10    
ref|XP_006567725.1|  PREDICTED: synaptosomal-associated protein 2...  68.2    5e-10    
ref|XP_006066251.1|  PREDICTED: synaptosomal-associated protein 2...  67.8    5e-10    
ref|XP_006258552.1|  PREDICTED: synaptosomal-associated protein 23    67.8    5e-10    
ref|XP_003395505.1|  PREDICTED: synaptosomal-associated protein 2...  67.8    5e-10    
ref|XP_005904054.1|  PREDICTED: synaptosomal-associated protein 2...  67.8    5e-10    
ref|XP_010776954.1|  PREDICTED: synaptosomal-associated protein 2...  67.4    6e-10    
ref|XP_005243819.1|  PREDICTED: synaptosomal-associated protein 2...  67.8    6e-10    
ref|XP_001950075.1|  PREDICTED: synaptosomal-associated protein 2...  68.2    6e-10    
gb|AAC47499.1|  SNAP-25 homolog                                       67.8    6e-10    
ref|XP_004519481.1|  PREDICTED: synaptosomal-associated protein 2...  67.8    6e-10    
gb|ADJ67506.1|  synaptosomal-associated protein 25                    67.8    6e-10    
ref|XP_005659756.1|  PREDICTED: synaptosomal-associated protein, ...  67.8    6e-10    
ref|XP_002016813.1|  GL21971                                          67.8    6e-10    
ref|XP_009275842.1|  PREDICTED: synaptosomal-associated protein 23    67.8    6e-10    
ref|XP_010731397.1|  PREDICTED: synaptosomal-associated protein 2...  67.8    6e-10    
ref|XP_003987288.1|  PREDICTED: synaptosomal-associated protein 2...  67.8    6e-10    
ref|XP_005284674.1|  PREDICTED: synaptosomal-associated protein 23    67.4    7e-10    
ref|XP_006889057.1|  PREDICTED: synaptosomal-associated protein 2...  67.4    7e-10    
gb|ELU17214.1|  hypothetical protein CAPTEDRAFT_180292                67.4    8e-10    
ref|XP_004010531.1|  PREDICTED: synaptosomal-associated protein 2...  67.8    8e-10    
ref|XP_004380727.1|  PREDICTED: synaptosomal-associated protein 2...  67.4    8e-10    
ref|XP_002784049.1|  conserved hypothetical protein                   67.4    8e-10    
ref|XP_001998152.1|  GI23792                                          67.4    9e-10    
ref|XP_010166215.1|  PREDICTED: synaptosomal-associated protein 23    67.0    9e-10    
ref|XP_009472031.1|  PREDICTED: synaptosomal-associated protein 2...  67.0    9e-10    
ref|XP_008309041.1|  PREDICTED: synaptosomal-associated protein 2...  67.0    1e-09    
gb|EAX10353.1|  synaptosomal-associated protein, 25kDa, isoform C...  67.0    1e-09    
sp|P36976.1|SNP25_TORMA  RecName: Full=Synaptosomal-associated pr...  67.0    1e-09    
ref|XP_003707277.1|  PREDICTED: synaptosomal-associated protein 2...  67.0    1e-09    
ref|XP_008700412.1|  PREDICTED: synaptosomal-associated protein 2...  67.0    1e-09    
ref|XP_004466754.1|  PREDICTED: synaptosomal-associated protein 23    67.0    1e-09    
ref|XP_008057526.1|  PREDICTED: synaptosomal-associated protein 23    67.0    1e-09    
gb|AAA99826.1|  SNAP-25b                                              66.2    1e-09    
ref|XP_010704930.1|  PREDICTED: synaptosomal-associated protein 25    67.0    1e-09    
ref|XP_005157788.1|  PREDICTED: synaptosomal-associated protein 2...  66.6    1e-09    
ref|XP_008309666.1|  PREDICTED: synaptosomal-associated protein 2...  67.4    1e-09    
gb|EDL28002.1|  mCG11986, isoform CRA_b                               66.6    1e-09    
ref|XP_008309659.1|  PREDICTED: synaptosomal-associated protein 2...  67.4    1e-09    
ref|XP_004792188.1|  PREDICTED: synaptosomal-associated protein 2...  66.6    1e-09    
ref|XP_005799309.1|  PREDICTED: synaptosomal-associated protein 2...  66.6    2e-09    
ref|XP_006036963.1|  PREDICTED: synaptosomal-associated protein 23    67.0    2e-09    
ref|NP_001191612.1|  SNAP-25                                          66.6    2e-09    
ref|XP_004709435.1|  PREDICTED: synaptosomal-associated protein 2...  66.6    2e-09    
ref|NP_073180.1|  synaptosomal-associated protein 23                  66.6    2e-09    
ref|NP_001231648.1|  synaptosomal-associated protein, 23kDa           66.6    2e-09    
emb|CAG13136.1|  unnamed protein product                              66.6    2e-09    
ref|XP_008188637.1|  PREDICTED: synaptosomal-associated protein 2...  66.6    2e-09    
ref|NP_001079032.1|  synaptosomal-associated protein, 23kDa           66.2    2e-09    
dbj|GAA28784.2|  synaptosomal-associated protein 23kDa                66.2    2e-09    
ref|XP_004896235.1|  PREDICTED: synaptosomal-associated protein 2...  66.2    2e-09    
ref|XP_005211626.1|  PREDICTED: synaptosomal-associated protein 2...  66.2    2e-09    
ref|XP_005447744.1|  PREDICTED: synaptosomal-associated protein 2...  66.2    2e-09    
ref|XP_009317483.1|  PREDICTED: synaptosomal-associated protein 23    66.2    2e-09    
ref|XP_001503302.1|  PREDICTED: synaptosomal-associated protein 2...  66.2    2e-09    
ref|XP_003339523.1|  PREDICTED: synaptosomal-associated protein 2...  66.2    2e-09    
ref|XP_004442428.1|  PREDICTED: synaptosomal-associated protein 29    67.0    2e-09    
ref|XP_005603161.1|  PREDICTED: synaptosomal-associated protein 2...  66.2    2e-09    
ref|XP_006822035.1|  PREDICTED: synaptosomal-associated protein 2...  65.9    2e-09    
ref|XP_004539801.1|  PREDICTED: synaptosomal-associated protein 2...  65.9    2e-09    
gb|AAA99825.1|  SNAP-25a                                              65.5    2e-09    
ref|XP_008309644.1|  PREDICTED: synaptosomal-associated protein 2...  67.0    3e-09    
ref|XP_003801730.1|  PREDICTED: synaptosomal-associated protein 29    66.6    3e-09    
ref|XP_006066248.1|  PREDICTED: synaptosomal-associated protein 2...  66.2    3e-09    
ref|XP_006920516.1|  PREDICTED: synaptosomal-associated protein 23    65.9    3e-09    
ref|XP_004665950.1|  PREDICTED: synaptosomal-associated protein 2...  65.9    3e-09    
ref|XP_004400441.1|  PREDICTED: synaptosomal-associated protein 2...  65.9    3e-09    
ref|XP_009162028.1|  hypothetical protein T265_00107                  66.2    3e-09    
ref|XP_535442.1|  PREDICTED: synaptosomal-associated protein 23 i...  65.5    3e-09    



>ref|XP_009777545.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Nicotiana 
sylvestris]
Length=273

 Score =   335 bits (859),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 177/274 (65%), Positives = 211/274 (77%), Gaps = 32/274 (12%)
 Frame = +3

Query  201  MFGFGK-KppasasaspMQSADEPPA---ARRTSSEPNL---------------------  305
            MFGF K K  ++ + +    +DE      ARRTSSEP L                     
Sbjct  1    MFGFRKGKADSATTNTTPSHSDEKHGTKNARRTSSEPVLVTPDDDDFGTSSSSGTRNKNK  60

Query  306  ----NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRT  473
                +FD+MS+QELE YAVNQA+ETT SVNNCL+IAEDIRQDGAKTL+TLHKQGEQIHRT
Sbjct  61   SKTQDFDNMSMQELEGYAVNQAKETTSSVNNCLKIAEDIRQDGAKTLDTLHKQGEQIHRT  120

Query  474  HEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQRE  653
            H MAV+MD+DLSKGEKLLNNLGGMFSMPWKPKK+ +I GP+TSKDD N++GK+ +  +RE
Sbjct  121  HMMAVDMDRDLSKGEKLLNNLGGMFSMPWKPKKSHDIKGPRTSKDD-NYRGKESSANERE  179

Query  654  KLGLNT--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTEL  827
            KLGL+   KGKSA +TPP E  NAMQ+VE+EKAKQDDAL DLS+ILGDLKGMA DMG+EL
Sbjct  180  KLGLSNGKKGKSASSTPPPESMNAMQQVELEKAKQDDALSDLSNILGDLKGMAVDMGSEL  239

Query  828  DKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            DKQNKA+D+LD D++ELNSRVKGAN+RAR ++ K
Sbjct  240  DKQNKAIDDLDKDVEELNSRVKGANRRARQIVGK  273



>ref|XP_009600214.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Nicotiana 
tomentosiformis]
Length=273

 Score =   332 bits (850),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 179/274 (65%), Positives = 210/274 (77%), Gaps = 32/274 (12%)
 Frame = +3

Query  201  MFGFGKKppasasaspMQS-ADEPPA---ARRTSSEPNL---------------------  305
            MFGF K  P  A+ +   S +DE      ARRTSSEP L                     
Sbjct  1    MFGFRKAKPDPATTNTTPSHSDEKHGTKNARRTSSEPVLVTPDDDDFGTSSSSGTRNKNK  60

Query  306  ----NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRT  473
                +FD+MS+QELE YAVNQA+ETT SVNNCL+IAEDIRQDGAKTL+TLHKQGEQIHRT
Sbjct  61   SKTQDFDNMSMQELEGYAVNQAKETTSSVNNCLKIAEDIRQDGAKTLDTLHKQGEQIHRT  120

Query  474  HEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQRE  653
            H MAV+MD+DLSKGEKLLNNLGGMFSM WKPKK+ +I GP+TSKDD N++GK+ +  QRE
Sbjct  121  HMMAVDMDRDLSKGEKLLNNLGGMFSMTWKPKKSHDIKGPRTSKDD-NYRGKESSANQRE  179

Query  654  KLGLNT--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTEL  827
            KLGL+   KGKSA +TPP E  NAMQ+VE+EKAKQDDAL DLS+ILGDLKGMA DMG+EL
Sbjct  180  KLGLSNGKKGKSASSTPPPESMNAMQQVELEKAKQDDALSDLSNILGDLKGMAVDMGSEL  239

Query  828  DKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            DKQNKA+D+LD D++ELNSRVKGAN+RAR ++ K
Sbjct  240  DKQNKAIDDLDKDVEELNSRVKGANRRARQIVGK  273



>ref|XP_004239070.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Solanum 
lycopersicum]
Length=266

 Score =   330 bits (845),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 178/275 (65%), Positives = 208/275 (76%), Gaps = 41/275 (15%)
 Frame = +3

Query  201  MFGFGKKppasasaspMQSADEP---PAARRTSSEPNL----------------------  305
            MFGF KK  ++       + DE     A RRTSSEP L                      
Sbjct  1    MFGFRKKADSA-------TPDEKNVMKAGRRTSSEPVLVTPDDDDFGTSSSSSGGTRNKH  53

Query  306  -----NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHR  470
                 +FD+MSVQELE YAV+QA+ETT SVNNCL+IAEDIRQ+GA+TL+TLHKQGEQI+R
Sbjct  54   KSKTEDFDNMSVQELEGYAVDQAKETTSSVNNCLKIAEDIRQEGAQTLDTLHKQGEQINR  113

Query  471  THEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQR  650
            TH MAVEMD+DLSKGEKLLNNLGGMF+MPWKPKKT +I GP+TSKDD NHKG KG+  +R
Sbjct  114  THMMAVEMDRDLSKGEKLLNNLGGMFAMPWKPKKTHDIKGPRTSKDD-NHKG-KGSASER  171

Query  651  EKLGLNT--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTE  824
            EKLGL+   KGKSA +TPP E  NAMQ++E EKAKQDDAL DLS+ILGDLKGMA DMG+E
Sbjct  172  EKLGLSNGKKGKSASSTPPPESMNAMQQIESEKAKQDDALSDLSNILGDLKGMAVDMGSE  231

Query  825  LDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            LDKQNKA+D+LD D+DELNSRVKGAN+RAR ++ K
Sbjct  232  LDKQNKAIDDLDKDVDELNSRVKGANRRARQIVGK  266



>ref|XP_011075579.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Sesamum 
indicum]
 ref|XP_011075581.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Sesamum 
indicum]
Length=258

 Score =   327 bits (837),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 184/208 (88%), Gaps = 2/208 (1%)
 Frame = +3

Query  306  NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMA  485
            +FD MS QELE YAVNQAEETTKSVNNCL+IAEDIRQD  +TL+TLH+QGEQIHRTH MA
Sbjct  53   DFDSMSQQELEGYAVNQAEETTKSVNNCLKIAEDIRQDATRTLDTLHEQGEQIHRTHVMA  112

Query  486  VEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGL  665
              MDKDLSKGEKLLNNLGGMFSMPWKPKKTK ITGP+TSKDDN+ +GK+GT E+REKLGL
Sbjct  113  ANMDKDLSKGEKLLNNLGGMFSMPWKPKKTKTITGPQTSKDDND-RGKRGTAEEREKLGL  171

Query  666  NTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
             TKGK +  TPP EP NA+QK+++EKAKQDD L DLSDILG+LKGMA DMGTELD+QNKA
Sbjct  172  GTKGKGS-RTPPPEPTNALQKIDVEKAKQDDGLGDLSDILGELKGMAVDMGTELDRQNKA  230

Query  846  LDNLDTDIDELNSRVKGANQRARHLLAK  929
            LD+L  D+DELNSRVKGAN+RA+ LL K
Sbjct  231  LDDLQEDVDELNSRVKGANRRAQKLLDK  258



>ref|XP_006348809.1| PREDICTED: putative SNAP25 homologous protein SNAP30-like [Solanum 
tuberosum]
Length=265

 Score =   323 bits (828),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 173/274 (63%), Positives = 206/274 (75%), Gaps = 40/274 (15%)
 Frame = +3

Query  201  MFGFGKKppasasaspMQSADE---PPAARRTSSEPNL----------------------  305
            MFGF KK  ++       + DE       RRTSSEP L                      
Sbjct  1    MFGFRKKADSA-------TPDEKNGTKTGRRTSSEPVLVTPDDDDFGTSSSSGVTRNKHK  53

Query  306  ----NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRT  473
                +FD+MS+QELE YAV+QA+ETT SVNNCL+IAEDIRQ+GA+TL+TLHKQGEQIHRT
Sbjct  54   SKTEDFDNMSMQELEGYAVDQAKETTSSVNNCLKIAEDIRQEGAQTLDTLHKQGEQIHRT  113

Query  474  HEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQRE  653
            H MAV+MD+DLSKGEKLLNNLGGMF+MPWK KKT +I GP+TSKDD +HKG KG+  +RE
Sbjct  114  HMMAVDMDRDLSKGEKLLNNLGGMFAMPWKAKKTHDIKGPRTSKDD-SHKG-KGSASERE  171

Query  654  KLGLNT--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTEL  827
            KLGL+   KGKSA +TPP E  NAMQ++E EK+KQDDAL DLS+ILGDLKGMA DMG+EL
Sbjct  172  KLGLSNGKKGKSASSTPPPESMNAMQQIESEKSKQDDALSDLSNILGDLKGMAVDMGSEL  231

Query  828  DKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            DKQNKA+D+LD D+DELNSRVKGAN+RAR ++ K
Sbjct  232  DKQNKAIDDLDKDVDELNSRVKGANRRARQIVGK  265



>gb|EYU28841.1| hypothetical protein MIMGU_mgv1a011448mg [Erythranthe guttata]
Length=281

 Score =   319 bits (817),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 186/243 (77%), Gaps = 28/243 (12%)
 Frame = +3

Query  276  ARRTSSEPNL--------------------------NFDDMSVQELENYAVNQAEETTKS  377
            ARRTSSEP L                          + + MSVQELE YAV+QAE+TTKS
Sbjct  41   ARRTSSEPALIIPDDSDDDFFGRGPASSLRNKHKKKDLESMSVQELEGYAVDQAEQTTKS  100

Query  378  VNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMP  557
            VNNCLRIAEDIR+D  KTL+TLH+QGEQIHRTH MA +MD+DLSKGEKLLNNLGGMFSMP
Sbjct  101  VNNCLRIAEDIREDATKTLDTLHQQGEQIHRTHVMAADMDRDLSKGEKLLNNLGGMFSMP  160

Query  558  WKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEM  737
            WKPKKTK ITGPKTSKDDN   GK+ + EQREKLGL    K +  TPP EP NA+QKVE+
Sbjct  161  WKPKKTKNITGPKTSKDDNT-TGKRSSAEQREKLGLAPAHKGS-KTPPPEPTNALQKVEL  218

Query  738  EKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARH  917
            EKAKQDDAL DL DILG+LKGMA  MG+ELD+QNKALD+L  D+DELNSRVKGANQRAR 
Sbjct  219  EKAKQDDALSDLGDILGELKGMAVGMGSELDRQNKALDDLQEDVDELNSRVKGANQRARK  278

Query  918  LLA  926
            L+ 
Sbjct  279  LIG  281



>emb|CDP00411.1| unnamed protein product [Coffea canephora]
Length=284

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 178/210 (85%), Gaps = 3/210 (1%)
 Frame = +3

Query  306  NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMA  485
            + D+MSVQ+LE+YAV+QA +TT SVNNCL+IAED++QD  +TLETLH QGEQI RTH MA
Sbjct  76   DLDNMSVQQLEDYAVDQARQTTNSVNNCLKIAEDMKQDATRTLETLHAQGEQITRTHMMA  135

Query  486  VEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGL  665
             ++D+DLSKGEKLLNNLGGMFSMPWKPKKT+EITGP  ++ DNN K KK + EQREKLGL
Sbjct  136  ADLDRDLSKGEKLLNNLGGMFSMPWKPKKTREITGPMITQ-DNNSKAKKASAEQREKLGL  194

Query  666  N--TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQN  839
                KGK    TPP EP NA+QKVE+EKAKQDDAL DLS+ILGDLKGMA +MG+ELD QN
Sbjct  195  APIPKGKQTSRTPPPEPTNALQKVELEKAKQDDALSDLSNILGDLKGMALEMGSELDTQN  254

Query  840  KALDNLDTDIDELNSRVKGANQRARHLLAK  929
            KA+D+L  ++DELNSRVKGANQRAR LLAK
Sbjct  255  KAMDHLSVEVDELNSRVKGANQRARKLLAK  284



>gb|EPS65928.1| hypothetical protein M569_08848, partial [Genlisea aurea]
Length=206

 Score =   305 bits (782),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 175/207 (85%), Gaps = 1/207 (0%)
 Frame = +3

Query  306  NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMA  485
            + D MS QELE+YAV++AEETTKSVNNCL+IAEDI+QD  +TLETLH+QG+QIHRTH+MA
Sbjct  1    DLDQMSKQELESYAVDRAEETTKSVNNCLKIAEDIKQDAGRTLETLHEQGDQIHRTHDMA  60

Query  486  VEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGL  665
             +MD+DLS GEKLLNNLGGMFSMPWKPKKTK+ITGP TSKDD N+  +K ++EQR+KLGL
Sbjct  61   ADMDRDLSTGEKLLNNLGGMFSMPWKPKKTKKITGPITSKDD-NYTERKASREQRQKLGL  119

Query  666  NTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
             T G+    TPP EP NA+QKVE+EK KQDDAL DL  IL DLKGMA  MG+ELD+QNKA
Sbjct  120  TTAGRGGSVTPPPEPTNALQKVELEKTKQDDALADLGSILEDLKGMAVGMGSELDRQNKA  179

Query  846  LDNLDTDIDELNSRVKGANQRARHLLA  926
            LD+L  D++ELNSRVKGAN RAR L+ 
Sbjct  180  LDHLHGDVEELNSRVKGANHRARKLIG  206



>ref|XP_008446422.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Cucumis 
melo]
Length=300

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 167/258 (65%), Positives = 187/258 (72%), Gaps = 40/258 (16%)
 Frame = +3

Query  273  AARRTSSEPNLN------FDD--------------------------------MSVQELE  338
            AARRTSSEP L       FDD                                 SVQELE
Sbjct  44   AARRTSSEPVLPIPNANPFDDDDGFVGRKGTATSSGSKDRYKNDFRDSGGLENQSVQELE  103

Query  339  NYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGE  518
            NYAV +AEETTKSVNNCL+IAEDIR+D  KTL+ LHKQGEQI RTH MA +MDKDLSKGE
Sbjct  104  NYAVYKAEETTKSVNNCLKIAEDIREDATKTLDMLHKQGEQIERTHRMAADMDKDLSKGE  163

Query  519  KLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNT-KGKSAPTT  695
            KLLNNLGGMFS PWKPKKTKEITGP  + D ++ K  +  K+QREKLGL+T K +SA  T
Sbjct  164  KLLNNLGGMFSKPWKPKKTKEITGPLITADHSSGK-TENNKKQREKLGLSTGKKQSATKT  222

Query  696  PPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDE  875
            PP+EP  AMQKVE+EK KQDDAL DLS+ILGDLK MA DMG+ELD+QNKALD+L  D+DE
Sbjct  223  PPSEPSGAMQKVEVEKEKQDDALSDLSNILGDLKSMAVDMGSELDRQNKALDHLSDDVDE  282

Query  876  LNSRVKGANQRARHLLAK  929
            LNSRVKGANQRARHL+ K
Sbjct  283  LNSRVKGANQRARHLIGK  300



>ref|XP_004135151.1| PREDICTED: putative SNAP25 homologous protein SNAP30-like [Cucumis 
sativus]
 ref|XP_004155298.1| PREDICTED: putative SNAP25 homologous protein SNAP30-like [Cucumis 
sativus]
 gb|KGN51968.1| hypothetical protein Csa_5G606590 [Cucumis sativus]
Length=302

 Score =   305 bits (780),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 176/208 (85%), Gaps = 2/208 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV +AEETTKSVNNCL+IAEDIR+D  KTL+ LHKQGEQI RTH MA 
Sbjct  96   LENQSVQELENYAVYKAEETTKSVNNCLKIAEDIREDATKTLDMLHKQGEQIERTHRMAA  155

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            +MDKDLSKGEKLLNNLGGMFS PWKPKKTKEITGP  + D ++ K  +  KEQREKLGL+
Sbjct  156  DMDKDLSKGEKLLNNLGGMFSKPWKPKKTKEITGPLITADHSSGK-TENNKEQREKLGLS  214

Query  669  T-KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
            T K +SA  TPP+EP  A+QKVE+EK KQDDAL DLS+ILGDLK MA DMG+ELD+QNKA
Sbjct  215  TGKKQSATKTPPSEPSGAIQKVEVEKEKQDDALSDLSNILGDLKSMAVDMGSELDRQNKA  274

Query  846  LDNLDTDIDELNSRVKGANQRARHLLAK  929
            LD+L  D+DELNSRVKGANQRARHL+ K
Sbjct  275  LDHLSDDVDELNSRVKGANQRARHLIGK  302



>ref|XP_010680731.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010680732.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Beta vulgaris 
subsp. vulgaris]
Length=254

 Score =   302 bits (774),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 173/257 (67%), Positives = 194/257 (75%), Gaps = 17/257 (7%)
 Frame = +3

Query  201  MFGFGKKppasasaspMQS-ADEPPAARRTSSEP---NLNFDDM-------SVQELENYA  347
            MFGF KK  AS +ASP    AD    +RRTSSEP     ++DD        S+QELE YA
Sbjct  1    MFGFKKKSAASTAASPAHPDADTGLKSRRTSSEPISVTQDYDDTPADLENKSMQELETYA  60

Query  348  VNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLL  527
            VN+AE+TTKSVNNCLRIAEDIR+D  KTLETLH+QGEQIHRTH+MA  +D+DLSKGEKLL
Sbjct  61   VNKAEDTTKSVNNCLRIAEDIREDATKTLETLHQQGEQIHRTHQMAANIDQDLSKGEKLL  120

Query  528  NNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKL---GLNTKGKSAPTTP  698
            N+LGGMFS PWKPKK   ITGP ++ D      K  TKEQ++KL       KGK    TP
Sbjct  121  NSLGGMFSKPWKPKKAHNITGPVSAPD---KPSKSATKEQKDKLKGAAPAPKGKPGSKTP  177

Query  699  PNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDEL  878
            P E   AMQKVEMEK KQDDAL DLS+ILGDLKGMA DMG+EL+KQNKALD+LDTDIDEL
Sbjct  178  PVEQSAAMQKVEMEKEKQDDALSDLSNILGDLKGMAVDMGSELEKQNKALDHLDTDIDEL  237

Query  879  NSRVKGANQRARHLLAK  929
            NSRVKGANQRARHLL K
Sbjct  238  NSRVKGANQRARHLLNK  254



>ref|NP_172842.1| N-ethylmaleimide-sensitive factor adaptor protein 30 [Arabidopsis 
thaliana]
 sp|Q9LMG8.1|SNP30_ARATH RecName: Full=Putative SNAP25 homologous protein SNAP30; Short=AtSNAP30; 
AltName: Full=Synaptosomal-associated protein SNAP25-like 
3 [Arabidopsis thaliana]
 gb|AAF79396.1|AC068197_6 F16A14.10 [Arabidopsis thaliana]
 gb|AEE29080.1| N-ethylmaleimide-sensitive factor adaptor protein 30 [Arabidopsis 
thaliana]
Length=263

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 183/243 (75%), Gaps = 30/243 (12%)
 Frame = +3

Query  273  AARRTSSEPNL---NFDD----------------MSVQELENYAVNQAEETTKSVNNCLR  395
            A RRTSSEP L   +FDD                 + +ELE YAV +AEETTK VNNCL+
Sbjct  27   AGRRTSSEPILITPDFDDDDKYKNGFNDSGGLQSQTTEELEKYAVYKAEETTKGVNNCLK  86

Query  396  IAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKT  575
            IAEDIR DGA+TLE LH+QGEQI+RTHEMAV+MDKDLS+GEKLLNNLGGMFS PWKPKKT
Sbjct  87   IAEDIRSDGARTLEMLHQQGEQINRTHEMAVDMDKDLSRGEKLLNNLGGMFSKPWKPKKT  146

Query  576  KEITGP-----KTSKDDNNHKGKKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEME  740
            K ITGP     K SK   NH      KE+REKLGL  KG+S+     ++P NA+QKVE E
Sbjct  147  KNITGPMITPDKPSKKSENH------KEEREKLGLGAKGRSSSQPALDQPTNALQKVEQE  200

Query  741  KAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHL  920
            KAKQDD L DLSDILGDLK MA DMG+E+DKQNKALD+L  D+DELNSRV+GANQRARHL
Sbjct  201  KAKQDDGLSDLSDILGDLKSMAVDMGSEIDKQNKALDHLGDDVDELNSRVQGANQRARHL  260

Query  921  LAK  929
            L+K
Sbjct  261  LSK  263



>gb|KDP41280.1| hypothetical protein JCGZ_15687 [Jatropha curcas]
Length=245

 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 166/250 (66%), Positives = 192/250 (77%), Gaps = 12/250 (5%)
 Frame = +3

Query  201  MFGFGKKppasasaspMQSADEPPAARRTSSEPNLNFDD-----MSVQELENYAVNQAEE  365
            MFGF K P   AS    Q +D+  A++  +S  + +FDD      SVQELENYA  +AEE
Sbjct  1    MFGFMKAPANKASK---QDSDDNQASQPAASGHDQSFDDEDLENKSVQELENYAKYKAEE  57

Query  366  TTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGM  545
            TTK VNNCLRIAEDIRQD  +TL+ LH QGEQI+RTH MAV+MDKDLSKGEKLLNNLGG+
Sbjct  58   TTKGVNNCLRIAEDIRQDATRTLDMLHSQGEQINRTHMMAVDMDKDLSKGEKLLNNLGGI  117

Query  546  FSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN--TKGKSAPTTPPNEPQNA  719
            FS PWKPKKTKEITGP  + D  + KG +  KEQREKLG+   TKG+S   T   EP  A
Sbjct  118  FSKPWKPKKTKEITGPVITADKPSKKG-ENNKEQREKLGVGGKTKGQSTSATHA-EPTTA  175

Query  720  MQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGA  899
            +Q +E+EKAKQDD L +LSDILGDLKGMA DMGTELD+QNKALD+L  D+DELNSRVKGA
Sbjct  176  LQHIELEKAKQDDGLSELSDILGDLKGMAVDMGTELDRQNKALDHLSDDVDELNSRVKGA  235

Query  900  NQRARHLLAK  929
            NQRARHLL+K
Sbjct  236  NQRARHLLSK  245



>ref|XP_006306393.1| hypothetical protein CARUB_v10012302mg [Capsella rubella]
 gb|EOA39291.1| hypothetical protein CARUB_v10012302mg [Capsella rubella]
Length=263

 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/238 (66%), Positives = 181/238 (76%), Gaps = 20/238 (8%)
 Frame = +3

Query  273  AARRTSSEPNL---NFDD----------------MSVQELENYAVNQAEETTKSVNNCLR  395
            A RRTSSEP L   +FDD                 + QELENYAV +AEETTK VNNCL+
Sbjct  27   AGRRTSSEPILITPDFDDDDKYKNGFRDSGGLQSQTTQELENYAVYKAEETTKGVNNCLK  86

Query  396  IAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKT  575
            IAEDIR D  +TLE LH+QGEQI+RTH MAV+MDKDLS+GEKLLNNLGGMFS PWKPKKT
Sbjct  87   IAEDIRSDATRTLEMLHEQGEQINRTHVMAVDMDKDLSRGEKLLNNLGGMFSKPWKPKKT  146

Query  576  KEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQD  755
            K I+GP  + D  + KG+   KE+REKLGL  KG+S+   P  +P  A+QKVE EKAKQD
Sbjct  147  KNISGPMITPDKPSKKGEN-HKEEREKLGLGAKGRSSSQPPAQQPTQALQKVEQEKAKQD  205

Query  756  DALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            D L DLSDILGDLK MA DMG+E+DKQNKALD+L  D+DELNSRVKGANQRARHLL+K
Sbjct  206  DGLSDLSDILGDLKSMAVDMGSEIDKQNKALDHLGDDVDELNSRVKGANQRARHLLSK  263



>ref|XP_010523484.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Tarenaya 
hassleriana]
 ref|XP_010523485.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Tarenaya 
hassleriana]
Length=267

 Score =   300 bits (769),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 167/268 (62%), Positives = 188/268 (70%), Gaps = 26/268 (10%)
 Frame = +3

Query  201  MFGFGKKppasasaspMQSADEPPAARRTSSEPNL---NFDDMS----------------  323
            MFGF K P  + S          P  RRTSSEP L   +FD  S                
Sbjct  1    MFGFFKSPGNNLSNESNSKGTINPG-RRTSSEPILITPDFDHPSSKDKYKDDFRDSGGLQ  59

Query  324  ---VQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEM  494
                ++LE YAV +AEETTK VNNCL+IAEDIR D  +TL+ LH+QGEQI+RTH MAVEM
Sbjct  60   SQTTEDLEKYAVYKAEETTKGVNNCLKIAEDIRSDATRTLDMLHQQGEQINRTHVMAVEM  119

Query  495  DKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGL---  665
            DKDLS+GEKLLNNLGGMFSMPWKPKKTK I GP  +  DN  K  +  KEQREKLGL   
Sbjct  120  DKDLSRGEKLLNNLGGMFSMPWKPKKTKHIAGPMITPADNPSKQSENRKEQREKLGLAPT  179

Query  666  NTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
              KG+S   TPP EP NA+QKVE EKAKQ+D L DLSDILGDLK MA DMG+ELD+QNKA
Sbjct  180  GNKGRSRSQTPPPEPTNALQKVEQEKAKQEDGLSDLSDILGDLKSMAVDMGSELDRQNKA  239

Query  846  LDNLDTDIDELNSRVKGANQRARHLLAK  929
            LD+L  D+DELNSRVKGANQRARHLL+K
Sbjct  240  LDHLSDDVDELNSRVKGANQRARHLLSK  267



>ref|XP_009356376.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Pyrus x 
bretschneideri]
Length=258

 Score =   300 bits (767),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 156/226 (69%), Positives = 174/226 (77%), Gaps = 13/226 (6%)
 Frame = +3

Query  276  ARRTSSEPNLNFDDMS----------VQELENYAVNQAEETTKSVNNCLRIAEDIRQDGA  425
            ARRTSSEP L   D S          +QELE YAVN++EETTKSVNNCLRIAEDIR D  
Sbjct  35   ARRTSSEPMLITPDFSNEKKPLEQQSMQELEKYAVNKSEETTKSVNNCLRIAEDIRGDAT  94

Query  426  KTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSK  605
            +TL+ LH+QGEQI RTH  AV++DKDLS+GEK+LNNLGGMFSMPWKPKKTK+I+GP  S 
Sbjct  95   RTLDMLHQQGEQITRTHMAAVDIDKDLSRGEKILNNLGGMFSMPWKPKKTKDISGPDLSL  154

Query  606  DDNNHKGKKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDIL  785
                   KK   +QREKLGL  KG+SAP TPP E   AMQKVE EKAKQDD L DLS+IL
Sbjct  155  ASAT---KKADPQQREKLGLGPKGRSAPATPPPEGSGAMQKVEYEKAKQDDGLSDLSNIL  211

Query  786  GDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
            GDLKGMA DMG ELD+QNKA+DNL  DIDE+NSRVKGANQR R LL
Sbjct  212  GDLKGMAMDMGNELDRQNKAIDNLSDDIDEVNSRVKGANQRTRRLL  257



>ref|XP_008389414.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Malus domestica]
 ref|XP_008389415.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Malus domestica]
Length=258

 Score =   297 bits (760),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 174/226 (77%), Gaps = 13/226 (6%)
 Frame = +3

Query  276  ARRTSSEPNLNFDDMS----------VQELENYAVNQAEETTKSVNNCLRIAEDIRQDGA  425
            ARRTSSEP L   D S          +QELE YAVN++EETTKSVNNCLRIAE+IR D  
Sbjct  35   ARRTSSEPMLITPDFSNEKKPLEQQSMQELEKYAVNKSEETTKSVNNCLRIAENIRGDAT  94

Query  426  KTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSK  605
            +TL+ LH+QGEQI RTH  AV++DKDLS+GEK+LNNLGGMFSMPWKPKKTK+I+GP  S 
Sbjct  95   RTLDMLHQQGEQITRTHMAAVDIDKDLSRGEKILNNLGGMFSMPWKPKKTKDISGPDLSL  154

Query  606  DDNNHKGKKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDIL  785
                   KK   +QREKLGL  KG+SAP TPP E   AMQKVE EKAKQDD L DLS+IL
Sbjct  155  ---ASAPKKADPQQREKLGLGPKGRSAPATPPPEGSGAMQKVEYEKAKQDDGLSDLSNIL  211

Query  786  GDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
            GDLKGMA DMG ELD+QN+A+DNL  DIDE+NSRVKGANQR R LL
Sbjct  212  GDLKGMAMDMGNELDRQNRAIDNLSDDIDEVNSRVKGANQRTRRLL  257



>ref|XP_008361774.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Malus domestica]
Length=248

 Score =   296 bits (757),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 176/226 (78%), Gaps = 14/226 (6%)
 Frame = +3

Query  276  ARRTSSEPNLNFDDMS----------VQELENYAVNQAEETTKSVNNCLRIAEDIRQDGA  425
            ARRTSSEP L   D S          +QELE YAVN+AEETTKSVNNCLRIAEDIR D  
Sbjct  26   ARRTSSEPMLVTPDFSNEKKPLEQQSMQELEKYAVNKAEETTKSVNNCLRIAEDIRGDAT  85

Query  426  KTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSK  605
            +TL+ LH+QGEQI RTH  AV++DKDLS+GEK+LNNLGGMFSMPWKPKKTK+I+GP    
Sbjct  86   RTLDMLHQQGEQITRTHMAAVDIDKDLSRGEKILNNLGGMFSMPWKPKKTKDISGP----  141

Query  606  DDNNHKGKKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDIL  785
            D +    KK   +Q+EKLG+  KG+SAP TPP E   A+QKVE EKAKQ+DAL DLS+IL
Sbjct  142  DFSLAAPKKADPQQKEKLGIAPKGRSAPATPPPEGSGALQKVEHEKAKQEDALSDLSNIL  201

Query  786  GDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
            GDLKGMA DMG+E+D+QNKA+DNL  D+DELN RVKGANQR R LL
Sbjct  202  GDLKGMAMDMGSEIDRQNKAIDNLSDDVDELNXRVKGANQRTRRLL  247



>ref|XP_011018220.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Populus 
euphratica]
 ref|XP_011018226.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Populus 
euphratica]
Length=282

 Score =   295 bits (754),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 166/285 (58%), Positives = 191/285 (67%), Gaps = 45/285 (16%)
 Frame = +3

Query  201  MFGFGKKppasasaspMQSADEPPAA---------------------RRTSSEPNLN---  308
            MFGF K P  +      QS   PPA+                     +RTSSEP LN   
Sbjct  1    MFGFRKSPANNKPTK--QSPVNPPASFTSNPFDSDDESNAKQALHHGKRTSSEPMLNVPS  58

Query  309  --FDD----------------MSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTL  434
              FDD                 SVQELE YA  +AEETTKSV NCLRIAEDIRQD  +TL
Sbjct  59   DAFDDREGYKNDFRDSGGLENQSVQELEKYATYKAEETTKSVTNCLRIAEDIRQDATRTL  118

Query  435  ETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDN  614
            + LH QGEQI RTH MAV+MDKDL KGEKLLNNLGG+FS PWKPKKT++ITGP  + D  
Sbjct  119  DMLHAQGEQITRTHNMAVDMDKDLGKGEKLLNNLGGIFSKPWKPKKTRDITGPLITADKP  178

Query  615  NHKGKKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDL  794
            + K  +  + +REKLGL  +G SAP TPP EP +A+QKVE EK KQDDAL DLS+ILGDL
Sbjct  179  S-KLNQYNRGEREKLGLAPRGHSAPITPPPEPSSALQKVEAEKGKQDDALSDLSNILGDL  237

Query  795  KGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            KGMA DMG+EL++QNK+LD+L  D+DELNSRVKGANQRAR LL K
Sbjct  238  KGMAIDMGSELNRQNKSLDHLSDDVDELNSRVKGANQRARRLLGK  282



>ref|XP_002890026.1| synaptosomal-associated protein 30 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66285.1| synaptosomal-associated protein 30 [Arabidopsis lyrata subsp. 
lyrata]
Length=264

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 160/245 (65%), Positives = 182/245 (74%), Gaps = 33/245 (13%)
 Frame = +3

Query  273  AARRTSSEPNL---NFDD----------------MSVQELENYAVNQAEETTKSVNNCLR  395
            A RRTSSEP L   +FDD                 + +ELENYAV +AEETTK VNNCL+
Sbjct  27   AGRRTSSEPILITPDFDDDDKYKNGFSDSGGLQSQTTEELENYAVYKAEETTKGVNNCLK  86

Query  396  IAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKT  575
            IAEDIR D  +TLE LH+QGEQI+RTH MAV+MDKDLS+GEKLLNNLGGMFS PWKPKKT
Sbjct  87   IAEDIRSDATRTLEMLHQQGEQINRTHVMAVDMDKDLSRGEKLLNNLGGMFSKPWKPKKT  146

Query  576  KEITGP-----KTSKDDNNHKGKKGTKEQREKLGLNTKGKSAPTTPP--NEPQNAMQKVE  734
            K ITGP     K SK   NH      KE+REKLGL  KG+S+ + P    +P NA+QKVE
Sbjct  147  KNITGPMITPDKPSKKSENH------KEEREKLGLGAKGRSS-SQPSGLGQPTNALQKVE  199

Query  735  MEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRAR  914
             EKAKQDD L DLSDILGDLK MA DMG+E+DKQNKALD+L  D+DELNSRV+GANQRAR
Sbjct  200  QEKAKQDDGLSDLSDILGDLKSMAVDMGSEIDKQNKALDHLGDDVDELNSRVQGANQRAR  259

Query  915  HLLAK  929
            HLL+K
Sbjct  260  HLLSK  264



>ref|XP_010527952.1| PREDICTED: putative SNAP25 homologous protein SNAP30 isoform 
X2 [Tarenaya hassleriana]
Length=263

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 180/240 (75%), Gaps = 23/240 (10%)
 Frame = +3

Query  276  ARRTSSEPNL-------------NFDD------MSVQELENYAVNQAEETTKSVNNCLRI  398
             RRTSSEP L              F D       + +ELENYAV +AEETTK+VNNCL+I
Sbjct  25   GRRTSSEPILMIPEFGREDYYKSEFRDSGGLQSQTTEELENYAVYKAEETTKNVNNCLKI  84

Query  399  AEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTK  578
            AEDIR D  +TL+ LH+QGEQI+RTH MA+EMDKDLS+GEKLLNNLGGMFS PWKPKK K
Sbjct  85   AEDIRSDATRTLDMLHQQGEQINRTHVMAIEMDKDLSRGEKLLNNLGGMFSKPWKPKKNK  144

Query  579  EITGPKTSKDDNNHKGKKGTKEQREKLGL---NTKGKSAPTTPPNEPQNAMQKVEMEKAK  749
            +ITGP  +  DN  K  +  KEQREKLGL     KG+S   TPP EP NA+Q+VE EKAK
Sbjct  145  QITGPMITP-DNPSKQSENRKEQREKLGLVPAGNKGRSHSQTPPPEPTNALQRVEQEKAK  203

Query  750  QDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            Q+D L DL+DILGD+K MA DMG+ELD+QNKALD+L  D+DELNSRVKGANQRARHLL+K
Sbjct  204  QEDGLSDLNDILGDMKSMAVDMGSELDRQNKALDHLSDDVDELNSRVKGANQRARHLLSK  263



>ref|XP_004490150.1| PREDICTED: putative SNAP25 homologous protein SNAP30-like isoform 
X1 [Cicer arietinum]
 ref|XP_004490151.1| PREDICTED: putative SNAP25 homologous protein SNAP30-like isoform 
X2 [Cicer arietinum]
Length=297

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 172/209 (82%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV ++EETT SVNNCLRIAEDIRQD  KTL+ LH+QG+QI RTH M V
Sbjct  90   LENQSVQELENYAVYKSEETTNSVNNCLRIAEDIRQDATKTLDMLHQQGDQITRTHNMVV  149

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            + +KDLS+GEKLLNNLGGMFS PWKPKKT++I GP  + D+++ K  K  KE REKLGL 
Sbjct  150  DTEKDLSRGEKLLNNLGGMFSKPWKPKKTRDIQGPVITSDNSSKKNIK-NKEDREKLGLA  208

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               KG+SAPT+PP+E  NA QK++ EKAKQDDAL DLSDILGDLKGMA  MGTELD QNK
Sbjct  209  PLPKGRSAPTSPPSESANAYQKIDYEKAKQDDALSDLSDILGDLKGMAISMGTELDSQNK  268

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD+L  D+DELNSRVKGANQRAR L+AK
Sbjct  269  ALDHLSDDVDELNSRVKGANQRARKLVAK  297



>ref|XP_006438803.1| hypothetical protein CICLE_v10033712mg [Citrus clementina]
 ref|XP_006483057.1| PREDICTED: putative SNAP25 homologous protein SNAP30-like [Citrus 
sinensis]
 gb|ESR52043.1| hypothetical protein CICLE_v10033712mg [Citrus clementina]
Length=275

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 157/244 (64%), Positives = 179/244 (73%), Gaps = 29/244 (12%)
 Frame = +3

Query  276  ARRTSSEPNL-----------------------NFDDMSVQELENYAVNQAEETTKSVNN  386
            ARRTSSEP L                         ++ SVQELENYAV +AEETT SVNN
Sbjct  35   ARRTSSEPVLITPDFSNDHKGRDHYKNDFRDSGGLENQSVQELENYAVYKAEETTNSVNN  94

Query  387  CLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKP  566
            CL+IAE+IR+D  KTL+ LH+QGEQIHRTH M  + +KDLSKGEK LNNLGGMFS  WKP
Sbjct  95   CLKIAENIREDATKTLDMLHQQGEQIHRTHNMVADTEKDLSKGEKQLNNLGGMFSKTWKP  154

Query  567  KKTKEITGPKTSKDDNNHKGKKGT-KEQREKLGLN--TKGKSAPTTPPNEPQNAMQKVEM  737
            KKT+ I GP  + D   H  KKG  K +REKLG+    K +SA  TPP EP NAMQKVEM
Sbjct  155  KKTRNIAGPLDTPD---HSSKKGVNKGEREKLGVAPVPKPRSAGRTPPPEPANAMQKVEM  211

Query  738  EKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARH  917
            EKA+QDDAL DLS+ILGDLKGMA DMG+ELD+QNK+LD+LD D+DELNSRVKGANQRARH
Sbjct  212  EKAEQDDALSDLSNILGDLKGMAVDMGSELDRQNKSLDHLDADVDELNSRVKGANQRARH  271

Query  918  LLAK  929
            LL K
Sbjct  272  LLGK  275



>ref|XP_009117957.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Brassica 
rapa]
 emb|CDY33792.1| BnaA09g45980D [Brassica napus]
 emb|CDY16118.1| BnaC08g40050D [Brassica napus]
Length=266

 Score =   290 bits (742),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 179/240 (75%), Gaps = 22/240 (9%)
 Frame = +3

Query  273  AARRTSSEPNL---NFDD-----------------MSVQELENYAVNQAEETTKSVNNCL  392
            A RRTSSEP L   +FD+                  + ++LE YAV +AEETTK VNNCL
Sbjct  28   AGRRTSSEPVLITPDFDEDDDKYKKGFSNSGDLQSQTTEDLEKYAVYKAEETTKGVNNCL  87

Query  393  RIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKK  572
            +IAEDIR D  +TL+ LH QGEQI+RTH MAVEMDKDL +GEKLLN+LGGMFS PWKPKK
Sbjct  88   KIAEDIRSDATRTLDMLHAQGEQINRTHVMAVEMDKDLGRGEKLLNSLGGMFSKPWKPKK  147

Query  573  TKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKGKSAPT-TPPNEPQNAMQKVEMEKAK  749
             KEI GP  + D  + K     KE+REKLGL  KG+S+    P ++P NAMQKVE EKAK
Sbjct  148  GKEIAGPMITPDKASKKSAN-NKEEREKLGLAAKGRSSSQPIPSDQPTNAMQKVEQEKAK  206

Query  750  QDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            QDD L DLSDILGDLKGMA DMG+ELDKQNKALD+LD DIDELN+RV+GANQRARHLL+K
Sbjct  207  QDDGLSDLSDILGDLKGMALDMGSELDKQNKALDHLDGDIDELNNRVQGANQRARHLLSK  266



>ref|XP_003517824.1| PREDICTED: putative SNAP25 homologous protein SNAP30-like [Glycine 
max]
 gb|KHN03632.1| Putative SNAP25 like protein SNAP30 [Glycine soja]
Length=280

 Score =   290 bits (743),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 170/208 (82%), Gaps = 3/208 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV ++EETTKSVNNCLRIAEDIR D  +TL+ LH+QGEQI RTH M V
Sbjct  74   LENQSVQELENYAVYKSEETTKSVNNCLRIAEDIRGDATRTLDMLHQQGEQITRTHNMVV  133

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            + +KDLS+GEKLLNNLGGMFS PWKPKKT+EI GP  + D  + K    +KE REKLGL 
Sbjct  134  DTEKDLSRGEKLLNNLGGMFSKPWKPKKTREIQGPIITPDKPSKKNVH-SKEDREKLGLA  192

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               KG+SAPTTPPNE  +A QKV+ EKAKQDDAL+DLSDILGDLKGMA  MG+ELDKQNK
Sbjct  193  PLPKGRSAPTTPPNESSDAYQKVDYEKAKQDDALEDLSDILGDLKGMAISMGSELDKQNK  252

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLA  926
            ALD+L  D+DELNSRVKGANQRAR L+ 
Sbjct  253  ALDHLADDVDELNSRVKGANQRARKLVG  280



>ref|XP_003614024.1| SNAP25 homologous protein SNAP33 [Medicago truncatula]
 gb|AES96982.1| soluble N-ethylmaleimide-sensitive factor adaptor protein [Medicago 
truncatula]
Length=271

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 164/277 (59%), Positives = 188/277 (68%), Gaps = 40/277 (14%)
 Frame = +3

Query  201  MFGFGKKppasasaspMQSADEPPAARRTSSEPNL-------------------------  305
            MFGF +K P   +     +A  P  ARRTSSEP L                         
Sbjct  1    MFGF-RKAPPPTTEPEKTTAITP--ARRTSSEPVLPVPKSKGNYFDEDDDDDWGRKPASS  57

Query  306  -----NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHR  470
                   ++ SVQELENYAVN+AEETT SVNNCLRIAEDIR D  +TL+ LH+QG+QI R
Sbjct  58   AASKGGLENQSVQELENYAVNKAEETTNSVNNCLRIAEDIRSDATRTLDMLHQQGDQITR  117

Query  471  THEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKG--TKE  644
            TH M V+ +KDLS+GEKLLNNLGGMFS PWKPKK K ITGP  + D   H  KK   +KE
Sbjct  118  THNMVVDTEKDLSRGEKLLNNLGGMFSKPWKPKKGKAITGPVITSD---HTSKKDVMSKE  174

Query  645  QREKLGLN--TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMG  818
             R KLGL    KG+SAPTTPPNE  NA QK++ EKAKQDD L +LSDILGDLKGMA  MG
Sbjct  175  DRAKLGLAPLPKGRSAPTTPPNESDNAYQKIDYEKAKQDDGLSELSDILGDLKGMAISMG  234

Query  819  TELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            TELD QNKALD+L  D+DELN+R+KGANQRAR L+AK
Sbjct  235  TELDSQNKALDHLGDDVDELNNRMKGANQRARKLVAK  271



>ref|XP_003520109.1| PREDICTED: putative SNAP25 homologous protein SNAP30-like [Glycine 
max]
 gb|KHN30003.1| Putative SNAP25 like protein SNAP30 [Glycine soja]
Length=280

 Score =   287 bits (735),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 167/208 (80%), Gaps = 3/208 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV ++EETT SVNNCLRIAEDIR D  +TL+ LH+QGEQI RTH M V
Sbjct  74   LENQSVQELENYAVYKSEETTNSVNNCLRIAEDIRGDATRTLDMLHQQGEQITRTHNMVV  133

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            + +KDLS+GEKLLNNLGGMFS PWKPKKT+EI GP  + D  + K     KE REKLGL 
Sbjct  134  DTEKDLSRGEKLLNNLGGMFSKPWKPKKTREIQGPIITPDKPSKKNVH-NKEDREKLGLA  192

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               KG+SAPTTPPNE  NA QKVE EKAKQDDAL+DLS ILGDLKGMA  MG+ELDKQNK
Sbjct  193  PLPKGRSAPTTPPNESSNAYQKVEHEKAKQDDALEDLSGILGDLKGMAIGMGSELDKQNK  252

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLA  926
            ALD+L  D+DELNSRVKGANQRAR L+ 
Sbjct  253  ALDHLGDDVDELNSRVKGANQRARKLVG  280



>ref|XP_007045922.1| Soluble N-ethylmaleimide-sensitive factor adaptor protein 30, 
putative isoform 2 [Theobroma cacao]
 gb|EOY01754.1| Soluble N-ethylmaleimide-sensitive factor adaptor protein 30, 
putative isoform 2 [Theobroma cacao]
Length=295

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 173/205 (84%), Gaps = 3/205 (1%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            ++++LENYAV +AEETT +VNNCL+IAE+IR+D  +TL+TLH+QGEQI RTH MAV++DK
Sbjct  92   TMEDLENYAVYKAEETTSTVNNCLKIAENIREDATRTLDTLHQQGEQIERTHAMAVDIDK  151

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKGK  680
            DLSKGEKLLN+LGGMFS PWKPKKT+EI GP  +   ++ K  +  KEQREKLGL    K
Sbjct  152  DLSKGEKLLNSLGGMFSKPWKPKKTREIAGPVVTSAKSSKKS-ENQKEQREKLGLAPVPK  210

Query  681  SAP--TTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
            + P   TPP EP NA+QKVE+EKAKQDDAL DLS+ILGDLKGMA +MG+ELD+QNKALD+
Sbjct  211  AKPGSKTPPPEPTNAIQKVELEKAKQDDALSDLSNILGDLKGMAVEMGSELDRQNKALDH  270

Query  855  LDTDIDELNSRVKGANQRARHLLAK  929
            L  D+DELNSRVKGANQRAR+LLAK
Sbjct  271  LHDDVDELNSRVKGANQRARNLLAK  295



>ref|XP_011015772.1| PREDICTED: putative SNAP25 homologous protein SNAP30, partial 
[Populus euphratica]
Length=250

 Score =   281 bits (719),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 169/207 (82%), Gaps = 2/207 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ +VQELE YA  +AEETT SVNNCLRIAEDI+QD  +TL+ LH QGEQI RTH MAV
Sbjct  46   LENQNVQELEKYAAYKAEETTNSVNNCLRIAEDIKQDATRTLDMLHAQGEQITRTHNMAV  105

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            +MDKDLSKGEKLLNNLGG+FS PWKPKK+++IT P  + D  +   +   K +REKLGL 
Sbjct  106  DMDKDLSKGEKLLNNLGGIFSKPWKPKKSRDITEPLIATDKPSEVNQY-IKGEREKLGLA  164

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
             KG+SA TTPP EP NA+Q+VE+EKAKQD+AL DLS+ILGDLKGMA DMG+ELD+QNKAL
Sbjct  165  PKGRSAITTPPPEPTNALQEVEVEKAKQDEALSDLSNILGDLKGMAVDMGSELDRQNKAL  224

Query  849  DNLDTDIDELNSRVKGANQRARHLLAK  929
            D+L  D+DELNSRVK ANQR RHLL K
Sbjct  225  DHL-GDVDELNSRVKRANQRTRHLLGK  250



>ref|XP_007157584.1| hypothetical protein PHAVU_002G081500g [Phaseolus vulgaris]
 ref|XP_007157585.1| hypothetical protein PHAVU_002G081500g [Phaseolus vulgaris]
 gb|ESW29578.1| hypothetical protein PHAVU_002G081500g [Phaseolus vulgaris]
 gb|ESW29579.1| hypothetical protein PHAVU_002G081500g [Phaseolus vulgaris]
Length=281

 Score =   281 bits (718),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 170/214 (79%), Gaps = 13/214 (6%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV ++EETTKSV+NCLRIAEDIR +  KTLE LH+QG+QI RTH M V
Sbjct  74   LENQSVQELENYAVYKSEETTKSVDNCLRIAEDIRGEATKTLEMLHEQGDQITRTHNMVV  133

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGP-----KTSKDDNNHKGKKGTKEQRE  653
            + +KDLS+GEKLLNNLGGMFS PWKPKKTK I GP     KT K D ++      KE RE
Sbjct  134  DTEKDLSRGEKLLNNLGGMFSKPWKPKKTKNIQGPVITPEKTGKKDIHN------KEDRE  187

Query  654  KLGLN--TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTEL  827
            KLGL    KG+SAPTTPPNE  +A QKV+ EKAKQDDAL DLSDILGDLKGMA  MG+EL
Sbjct  188  KLGLAPVPKGRSAPTTPPNESDSAYQKVDYEKAKQDDALSDLSDILGDLKGMAIGMGSEL  247

Query  828  DKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            D+QNKALD+L  D+DE+NSRVKGANQRAR L+ K
Sbjct  248  DRQNKALDHLGDDVDEMNSRVKGANQRARKLVDK  281



>ref|XP_004298390.1| PREDICTED: putative SNAP25 homologous protein SNAP30-like [Fragaria 
vesca subsp. vesca]
Length=284

 Score =   281 bits (718),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 189/287 (66%), Gaps = 47/287 (16%)
 Frame = +3

Query  201  MFGFGKKppasasaspMQSADEPPA----------ARRTSSEPNLNFDDM----------  320
            MFGF K P   A  S +      PA          ARRTSSEP L   DM          
Sbjct  1    MFGFMKSPAKIAKQSSVDPGALDPATKSDGAKITPARRTSSEPVLITPDMGDEKHGRPRT  60

Query  321  ---------------------SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLE  437
                                 SVQELENYAV ++EETTKSVNNCL+IAEDIR+    TL+
Sbjct  61   RGTSPASYQNDFRDSGGLENQSVQELENYAVYKSEETTKSVNNCLKIAEDIRESATTTLD  120

Query  438  TLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNN  617
            TLH+QG+QI+RTH  AV++D+DLSKGEKLLN LGG+FS PWK KKTKEI GP  S    +
Sbjct  121  TLHQQGDQINRTHMAAVDIDRDLSKGEKLLNGLGGIFSKPWKAKKTKEINGPDMSAASTS  180

Query  618  HKGKKGTKEQREKLGLNTK---GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILG  788
               K  TK QREKLG++     G+SAP TPP E  +A+Q+VE EKAKQDDAL DLS+ILG
Sbjct  181  ---KGATKAQREKLGISPAPKGGRSAPRTPPPEGASAIQQVEAEKAKQDDALSDLSNILG  237

Query  789  DLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            DLKGMATDMG+EL++QNKA+D+L  D+DELNSR+KGANQR R LL K
Sbjct  238  DLKGMATDMGSELERQNKAMDHLSEDVDELNSRMKGANQRTRRLLGK  284



>ref|XP_002312278.1| SNAP25 homologous protein SNAP30 [Populus trichocarpa]
 gb|ABK93599.1| unknown [Populus trichocarpa]
 gb|EEE89645.1| SNAP25 homologous protein SNAP30 [Populus trichocarpa]
Length=282

 Score =   280 bits (717),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 169/285 (59%), Positives = 193/285 (68%), Gaps = 45/285 (16%)
 Frame = +3

Query  201  MFGFGKKppasasaspMQSADEPPAA---------------------RRTSSEPNLN---  308
            MFGF K P  +      QS+  PPA+                     +RT SEP LN   
Sbjct  1    MFGFRKSPANNKPTK--QSSVNPPASFTSNPFDSDDESNAKQTLHHGKRTYSEPMLNVPN  58

Query  309  --FDD----------------MSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTL  434
              FDD                 SVQELE YA  +AEETTKSVNNCLRIAEDIRQD  +TL
Sbjct  59   DAFDDRDGYKNDFRDSGGLENQSVQELEKYATYKAEETTKSVNNCLRIAEDIRQDATRTL  118

Query  435  ETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDN  614
            + LH QGEQI RTH MAV+MDKDL KGEKLLNNLGG+FS PWKPKKT++ITGP  + D  
Sbjct  119  DMLHAQGEQITRTHNMAVDMDKDLGKGEKLLNNLGGIFSKPWKPKKTRDITGPLITADKP  178

Query  615  NHKGKKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDL  794
            + K  +  + +REKLGL  +G+SAPTTPP EP NA+QKVE EK KQDDAL DLS+ILGDL
Sbjct  179  S-KLNQYNRGEREKLGLAPRGRSAPTTPPPEPTNALQKVEAEKGKQDDALSDLSNILGDL  237

Query  795  KGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            KGMA DMG+ELD QNK+LD+L  D+DELNSRVKGANQRAR LL K
Sbjct  238  KGMAIDMGSELDSQNKSLDHLSDDVDELNSRVKGANQRARRLLGK  282



>ref|XP_010476417.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Camelina 
sativa]
 ref|XP_010476418.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Camelina 
sativa]
Length=263

 Score =   279 bits (713),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 158/238 (66%), Positives = 182/238 (76%), Gaps = 20/238 (8%)
 Frame = +3

Query  273  AARRTSSEPNL---NFDD----------------MSVQELENYAVNQAEETTKSVNNCLR  395
            A RRTSSEP L   +FDD                 + +ELENYAV +AEETTK VNNCL+
Sbjct  27   AGRRTSSEPILVTPDFDDDDKYKNGFRDSGGLQSQTTEELENYAVYKAEETTKGVNNCLK  86

Query  396  IAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKT  575
            IAEDIR D  +TLE LH QGEQI+RTHEMAV+MDKDLS+GEKLLNNLGGMFS PWKPKKT
Sbjct  87   IAEDIRSDATRTLEMLHDQGEQINRTHEMAVDMDKDLSRGEKLLNNLGGMFSKPWKPKKT  146

Query  576  KEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQD  755
            K I+GP  + D  + KG+   KE+REKLGL  KG+S+     ++P NA+QKVE EKAKQD
Sbjct  147  KTISGPMITPDKPSKKGEN-HKEEREKLGLGGKGRSSSQPALDQPTNALQKVEQEKAKQD  205

Query  756  DALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            D L DLSDILGDLK MA DMG+E+DKQNKALD+L  D+DELNSRVKGANQRARHLL+K
Sbjct  206  DGLSDLSDILGDLKSMAVDMGSEIDKQNKALDHLGDDVDELNSRVKGANQRARHLLSK  263



>ref|XP_006417081.1| hypothetical protein EUTSA_v10008501mg [Eutrema salsugineum]
 gb|ESQ35434.1| hypothetical protein EUTSA_v10008501mg [Eutrema salsugineum]
Length=264

 Score =   279 bits (713),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 162/244 (66%), Positives = 182/244 (75%), Gaps = 31/244 (13%)
 Frame = +3

Query  273  AARRTSSEPNL---NFDD----------------MSVQELENYAVNQAEETTKSVNNCLR  395
            A RRTSSEP L   +FDD                 + +ELENYAV +AEETTK VNNCL+
Sbjct  27   AGRRTSSEPILITPDFDDEDKYKNGFRDSGGLQSQTTEELENYAVYKAEETTKGVNNCLK  86

Query  396  IAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKT  575
            IAEDI+ D  +TLE LH QGEQI+RTH MAVEMDKDLS+GEKLLNNLGGMFS PWKPKK+
Sbjct  87   IAEDIKSDATRTLEMLHTQGEQINRTHVMAVEMDKDLSRGEKLLNNLGGMFSKPWKPKKS  146

Query  576  KEITGP-----KTSKDDNNHKGKKGTKEQREKLGLNTKGKSAPTTPP-NEPQNAMQKVEM  737
            KEI GP     K SK   NH      KE+REKLGL  KG+S+   PP N+P NA+QKVE 
Sbjct  147  KEIAGPMITPDKASKKSGNH------KEEREKLGLGGKGRSSSQPPPLNQPTNALQKVEQ  200

Query  738  EKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARH  917
            EKAKQDD L DLSDILGDLK MA DMG+EL+KQNKALD+L  D+DELNSRVKGANQRARH
Sbjct  201  EKAKQDDGLSDLSDILGDLKSMAVDMGSELEKQNKALDHLGDDVDELNSRVKGANQRARH  260

Query  918  LLAK  929
            LL+K
Sbjct  261  LLSK  264



>ref|XP_010495643.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Camelina 
sativa]
 ref|XP_010495647.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Camelina 
sativa]
Length=261

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 192/263 (73%), Gaps = 22/263 (8%)
 Frame = +3

Query  201  MFGFGKKppasasaspMQSADEPPAARRTSSEPNL---NFDD----------------MS  323
            MFGF K P  +   +   S     A RRTSSEP L   +FDD                 +
Sbjct  1    MFGFFKSPGNNKLPNE-SSGGTITAGRRTSSEPILITPDFDDDDKYKNGFRDSGGLQSQT  59

Query  324  VQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKD  503
             +ELENYAV +AEETTK VNNCL+IAEDIR D  +TLE LH QGEQI+RTH MAV+MDKD
Sbjct  60   TEELENYAVYKAEETTKGVNNCLKIAEDIRSDATRTLEMLHDQGEQINRTHAMAVDMDKD  119

Query  504  LSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKGKS  683
            LS+GEKLLNNLGGMFS PWKPKKTK I+GP  + D  + KG+   KE+REKLGL  KG+S
Sbjct  120  LSRGEKLLNNLGGMFSKPWKPKKTKTISGPMITPDKPSKKGEN-HKEEREKLGLGGKGRS  178

Query  684  APTTPP-NEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLD  860
            +   P  ++P NA+QKVE+EKAKQDD L DLSDILGDLK MA DMG+E+DKQNKALD+L 
Sbjct  179  SSQPPALDQPTNALQKVELEKAKQDDGLSDLSDILGDLKSMAVDMGSEIDKQNKALDHLG  238

Query  861  TDIDELNSRVKGANQRARHLLAK  929
             D+DELNSRVKGANQRARHLL+K
Sbjct  239  DDVDELNSRVKGANQRARHLLSK  261



>gb|KDO83098.1| hypothetical protein CISIN_1g023155mg [Citrus sinensis]
Length=286

 Score =   278 bits (712),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 155/255 (61%), Positives = 176/255 (69%), Gaps = 40/255 (16%)
 Frame = +3

Query  276  ARRTSSEPNL-----------------------NFDDMSVQELENYAVNQAEETTKSVNN  386
            ARRTSSEP L                         ++ SVQELENYAV +AEETT SVNN
Sbjct  35   ARRTSSEPVLITPDFSNDHKGRDHYKNDFRDSGGLENQSVQELENYAVYKAEETTNSVNN  94

Query  387  CLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKP  566
            CL+IAE+IR+D  KTL+ LH+QGEQIHRTH M  + +KDLSKGEK LNNLGGMFS  WKP
Sbjct  95   CLKIAENIREDATKTLDMLHQQGEQIHRTHNMVTDTEKDLSKGEKQLNNLGGMFSKTWKP  154

Query  567  KKTKEITGPKTSKDDNNHKGKKGT-KEQREKLGLN--TKGKSAPTTPPNEPQNAMQKVE-  734
            KKT+ I GP  + D   H  KKG  K +REKLG+    K +SA  TPP EP NAMQKVE 
Sbjct  155  KKTRNIAGPLDTPD---HSSKKGVNKGEREKLGVAPVPKPRSAGRTPPPEPANAMQKVET  211

Query  735  ----------MEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNS  884
                        K KQDDAL DLS+ILGDLKGMA DMG+ELD+QNK+LD+LD D+DELNS
Sbjct  212  GIYLRVIKTRWRKPKQDDALSDLSNILGDLKGMAVDMGSELDRQNKSLDHLDADVDELNS  271

Query  885  RVKGANQRARHLLAK  929
            RVKGANQRARHLL K
Sbjct  272  RVKGANQRARHLLGK  286



>ref|XP_010458853.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Camelina 
sativa]
 ref|XP_010458854.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Camelina 
sativa]
Length=261

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 165/263 (63%), Positives = 190/263 (72%), Gaps = 22/263 (8%)
 Frame = +3

Query  201  MFGFGKKppasasaspMQSADEPPAARRTSSEPNL---NFDD----------------MS  323
            MFGF K P  +   +   S     A RRTSSEP L   +FDD                 +
Sbjct  1    MFGFFKSPGNNKLPNE-SSGGTITAGRRTSSEPILITPDFDDDDKYKNGFRDSGGLQSQT  59

Query  324  VQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKD  503
             +ELENYAV +AEETTK VNNCL+IAEDIR D  +TLE LH QGEQI+RTH MAV+MDKD
Sbjct  60   TEELENYAVYKAEETTKGVNNCLKIAEDIRSDATRTLEMLHDQGEQINRTHAMAVDMDKD  119

Query  504  LSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKGKS  683
            LS+GEKLLNNLGGMFS PWKPKKTK I+GP  + D  + KG+   KE REKLGL  KG+S
Sbjct  120  LSRGEKLLNNLGGMFSKPWKPKKTKTISGPMITPDKPSKKGENHKKE-REKLGLGGKGRS  178

Query  684  APTTPP-NEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLD  860
            +   P  ++P NA+QKVE EKAKQDD L DLSDILGDLK MA DMG+E+DKQNKALD+L 
Sbjct  179  SSQPPALDQPTNALQKVEQEKAKQDDGLSDLSDILGDLKSMAVDMGSEIDKQNKALDHLG  238

Query  861  TDIDELNSRVKGANQRARHLLAK  929
             D+DELNSRVKGANQRARHLL+K
Sbjct  239  DDVDELNSRVKGANQRARHLLSK  261



>ref|XP_007227456.1| hypothetical protein PRUPE_ppa009702mg [Prunus persica]
 gb|EMJ28655.1| hypothetical protein PRUPE_ppa009702mg [Prunus persica]
Length=281

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 157/284 (55%), Positives = 184/284 (65%), Gaps = 44/284 (15%)
 Frame = +3

Query  201  MFGFGKKppasasaspMQSADEPPA-----------ARRTSSEPNL--------------  305
            MFGF K P   A  + +    + PA           ARRTSSEP L              
Sbjct  1    MFGFKKSPAKIAKQNSVDPGFQAPADSETDKDTHKPARRTSSEPMLITPDFSKEKPGKRG  60

Query  306  --------------NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETL  443
                            ++ SVQELE YAV +AEETT+SVNNCLRIAE+IR+D  KTL+ L
Sbjct  61   SSPASYKNDFLDSGGIENQSVQELEKYAVYKAEETTQSVNNCLRIAENIREDATKTLDML  120

Query  444  HKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHK  623
            H QGEQI RTH  AV++DKDLS+GEKLLNNLGGMF+MPWK KK K+I+GP  S       
Sbjct  121  HAQGEQITRTHMAAVDIDKDLSRGEKLLNNLGGMFAMPWKAKKGKDISGPDFSA---ASA  177

Query  624  GKKGTKEQREKLGLN--TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLK  797
             KK    QREKLGL    KG+SAP T P +   A+Q+VE EKAKQDDAL DLS+ILGDLK
Sbjct  178  PKKSDPHQREKLGLAPIPKGRSAPATSPPDGSGALQQVEYEKAKQDDALSDLSNILGDLK  237

Query  798  GMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            GMA DMG+ELD+QNK +D+L  D+DELNSR+KGANQR R LL K
Sbjct  238  GMAVDMGSELDRQNKTIDHLSDDVDELNSRMKGANQRTRRLLGK  281



>ref|XP_008221529.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Prunus 
mume]
Length=281

 Score =   275 bits (703),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 156/284 (55%), Positives = 184/284 (65%), Gaps = 44/284 (15%)
 Frame = +3

Query  201  MFGFGKKppasasaspMQSADEPPA-----------ARRTSSEPNL--------------  305
            MFGF K P   A  + +    + PA           ARRTSSEP L              
Sbjct  1    MFGFKKSPAKIAKQNSVDPGFQAPADSETDKDTHKPARRTSSEPMLITPDFSKEKPGKRG  60

Query  306  --------------NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETL  443
                            ++ SVQELE YAV +AEETT+SVNNCLRIAE+IR+D  KTL+ L
Sbjct  61   SSPASYKNDFRDSGGIENQSVQELEKYAVYKAEETTQSVNNCLRIAENIREDATKTLDML  120

Query  444  HKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHK  623
            H QGEQI RTH  AV++DKDLS+GEKLLNNLGGMF+MPWK KK K+I+GP  S       
Sbjct  121  HAQGEQITRTHMAAVDIDKDLSRGEKLLNNLGGMFAMPWKAKKGKDISGPDFSA---ASA  177

Query  624  GKKGTKEQREKLGLN--TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLK  797
              K    QREKLGL    KG+SAP TPP +   A+Q+VE EKAKQDDAL DLS+ILGDLK
Sbjct  178  PTKSDPHQREKLGLAPIPKGRSAPATPPPDGSGALQQVEYEKAKQDDALSDLSNILGDLK  237

Query  798  GMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            GMA DMG+EL++QNK +D+L  D+DELNSR+KGANQR R LL K
Sbjct  238  GMAVDMGSELNRQNKTIDHLSDDVDELNSRMKGANQRTRRLLGK  281



>ref|XP_010259208.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Nelumbo nucifera]
Length=289

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 168/208 (81%), Gaps = 3/208 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYA  +AEETT +VNNCLRIAEDIR D ++TL TLH+QGEQI R H  AV
Sbjct  84   LENQSVQELENYAAYKAEETTSAVNNCLRIAEDIRDDASRTLVTLHQQGEQIARIHNTAV  143

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D+DLS+GEKLL +LGGMFS+ WKPKKT+EITGP  +K DN  K K    EQ+EKLG+ 
Sbjct  144  DIDQDLSRGEKLLGSLGGMFSITWKPKKTREITGPVVTK-DNPSKKKASHLEQKEKLGIK  202

Query  669  -TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
             +KGKS  + P  EP  A++KVE+EKAKQDDAL DLS+ILGDLKGMA DMGTELD+QNKA
Sbjct  203  PSKGKSN-SEPAPEPTTALEKVEVEKAKQDDALSDLSNILGDLKGMAIDMGTELDRQNKA  261

Query  846  LDNLDTDIDELNSRVKGANQRARHLLAK  929
            LD+L+ DIDELNSR+K ANQR R LL K
Sbjct  262  LDHLNDDIDELNSRMKNANQRGRRLLGK  289



>ref|XP_009623745.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Nicotiana tomentosiformis]
Length=305

 Score =   273 bits (699),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 170/209 (81%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
            F++ +VQELENYAV++AEETTK+VN+CLRIAED+RQD  KTL TLH+QGEQI RTH  A 
Sbjct  98   FENQTVQELENYAVHKAEETTKTVNSCLRIAEDMRQDATKTLITLHQQGEQITRTHTTAA  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEKLL +LGG+FS  WKPKKT+ ITGP  ++DD   + K    EQREKLGL+
Sbjct  158  DIDHDLSRGEKLLGSLGGLFSKTWKPKKTRPITGPVITRDDPVQR-KGNHLEQREKLGLS  216

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  KG+S+  TPP EP NA+Q++E+EKAKQDDAL DLS++LG+LK MA DMG+E+ +QNK
Sbjct  217  SAPKGRSSSRTPPPEPTNALQQIEVEKAKQDDALSDLSNLLGELKDMALDMGSEIGRQNK  276

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD+L  D+DELN RVKGANQR R LL K
Sbjct  277  ALDHLQDDVDELNFRVKGANQRGRRLLGK  305



>emb|CBI27272.3| unnamed protein product [Vitis vinifera]
Length=241

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 165/209 (79%), Gaps = 4/209 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYA  +A+ETTK+VNNCL+IAEDIR+D   TL TLH+QGEQI RTH MA 
Sbjct  35   LENQSVQELENYAAYKAKETTKTVNNCLKIAEDIREDATNTLATLHQQGEQITRTHMMAA  94

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGL-  665
            +MDKDLSKGEKLL NLGGMFS  WKPKK+K+ITGP  + +D+  KG   + EQR+KLGL 
Sbjct  95   DMDKDLSKGEKLLGNLGGMFSRTWKPKKSKDITGPLITSEDS--KGGPASLEQRQKLGLA  152

Query  666  -NTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               KG++    P  EP  AMQ+VE E  KQDDAL DLS+ILGDLK MA DMG+ELD+QNK
Sbjct  153  PAPKGRTTSRAPGPEPTAAMQQVEGEMLKQDDALSDLSNILGDLKNMAADMGSELDRQNK  212

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD+L  D+DELN+RVKGANQRAR LLAK
Sbjct  213  ALDHLSDDVDELNARVKGANQRARRLLAK  241



>ref|XP_010649550.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Vitis vinifera]
 ref|XP_010649553.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Vitis vinifera]
 emb|CAN70141.1| hypothetical protein VITISV_032084 [Vitis vinifera]
Length=280

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 174/239 (73%), Gaps = 23/239 (10%)
 Frame = +3

Query  276  ARRTSSEP-----NLNFDDM--------------SVQELENYAVNQAEETTKSVNNCLRI  398
            ++R +SEP     N N +D               SVQELENYA  +A+ETTK+VNNCL+I
Sbjct  44   SKRAASEPTLPGLNFNIEDQYKNDFRNSGGLENQSVQELENYAAYKAKETTKTVNNCLKI  103

Query  399  AEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTK  578
            AEDIR+D   TL TLH+QGEQI RTH MA +MDKDLSKGEKLL NLGGMFS  WKPKK+K
Sbjct  104  AEDIREDATNTLATLHQQGEQITRTHMMAADMDKDLSKGEKLLGNLGGMFSRTWKPKKSK  163

Query  579  EITGPKTSKDDNNHKGKKGTKEQREKLGL--NTKGKSAPTTPPNEPQNAMQKVEMEKAKQ  752
            +ITGP  + +D+  KG   + EQR+KLGL    KG++    P  EP  AMQ+VE E  KQ
Sbjct  164  DITGPLITSEDS--KGGPASLEQRQKLGLAPAPKGRTTSRAPGPEPTAAMQQVEGEMLKQ  221

Query  753  DDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            DDAL DLS+ILGDLK MA DMG+ELD+QNKALD+L  D+DELN+RVKGANQRAR LLAK
Sbjct  222  DDALSDLSNILGDLKNMAADMGSELDRQNKALDHLSDDVDELNARVKGANQRARRLLAK  280



>ref|XP_009761175.1| PREDICTED: SNAP25 homologous protein SNAP33 [Nicotiana sylvestris]
Length=305

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 168/209 (80%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
            F++ +VQELENYAV++AEETTK+VN+CLRIAED+RQD  KTL TLH QGEQI RTH  A 
Sbjct  98   FENQTVQELENYAVHKAEETTKTVNSCLRIAEDMRQDATKTLITLHHQGEQITRTHTTAA  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEKLL +LGG+FS  WKPKKT+ ITGP  ++DD   + K    EQREKLGL+
Sbjct  158  DIDHDLSRGEKLLGSLGGLFSKTWKPKKTRPITGPVITRDDPVQR-KGNHLEQREKLGLS  216

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  KG+S+  TPP EP NA+Q +E+EKAKQDDAL DLS++LG+LK MA DMG+E+ +QNK
Sbjct  217  SAPKGRSSSRTPPPEPTNALQHIEVEKAKQDDALSDLSNLLGELKDMALDMGSEIGRQNK  276

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD+L  D+DELN RVKGANQR R LL K
Sbjct  277  ALDHLQDDVDELNFRVKGANQRGRRLLGK  305



>ref|XP_010107458.1| Putative SNAP25-like protein [Morus notabilis]
 gb|EXC54352.1| Putative SNAP25-like protein [Morus notabilis]
Length=285

 Score =   270 bits (690),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 174/245 (71%), Gaps = 28/245 (11%)
 Frame = +3

Query  276  ARRTSSEPNLNFDDM-------------------------SVQELENYAVNQAEETTKSV  380
            +RRTSSEP     D                          SVQELENYAV +AEETTK V
Sbjct  42   SRRTSSEPMFIVPDFEEDDYDKRRDRYRNDFRDSGGLESQSVQELENYAVYKAEETTKGV  101

Query  381  NNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPW  560
            +NCL+IA+DIR+D  +TL+ L++QGEQI RTH MA++MDKDLS+GEKLLN+LGGMFS  W
Sbjct  102  DNCLKIADDIREDATRTLDMLNQQGEQITRTHLMAIDMDKDLSRGEKLLNSLGGMFSKTW  161

Query  561  KPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN--TKGKSAPTTPPNEPQNAMQKVE  734
            KPKKT+EI+GP  + D ++ +      EQR+KLGL    KGKS   T P E   A+QKVE
Sbjct  162  KPKKTREISGPLITADTSSKRSVNNL-EQRQKLGLAPIPKGKSGTRTTPPETAGALQKVE  220

Query  735  MEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRAR  914
            +EKAKQDDAL DLS+ILGDLK +A DMG EL++QNKALD+L  D+DELNSRVKG NQRAR
Sbjct  221  VEKAKQDDALSDLSNILGDLKSVAVDMGNELNRQNKALDHLSDDVDELNSRVKGTNQRAR  280

Query  915  HLLAK  929
            HLL K
Sbjct  281  HLLGK  285



>ref|XP_002514694.1| synaptosomal associated protein, putative [Ricinus communis]
 gb|EEF47800.1| synaptosomal associated protein, putative [Ricinus communis]
Length=305

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 168/209 (80%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV +AEETTK+VN CL+IAE+IR+D  KT+ TLH+QGEQ++RTH +AV
Sbjct  98   VENQSVQELENYAVYKAEETTKAVNGCLKIAEEIREDATKTMITLHQQGEQMYRTHNVAV  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            EMD DLS+GEKLL +LGG+FS  WKPKK + ITGP  ++DD + K +    EQREKLGLN
Sbjct  158  EMDHDLSRGEKLLGSLGGIFSRTWKPKKNRPITGPVITRDD-SPKRRGNHLEQREKLGLN  216

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               KG+++  TPP EP NA QKVEMEK KQDDAL DLS++LG+LK MA DMG+E+++Q K
Sbjct  217  AAPKGRTSTRTPPPEPTNAYQKVEMEKTKQDDALSDLSNLLGELKDMAVDMGSEIERQTK  276

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD++  D+DELNSRV+GANQR R LL K
Sbjct  277  ALDHVQDDVDELNSRVRGANQRGRRLLGK  305



>ref|XP_002512109.1| synaptosomal associated protein, putative [Ricinus communis]
 gb|EEF50778.1| synaptosomal associated protein, putative [Ricinus communis]
Length=233

 Score =   265 bits (678),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 167/225 (74%), Gaps = 21/225 (9%)
 Frame = +3

Query  273  AARRTSSEPNLN-----FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLE  437
            +A+R +SEP LN     FDD              + T +  N    IAEDI+QD  KTL+
Sbjct  24   SAKRANSEPALNIPGKDFDD--------------DATDRYKNGFREIAEDIKQDATKTLD  69

Query  438  TLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNN  617
            TLH QGEQI RTH MAV+M+KDLSKGEKLLNNLGG+FS PWKPKKT++ITGP  +  DN 
Sbjct  70   TLHAQGEQITRTHNMAVDMEKDLSKGEKLLNNLGGIFSKPWKPKKTRQITGPVVAA-DNP  128

Query  618  HKGKKGTKEQREKLGLNTK-GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDL  794
             K     KEQREKLGL  K G SAPTTPP+EP +A+QKVE+EKAKQDDAL DLS+ILGDL
Sbjct  129  SKKSDNHKEQREKLGLGGKRGHSAPTTPPSEPTSALQKVELEKAKQDDALSDLSNILGDL  188

Query  795  KGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            KGMA DMG E+++QNKALD+L  D+DEL +RVKGANQRARHLL K
Sbjct  189  KGMAVDMGNEIERQNKALDHLSDDVDELKTRVKGANQRARHLLGK  233



>ref|XP_010096581.1| Putative SNAP25-like protein [Morus notabilis]
 gb|EXB65081.1| Putative SNAP25-like protein [Morus notabilis]
Length=282

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 173/245 (71%), Gaps = 31/245 (13%)
 Frame = +3

Query  276  ARRTSSEPNLNFDDM-------------------------SVQELENYAVNQAEETTKSV  380
            +RRTSSEP     D                          SVQELENYA   AEETTK V
Sbjct  42   SRRTSSEPMFIVPDFEEDDYDKRRDRYRNDFRDSGGLESQSVQELENYA---AEETTKGV  98

Query  381  NNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPW  560
            +NCL+IA+DIR+D  +TL+ L++QGEQI RTH MA++MDKDLS+GEKLLN+LGGMFS  W
Sbjct  99   DNCLKIADDIREDATRTLDMLNQQGEQITRTHLMAIDMDKDLSRGEKLLNSLGGMFSKTW  158

Query  561  KPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN--TKGKSAPTTPPNEPQNAMQKVE  734
            KPKKT+EI+GP  + D ++ +      EQR+KLGL    KGKS   TPP E   A+QKVE
Sbjct  159  KPKKTREISGPLITADTSSKRSVNNL-EQRQKLGLAPIPKGKSGTRTPPPETAGALQKVE  217

Query  735  MEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRAR  914
            +EKAKQDDAL DLS+ILGDLK +A DMG EL++QNKALD+L  D+DELNSRVKG NQRAR
Sbjct  218  VEKAKQDDALSDLSNILGDLKSVAVDMGNELNRQNKALDHLSDDVDELNSRVKGTNQRAR  277

Query  915  HLLAK  929
            HLL K
Sbjct  278  HLLGK  282



>ref|XP_003575060.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Brachypodium 
distachyon]
Length=257

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 165/207 (80%), Gaps = 1/207 (0%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYA  +AEETT ++N CLRIAE+IR+D + TL TL+KQGEQI RTH+ AV
Sbjct  52   LENQSVQELENYAAYKAEETTDTLNGCLRIAENIREDASNTLITLNKQGEQISRTHDKAV  111

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D+DL+KGE LLN+LGG FS PWKPKKT++I GP     D++ K K    EQR+KLGL+
Sbjct  112  EIDQDLAKGESLLNSLGGFFSKPWKPKKTRQIKGPAQVSRDDSFKKKANRMEQRDKLGLS  171

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
             +GK    T  ++P NAM KV++EK KQDDALDDLS +LG LKGMA DMG+ELD+QN+AL
Sbjct  172  PRGKGNSRT-YDDPTNAMDKVQVEKQKQDDALDDLSGVLGQLKGMAVDMGSELDRQNQAL  230

Query  849  DNLDTDIDELNSRVKGANQRARHLLAK  929
            DNL  D++ELNSR+KGANQRAR L+AK
Sbjct  231  DNLQDDVEELNSRMKGANQRARKLVAK  257



>ref|NP_001047013.1| Os02g0529500 [Oryza sativa Japonica Group]
 dbj|BAD25433.1| putative SNAP25 [Oryza sativa Japonica Group]
 dbj|BAF08927.1| Os02g0529500 [Oryza sativa Japonica Group]
 gb|EAY86115.1| hypothetical protein OsI_07487 [Oryza sativa Indica Group]
 dbj|BAG91708.1| unnamed protein product [Oryza sativa Japonica Group]
Length=259

 Score =   264 bits (675),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 161/207 (78%), Gaps = 2/207 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             +  SVQELENYA  +AEETT ++  CLRIAE+IR+D A TL TL+KQG+QI RTHE AV
Sbjct  55   LEQQSVQELENYAAYKAEETTDALGGCLRIAENIREDAANTLVTLNKQGQQISRTHEKAV  114

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D+DLSKGE LL +LGG FS PWKPKKT++I GP    DD + K K    EQREKLGL+
Sbjct  115  EIDQDLSKGESLLGSLGGFFSKPWKPKKTRQIKGPAHVSDD-SFKKKASHIEQREKLGLS  173

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
              GKSA  +   EP  AM+KV++EK KQDDALDDLS +LG LKGMA DMG+ELD+QNKAL
Sbjct  174  PSGKSANRSYA-EPTTAMEKVQVEKQKQDDALDDLSGVLGQLKGMACDMGSELDRQNKAL  232

Query  849  DNLDTDIDELNSRVKGANQRARHLLAK  929
            D+L  D+DELNSRVKGANQRAR L+ K
Sbjct  233  DDLQGDVDELNSRVKGANQRARKLIEK  259



>gb|EAZ23291.1| hypothetical protein OsJ_06988 [Oryza sativa Japonica Group]
Length=264

 Score =   264 bits (675),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 161/207 (78%), Gaps = 2/207 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             +  SVQELENYA  +AEETT ++  CLRIAE+IR+D A TL TL+KQG+QI RTHE AV
Sbjct  60   LEQQSVQELENYAAYKAEETTDALGGCLRIAENIREDAANTLVTLNKQGQQISRTHEKAV  119

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D+DLSKGE LL +LGG FS PWKPKKT++I GP    DD + K K    EQREKLGL+
Sbjct  120  EIDQDLSKGESLLGSLGGFFSKPWKPKKTRQIKGPAHVSDD-SFKKKASHIEQREKLGLS  178

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
              GKSA  +   EP  AM+KV++EK KQDDALDDLS +LG LKGMA DMG+ELD+QNKAL
Sbjct  179  PSGKSANRSYA-EPTTAMEKVQLEKQKQDDALDDLSGVLGQLKGMACDMGSELDRQNKAL  237

Query  849  DNLDTDIDELNSRVKGANQRARHLLAK  929
            D+L  D+DELNSRVKGANQRAR L+ K
Sbjct  238  DDLQGDVDELNSRVKGANQRARKLIEK  264



>ref|XP_010044425.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Eucalyptus 
grandis]
 ref|XP_010044426.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Eucalyptus 
grandis]
 ref|XP_010044427.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Eucalyptus 
grandis]
 gb|KCW86518.1| hypothetical protein EUGRSUZ_B03167 [Eucalyptus grandis]
Length=303

 Score =   265 bits (678),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 167/209 (80%), Gaps = 5/209 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV ++EETT SVNNCL+IAEDIR+D  +TL+ LH QGEQI RTHE+  
Sbjct  98   LENQSVQELENYAVYKSEETTSSVNNCLKIAEDIREDATRTLDMLHNQGEQIRRTHEVVA  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            + DKDLSKGEKLL NLGGMFS  WKPKKT+EI+GP  + D+++   KK  K+QREKLGL 
Sbjct  158  DTDKDLSKGEKLLGNLGGMFSKTWKPKKTREISGPVVTTDNSS---KKSDKKQREKLGLA  214

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               KGK    TPP EP NA+QKVE+EKAKQDDAL DLS++LGDLK MA DMG EL++QNK
Sbjct  215  PVPKGKGTTRTPPPEPTNALQKVEVEKAKQDDALSDLSNVLGDLKNMAVDMGGELNRQNK  274

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD+L  D+DE+NSRVKGANQR R LL K
Sbjct  275  ALDHLSDDVDEMNSRVKGANQRTRRLLGK  303



>gb|EYU23575.1| hypothetical protein MIMGU_mgv1a010387mg [Erythranthe guttata]
Length=313

 Score =   266 bits (679),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 165/211 (78%), Gaps = 5/211 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
            FD+ SVQELE+YAV ++EETTK+VNNCL+IAED+R+D  KTL TLH+QGEQI RTH  A 
Sbjct  104  FDNQSVQELESYAVYKSEETTKTVNNCLKIAEDMREDATKTLVTLHQQGEQITRTHMTAA  163

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKK KEI+GP  ++DD  H+ K    EQREKLGL 
Sbjct  164  EIDHDLSRGEKLLGSLGGMFSKTWKPKKNKEISGPVITRDDPVHR-KGNHLEQREKLGLT  222

Query  669  TKGKSAPT----TPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQ  836
            +      +     PP EP NA+QKVE+EK KQDDA +DLS+ILGDLK MA DMG+E+++Q
Sbjct  223  SSTSHERSHTRKPPPIEPTNALQKVEVEKLKQDDAFEDLSNILGDLKSMAVDMGSEIERQ  282

Query  837  NKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            NKALD+++ D+DELN RV+GAN+R R LL K
Sbjct  283  NKALDHVEDDVDELNFRVQGANRRTRRLLGK  313



>ref|XP_007045921.1| Soluble N-ethylmaleimide-sensitive factor adaptor protein 30 
isoform 1 [Theobroma cacao]
 gb|EOY01753.1| Soluble N-ethylmaleimide-sensitive factor adaptor protein 30 
isoform 1 [Theobroma cacao]
Length=331

 Score =   266 bits (680),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 142/241 (59%), Positives = 172/241 (71%), Gaps = 39/241 (16%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            ++++LENYAV +AEETT +VNNCL+IAE+IR+D  +TL+TLH+QGEQI RTH MAV++DK
Sbjct  92   TMEDLENYAVYKAEETTSTVNNCLKIAENIREDATRTLDTLHQQGEQIERTHAMAVDIDK  151

Query  501  DLSK------------------------------------GEKLLNNLGGMFSMPWKPKK  572
            DL K                                    GEKLLN+LGGMFS PWKPKK
Sbjct  152  DLRKCILLMLISLAIHTYKAVGKHVALYLGRWVIDTYSLLGEKLLNSLGGMFSKPWKPKK  211

Query  573  TKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKGKSAP--TTPPNEPQNAMQKVEMEKA  746
            T+EI GP  +   ++ K +   KEQREKLGL    K+ P   TPP EP NA+QKVE+EKA
Sbjct  212  TREIAGPVVTSAKSSKKSE-NQKEQREKLGLAPVPKAKPGSKTPPPEPTNAIQKVELEKA  270

Query  747  KQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLA  926
            KQDDAL DLS+ILGDLKGMA +MG+ELD+QNKALD+L  D+DELNSRVKGANQRAR+LLA
Sbjct  271  KQDDALSDLSNILGDLKGMAVEMGSELDRQNKALDHLHDDVDELNSRVKGANQRARNLLA  330

Query  927  K  929
            K
Sbjct  331  K  331



>ref|XP_004236003.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Solanum lycopersicum]
 ref|XP_010318837.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Solanum lycopersicum]
Length=343

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 164/209 (78%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
            F++ +VQELENYAV++AEETTKSVNNCLRIAEDIRQD  KT+ TLH+QGEQI RTH  A 
Sbjct  136  FENQTVQELENYAVHKAEETTKSVNNCLRIAEDIRQDATKTVITLHQQGEQITRTHLTAA  195

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+ EKLL  LGG FS  WKPKKT+ ITGP  ++DD   + +    EQREKLGLN
Sbjct  196  DIDHDLSRSEKLLGTLGGFFSKSWKPKKTRSITGPVITRDDPVQR-RGNHLEQREKLGLN  254

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  K +S+  T P EP NA+QKVE+E AKQDDAL DLS++LG+LK MA DMG+E+++QN+
Sbjct  255  SAPKERSSSRTLPQEPTNALQKVEVEHAKQDDALSDLSNLLGELKHMAIDMGSEIERQNR  314

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            +LD+   D+DELN RVKGANQR R LL K
Sbjct  315  SLDHFQDDVDELNFRVKGANQRGRRLLGK  343



>gb|KDP31313.1| hypothetical protein JCGZ_11689 [Jatropha curcas]
Length=302

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 163/209 (78%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             +  SVQELENYAV +AEETTK+VN CL+IAE+IR+D  KTL TLH QGEQI RTH +AV
Sbjct  95   IESQSVQELENYAVYKAEETTKAVNGCLKIAEEIREDANKTLITLHHQGEQITRTHNVAV  154

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            EMD DLS+GEKLL +LGG+FS  WKPKKT+ ITGP  ++DD   K   G  EQREKLGLN
Sbjct  155  EMDHDLSRGEKLLGSLGGIFSRTWKPKKTRPITGPVITRDD-APKSIGGHLEQREKLGLN  213

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               KG+S   T   EP +A+QKVE+EKAKQDDAL DLS++LG+LKGMA DMG+E+D+Q K
Sbjct  214  NAPKGRSNTRTNTPEPTDAIQKVEIEKAKQDDALSDLSNLLGELKGMAVDMGSEIDRQTK  273

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD+   D+DELN RV+GANQR R LL K
Sbjct  274  ALDHFQDDVDELNFRVRGANQRGRRLLGK  302



>ref|XP_009405997.1| PREDICTED: SNAP25 homologous protein SNAP33-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=263

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 161/207 (78%), Gaps = 2/207 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE+YA  +AEETT+ VN+CL+IAE IR+D + TL  LH+QGEQI RTHE AV
Sbjct  59   LENQSVQELESYAAYKAEETTQKVNDCLKIAEVIREDASNTLVMLHQQGEQITRTHETAV  118

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D+DLS+GEKLL +LGG FS PWKP K  +I GP  + DD+  K K    EQREKLGL+
Sbjct  119  SIDQDLSRGEKLLGSLGGFFSRPWKPNKAHQIKGPAPTTDDSLSK-KVSHMEQREKLGLS  177

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
            +K +S P    +EP +AM KV+MEKAKQDD L DLSD+LG LKGMA DMG+E+D+QNKAL
Sbjct  178  SKPQSNPRN-YSEPTSAMDKVQMEKAKQDDTLSDLSDVLGQLKGMAVDMGSEMDRQNKAL  236

Query  849  DNLDTDIDELNSRVKGANQRARHLLAK  929
            D L  D+DELNSRVKGANQRARHLL K
Sbjct  237  DALHDDVDELNSRVKGANQRARHLLGK  263



>ref|XP_009405995.1| PREDICTED: SNAP25 homologous protein SNAP33-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009405996.1| PREDICTED: SNAP25 homologous protein SNAP33-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=266

 Score =   261 bits (667),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 161/207 (78%), Gaps = 2/207 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE+YA  +AEETT+ VN+CL+IAE IR+D + TL  LH+QGEQI RTHE AV
Sbjct  62   LENQSVQELESYAAYKAEETTQKVNDCLKIAEVIREDASNTLVMLHQQGEQITRTHETAV  121

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D+DLS+GEKLL +LGG FS PWKP K  +I GP  + DD+  K K    EQREKLGL+
Sbjct  122  SIDQDLSRGEKLLGSLGGFFSRPWKPNKAHQIKGPAPTTDDSLSK-KVSHMEQREKLGLS  180

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
            +K +S P    +EP +AM KV+MEKAKQDD L DLSD+LG LKGMA DMG+E+D+QNKAL
Sbjct  181  SKPQSNPRN-YSEPTSAMDKVQMEKAKQDDTLSDLSDVLGQLKGMAVDMGSEMDRQNKAL  239

Query  849  DNLDTDIDELNSRVKGANQRARHLLAK  929
            D L  D+DELNSRVKGANQRARHLL K
Sbjct  240  DALHDDVDELNSRVKGANQRARHLLGK  266



>ref|XP_011013081.1| PREDICTED: SNAP25 homologous protein SNAP33 [Populus euphratica]
 ref|XP_011013082.1| PREDICTED: SNAP25 homologous protein SNAP33 [Populus euphratica]
Length=305

 Score =   263 bits (671),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 164/209 (78%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV +AEETTKSVN CL+IAED+R+   +TL TLH+QGEQI +TH++AV
Sbjct  98   LENQSVQELENYAVYKAEETTKSVNGCLKIAEDMREGATRTLITLHQQGEQITKTHDVAV  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKK + ITGP  ++D +  K +    EQREKLGLN
Sbjct  158  EIDHDLSRGEKLLGSLGGMFSKTWKPKKNRPITGPVITRDASPQK-RGNHLEQREKLGLN  216

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               KG+S   TP  EP NA QKVE+EK+KQDD+L DLS+ILG+LK MA DMGTE+D+Q K
Sbjct  217  PAPKGQSGMQTPLPEPTNAFQKVELEKSKQDDSLSDLSNILGELKNMAVDMGTEIDRQTK  276

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            +LD+L  D+DELN RV+GANQR R LL K
Sbjct  277  SLDHLQNDVDELNYRVRGANQRGRRLLGK  305



>ref|XP_010546183.1| PREDICTED: SNAP25 homologous protein SNAP33 [Tarenaya hassleriana]
Length=305

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 161/209 (77%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQEL+NYAV +AEETTK+VN CLRIAEDIR D  +TL  LH+QGEQI RTH  AV
Sbjct  98   VENQSVQELKNYAVYKAEETTKTVNGCLRIAEDIRSDATRTLVMLHEQGEQITRTHHKAV  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKKT+ ITGP  ++DD+  K +    EQREKLGLN
Sbjct  158  EIDHDLSRGEKLLGSLGGMFSRTWKPKKTRPITGPIVTRDDSP-KRRANHIEQREKLGLN  216

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               K +S   +P  EP +A QKVE+EKAKQDDAL DLSD+LGDLK MA DMG+E+++QNK
Sbjct  217  APPKAQSRTRSPLPEPTDAYQKVEVEKAKQDDALSDLSDLLGDLKNMAVDMGSEIERQNK  276

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
             LDNL  D+DELN RVK +NQR R LL K
Sbjct  277  GLDNLQDDVDELNFRVKQSNQRGRRLLGK  305



>ref|XP_002452196.1| hypothetical protein SORBIDRAFT_04g021560 [Sorghum bicolor]
 gb|EES05172.1| hypothetical protein SORBIDRAFT_04g021560 [Sorghum bicolor]
Length=261

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 160/207 (77%), Gaps = 1/207 (0%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SV+EL++YA  +AEETT ++  CLRIAEDI++D + TL TLHKQGEQI RTHE AV
Sbjct  56   LENQSVEELQHYAAYKAEETTDALEGCLRIAEDIKKDASDTLVTLHKQGEQISRTHEKAV  115

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D+DLSK E LL +LGG FS PWKPKKTK+I GP     D++ K K    EQR+KLGL+
Sbjct  116  EIDQDLSKSESLLGSLGGFFSKPWKPKKTKQIKGPAHVSRDDSFKKKASRMEQRDKLGLS  175

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
             +GK  P     E  +AM KV++EK KQDDALDDLS +LG LKGMA DMG+ELD+QN+AL
Sbjct  176  PRGKRDPRHYA-EATDAMDKVQIEKKKQDDALDDLSGVLGQLKGMAVDMGSELDRQNEAL  234

Query  849  DNLDTDIDELNSRVKGANQRARHLLAK  929
            DNL  D+DELNSRVKGANQRAR L+AK
Sbjct  235  DNLQGDVDELNSRVKGANQRARKLVAK  261



>gb|AEB71568.1| SNAP33 [Solanum chacoense]
Length=306

 Score =   260 bits (665),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 162/209 (78%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
            F++ +VQELENYAV++AEETTK+VNNCLRIAEDIRQD  KT+  LH+QGEQI RTH  A 
Sbjct  99   FENQTVQELENYAVHKAEETTKAVNNCLRIAEDIRQDATKTVIALHQQGEQITRTHLTAA  158

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            +++ DLS+GEKLL  LG  FS  WKPKK + ITGP  ++DD   + +    EQREKLGL+
Sbjct  159  DIEHDLSRGEKLLGTLGSYFSKTWKPKKIRSITGPVITRDDPVQR-RGNHLEQREKLGLS  217

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  K +S+  TPP EP NA+QKVE+E AKQDDAL DLS++LG+LK MA DMG+E+++QNK
Sbjct  218  SAPKERSSSRTPPQEPTNALQKVEVEHAKQDDALSDLSNLLGELKHMAIDMGSEIERQNK  277

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            +LD+   D+DELN RVKGANQR   LL K
Sbjct  278  SLDHFQDDVDELNFRVKGANQRGHRLLGK  306



>ref|XP_002322041.1| hypothetical protein POPTR_0015s03450g [Populus trichocarpa]
 gb|EEF06168.1| hypothetical protein POPTR_0015s03450g [Populus trichocarpa]
Length=305

 Score =   260 bits (665),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 165/210 (79%), Gaps = 5/210 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE+YAV +AEETTKSVN CL+IAED+R+   +TL TLH+QGEQI RTH+ AV
Sbjct  98   LENQSVQELESYAVYKAEETTKSVNGCLKIAEDMREGATRTLITLHQQGEQITRTHDAAV  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTK-EQREKLGL  665
            E+D DLS+GEKLL +LGGMFS  WKPKK + ITGP  ++D +    ++G + EQREKLGL
Sbjct  158  EIDHDLSRGEKLLGSLGGMFSKTWKPKKNRPITGPVITRDASPQ--RRGNQLEQREKLGL  215

Query  666  N--TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQN  839
            N   KG+S+  TP  EP NA QKVE+EK+KQDD+L DLS+ILG+LK MA DMGTE+D+Q 
Sbjct  216  NPAPKGQSSMRTPLPEPTNAFQKVELEKSKQDDSLSDLSNILGELKNMAVDMGTEIDRQT  275

Query  840  KALDNLDTDIDELNSRVKGANQRARHLLAK  929
             +LD+L  D+DELN RV+GANQR R LL K
Sbjct  276  NSLDHLQNDVDELNYRVRGANQRGRRLLGK  305



>ref|XP_010037206.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Eucalyptus 
grandis]
 ref|XP_010037207.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Eucalyptus 
grandis]
 gb|KCW48872.1| hypothetical protein EUGRSUZ_K02499 [Eucalyptus grandis]
 gb|KCW48873.1| hypothetical protein EUGRSUZ_K02499 [Eucalyptus grandis]
 gb|KCW48874.1| hypothetical protein EUGRSUZ_K02499 [Eucalyptus grandis]
Length=304

 Score =   260 bits (665),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 157/205 (77%), Gaps = 4/205 (2%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELENYAV +AEETT+SVNNCL+IAE IR+D  KTL TLH+QGEQ+ RTH  A ++D 
Sbjct  102  SVQELENYAVYKAEETTESVNNCLKIAEGIREDATKTLVTLHQQGEQLTRTHMAAADIDH  161

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN--TK  674
            DLS+GEKLL NLGGMFS  WKPKK + I+GP   ++D   KG     EQREKLGL   TK
Sbjct  162  DLSRGEKLLGNLGGMFSKTWKPKKNRPISGPVIMREDVQRKGNH--LEQREKLGLTSATK  219

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
             +S   TPP EP NA++KVE+EK KQDDAL DLSD+LG+LKGMA DMG+E+++QNKALD+
Sbjct  220  HQSNSRTPPPEPTNAIEKVEVEKVKQDDALSDLSDLLGELKGMAVDMGSEIERQNKALDH  279

Query  855  LDTDIDELNSRVKGANQRARHLLAK  929
             D D DEL  RVK A QR R LL K
Sbjct  280  FDVDADELGYRVKQAGQRGRRLLGK  304



>emb|CDP17499.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   260 bits (664),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 165/210 (79%), Gaps = 5/210 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ +VQELENY+V +AEETTK+VN CL+IAE++R+D  KTL TLH QGEQI RTH  A 
Sbjct  95   LENQTVQELENYSVYRAEETTKAVNGCLKIAEEMREDATKTLVTLHHQGEQITRTHHAAA  154

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTK-EQREKLGL  665
            ++D DLS+GEKLL +LGGMFS  WKPKKT+ ITGP  ++DD  +  +KG+  EQREKLGL
Sbjct  155  DIDHDLSRGEKLLGSLGGMFSKTWKPKKTRPITGPIITRDDPVY--RKGSHLEQREKLGL  212

Query  666  NT--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQN  839
             +  +G+S    PP EP  A+QKVE+EK KQDDAL DLS+ILG+LK MA DMG+EL++QN
Sbjct  213  TSAPQGRSNSRAPPAEPTTALQKVEVEKVKQDDALSDLSNILGELKEMAVDMGSELERQN  272

Query  840  KALDNLDTDIDELNSRVKGANQRARHLLAK  929
            K L++L+TD++ELN RVKGA QR R LL K
Sbjct  273  KGLEHLETDVEELNFRVKGAAQRGRRLLGK  302



>ref|XP_008239879.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Prunus mume]
Length=284

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 164/209 (78%), Gaps = 4/209 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SV+ELENYAV +AEETTKSVN CL+IAE+IR+D  KTL TLH+QGEQI R+H +A 
Sbjct  78   VENQSVEELENYAVYKAEETTKSVNGCLKIAEEIREDATKTLVTLHQQGEQITRSHMVAA  137

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D+DLS+GEKLL +LGG+FS  WKPKKT+ I+GP  + D+   +G  G  E+REKLGL 
Sbjct  138  DIDQDLSRGEKLLGSLGGIFSKTWKPKKTRPISGPVITGDNAVRRG--GQLEEREKLGLT  195

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  KG+S P T P  P NA+QKVE+EKAKQDD L DLSD+LG+LK MA DMG+E+++ NK
Sbjct  196  SAPKGRSTPQTLPPGPVNALQKVELEKAKQDDGLSDLSDLLGELKDMAVDMGSEIERHNK  255

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            AL +L  D+DELN RV+GANQR R LL K
Sbjct  256  ALGHLYDDVDELNVRVRGANQRGRRLLGK  284



>ref|XP_006345160.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Solanum tuberosum]
Length=306

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 162/209 (78%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
            F++ +VQELENYAV++AEETTK+VNNCLRIAEDIRQD  KT+  LH+QGEQI RTH  A 
Sbjct  99   FENQTVQELENYAVHKAEETTKTVNNCLRIAEDIRQDATKTVIALHQQGEQITRTHLTAA  158

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            +++ DLS+GEKLL  LG  FS  WK KK + ITGP  ++DD   + +    EQREKLGL+
Sbjct  159  DIEHDLSRGEKLLGTLGSYFSKTWKSKKIRSITGPVITRDDPIQR-RGNHLEQREKLGLS  217

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  K +S+  TPP EP NA+QKVE+E AKQDDAL DLS++LG+LK MA DMG+E+++QNK
Sbjct  218  SAPKERSSSRTPPQEPTNALQKVEVEHAKQDDALSDLSNLLGELKHMAIDMGSEIERQNK  277

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            +LD+   D+DELN RVKGANQR R LL K
Sbjct  278  SLDHFQDDVDELNFRVKGANQRGRRLLGK  306



>ref|XP_004952631.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Setaria italica]
Length=261

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 160/207 (77%), Gaps = 1/207 (0%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE+YA  +AEETT ++  CLRIAEDI++D + TL TLHKQGEQI RTHE AV
Sbjct  56   LENQSVQELEHYAAYKAEETTDALAGCLRIAEDIKKDASDTLITLHKQGEQISRTHEKAV  115

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D+DL+K E LL +LGG FS PWKPKKT++I GP     D++ K K    EQR+KLGL+
Sbjct  116  EIDQDLTKSESLLGSLGGFFSKPWKPKKTRQIKGPAMVSRDDSFKKKASRMEQRDKLGLS  175

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
             +GK+A      E  +AM KV++EK KQDDALDDLS +LG LKGMA DMG+ELD+QN+AL
Sbjct  176  PRGKNA-NRHYGEANSAMDKVQIEKQKQDDALDDLSGVLGQLKGMAVDMGSELDRQNEAL  234

Query  849  DNLDTDIDELNSRVKGANQRARHLLAK  929
            D+L  D+DELNSRVKGANQRAR L AK
Sbjct  235  DHLQDDVDELNSRVKGANQRARKLAAK  261



>gb|KEH31992.1| soluble N-ethylmaleimide-sensitive factor adaptor protein [Medicago 
truncatula]
Length=300

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 164/209 (78%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ S+QELENYAV +AEETTKSV+NCL+IAE+IR+D AKTL TLH QGEQI R+H +A 
Sbjct  93   VENQSMQELENYAVYKAEETTKSVHNCLKIAENIREDAAKTLVTLHHQGEQITRSHHVAT  152

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D+DLS+GEKLL +LGG+FS  WKPKKT+ ITGP    DD   + K    EQREKLGL 
Sbjct  153  DIDRDLSRGEKLLGSLGGLFSKTWKPKKTRTITGPVIFGDDAVRR-KGNHLEQREKLGLT  211

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
              ++G+S   TPP EP +A+ KVE EK KQDDAL +LSD+LG+LK MA DMG+E+++ NK
Sbjct  212  SASEGQSRLRTPPQEPTDALTKVEFEKGKQDDALSNLSDLLGELKDMAVDMGSEIERHNK  271

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            AL +LD D+DELN RVKGANQRAR L+ K
Sbjct  272  ALGHLDDDVDELNFRVKGANQRARRLMGK  300



>ref|XP_011072852.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Sesamum indicum]
 ref|XP_011072853.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Sesamum indicum]
 ref|XP_011072854.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Sesamum indicum]
Length=321

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 165/208 (79%), Gaps = 2/208 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ +VQELENYA  +AEETTK+V +CL+IAEDIR+D  KTL TLH+QGEQI RTH +A 
Sbjct  115  LENQTVQELENYAAYKAEETTKTVKHCLKIAEDIREDATKTLVTLHQQGEQITRTHMVAA  174

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGL-  665
            +MD DLS+GEKLL +LGGMFS  WKPKKT+ ITGP  ++DD   + +    EQRE+LGL 
Sbjct  175  DMDHDLSRGEKLLGSLGGMFSKTWKPKKTRPITGPIITRDDPVQR-RGNHLEQRERLGLS  233

Query  666  NTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
            ++K +S   TP +EP +A+QKVE+EK KQDDAL DLS+ILG+LK MA DMG+E+D+QNKA
Sbjct  234  SSKERSHTRTPTSEPTDALQKVEVEKVKQDDALSDLSNILGELKDMAIDMGSEIDRQNKA  293

Query  846  LDNLDTDIDELNSRVKGANQRARHLLAK  929
            LD++  D++ELN RVKGANQR R LL K
Sbjct  294  LDHVQDDVEELNFRVKGANQRTRRLLGK  321



>ref|XP_007037493.1| Synaptosomal associated protein, putative [Theobroma cacao]
 gb|EOY21994.1| Synaptosomal associated protein, putative [Theobroma cacao]
Length=305

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 161/209 (77%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV +AEETTK+VNNC++IAE++R+    TL TLH+QGEQI RTH +A 
Sbjct  98   LENQSVQELENYAVYKAEETTKTVNNCVKIAEEMREGATNTLITLHQQGEQITRTHNVAA  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D DLS+GEKLL +LGGMFS  WKPKKT+ I GP  ++ D + K   G  EQ+EKLGLN
Sbjct  158  GIDHDLSRGEKLLGSLGGMFSRTWKPKKTRTIVGPVITR-DVSPKRSGGHLEQKEKLGLN  216

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               +G S   TPP EP NA QKVE+EKAKQDDAL DLSD+LG+LK MA DMG+E+++QNK
Sbjct  217  PVRRGHSKSQTPPPEPTNAFQKVEVEKAKQDDALSDLSDLLGELKDMAVDMGSEIERQNK  276

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
             L+ L  D+DELN RVKGANQRAR LL K
Sbjct  277  GLNGLQDDVDELNFRVKGANQRARRLLGK  305



>ref|XP_006648688.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Oryza brachyantha]
Length=293

 Score =   258 bits (658),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 162/204 (79%), Gaps = 1/204 (0%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYA  +AEETT ++  CLRIAE+I++D A TL TL+KQG+QI RTHE AV
Sbjct  55   LENQSVQELENYAAYKAEETTDALAGCLRIAENIKEDAANTLVTLNKQGQQISRTHEKAV  114

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D+DL+K E LL +LGG FS PWKPKKT++I GP     D++ K K    EQR+KLGL+
Sbjct  115  DIDQDLTKSESLLGSLGGFFSKPWKPKKTRQIKGPAYVSRDDSFKKKANRIEQRDKLGLS  174

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
             +GKSA  +  +EP +AM KV++EK KQDDALDD+S +LG LKGMATDMG+ELD+QNKAL
Sbjct  175  PRGKSANRS-YDEPTSAMDKVQIEKQKQDDALDDISGVLGQLKGMATDMGSELDRQNKAL  233

Query  849  DNLDTDIDELNSRVKGANQRARHL  920
            D+L  D+DELNSRVKGANQRAR L
Sbjct  234  DDLQDDVDELNSRVKGANQRARKL  257



>ref|XP_008645745.1| PREDICTED: SNAP25 homologous protein SNAP33 [Zea mays]
 gb|AFW71660.1| hypothetical protein ZEAMMB73_534208 [Zea mays]
Length=262

 Score =   256 bits (653),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 159/207 (77%), Gaps = 1/207 (0%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE+YA  +AEETT ++  CLRIAEDIRQD + TL TLHKQGEQI RTHE AV
Sbjct  57   LENQSVQELEHYAAYKAEETTDALAGCLRIAEDIRQDASDTLITLHKQGEQISRTHEKAV  116

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D+DL+K E LL +LGG FS  WKPKKT++I GP     D++ K K    EQR+KLGL+
Sbjct  117  EIDQDLAKSETLLGSLGGFFSKTWKPKKTRQIKGPAQVSRDDSFKKKASRMEQRDKLGLS  176

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
             +GK  P     E  +AM KV++EK KQDDALDDLS +LG LKGMA DMG+ELD+QN+AL
Sbjct  177  PRGKRDPRHYA-EATDAMDKVQIEKKKQDDALDDLSGVLGQLKGMAVDMGSELDRQNEAL  235

Query  849  DNLDTDIDELNSRVKGANQRARHLLAK  929
            D+L  D++ELNSRVKGANQRAR L+AK
Sbjct  236  DHLQGDVEELNSRVKGANQRARKLVAK  262



>ref|XP_010258125.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Nelumbo nucifera]
Length=298

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 165/210 (79%), Gaps = 5/210 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE+YA  +AEETTK+V+NCL+IAEDIR D  KTL TLH+QGEQI RTH +AV
Sbjct  91   LENQSVQELEHYAAYKAEETTKTVSNCLKIAEDIRDDATKTLVTLHQQGEQITRTHMLAV  150

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTK-EQREKLGL  665
            ++D+DLS+GEKLL +LGG+FS  WKPKKT+EI GP   KDD +   K+G+  EQ  KLGL
Sbjct  151  DIDQDLSRGEKLLGSLGGIFSKTWKPKKTREIAGPVVIKDDPSK--KRGSHLEQLGKLGL  208

Query  666  N--TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQN  839
               ++GK    +PP EP  A+QKVE+EK KQDDAL DLS+ILG+LK MA DMG+E+++Q+
Sbjct  209  TPPSRGKPNSRSPPPEPTTALQKVEVEKEKQDDALSDLSNILGELKEMAVDMGSEIERQS  268

Query  840  KALDNLDTDIDELNSRVKGANQRARHLLAK  929
            KALD +  D+DELNSRV+GANQR R LL K
Sbjct  269  KALDYVHDDVDELNSRVRGANQRGRRLLGK  298



>ref|XP_008393203.1| PREDICTED: SNAP25 homologous protein SNAP33 [Malus domestica]
Length=276

 Score =   254 bits (649),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 162/205 (79%), Gaps = 5/205 (2%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SV+ELENYAV +AEETTK+VN CL+IAE+IR+D  KTL TLH+QGEQI RTH +A ++D+
Sbjct  75   SVEELENYAVYKAEETTKAVNGCLKIAEEIREDATKTLVTLHQQGEQITRTHMVAADIDQ  134

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN--TK  674
            DLS+GEKLL +LGGMFS  WKPK+T+ I+GP  + D   H  ++G++E+REKLGL    K
Sbjct  135  DLSRGEKLLGSLGGMFSKTWKPKRTRPISGPVITGD---HAVRRGSQEEREKLGLTPAPK  191

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
            G+S P T P+ P +A+QKVE+EKAKQDD L DLSD+LG+LK MA DMG+E+++ NKALD 
Sbjct  192  GRSNPRTLPDGPTSALQKVEVEKAKQDDGLSDLSDLLGELKDMAVDMGSEIERHNKALDG  251

Query  855  LDTDIDELNSRVKGANQRARHLLAK  929
            +  D+D +N RV+ ANQR R LL K
Sbjct  252  VYDDVDVINGRVRDANQRGRRLLGK  276



>ref|XP_003524667.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Glycine max]
 gb|KHN48724.1| SNAP25 like protein SNAP33 [Glycine soja]
Length=300

 Score =   255 bits (651),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 162/209 (78%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE+YAV +AEETT SVNNCL+IAE+IR+D  KTL TL +QGEQI R+H +A 
Sbjct  93   LENQSVQELESYAVYKAEETTNSVNNCLKIAENIREDATKTLVTLEQQGEQITRSHHVAA  152

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEKLL +LGG+FS  WKPKKT+ ITGP    DD   + K    EQR+KLGL 
Sbjct  153  DIDHDLSRGEKLLGSLGGLFSKTWKPKKTRAITGPVIVGDDPVRR-KDNHLEQRDKLGLT  211

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  KG+S   TPP EP NA++KVE+EK KQDDAL DLSD+LG+LK MA DMG+E+++ NK
Sbjct  212  SAPKGQSKLRTPPPEPTNALEKVEVEKKKQDDALSDLSDLLGELKDMAVDMGSEIERHNK  271

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            AL++L  D+DELN RVKGANQR R LL K
Sbjct  272  ALNHLYDDVDELNFRVKGANQRGRRLLGK  300



>ref|XP_004508695.1| PREDICTED: SNAP25 homologous protein SNAP33-like isoform X1 [Cicer 
arietinum]
 ref|XP_004508696.1| PREDICTED: SNAP25 homologous protein SNAP33-like isoform X2 [Cicer 
arietinum]
Length=308

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 162/209 (78%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV++AEE T S++NCL+IAE IR++  KTL TLH+QG+QI R+H++A 
Sbjct  101  LENQSVQELENYAVHKAEEATNSIHNCLKIAETIRENATKTLVTLHQQGDQITRSHQVAA  160

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++++DLS+GEKLL +LGG+FS  WKPKKT+ ITGP    DD   + K    EQREKLGL 
Sbjct  161  DIEQDLSRGEKLLGSLGGLFSRTWKPKKTRTITGPVIFGDDPVRR-KGNHLEQREKLGLT  219

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
              +KG S   TPP EP  A++KVE EK KQDDAL DLSD+LG+LK MA DMG+E+++ NK
Sbjct  220  SESKGHSKLRTPPQEPTTALEKVEFEKGKQDDALSDLSDLLGELKDMAVDMGSEIERHNK  279

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            AL++LD D+DELN RVKGANQR R LL K
Sbjct  280  ALNHLDNDVDELNFRVKGANQRGRRLLGK  308



>gb|KHG22115.1| SNAP25 ous SNAP33 -like protein [Gossypium arboreum]
Length=304

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 160/209 (77%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV ++EETTK+VNNC++IAE++R+    TL  LH+QGEQI RTH  A 
Sbjct  97   LENQSVQELENYAVYKSEETTKTVNNCVKIAEEMREGATNTLIALHQQGEQITRTHNTAA  156

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D DLS+GEKLL +LGGMFS  WKPKKT++I GP  ++DD   K + G  EQ+EKLGLN
Sbjct  157  GIDHDLSRGEKLLGSLGGMFSRTWKPKKTRQIVGPVITRDD-LPKSRGGHLEQKEKLGLN  215

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               +  S   TPP EP +A QKVE EKAKQDDAL  LSD+LG+LKGMA DMG+E+++QNK
Sbjct  216  PVPRRHSKSQTPPPEPVDAYQKVEFEKAKQDDALSGLSDLLGELKGMAVDMGSEIERQNK  275

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            +L+ L  D+DELN RV+GANQRAR LL K
Sbjct  276  SLNGLQDDVDELNFRVRGANQRARRLLGK  304



>ref|XP_009338645.1| PREDICTED: SNAP25 homologous protein SNAP33 [Pyrus x bretschneideri]
Length=283

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 161/205 (79%), Gaps = 5/205 (2%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SV+ELENYAV +AEETTK+VN CL+IAE+IR+D  KTL TLH+QGEQI RTH +A ++D+
Sbjct  82   SVEELENYAVYKAEETTKAVNGCLKIAEEIREDATKTLVTLHQQGEQITRTHMVAADIDQ  141

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN--TK  674
            DLS+GEKLL +LGGMFS  WKPK+T+ I+GP  + D   H  ++G++E+REKLGL    K
Sbjct  142  DLSRGEKLLGSLGGMFSKTWKPKRTRPISGPVITGD---HAVRRGSQEEREKLGLTPAPK  198

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
            G+S P T P+ P +A+QKVE+EKAKQDD L DLSD+LG+LK MA DMG+E+++ NKALD 
Sbjct  199  GRSNPRTLPDGPTSALQKVEVEKAKQDDGLSDLSDLLGELKDMAVDMGSEIERHNKALDG  258

Query  855  LDTDIDELNSRVKGANQRARHLLAK  929
            +  D+D +N RV+ A QR R LL K
Sbjct  259  VYDDVDVINGRVRDATQRGRRLLGK  283



>ref|NP_001241533.1| uncharacterized protein LOC100793323 [Glycine max]
 ref|XP_006600190.1| PREDICTED: uncharacterized protein LOC100793323 isoform X1 [Glycine 
max]
 gb|ACU23055.1| unknown [Glycine max]
 gb|KHN18338.1| SNAP25 like protein SNAP33 [Glycine soja]
Length=300

 Score =   252 bits (644),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 161/209 (77%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE+YAV +AEETT SV NCL+IAE+IR++  +TL TLH+QGEQI R+H +A 
Sbjct  93   LENQSVQELESYAVYKAEETTNSVTNCLKIAENIREEATQTLVTLHQQGEQITRSHHVAA  152

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DL++GEKLL +LGG+FS  WKPKKT+ ITGP    DD   + K    EQREKLGL 
Sbjct  153  DIDHDLTRGEKLLGSLGGLFSKTWKPKKTRAITGPVIVGDDPVRR-KGNHLEQREKLGLT  211

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  KG+S   +PP EP NA +KVE+EK KQDDAL DLSD+LG+LKGMA DMG+E+++ NK
Sbjct  212  SAPKGQSKLRSPPQEPTNAFEKVEVEKNKQDDALSDLSDLLGELKGMAVDMGSEIERHNK  271

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            AL++L  D+DELN RV GANQR R LL K
Sbjct  272  ALNHLYDDVDELNFRVIGANQRGRRLLGK  300



>ref|XP_011087328.1| PREDICTED: SNAP25 homologous protein SNAP33 [Sesamum indicum]
Length=305

 Score =   252 bits (644),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 163/209 (78%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ +VQELE+YA+ +AEETTKSVN+CL+IAE++R+D  KTL TLH+QGEQI RTH +A 
Sbjct  98   LENQTVQELESYALYKAEETTKSVNDCLKIAEEMREDATKTLVTLHQQGEQITRTHMVAA  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            +MD DLS+GEKLL +LGG+FS  WKPKKT+ ITGP  ++DD  H+ K    EQRE+LGL 
Sbjct  158  DMDHDLSRGEKLLGSLGGIFSKTWKPKKTRPITGPLITRDDAVHR-KGNHLEQRERLGLT  216

Query  669  TKGKSAPTT--PPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  K    T    +EP NA+QKVE+EK KQDDAL DLS+ILG+LK MA DMG+E+++QNK
Sbjct  217  SASKEISHTRKQSSEPTNALQKVEVEKVKQDDALADLSNILGELKDMAIDMGSEIERQNK  276

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD++  D++ LN RVKGANQR R LL K
Sbjct  277  ALDHVQDDVEVLNIRVKGANQRTRRLLGK  305



>ref|XP_009801843.1| PREDICTED: SNAP25 homologous protein SNAP33 [Nicotiana sylvestris]
 ref|XP_009801844.1| PREDICTED: SNAP25 homologous protein SNAP33 [Nicotiana sylvestris]
Length=303

 Score =   252 bits (644),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 164/209 (78%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
            F++ +V+ELE+YAV +AEETTKSVN CL+IAE++R+D  KTL TLH+QGEQI RTH  A 
Sbjct  96   FENQTVEELEDYAVYKAEETTKSVNGCLKIAEEMREDATKTLITLHQQGEQITRTHMTAA  155

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEKL+ +LGG+FS  WKPKK + ITGP  ++DD   + +    E REKLGL+
Sbjct  156  DIDHDLSRGEKLVGSLGGIFSKTWKPKKNRAITGPVITRDDPVQR-RGNHLELREKLGLS  214

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  K +S+  TPP EP NA+QKVE+EKAKQDD L DLS++LGDLK MA DMG+E+++QNK
Sbjct  215  SAPKARSSSRTPPQEPANALQKVELEKAKQDDGLSDLSNLLGDLKNMAMDMGSEIERQNK  274

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD+++ D+DE+  RVKGANQR   LL K
Sbjct  275  ALDHVEDDVDEIAFRVKGANQRIHRLLRK  303



>gb|KHG01928.1| SNAP25 ous SNAP33 -like protein [Gossypium arboreum]
Length=303

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 158/209 (76%), Gaps = 4/209 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++  VQELENYAV +AEETTK+VNNC++IAE++R+   KTL TLH+QGEQI RTH+ A 
Sbjct  97   IENQPVQELENYAVYKAEETTKTVNNCVKIAEEMREGATKTLITLHQQGEQITRTHDAAA  156

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D DLS GEKLL +LGGMFS  WKPKKT+ I GP  ++DD+  +G     EQREKLGL 
Sbjct  157  GIDHDLSMGEKLLGSLGGMFSKTWKPKKTRAIIGPLVTRDDSQRRG--AHLEQREKLGLT  214

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               +G S   TPP EP N  QKVE+EK+KQD AL DLSD+LG+LK MA DMG+E+++QNK
Sbjct  215  PVPRGGSKSQTPPLEPTNTFQKVEVEKSKQDVALSDLSDLLGELKDMAIDMGSEIERQNK  274

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
             L+ L  D+DELN RV+GANQRAR LL K
Sbjct  275  NLNGLQDDVDELNFRVRGANQRARRLLGK  303



>ref|XP_008792740.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Phoenix dactylifera]
Length=276

 Score =   249 bits (637),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 159/207 (77%), Gaps = 1/207 (0%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV +AEETT+ VN+C++IAE IR+D ++TLETLH+QGEQI RTH+ A 
Sbjct  71   LENQSVQELENYAVCKAEETTQKVNDCMKIAEVIREDASRTLETLHQQGEQIARTHQTAA  130

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D+ LSK EKLL +LGG+FS PWKPKKT++I GP      ++   KKG KEQREKLGL+
Sbjct  131  NIDQGLSKSEKLLGSLGGIFSKPWKPKKTRQIKGPVPGVTRDDSFKKKGNKEQREKLGLS  190

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
            +   + P +  +EP  AM+KV++EK KQDD+L DLSD+LG LK MA  MGTEL+ QNKAL
Sbjct  191  SSPGARPRS-YSEPSTAMEKVQVEKQKQDDSLSDLSDVLGQLKDMALGMGTELEMQNKAL  249

Query  849  DNLDTDIDELNSRVKGANQRARHLLAK  929
            D L  D++ELN R+KGANQR R LL K
Sbjct  250  DGLHDDVEELNHRIKGANQRTRRLLGK  276



>ref|XP_009595358.1| PREDICTED: SNAP25 homologous protein SNAP33 [Nicotiana tomentosiformis]
 ref|XP_009595360.1| PREDICTED: SNAP25 homologous protein SNAP33 [Nicotiana tomentosiformis]
Length=304

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 164/209 (78%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
            F++ +V+ELE+YAV +AEETTKSVN CL+IAE++R+D  KTL TLH+QGEQI RTH  A 
Sbjct  97   FENQTVEELEDYAVYKAEETTKSVNGCLKIAEEMREDATKTLITLHQQGEQITRTHMTAA  156

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEKL+ +LGG+FS  WKPKK + ITGP  ++DD   + +    E REKLGL+
Sbjct  157  DIDHDLSRGEKLVGSLGGIFSKTWKPKKNRAITGPVITRDDPVQR-RGNHLELREKLGLS  215

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  K +S+  TPP EP N +QKVE+EKAKQDD L DLS++LG+LK MATDMG+E+++QNK
Sbjct  216  SAPKARSSSRTPPPEPANVLQKVELEKAKQDDGLSDLSNLLGELKHMATDMGSEIERQNK  275

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD+++ D+DE+  RVKGANQR   LL K
Sbjct  276  ALDHVEDDVDEIAFRVKGANQRIHRLLRK  304



>ref|XP_008805102.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Phoenix dactylifera]
Length=276

 Score =   249 bits (636),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 159/207 (77%), Gaps = 1/207 (0%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV+ A+ETT+ VN+CL+IAE IR+D ++TLETLH+QGEQI RTH+ AV
Sbjct  71   LENQSVQELENYAVHTAKETTQKVNDCLKIAEVIREDASRTLETLHQQGEQIARTHQTAV  130

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D+DLSK E LL++LGG FS PWKPKKT++I GP      ++   +KG KEQREKLGL+
Sbjct  131  NIDQDLSKSETLLSSLGGFFSKPWKPKKTRQIKGPVPVVTRDDSFKRKGNKEQREKLGLS  190

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
            +  + A +    E   AM+KV++EK KQDD+L DLSD+LG LK MA DM TELD+QNKAL
Sbjct  191  SSPQ-ARSRIYTESTTAMEKVQVEKQKQDDSLSDLSDVLGQLKDMALDMSTELDRQNKAL  249

Query  849  DNLDTDIDELNSRVKGANQRARHLLAK  929
            D L  D++ELN R+KGANQR R LL K
Sbjct  250  DGLHDDVEELNHRIKGANQRTRKLLGK  276



>ref|XP_010904957.1| PREDICTED: SNAP25 homologous protein SNAP33-like isoform X2 [Elaeis 
guineensis]
Length=276

 Score =   249 bits (635),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 161/207 (78%), Gaps = 1/207 (0%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV++++ETT+ VN+CL+IAE IR+D ++TLETLH+QGEQI RTH+ AV
Sbjct  71   LENQSVQELENYAVHKSKETTQKVNDCLKIAEVIREDASRTLETLHQQGEQIARTHQTAV  130

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D+DL K E LL++LGG FS PWKPKKT++I GP      ++   +KG KEQREKLGL+
Sbjct  131  NIDQDLCKSETLLSSLGGFFSKPWKPKKTRQIKGPVPVVTRDDSFKRKGNKEQREKLGLS  190

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
            +  ++ P    +EP  AM+KV++EK KQDD+L DLSD+LG LK MA DMGTEL +QN+AL
Sbjct  191  SNPQARPRN-YSEPTAAMEKVQVEKQKQDDSLSDLSDVLGQLKDMALDMGTELGRQNEAL  249

Query  849  DNLDTDIDELNSRVKGANQRARHLLAK  929
            D L  D++ELN R+KGANQR R LL K
Sbjct  250  DGLHDDVEELNHRIKGANQRTRKLLGK  276



>ref|XP_010904956.1| PREDICTED: putative SNAP25 homologous protein SNAP30 isoform 
X1 [Elaeis guineensis]
Length=329

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 161/207 (78%), Gaps = 1/207 (0%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV++++ETT+ VN+CL+IAE IR+D ++TLETLH+QGEQI RTH+ AV
Sbjct  124  LENQSVQELENYAVHKSKETTQKVNDCLKIAEVIREDASRTLETLHQQGEQIARTHQTAV  183

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D+DL K E LL++LGG FS PWKPKKT++I GP      ++   +KG KEQREKLGL+
Sbjct  184  NIDQDLCKSETLLSSLGGFFSKPWKPKKTRQIKGPVPVVTRDDSFKRKGNKEQREKLGLS  243

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
            +  ++ P    +EP  AM+KV++EK KQDD+L DLSD+LG LK MA DMGTEL +QN+AL
Sbjct  244  SNPQARPRN-YSEPTAAMEKVQVEKQKQDDSLSDLSDVLGQLKDMALDMGTELGRQNEAL  302

Query  849  DNLDTDIDELNSRVKGANQRARHLLAK  929
            D L  D++ELN R+KGANQR R LL K
Sbjct  303  DGLHDDVEELNHRIKGANQRTRKLLGK  329



>gb|AFK41395.1| unknown [Lotus japonicus]
Length=305

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 158/209 (76%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE+YAV +AEETTKSVNNCL+IAE IR+D  KTL TLH+QGEQI R+H +A 
Sbjct  98   VENQSVQELESYAVYKAEETTKSVNNCLKIAEHIREDATKTLVTLHQQGEQITRSHYVAA  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEKLL +LG +FS  WKPKKT+ I GP     DN    +    EQREKLGL 
Sbjct  158  DIDHDLSRGEKLLGSLGDLFSKTWKPKKTRAIRGPVIF-GDNPVSRQANHLEQREKLGLT  216

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  +G++   TPP+E   A+QKVE EK KQDDAL DLSD+LG+LK MA DMG+E+++ NK
Sbjct  217  SAPRGQTKMRTPPHESSTALQKVEFEKGKQDDALSDLSDLLGELKDMAIDMGSEIERHNK  276

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            AL +LD D++ELN RVKGANQR R LL K
Sbjct  277  ALSHLDDDVEELNFRVKGANQRGRRLLGK  305



>ref|XP_006281801.1| hypothetical protein CARUB_v10027974mg [Capsella rubella]
 gb|EOA14699.1| hypothetical protein CARUB_v10027974mg [Capsella rubella]
Length=306

 Score =   248 bits (632),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 156/209 (75%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             D+ SVQELE YAV +AEETTKSV+ CL++AEDIR D  +TL  LH+QGEQI RTH  AV
Sbjct  99   IDNQSVQELEGYAVYKAEETTKSVHGCLKVAEDIRSDATRTLVMLHEQGEQITRTHHKAV  158

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKKT+ I GP  ++D +  + +    E+REKLGLN
Sbjct  159  EIDHDLSRGEKLLGSLGGMFSKTWKPKKTRPINGPSITRDHSPTR-RVNHLEKREKLGLN  217

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               +G+S    P  E  +A QKVEMEKAKQDD L DLSDILG+LK MA DMG+E++KQNK
Sbjct  218  PAPRGQSRTREPLPESADAYQKVEMEKAKQDDGLSDLSDILGELKNMAVDMGSEIEKQNK  277

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
             LD+L  D+DELN RV+ +NQR R LL K
Sbjct  278  GLDHLHDDVDELNYRVQQSNQRGRRLLGK  306



>ref|XP_008777761.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Phoenix dactylifera]
Length=301

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 164/208 (79%), Gaps = 2/208 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
            F++ SVQELENYAV +A+ETT+ VN CL+IAE++R D ++TL TLH+QG+QI+RTH   +
Sbjct  95   FENQSVQELENYAVYKADETTQKVNGCLKIAEEMRDDASRTLVTLHQQGQQINRTHLTTI  154

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D +LS+GEKLL +LGG+FS  WKPKKT+ I GP  ++DD+  + K    EQR+KLGL+
Sbjct  155  DVDHELSRGEKLLGSLGGIFSKTWKPKKTRTIKGPALTRDDSFIR-KGSHMEQRQKLGLS  213

Query  669  TK-GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
                +S P T P+EP +A+++VE+EKAKQDDAL DLS++LG+LK MA DMG+E+D+Q KA
Sbjct  214  GPLPRSNPRTFPSEPTSALEQVEIEKAKQDDALSDLSNLLGELKDMAIDMGSEMDRQTKA  273

Query  846  LDNLDTDIDELNSRVKGANQRARHLLAK  929
            LDN+  D+DELN RVKGAN R R LL K
Sbjct  274  LDNMQDDVDELNFRVKGANIRGRRLLGK  301



>ref|XP_010322574.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Solanum lycopersicum]
 ref|XP_010322575.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Solanum lycopersicum]
Length=306

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 163/210 (78%), Gaps = 3/210 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
            F++ +V+ELENYAV ++EETTKSVN+CL+IA+D+R+D  KTL TLH+QGEQI RTH  A 
Sbjct  97   FENQTVEELENYAVYRSEETTKSVNSCLKIAQDMREDATKTLITLHQQGEQITRTHMTAA  156

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTK-EQREKLGL  665
            ++D DLS+GEKLL +LGG+FS  WKPK ++ ITGP  ++  ++   ++G   EQREKLGL
Sbjct  157  DIDHDLSRGEKLLGSLGGIFSKTWKPKTSRPITGPVITRMSDDPVQRRGNHLEQREKLGL  216

Query  666  NT--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQN  839
            N+  K +S+  TP  EP NAMQKVE EKAKQDD L +LSD+LG+LK MA DMG+E+++  
Sbjct  217  NSAPKARSSSRTPHPEPTNAMQKVEAEKAKQDDGLSELSDLLGELKNMAVDMGSEIERHK  276

Query  840  KALDNLDTDIDELNSRVKGANQRARHLLAK  929
             ALD+ + D+DEL +RV+GAN+R R LL K
Sbjct  277  DALDHTEQDVDELGTRVQGANRRIRRLLGK  306



>ref|XP_007155259.1| hypothetical protein PHAVU_003G186500g [Phaseolus vulgaris]
 ref|XP_007155260.1| hypothetical protein PHAVU_003G186500g [Phaseolus vulgaris]
 gb|ESW27253.1| hypothetical protein PHAVU_003G186500g [Phaseolus vulgaris]
 gb|ESW27254.1| hypothetical protein PHAVU_003G186500g [Phaseolus vulgaris]
Length=300

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 159/209 (76%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE+YAV +AEETT SVN+CL+IA +IR+D   TL TLH+QGEQI ++H +A 
Sbjct  93   LENQSVQELESYAVYKAEETTNSVNSCLKIAANIREDATNTLVTLHQQGEQIIKSHHVAA  152

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEKLL +LGG+FS  WKPKKT+ ITGP    DD   + K    EQREKLGL 
Sbjct  153  DIDHDLSRGEKLLGSLGGLFSKTWKPKKTRAITGPVIVGDDPV-RSKGSHLEQREKLGLT  211

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
              TKG+S   T P EP NA++KVE+E  KQDDAL DLSD+LG+LK MA DMG+E+++ NK
Sbjct  212  SATKGQSKLRTLPQEPTNALEKVEVEIKKQDDALSDLSDMLGELKDMAVDMGSEIERHNK  271

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            AL++L  D+DELN R+KGANQR R LL K
Sbjct  272  ALNHLYDDVDELNYRMKGANQRGRRLLGK  300



>ref|XP_006354763.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Solanum tuberosum]
Length=306

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 163/210 (78%), Gaps = 3/210 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
            F++ +V ELENYAV ++EETTKSVN+CL+IA+D+R+D  KTL TLH+QGEQI RTH  A 
Sbjct  97   FENQTVDELENYAVYRSEETTKSVNSCLKIAQDMREDATKTLITLHQQGEQITRTHMTAA  156

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTK-EQREKLGL  665
            ++D DLS+GEKLL +LGG+FS  WKPK ++ ITGP  ++  ++   ++G   EQREKLGL
Sbjct  157  DIDHDLSRGEKLLGSLGGIFSKTWKPKTSRPITGPVITRMSDDPVQRRGNHLEQREKLGL  216

Query  666  NT--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQN  839
            ++  K +S+  TPP EP NA+QKVE EKAKQDD L +LSD+LG+LK MA DMG+E+ +  
Sbjct  217  SSAPKARSSSRTPPPEPTNALQKVEAEKAKQDDGLSELSDLLGELKNMAVDMGSEIGRHK  276

Query  840  KALDNLDTDIDELNSRVKGANQRARHLLAK  929
            +ALD+ + D+DEL +RV+GAN+R R LL K
Sbjct  277  EALDHTEQDVDELGTRVQGANRRIRRLLGK  306



>gb|AAM62553.1| snap25a [Arabidopsis thaliana]
Length=300

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 156/209 (75%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE YAV +AEETTKSV  CL++AEDIR D  +TL  LH QGEQI RTH  AV
Sbjct  93   IENQSVQELEGYAVYKAEETTKSVQGCLKVAEDIRSDATRTLVMLHDQGEQITRTHHKAV  152

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKKT+ I GP  ++DD+  + +    E+REKLGLN
Sbjct  153  EIDHDLSRGEKLLGSLGGMFSKTWKPKKTRPINGPVVTRDDSPTR-RVNHLEKREKLGLN  211

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  +G+S    P  E  +A Q+VEMEKAKQDD L DLSDILG+LK MA DMG+E++KQNK
Sbjct  212  SAPRGQSRTREPLPESADAYQRVEMEKAKQDDGLSDLSDILGELKNMAVDMGSEIEKQNK  271

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
             LD+L  D+DELN RV+ +NQR R LL K
Sbjct  272  GLDHLHDDVDELNFRVQQSNQRGRRLLGK  300



>ref|NP_200929.1| soluble N-ethylmaleimide-sensitive factor adaptor protein 33 
[Arabidopsis thaliana]
 sp|Q9S7P9.1|SNP33_ARATH RecName: Full=SNAP25 homologous protein SNAP33; Short=AtSNAP33; 
AltName: Full=Snap25a; AltName: Full=Synaptosomal-associated 
protein SNAP25-like 1; Short=SNAP-25-like protein 1 [Arabidopsis 
thaliana]
 emb|CAB52582.1| SNAP33 protein [Arabidopsis thaliana]
 emb|CAB52583.1| SNAP33B protein [Arabidopsis thaliana]
 dbj|BAB10383.1| SNAP25A protein [Arabidopsis thaliana]
 gb|AAL15258.1| AT5g61210/maf19_210 [Arabidopsis thaliana]
 emb|CAC79615.1| SNAP-25 like protein [Arabidopsis thaliana]
 gb|AAM98258.1| At5g61210/maf19_210 [Arabidopsis thaliana]
 gb|AED97436.1| soluble N-ethylmaleimide-sensitive factor adaptor protein 33 
[Arabidopsis thaliana]
Length=300

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 156/209 (75%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE YAV +AEETTKSV  CL++AEDIR D  +TL  LH QGEQI RTH  AV
Sbjct  93   IENQSVQELEGYAVYKAEETTKSVQGCLKVAEDIRSDATRTLVMLHDQGEQITRTHHKAV  152

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKKT+ I GP  ++DD+  + +    E+REKLGLN
Sbjct  153  EIDHDLSRGEKLLGSLGGMFSKTWKPKKTRPINGPVVTRDDSPTR-RVNHLEKREKLGLN  211

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  +G+S    P  E  +A Q+VEMEKAKQDD L DLSDILG+LK MA DMG+E++KQNK
Sbjct  212  SAPRGQSRTREPLPESADAYQRVEMEKAKQDDGLSDLSDILGELKNMAVDMGSEIEKQNK  271

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
             LD+L  D+DELN RV+ +NQR R LL K
Sbjct  272  GLDHLHDDVDELNFRVQQSNQRGRRLLGK  300



>ref|XP_002864724.1| synaptosomal-associated protein 33 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40983.1| synaptosomal-associated protein 33 [Arabidopsis lyrata subsp. 
lyrata]
Length=300

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 158/209 (76%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE YAV +AEETTKSV+ CL++AEDIR D  +TL  LH+QGEQI RTH  AV
Sbjct  93   IENQSVQELEGYAVYKAEETTKSVHGCLKVAEDIRSDATRTLVMLHEQGEQITRTHHKAV  152

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D+DLS+GEKLL +LGGMFS  WKPKKT+ I GP  ++D +  + +    E+REKLGLN
Sbjct  153  EIDQDLSRGEKLLGSLGGMFSKTWKPKKTRPINGPVITRDHSPTR-RVNHLEKREKLGLN  211

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  KG+S    P  E  +A Q+VEMEKAKQDD L DLSDILG+LK MA DMG+E++KQNK
Sbjct  212  SAPKGQSRTREPLPESADAYQRVEMEKAKQDDGLSDLSDILGELKNMAVDMGSEIEKQNK  271

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
             LD+L  D+DELN RV+ +NQR R LL K
Sbjct  272  GLDHLHDDVDELNFRVQQSNQRGRRLLGK  300



>ref|XP_010106653.1| SNAP25-like protein [Morus notabilis]
 gb|EXC11032.1| SNAP25-like protein [Morus notabilis]
Length=306

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 157/209 (75%), Gaps = 4/209 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE+YAV +AEETTKSVNNCL+IAED+R+D  KTL  LH QGEQI RTH +A 
Sbjct  100  LENQSVQELEDYAVYKAEETTKSVNNCLKIAEDMREDATKTLVLLHHQGEQITRTHTVAA  159

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEKLL +LGG+FS  WKPKKT++I GP    DD     K    EQREKLGL 
Sbjct  160  DIDYDLSRGEKLLGSLGGIFSKTWKPKKTRQIKGPVIVGDDVQR--KVAHMEQREKLGLA  217

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               K ++   T   EP +A QKVE+EKAKQDDAL DLS++LG+LK MA DMGTE+++ NK
Sbjct  218  PLPKARTKAQTLHPEPTDAYQKVEVEKAKQDDALSDLSNMLGELKDMAVDMGTEIERHNK  277

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD++  D+DELN RV+GAN+R R LL K
Sbjct  278  ALDHMYDDVDELNYRVRGANERGRRLLGK  306



>ref|XP_010678419.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Beta vulgaris 
subsp. vulgaris]
Length=311

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 156/210 (74%), Gaps = 5/210 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             D+ SV+ELENYA  +AE+TTKSV+NCLRIAE IR D  KTL TLH+QGEQI RTHE A 
Sbjct  104  VDNQSVEELENYAAYKAEDTTKSVDNCLRIAEGIRDDATKTLVTLHQQGEQIRRTHEEAA  163

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTK-EQREKLGL  665
             MD DLS+GEKLL +LGG+FS  WKPKKT  + GP   +DD      KG+  EQ+E+LGL
Sbjct  164  SMDYDLSRGEKLLGSLGGLFSKTWKPKKTAPVKGPIMLRDD--PVWSKGSHLEQKERLGL  221

Query  666  NT--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQN  839
             +   G+S   TPP EP NA+QKVE EK KQDDAL DLSD+LG+LK MA DMG+E+ +QN
Sbjct  222  TSTKNGRSKSRTPPPEPTNALQKVEAEKVKQDDALSDLSDLLGELKVMAQDMGSEIQRQN  281

Query  840  KALDNLDTDIDELNSRVKGANQRARHLLAK  929
             +L+++D D+  LN RVK +NQRAR LL K
Sbjct  282  HSLNHVDDDVAILNDRVKDSNQRARRLLGK  311



>ref|XP_010443936.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Camelina sativa]
Length=303

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 154/209 (74%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             D+ SVQELE YAV +AEETTKSV  CL++AEDIR D  +TL  LH QGEQI RTH  AV
Sbjct  96   IDNQSVQELEGYAVYKAEETTKSVQGCLKVAEDIRSDATRTLVMLHDQGEQITRTHHKAV  155

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKKT+ I GP  ++D +  + +    E+REKLGLN
Sbjct  156  EIDHDLSRGEKLLGSLGGMFSKTWKPKKTRPINGPIITRDHSPTR-RVNHLEKREKLGLN  214

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               KG+S       EP +A Q+VEMEKAKQDD L DLSDILG+LK MA DMG+E++KQNK
Sbjct  215  PAPKGQSRTREALPEPADAYQRVEMEKAKQDDGLSDLSDILGELKNMAVDMGSEIEKQNK  274

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
             LD+L  D+DELN RV+ +NQR R LL K
Sbjct  275  GLDHLHDDVDELNFRVQQSNQRGRRLLGK  303



>ref|XP_010483785.1| PREDICTED: SNAP25 homologous protein SNAP33 [Camelina sativa]
 ref|XP_010483786.1| PREDICTED: SNAP25 homologous protein SNAP33 [Camelina sativa]
 ref|XP_010483787.1| PREDICTED: SNAP25 homologous protein SNAP33 [Camelina sativa]
Length=302

 Score =   244 bits (624),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 154/209 (74%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             D+ SVQELE YAV +AEETTKSV  CL++AEDIR D  +TL  LH QGEQI RTH  AV
Sbjct  95   IDNQSVQELEGYAVYKAEETTKSVQGCLKVAEDIRSDATRTLVMLHDQGEQITRTHHKAV  154

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKKT+ I GP  ++D +  + +    E+REKLGLN
Sbjct  155  EIDHDLSRGEKLLGSLGGMFSKTWKPKKTRPINGPIITRDHSPTR-RVNHLEKREKLGLN  213

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               KG+S    P  E  +A Q+VEMEKAKQDD L DLSDILG+LK MA DMG+E++KQNK
Sbjct  214  PAPKGQSRTREPLPESADAYQRVEMEKAKQDDGLSDLSDILGELKNMAVDMGSEIEKQNK  273

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
             LD+L  D+DELN RV+ +NQR R LL K
Sbjct  274  GLDHLHDDVDELNFRVQQSNQRGRRLLGK  302



>gb|AFK39371.1| unknown [Lotus japonicus]
Length=302

 Score =   244 bits (624),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 156/215 (73%), Gaps = 14/215 (7%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             +  SVQELENYAV ++EETTKSVNNCL+IAE+IR+D   TL  LH+QGEQI R+H++A 
Sbjct  90   LESQSVQELENYAVYKSEETTKSVNNCLKIAEEIREDATNTLVMLHQQGEQITRSHDVAA  149

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDD-----NNHKGKKGTKEQRE  653
            ++D DLS+GEKLL +LGGMFS  WKPKKT  ITGP     D      NH       EQRE
Sbjct  150  DIDHDLSRGEKLLGSLGGMFSRTWKPKKTGTITGPVIFGADPVRRNGNH------SEQRE  203

Query  654  KLGLNT---KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTE  824
            KLGL +   KG+S P    +EP NA +KVE+EK KQDDAL D+SD+LG+LKGMA DMG+E
Sbjct  204  KLGLTSSAPKGQSKPRKSLSEPTNAFEKVEVEKGKQDDALSDISDLLGELKGMAMDMGSE  263

Query  825  LDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            +D+   A+D  D D+++L+ R+ GANQR RHLL K
Sbjct  264  IDRHINAMDGFDKDVEKLSIRMNGANQRGRHLLGK  298



>ref|XP_010939205.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Elaeis guineensis]
Length=303

 Score =   244 bits (623),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 163/208 (78%), Gaps = 2/208 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV +AEETT+ VN CL+IAE++R D ++TL TLH+QG+QI+RTH  A+
Sbjct  97   LENQSVQELENYAVYKAEETTQKVNGCLKIAEEMRDDASRTLVTLHQQGQQINRTHLTAI  156

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D +LS+GEKLL +LGG+FS  WKPKK +EI GP  ++DD+  + K    EQR+KLGL+
Sbjct  157  DIDHELSRGEKLLGSLGGIFSKTWKPKKNREIKGPALTRDDSFIR-KGSHMEQRQKLGLS  215

Query  669  TK-GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
                +S P T P++P +A++KVE+EKAKQDD L DLS++LG+LK MATDMG E+++Q KA
Sbjct  216  GPLPRSNPRTFPSDPTSALEKVEVEKAKQDDTLSDLSNLLGELKDMATDMGAEIERQTKA  275

Query  846  LDNLDTDIDELNSRVKGANQRARHLLAK  929
            +DN+  D+DELN RVKGAN R R LL K
Sbjct  276  MDNMQDDVDELNFRVKGANIRGRRLLGK  303



>ref|XP_008453247.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Cucumis 
melo]
Length=307

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 156/208 (75%), Gaps = 1/208 (0%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ +V+ELENYAV +AEETT SVNNCL+IAEDIR+D  KTL  LH+QGEQI RTH +  
Sbjct  100  IENQTVEELENYAVYKAEETTNSVNNCLKIAEDIREDATKTLVALHQQGEQITRTHMVTA  159

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEKLL +LGG+FS  WKPKK ++ITGP   + D+    K    EQREKLGL+
Sbjct  160  DIDNDLSRGEKLLGSLGGIFSKTWKPKKGRQITGPVIFEGDHAVISKGNHLEQREKLGLS  219

Query  669  TKGKSAPTTPPN-EPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
                   +  P+ EP N++QKVE+EK KQ+DAL DLS+ILG+LK MA DMG+ELDKQN+A
Sbjct  220  RAPNPRSSRAPHPEPTNSLQKVEVEKVKQEDALSDLSNILGELKEMAVDMGSELDKQNRA  279

Query  846  LDNLDTDIDELNSRVKGANQRARHLLAK  929
            LDNL  D +E+  RV  ANQRARHLL K
Sbjct  280  LDNLFDDANEVTIRVDNANQRARHLLRK  307



>ref|XP_010457045.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Camelina sativa]
Length=306

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 154/209 (74%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             D+ SVQELE YAV +AEETTKSV  CL++AEDIR D  +TL  LH QGEQI RTH  AV
Sbjct  99   IDNQSVQELEGYAVYKAEETTKSVQGCLKVAEDIRSDATRTLVMLHDQGEQITRTHHKAV  158

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKKT+ I GP  ++D +  + +    E+REKLGLN
Sbjct  159  EIDHDLSRGEKLLGSLGGMFSKTWKPKKTRPINGPIITRDHSPTR-RVNHLEKREKLGLN  217

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               KG+S    P  E  +A Q+VEMEKAKQDD L DLSDILG+LK MA DMG+E++KQNK
Sbjct  218  PAPKGQSRTREPLPESADAYQRVEMEKAKQDDGLSDLSDILGELKNMAVDMGSEIEKQNK  277

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
             LD+L  D+DELN RV+ +NQR R LL K
Sbjct  278  GLDHLHDDVDELNFRVQQSNQRGRRLLGK  306



>ref|XP_002284486.1| PREDICTED: SNAP25 homologous protein SNAP33 [Vitis vinifera]
Length=305

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 158/209 (76%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV +AEE TK VNNCL+IAEDIR+D  KTL TLH+QG+QI RTH  A 
Sbjct  98   IENQSVQELENYAVYKAEENTKMVNNCLKIAEDIREDATKTLVTLHQQGQQITRTHMNAA  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGL-  665
            ++D DLS+GEKLL +LGG+FS  WKP KT+ ITGP T++DD +++ K    EQREKLGL 
Sbjct  158  DIDHDLSRGEKLLGSLGGIFSKTWKPIKTRPITGPITTRDDLSYR-KGSHMEQREKLGLA  216

Query  666  -NTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               KG+ A  TPP EP NA+QKVE+E AKQDD L DLS++L +LK MA DMGTE++  N+
Sbjct  217  PAPKGRLATRTPPPEPTNALQKVEVEHAKQDDTLSDLSNLLDELKYMAVDMGTEIESHNR  276

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            AL  ++ D+D L+ R+K  NQRAR LL K
Sbjct  277  ALAPMEDDVDVLSIRIKDGNQRARRLLGK  305



>gb|KCW83692.1| hypothetical protein EUGRSUZ_B00569 [Eucalyptus grandis]
Length=243

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 157/209 (75%), Gaps = 4/209 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             +  SVQELE+YA  +AEETTKSVNN L+IA D+R+D  +TL  LH+Q EQI R+H +A 
Sbjct  37   LESQSVQELESYATYKAEETTKSVNNSLKIAVDMREDATRTLVMLHEQSEQITRSHAIAA  96

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D+DLS+GEKLL +LGGMFS  WKPKK ++I GP  ++D    KG     EQREKLGL 
Sbjct  97   NIDQDLSRGEKLLGSLGGMFSKTWKPKKNRQIAGPLITRDAVQTKGNH--LEQREKLGLT  154

Query  669  TKGK--SAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  K  S   TP +EP +A+QKVE+EK+KQDDAL ++S+ILG+LK MA DMGTE+++ NK
Sbjct  155  SASKQQSKTRTPLHEPTDALQKVEVEKSKQDDALSEISNILGELKDMAIDMGTEIERSNK  214

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD+ D D++EL+ RVKGANQR R LL K
Sbjct  215  ALDHFDKDVEELDYRVKGANQRGRRLLGK  243



>gb|EYU29393.1| hypothetical protein MIMGU_mgv1a010876mg [Erythranthe guttata]
Length=299

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 158/206 (77%), Gaps = 7/206 (3%)
 Frame = +3

Query  324  VQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKD  503
            +QELE YAV++AEETTK+VNNCL+IAE IR+D ++TL  LH+QGEQI RTH +A +MD+D
Sbjct  97   LQELEEYAVSKAEETTKTVNNCLKIAEGIREDASRTLVNLHQQGEQITRTHMVAADMDRD  156

Query  504  LSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKGKS  683
            L++GEKLL +LGG+FS  WKPK T++I GP  +KD           EQRE+LGL +   S
Sbjct  157  LTRGEKLLGSLGGIFSKTWKPKMTRQIIGPTITKDYPVLHRTGNQLEQRERLGLTS---S  213

Query  684  AP----TTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALD  851
            AP    +  P+EP N +QKVE+EK KQDDAL DLS+ILG+LK MA DMG+E+++QNKALD
Sbjct  214  APKDERSHAPHEPANVLQKVEVEKVKQDDALVDLSNILGELKNMAIDMGSEIERQNKALD  273

Query  852  NLDTDIDELNSRVKGANQRARHLLAK  929
            ++  D++E+N RVKGANQR R LL K
Sbjct  274  HVHDDVEEINFRVKGANQRTRRLLGK  299



>ref|NP_001241453.1| uncharacterized protein LOC100794076 [Glycine max]
 gb|ACU17955.1| unknown [Glycine max]
Length=291

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 155/209 (74%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             +  SVQELENYAV +AEETT SVN+CL+IAE++R+D  KTL  LH+QGEQI R+H +A 
Sbjct  84   LESQSVQELENYAVYKAEETTNSVNSCLKIAEEMREDATKTLVMLHQQGEQITRSHHVAA  143

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEKLL +LGGMFS  WKPKKT  ITGP    +D   K K    EQREKLGL 
Sbjct  144  DIDHDLSRGEKLLGSLGGMFSKTWKPKKTGTITGPVVFGEDPVRK-KGNHLEQREKLGLT  202

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  KG+S   T  +EP N ++KVE+EK KQDDAL DLSD+LG+LKGMA DMG+E+  QN+
Sbjct  203  SAPKGQSKSRTTLSEPSNVLEKVEVEKGKQDDALSDLSDLLGELKGMAIDMGSEIGSQNQ  262

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD  D D+++L  RV GANQR R LL K
Sbjct  263  ALDGFDNDMEKLIVRVNGANQRGRRLLGK  291



>ref|XP_003562758.1| PREDICTED: SNAP25 homologous protein SNAP33 [Brachypodium distachyon]
Length=263

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 158/208 (76%), Gaps = 1/208 (0%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
            F++ SVQELE+YA  +A+ETT+ VN+CLR+AE+IR+    TL TLHKQGEQI+RTHE A 
Sbjct  56   FENQSVQELESYAEYKADETTQRVNDCLRLAENIREGATNTLITLHKQGEQINRTHETAA  115

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D+DLS+ E LL +LGG+FS  WKPKKT++I GP     D++ K +    EQREKLGL+
Sbjct  116  NIDQDLSRSETLLGSLGGLFSKTWKPKKTRQIKGPAIITRDDSFKRRANHLEQREKLGLS  175

Query  669  TKGKSAPTTPP-NEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
            +  +    +   ++P NAM+KV++EK KQD+AL DLSDILG LKGMA DMG+E+D+Q KA
Sbjct  176  SSPREKLNSQKYSDPTNAMEKVQVEKDKQDNALSDLSDILGQLKGMALDMGSEIDRQTKA  235

Query  846  LDNLDTDIDELNSRVKGANQRARHLLAK  929
            +D L  D+ ELNSRVKGANQRAR LL K
Sbjct  236  MDGLQDDVVELNSRVKGANQRARRLLWK  263



>gb|KHN48757.1| SNAP25 like protein SNAP33 [Glycine soja]
Length=291

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 155/209 (74%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             +  SVQELENYAV +AEETT SVN+CL+IAE++R+D  KTL  LH+QGEQI R+H +A 
Sbjct  84   LESQSVQELENYAVYKAEETTNSVNSCLKIAEEMREDATKTLVMLHQQGEQITRSHHVAA  143

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEKLL +LGGMFS  WKPKKT  ITGP    +D   K K    EQREKLGL 
Sbjct  144  DIDHDLSRGEKLLGSLGGMFSKTWKPKKTGTITGPVVFGEDPVRK-KGNHLEQREKLGLT  202

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  KG+S   T  +EP N ++KVE+EK KQDDAL DLSD+LG+LKGMA DMG+E+  QN+
Sbjct  203  SAPKGQSKSRTTLSEPSNVLEKVEVEKGKQDDALSDLSDLLGELKGMAIDMGSEIGSQNQ  262

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD  D D+++L  RV GANQR R LL K
Sbjct  263  ALDGFDNDMEKLIVRVNGANQRGRRLLGK  291



>emb|CDY02165.1| BnaA03g40020D [Brassica napus]
Length=306

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 155/209 (74%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE YAV +AEETTKSV  CL++AEDIR D  +TL  LH+QGEQI RTH  AV
Sbjct  99   VENQSVQELEGYAVYKAEETTKSVQGCLKVAEDIRSDATRTLVMLHEQGEQITRTHHQAV  158

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKKT+ I GP  ++D +  + +    E+REKLGLN
Sbjct  159  EIDHDLSRGEKLLGSLGGMFSKTWKPKKTRPINGPVITRDHSPTR-RINHLEKREKLGLN  217

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               KG+S    P  E  +A Q+VEMEKAKQDD L DLSD+LG+LK MA DMG+E++KQNK
Sbjct  218  PAPKGQSRSREPLPESADAYQRVEMEKAKQDDGLSDLSDLLGELKNMAVDMGSEIEKQNK  277

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
             LD+L  D+DELN RV+ +NQR R LL K
Sbjct  278  GLDHLQDDVDELNFRVQQSNQRGRRLLGK  306



>ref|XP_003527100.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Glycine max]
 gb|KHN04136.1| SNAP25 like protein SNAP33 [Glycine soja]
Length=292

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 155/209 (74%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             +  SVQELENYAV +AEETT SVN+CL+IAE++R+D  KTL  LH QGEQI R+H +A 
Sbjct  85   LESQSVQELENYAVYKAEETTNSVNSCLKIAEEMREDATKTLVMLHHQGEQITRSHHVAA  144

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEKLL +LGGMFS  WKPKKT  ITGP    DD   + K    EQREKLGL 
Sbjct  145  DIDHDLSRGEKLLGSLGGMFSKTWKPKKTGTITGPVVFGDDPVRR-KGNHLEQREKLGLT  203

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  KG+S      +EP NA++KVE+EK KQDDAL DLSD+LG+LKGMA DMG+E+ +QN+
Sbjct  204  SAPKGQSKSRPTLSEPSNALEKVEVEKGKQDDALSDLSDLLGELKGMAIDMGSEIGRQNQ  263

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD  D D+++L  RV GANQR+  LL K
Sbjct  264  ALDGFDNDMEKLTVRVNGANQRSHRLLGK  292



>ref|XP_004138184.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Cucumis sativus]
 gb|KGN63709.1| hypothetical protein Csa_1G012100 [Cucumis sativus]
Length=308

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 156/208 (75%), Gaps = 1/208 (0%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ +V+ELE+YAV +AEETT SVNNCL+IAEDIR+D  KTL  LH+QGEQI RTH +  
Sbjct  101  IENQTVEELESYAVYKAEETTNSVNNCLKIAEDIREDATKTLVALHQQGEQITRTHVVTA  160

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEKLL +LGG+FS  WKPKK ++ITGP   + D+    K    EQREKLGL+
Sbjct  161  DIDNDLSRGEKLLGSLGGIFSKTWKPKKGRQITGPVIFEGDHAVISKGNHLEQREKLGLS  220

Query  669  TKGKSAPTTPPN-EPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
                   +  P+ EP N++QKVE+EK KQDDAL DLS+ILG+LK MA DMG+ELDKQNKA
Sbjct  221  RAPNPRSSRAPHPEPTNSLQKVEVEKVKQDDALSDLSNILGELKEMAVDMGSELDKQNKA  280

Query  846  LDNLDTDIDELNSRVKGANQRARHLLAK  929
            LD+L  D +E+  RV  ANQRARHLL K
Sbjct  281  LDHLFDDANEVTIRVDNANQRARHLLRK  308



>ref|XP_007157643.1| hypothetical protein PHAVU_002G087000g [Phaseolus vulgaris]
 ref|XP_007157644.1| hypothetical protein PHAVU_002G087000g [Phaseolus vulgaris]
 ref|XP_007157646.1| hypothetical protein PHAVU_002G087000g [Phaseolus vulgaris]
 gb|ESW29637.1| hypothetical protein PHAVU_002G087000g [Phaseolus vulgaris]
 gb|ESW29638.1| hypothetical protein PHAVU_002G087000g [Phaseolus vulgaris]
 gb|ESW29640.1| hypothetical protein PHAVU_002G087000g [Phaseolus vulgaris]
Length=290

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 155/209 (74%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             +  SVQELE+YAV +AEETTKSVN+CL+IAE++R+D  KTL  LH+QGEQI R+H +A 
Sbjct  83   LESQSVQELEDYAVYKAEETTKSVNSCLKIAEEMREDATKTLVMLHQQGEQITRSHHVAA  142

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEKLL +LGGMFS  WKPKKT  ITGP    DD   + K    EQREKLGL 
Sbjct  143  DIDHDLSRGEKLLGSLGGMFSKTWKPKKTGTITGPVVFGDDPVRR-KGNHLEQREKLGLT  201

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  KG+S   T P+E  NA +KVE+EK KQDDAL D+SD+LG+LK MA DMG+EL + N 
Sbjct  202  SAPKGQSKSRTTPSESTNAFEKVEVEKGKQDDALSDISDLLGELKDMAIDMGSELGRHND  261

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            AL+  D D+++L  RV GANQR RHLL K
Sbjct  262  ALNGFDKDMEKLTIRVNGANQRGRHLLRK  290



>ref|XP_003627345.1| SNAP25 homologous protein SNAP33 [Medicago truncatula]
 gb|AET01821.1| soluble N-ethylmaleimide-sensitive factor adaptor protein [Medicago 
truncatula]
Length=227

 Score =   239 bits (611),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 155/204 (76%), Gaps = 3/204 (1%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE+YAV++AEETTKSV NCL+IAE+IR++  KT  TLH QGEQI RTH +A ++D 
Sbjct  24   SVQELEDYAVHKAEETTKSVQNCLKIAENIRENATKTFVTLHHQGEQITRTHHVAADIDG  83

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGL--NTK  674
             LS+GEKLL +LGG+FS  WKPKKT++ITGP    DD   + K    +QREKLGL   +K
Sbjct  84   HLSRGEKLLRSLGGLFSKTWKPKKTRKITGPVIFGDDAVRR-KVSHLKQREKLGLPSASK  142

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
            G+S   TPP EP  A++KVE EK  QDDAL +LSD+LG++K MA  MG+E+++QNKAL +
Sbjct  143  GQSRLRTPPQEPTVALEKVEFEKGNQDDALSNLSDLLGEVKDMAVHMGSEIERQNKALSH  202

Query  855  LDTDIDELNSRVKGANQRARHLLA  926
             + D+DELN R+KGAN+RA  LL 
Sbjct  203  FEDDVDELNFRLKGANRRANRLLG  226



>ref|XP_008374599.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Malus domestica]
 ref|XP_008374601.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Malus domestica]
Length=283

 Score =   241 bits (616),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 159/205 (78%), Gaps = 5/205 (2%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SV+ELENYAV +AEETTK+V+ CL+IAE++R+D  KTL  LH+QGEQI RTH +A +MD+
Sbjct  82   SVEELENYAVYKAEETTKAVHGCLKIAEEMREDATKTLVMLHQQGEQITRTHMVAADMDQ  141

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGL--NTK  674
            DL++GEKLL +LGG+FS  WKPK+T+ I GP  + D   H  +KG++E+REKLGL    K
Sbjct  142  DLTRGEKLLGSLGGIFSKTWKPKRTRPIRGPLITGD---HAVRKGSQEEREKLGLAPAPK  198

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
            G+S P T P+ P + +QKVE+EKAKQDD L +LSD+LG+LKGMA DMG+E+++Q K+LD+
Sbjct  199  GRSNPRTLPDGPTSTLQKVEVEKAKQDDGLSNLSDLLGELKGMAIDMGSEIERQGKSLDH  258

Query  855  LDTDIDELNSRVKGANQRARHLLAK  929
            L  D D LNSR+  AN R R LL K
Sbjct  259  LYDDADVLNSRIGDANLRGRRLLGK  283



>emb|CDY23079.1| BnaC07g31080D [Brassica napus]
Length=304

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 154/209 (74%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE YAV +AEETTKSV  CL++AEDIR D  +TL  LH+QGEQI RTH  AV
Sbjct  97   VENQSVQELEGYAVYKAEETTKSVQGCLKVAEDIRSDATRTLVMLHEQGEQITRTHHKAV  156

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKKT+ I GP  ++D +  + +    E+REKLGLN
Sbjct  157  EIDHDLSRGEKLLGSLGGMFSKTWKPKKTRPINGPVITRDHSPTR-RINHLEKREKLGLN  215

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               K +S    P  E  +A Q+VEMEKAKQDD L DLSD+LGDLK MA DMG+E++KQNK
Sbjct  216  PAPKAQSRSREPLPESADAYQRVEMEKAKQDDGLSDLSDLLGDLKNMAVDMGSEIEKQNK  275

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
             LD+L  D+DELN RV+ +NQR R LL K
Sbjct  276  GLDHLQDDVDELNFRVQQSNQRGRRLLGK  304



>ref|XP_006394530.1| hypothetical protein EUTSA_v10004672mg [Eutrema salsugineum]
 dbj|BAJ34130.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31816.1| hypothetical protein EUTSA_v10004672mg [Eutrema salsugineum]
Length=302

 Score =   242 bits (617),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 154/209 (74%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE YAV +AEETTKSV  CL++AEDIR D  +TL  LH+QGEQI RTH  AV
Sbjct  95   IENQSVQELEGYAVYKAEETTKSVQGCLKVAEDIRSDATRTLVMLHEQGEQITRTHHKAV  154

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKKT+ I GP  ++D +  + +    E+REKLGLN
Sbjct  155  EIDHDLSRGEKLLGSLGGMFSKTWKPKKTRSIDGPIITRDHSPTR-RVNHLEKREKLGLN  213

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               K +S    P  E  +A QKVEMEKAKQDD L DLSD+LG+LK MA DMG+E++KQNK
Sbjct  214  PAPKAQSRTREPLPESADAYQKVEMEKAKQDDGLSDLSDLLGELKNMAVDMGSEIEKQNK  273

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
             LD+L  D+DELN RV+ +NQR R LL K
Sbjct  274  GLDHLHDDVDELNFRVQQSNQRGRRLLGK  302



>ref|XP_009136443.1| PREDICTED: SNAP25 homologous protein SNAP33 [Brassica rapa]
Length=305

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 154/209 (74%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE YAV +AEETTKSV  CL++AEDIR D  +TL  LH+QGEQI RTH  AV
Sbjct  98   VENQSVQELEGYAVYKAEETTKSVQGCLKVAEDIRSDATRTLVMLHEQGEQITRTHHQAV  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKKT+ I GP  ++D +  + +    E+REKLGLN
Sbjct  158  EIDHDLSRGEKLLGSLGGMFSKTWKPKKTRPINGPVITRDHSPTR-RINHLEKREKLGLN  216

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
                G+S    P  E  +A Q+VEMEKAKQDD L DLSD+LG+LK MA DMG+E++KQNK
Sbjct  217  PAPNGQSRSREPLPESADAYQRVEMEKAKQDDGLSDLSDLLGELKNMAVDMGSEIEKQNK  276

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
             LD+L  D+DELN RV+ +NQR R LL K
Sbjct  277  GLDHLQDDVDELNFRVQQSNQRGRRLLGK  305



>ref|XP_010030467.1| PREDICTED: SNAP25 homologous protein SNAP33 [Eucalyptus grandis]
 gb|KCW83691.1| hypothetical protein EUGRSUZ_B00569 [Eucalyptus grandis]
Length=295

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 157/209 (75%), Gaps = 4/209 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             +  SVQELE+YA  +AEETTKSVNN L+IA D+R+D  +TL  LH+Q EQI R+H +A 
Sbjct  89   LESQSVQELESYATYKAEETTKSVNNSLKIAVDMREDATRTLVMLHEQSEQITRSHAIAA  148

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D+DLS+GEKLL +LGGMFS  WKPKK ++I GP  ++D    KG     EQREKLGL 
Sbjct  149  NIDQDLSRGEKLLGSLGGMFSKTWKPKKNRQIAGPLITRDAVQTKGNH--LEQREKLGLT  206

Query  669  TKGK--SAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  K  S   TP +EP +A+QKVE+EK+KQDDAL ++S+ILG+LK MA DMGTE+++ NK
Sbjct  207  SASKQQSKTRTPLHEPTDALQKVEVEKSKQDDALSEISNILGELKDMAIDMGTEIERSNK  266

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD+ D D++EL+ RVKGANQR R LL K
Sbjct  267  ALDHFDKDVEELDYRVKGANQRGRRLLGK  295



>ref|XP_004299325.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Fragaria vesca 
subsp. vesca]
Length=307

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 157/209 (75%), Gaps = 5/209 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE+YAV +AEETT SVN CL+IAEDIR+D +KTL  LH QG+QI RTH +A 
Sbjct  102  LENQSVQELESYAVYKAEETTNSVNQCLKIAEDIREDASKTLVMLHHQGDQIRRTHMVAA  161

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++++DLS+GEKLL +LGG+FS  WKPKKT+ I+GP   ++      K+ +  +REKLGL 
Sbjct  162  DIEQDLSRGEKLLGSLGGIFSKTWKPKKTRTISGPVIMEESAT---KRSSHLEREKLGLT  218

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               KG S   TP  EP NA+QKVE+EK KQDD L DLS++LG+LK MA DMG+E+D+ NK
Sbjct  219  PALKGSSHSRTPLPEPTNALQKVEVEKTKQDDGLSDLSNLLGELKDMAVDMGSEIDRHNK  278

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            A+ ++D D+DEL+ RV+GA QR R LL K
Sbjct  279  AIGHMDADVDELHYRVRGATQRGRRLLGK  307



>gb|ACU18010.1| unknown [Glycine max]
Length=292

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 154/209 (74%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             +  SVQELENY V +AEETT SVN+CL+IAE++R+D  KTL  LH QGEQI R+H +A 
Sbjct  85   LESQSVQELENYTVYKAEETTNSVNSCLKIAEEMREDATKTLVMLHHQGEQITRSHHVAA  144

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEKLL +LGGMFS  WKPKKT  ITGP    DD   + K    EQREKLGL 
Sbjct  145  DIDHDLSRGEKLLGSLGGMFSKTWKPKKTGTITGPVVFGDDPVRR-KGNHLEQREKLGLT  203

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  KG+S      +EP NA++KVE+EK KQDDAL DLSD+LG+LKGMA DMG+E+ +QN+
Sbjct  204  SAPKGQSKSRPTLSEPSNALEKVEVEKGKQDDALSDLSDLLGELKGMAIDMGSEIGRQNQ  263

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD  D D+++L  RV GANQR+  LL K
Sbjct  264  ALDGFDNDMEKLTVRVNGANQRSHRLLGK  292



>ref|XP_010527948.1| PREDICTED: putative SNAP25 homologous protein SNAP30 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010527949.1| PREDICTED: putative SNAP25 homologous protein SNAP30 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010527950.1| PREDICTED: putative SNAP25 homologous protein SNAP30 isoform 
X1 [Tarenaya hassleriana]
Length=270

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 149/208 (72%), Gaps = 23/208 (11%)
 Frame = +3

Query  276  ARRTSSEPNLNFDDM-------------------SVQELENYAVNQAEETTKSVNNCLRI  398
             RRTSSEP L   +                    + +ELENYAV +AEETTK+VNNCL+I
Sbjct  25   GRRTSSEPILMIPEFGREDYYKSEFRDSGGLQSQTTEELENYAVYKAEETTKNVNNCLKI  84

Query  399  AEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTK  578
            AEDIR D  +TL+ LH+QGEQI+RTH MA+EMDKDLS+GEKLLNNLGGMFS PWKPKK K
Sbjct  85   AEDIRSDATRTLDMLHQQGEQINRTHVMAIEMDKDLSRGEKLLNNLGGMFSKPWKPKKNK  144

Query  579  EITGPKTSKDDNNHKGKKGTKEQREKLGL---NTKGKSAPTTPPNEPQNAMQKVEMEKAK  749
            +ITGP  +  DN  K  +  KEQREKLGL     KG+S   TPP EP NA+Q+VE EKAK
Sbjct  145  QITGPMITP-DNPSKQSENRKEQREKLGLVPAGNKGRSHSQTPPPEPTNALQRVEQEKAK  203

Query  750  QDDALDDLSDILGDLKGMATDMGTELDK  833
            Q+D L DL+DILGD+K MA DMG+ELD+
Sbjct  204  QEDGLSDLNDILGDMKSMAVDMGSELDR  231



>gb|EPS65203.1| hypothetical protein M569_09573, partial [Genlisea aurea]
Length=254

 Score =   238 bits (606),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 154/210 (73%), Gaps = 8/210 (4%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQ+LEN+AV++AEETTKSVN CL+IAE++R+D  KTL TLH+QGEQI R H +A ++D+
Sbjct  46   SVQDLENHAVHRAEETTKSVNECLKIAEEMREDATKTLVTLHQQGEQITRAHTVAADIDQ  105

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGP-------KTSKDDNNHKGKKGTKEQREKL  659
            DLS+ EKLL +LGG+FS  WKPKK+  I GP        T  DD  H+ +    EQRE+L
Sbjct  106  DLSRSEKLLGSLGGIFSKTWKPKKSHPIKGPIMTTTTTTTITDDPLHR-RGNHLEQRERL  164

Query  660  GLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQN  839
            GL  K K  P      P NA+QKVE+E+AKQDDAL DLSD+LG+LK MA DMGTE+++ N
Sbjct  165  GLTRKSKLVPDDEQQRPTNALQKVEVERAKQDDALGDLSDVLGELKAMAIDMGTEIERHN  224

Query  840  KALDNLDTDIDELNSRVKGANQRARHLLAK  929
            KALD  + D DEL+ RVKGA+QR R LL K
Sbjct  225  KALDRFEDDADELHHRVKGASQRTRRLLGK  254



>ref|XP_009339111.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Pyrus x bretschneideri]
Length=273

 Score =   238 bits (608),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 161/209 (77%), Gaps = 5/209 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SV+ELENYAV +AEETTK+V+ CL+IAE++R+D  KTL  LH+QGEQI RTH +A 
Sbjct  68   VENQSVEELENYAVYKAEETTKAVHGCLKIAEEMREDATKTLVMLHQQGEQITRTHMVAA  127

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D+DL++GEKLL +LGG+FS  WKPK+T+ I GP  + D   H  + G++E+REKLGL 
Sbjct  128  DIDQDLTRGEKLLGSLGGIFSKTWKPKRTRPIRGPLITGD---HAVRMGSQEEREKLGLR  184

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               KG+S P T P+ P + +QKVE+EK+KQDD L DLSD+LG+LKGMA DMG+E+++Q++
Sbjct  185  PEPKGRSNPRTLPDGPTSTLQKVEVEKSKQDDGLSDLSDLLGELKGMAIDMGSEIERQSR  244

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ++D+L  D D LNSR+  AN R R LL K
Sbjct  245  SIDHLYDDADVLNSRIGDANLRGRRLLGK  273



>gb|EPS61222.1| hypothetical protein M569_13575, partial [Genlisea aurea]
Length=206

 Score =   236 bits (601),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 159/207 (77%), Gaps = 5/207 (2%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELEN+AV++A+ETTKSVN CL+IAE IR+D  KTL  LH+QGE+I  TH +A ++D 
Sbjct  1    SVQELENHAVSEAQETTKSVNACLKIAEGIREDATKTLVALHQQGERITTTHMVAADIDH  60

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGL---NT  671
            DLS+GEKLL +LGG+FS  WKPKKT  ITGP  S+ D   + K    EQRE+LGL   ++
Sbjct  61   DLSRGEKLLGSLGGIFSKKWKPKKTHSITGPIISQGDPVQR-KGNHLEQRERLGLTFSSS  119

Query  672  KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELD-KQNKAL  848
            + +S+  TP  E  N++QKVE+EKAKQDDAL DLS+ILG+LK MA DMG+E+D +Q KAL
Sbjct  120  EQRSSIFTPHPEAANSLQKVEVEKAKQDDALTDLSNILGELKEMAVDMGSEIDSRQMKAL  179

Query  849  DNLDTDIDELNSRVKGANQRARHLLAK  929
            D++  D++ELN RVKGA+QR R LL K
Sbjct  180  DHVQNDVEELNFRVKGASQRTRRLLGK  206



>ref|XP_002317966.1| hypothetical protein POPTR_0012s06830g [Populus trichocarpa]
 gb|EEE96186.1| hypothetical protein POPTR_0012s06830g [Populus trichocarpa]
Length=305

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 155/209 (74%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++  VQELENYAV +AEETTK+VN CL+IAE++R+    TL TLH+QGEQI +TH +AV
Sbjct  98   LENQPVQELENYAVYKAEETTKAVNGCLKIAEEMREGATTTLITLHQQGEQITKTHSVAV  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKK + I GP  ++D +  + +    EQREKLGLN
Sbjct  158  EIDHDLSRGEKLLGSLGGMFSKTWKPKKNRAIRGPVITRDASPRR-RGNHLEQREKLGLN  216

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               K +S+  TP  E  NA QKVE EK+KQDDAL DLS+++G+LK MA DMG E D+Q  
Sbjct  217  LAPKERSSTKTPLPETANAFQKVEFEKSKQDDALSDLSNVIGELKNMAVDMGAEFDRQVG  276

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD++  D+DELNSR+ GAN+R  HLL K
Sbjct  277  ALDHVQDDVDELNSRLGGANKRGLHLLRK  305



>ref|XP_009398274.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398275.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Musa acuminata 
subsp. malaccensis]
Length=301

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 163/210 (78%), Gaps = 5/210 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV +AEETT  +N CLRIAE+IR+   KTL TLH+QGEQI RTH+ A 
Sbjct  94   IENQSVQELENYAVYKAEETTNELNGCLRIAEEIREGATKTLVTLHQQGEQITRTHQTAA  153

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTK-EQREKLGL  665
            +++ DLS+GEKLL NLGG+FS  WKPKKT+EI GP  ++DD+    K+G+  EQR++LGL
Sbjct  154  DIEHDLSRGEKLLGNLGGLFSKKWKPKKTREIRGPLLTRDDSFI--KRGSHLEQRQRLGL  211

Query  666  NT-KGKSAPT-TPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQN  839
            +  + +S P  +  +EP +A++KVE EKAKQDDAL DLS++LG+LK MA DMG+E+++Q 
Sbjct  212  SAPRPRSEPRHSSSSEPTSALEKVETEKAKQDDALSDLSNLLGELKNMAIDMGSEIERQT  271

Query  840  KALDNLDTDIDELNSRVKGANQRARHLLAK  929
             ALD+++ D++E+N RVKGAN R R LL K
Sbjct  272  AALDHMEDDVEEVNFRVKGANLRGRRLLRK  301



>ref|XP_011010042.1| PREDICTED: SNAP25 homologous protein SNAP33-like isoform X2 [Populus 
euphratica]
Length=305

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 155/209 (74%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++  VQELENYAV +AEETTK+VN CL+IAE++R+    TL TLH+QGEQI +TH +AV
Sbjct  98   LENQPVQELENYAVYKAEETTKAVNGCLKIAEEMREGATTTLITLHQQGEQITKTHSVAV  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKK + I GP  ++D +  + +    E REKLGLN
Sbjct  158  EIDHDLSRGEKLLGSLGGMFSKTWKPKKNRAIRGPVITRDASPRR-RGNHLEHREKLGLN  216

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               K +S+  TP  E  NA QKVE EK+KQDDAL DLS++LG+LK MA DMGTE D+Q  
Sbjct  217  LAPKERSSMKTPLPETANAFQKVEFEKSKQDDALSDLSNLLGELKNMAADMGTEFDRQVC  276

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD++  D+DELNSR+ GAN+R  HLL K
Sbjct  277  ALDHVQDDVDELNSRLGGANKRGLHLLRK  305



>ref|XP_004499490.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Cicer arietinum]
Length=295

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 156/209 (75%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SV+ELENYA+ +AEETTKSVNNC +IAE++R+D  KTL  LH QGEQI R+H++A 
Sbjct  88   LENQSVEELENYALYKAEETTKSVNNCRKIAEEMREDATKTLVMLHHQGEQITRSHDIAA  147

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D DLS+GEKLL +LGGMFS  WKPKKT  I GP    +D   +      +QREKLGLN
Sbjct  148  GIDHDLSRGEKLLGSLGGMFSKTWKPKKTGTIKGPVIFGEDPVRRSANHL-DQREKLGLN  206

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +  KG+S P    +EP NA ++VE+EK KQDDAL D+SD+LG+LKGMA DMG+E+++QNK
Sbjct  207  SAPKGQSKPRKTLHEPTNAFERVEVEKGKQDDALSDISDLLGELKGMAIDMGSEIERQNK  266

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            A+D  + D ++LN R+ GANQR  HLL K
Sbjct  267  AIDGFEKDTEKLNIRMNGANQRTLHLLRK  295



>ref|XP_011010041.1| PREDICTED: SNAP25 homologous protein SNAP33-like isoform X1 [Populus 
euphratica]
Length=326

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 155/209 (74%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++  VQELENYAV +AEETTK+VN CL+IAE++R+    TL TLH+QGEQI +TH +AV
Sbjct  119  LENQPVQELENYAVYKAEETTKAVNGCLKIAEEMREGATTTLITLHQQGEQITKTHSVAV  178

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKK + I GP  ++D +  + +    E REKLGLN
Sbjct  179  EIDHDLSRGEKLLGSLGGMFSKTWKPKKNRAIRGPVITRDASPRR-RGNHLEHREKLGLN  237

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               K +S+  TP  E  NA QKVE EK+KQDDAL DLS++LG+LK MA DMGTE D+Q  
Sbjct  238  LAPKERSSMKTPLPETANAFQKVEFEKSKQDDALSDLSNLLGELKNMAADMGTEFDRQVC  297

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD++  D+DELNSR+ GAN+R  HLL K
Sbjct  298  ALDHVQDDVDELNSRLGGANKRGLHLLRK  326



>ref|XP_010936394.1| PREDICTED: LOW QUALITY PROTEIN: SNAP25 homologous protein SNAP33 
[Elaeis guineensis]
Length=244

 Score =   235 bits (599),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 152/203 (75%), Gaps = 1/203 (0%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            S QE ENYAV +AEETT+ VN+C++IAE IR+D ++TL TLH+QGEQI RT +    +D+
Sbjct  43   SAQEPENYAVYKAEETTQKVNDCMKIAEVIREDASRTLVTLHQQGEQIARTPQTDANIDQ  102

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKGK  680
            DLSK EKLL +LGG+FS PWKPKK+++I GP      ++   KKG KEQREKLGL++   
Sbjct  103  DLSKSEKLLGSLGGIFSKPWKPKKSRQIKGPLPVVTRDDSFKKKGNKEQREKLGLSSNPG  162

Query  681  SAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLD  860
            + P +  +EP  AM+KV++EK KQDD L DLSD+LG LK MA DMGTEL+ QNKA D L 
Sbjct  163  AQPRS-YSEPTTAMEKVQVEKQKQDDFLSDLSDVLGQLKDMALDMGTELEGQNKAFDGLH  221

Query  861  TDIDELNSRVKGANQRARHLLAK  929
             D++ELN R+KGANQR R LL K
Sbjct  222  DDVEELNDRIKGANQRTRRLLGK  244



>gb|EMS63818.1| SNAP25 homologous protein SNAP33 [Triticum urartu]
Length=348

 Score =   238 bits (607),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 157/208 (75%), Gaps = 1/208 (0%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
            FD+ SVQELE Y  ++AEE T+ V+ CLR+AE+I++D   T+  LHKQG+Q++RTHE A 
Sbjct  141  FDNQSVQELEGYVAHKAEEVTQKVSVCLRLAENIKEDATNTMIALHKQGQQMNRTHETAA  200

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D+DLS+ E LL +LGG FS  WKPKKT++I GP     D++ K +    EQREKLGL+
Sbjct  201  NIDQDLSRSETLLGSLGGFFSKTWKPKKTRQIRGPAVISRDDSFKRRANHLEQREKLGLS  260

Query  669  TKGKSAPTT-PPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
            +  +   ++   ++P NAM+KV++EK KQD+AL DLSD+LG LKGMA DMG+E+D+QNKA
Sbjct  261  SSPREKSSSQTYSDPTNAMEKVQVEKDKQDNALSDLSDVLGQLKGMALDMGSEIDRQNKA  320

Query  846  LDNLDTDIDELNSRVKGANQRARHLLAK  929
            +D L  D++ELNSRVKGANQRAR LL K
Sbjct  321  MDGLQDDVEELNSRVKGANQRARRLLEK  348



>ref|XP_008447897.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Cucumis melo]
 ref|XP_008447972.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Cucumis melo]
Length=292

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 152/208 (73%), Gaps = 3/208 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV +AEETTK+VN CL+IAE+IR+D  +TL  LH QGEQI RTH +A 
Sbjct  87   IENQSVQELENYAVYKAEETTKAVNGCLKIAEEIREDATQTLVALHHQGEQITRTHMVAA  146

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGL-  665
            ++D DLS+GEKLL NLGGMFS  WKPKKT+ I+GP  S D+   KG     EQ+E+LGL 
Sbjct  147  DIDYDLSRGEKLLGNLGGMFSKTWKPKKTRPISGPIISSDEVRRKGNH--LEQKERLGLT  204

Query  666  NTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
            + K +++      EP NA+QKVE+EK KQDDAL D+SDIL  LK MA DMG+E+D+QN A
Sbjct  205  HHKERTSTKAAFAEPTNAIQKVEVEKMKQDDALSDMSDILVQLKEMAVDMGSEMDRQNVA  264

Query  846  LDNLDTDIDELNSRVKGANQRARHLLAK  929
            LD    D++ L  RVK AN+R R LL K
Sbjct  265  LDRASVDVEVLGDRVKDANRRGRRLLGK  292



>gb|KEH33105.1| soluble N-ethylmaleimide-sensitive factor adaptor protein [Medicago 
truncatula]
Length=296

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 153/205 (75%), Gaps = 3/205 (1%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SV++LE YAV +AEETTKSVNNC +IAE++R+D  KTL  LH QGEQI R+H++A  +D 
Sbjct  93   SVEDLEEYAVYKAEETTKSVNNCRKIAEEMREDATKTLVMLHHQGEQITRSHDIAAGIDH  152

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNT--K  674
            +LS+GEKLL +LGG+FS  WKPKKT  ITGP    DD   K      EQREKLGLN+  K
Sbjct  153  NLSRGEKLLGSLGGIFSKTWKPKKTGTITGPTIFGDDPVRKSANHL-EQREKLGLNSAPK  211

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
            G+S P    +EP NA ++VE+EK KQDDAL D+SD+LG+LKGMA DMGTE+++Q KA+D 
Sbjct  212  GQSKPRKALSEPTNAFERVEVEKEKQDDALSDISDLLGELKGMAMDMGTEIERQTKAIDG  271

Query  855  LDTDIDELNSRVKGANQRARHLLAK  929
             + D ++LN R+ GANQR  HLL K
Sbjct  272  FEKDTEKLNIRMNGANQRTLHLLRK  296



>gb|EEC74748.1| hypothetical protein OsI_10502 [Oryza sativa Indica Group]
Length=244

 Score =   233 bits (593),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 157/221 (71%), Gaps = 3/221 (1%)
 Frame = +3

Query  267  PPAARRTSSEPNLNFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLH  446
            P    R  S P +   D S+QELE+YAV++ EET++ VN+C+R AE IR+D  KTL TLH
Sbjct  27   PSRPSRAQSVP-VRRTDQSIQELEDYAVDKVEETSRKVNDCVRAAEAIREDATKTLVTLH  85

Query  447  KQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKG  626
            +QGEQI RTH +A +++ DLS  EKLL +LGG+FS  WKPK+ ++I GP +   +N+   
Sbjct  86   RQGEQITRTHRVAADIEHDLSMSEKLLGSLGGLFSKTWKPKRNQQIKGPISQ--NNSFTS  143

Query  627  KKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMA  806
                 EQR++LG+++  + +P      P  A++KV++E AKQDDAL DLS++LG+LKGMA
Sbjct  144  SANNMEQRQRLGISSTRQPSPNQVHRSPATAIEKVQVEIAKQDDALSDLSNMLGELKGMA  203

Query  807  TDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
             DMGTE+++QNK+LD    D+DELN RVKGANQR R LL K
Sbjct  204  LDMGTEIERQNKSLDAFGDDVDELNFRVKGANQRGRRLLGK  244



>gb|ABF94609.1| SNARE domain containing protein, expressed [Oryza sativa Japonica 
Group]
 gb|ABF94610.1| SNARE domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG95714.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58572.1| hypothetical protein OsJ_09892 [Oryza sativa Japonica Group]
Length=244

 Score =   232 bits (592),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 157/221 (71%), Gaps = 3/221 (1%)
 Frame = +3

Query  267  PPAARRTSSEPNLNFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLH  446
            P    R  S P +   D S+QELE+YAV++ EET++ VN+C+R AE IR+D  KTL TLH
Sbjct  27   PSRPSRAQSVP-VRRTDQSIQELEDYAVDKVEETSRKVNDCVRAAEAIREDATKTLVTLH  85

Query  447  KQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKG  626
            +QGEQI RTH +A +++ DLS  EKLL +LGG+FS  WKPK+ ++I GP +   +N+   
Sbjct  86   RQGEQITRTHRVAADIEHDLSMSEKLLGSLGGLFSKTWKPKRNQQIKGPISQ--NNSFTS  143

Query  627  KKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMA  806
                 EQR++LG+++  + +P      P  A++KV++E AKQDDAL DLS++LG+LKGMA
Sbjct  144  SANHMEQRQRLGISSTRQPSPNQVHRSPATAIEKVQVEIAKQDDALSDLSNMLGELKGMA  203

Query  807  TDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
             DMGTE+++QNK+LD    D+DELN RVKGANQR R LL K
Sbjct  204  LDMGTEIERQNKSLDAFGDDVDELNFRVKGANQRGRRLLGK  244



>ref|NP_001049355.2| Os03g0212400 [Oryza sativa Japonica Group]
 dbj|BAF11269.2| Os03g0212400, partial [Oryza sativa Japonica Group]
Length=251

 Score =   232 bits (592),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 157/221 (71%), Gaps = 3/221 (1%)
 Frame = +3

Query  267  PPAARRTSSEPNLNFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLH  446
            P    R  S P +   D S+QELE+YAV++ EET++ VN+C+R AE IR+D  KTL TLH
Sbjct  34   PSRPSRAQSVP-VRRTDQSIQELEDYAVDKVEETSRKVNDCVRAAEAIREDATKTLVTLH  92

Query  447  KQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKG  626
            +QGEQI RTH +A +++ DLS  EKLL +LGG+FS  WKPK+ ++I GP +   +N+   
Sbjct  93   RQGEQITRTHRVAADIEHDLSMSEKLLGSLGGLFSKTWKPKRNQQIKGPISQ--NNSFTS  150

Query  627  KKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMA  806
                 EQR++LG+++  + +P      P  A++KV++E AKQDDAL DLS++LG+LKGMA
Sbjct  151  SANHMEQRQRLGISSTRQPSPNQVHRSPATAIEKVQVEIAKQDDALSDLSNMLGELKGMA  210

Query  807  TDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
             DMGTE+++QNK+LD    D+DELN RVKGANQR R LL K
Sbjct  211  LDMGTEIERQNKSLDAFGDDVDELNFRVKGANQRGRRLLGK  251



>ref|XP_004137424.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Cucumis sativus]
 ref|XP_004157458.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Cucumis sativus]
 gb|KGN64035.1| hypothetical protein Csa_1G039020 [Cucumis sativus]
Length=293

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 153/208 (74%), Gaps = 2/208 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV +AEETTK+VN CL+IAE+IR+D  +TL  LH QGEQI RTH +A 
Sbjct  87   VENQSVQELENYAVYKAEETTKAVNGCLKIAEEIREDATQTLVALHHQGEQITRTHMVAA  146

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGL-  665
            ++D DLS+GEKLL NLGG+FS  WKPKKT+ I+GP  S DD   + K    EQ+E+LGL 
Sbjct  147  DIDYDLSRGEKLLGNLGGIFSKTWKPKKTRPISGPIISSDDLVRR-KGNHLEQKERLGLT  205

Query  666  NTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
            + K +++      EP NA+QKVE+EK KQDDAL D+SDIL  LK MA DMG+E+D+QN A
Sbjct  206  HHKERTSTKAAFAEPTNAIQKVEVEKMKQDDALSDMSDILVQLKEMAVDMGSEMDRQNVA  265

Query  846  LDNLDTDIDELNSRVKGANQRARHLLAK  929
            LD+   D++ L  RVK AN+R R LL K
Sbjct  266  LDHASVDVEVLGDRVKDANRRGRRLLGK  293



>emb|CDX78314.1| BnaA03g02260D [Brassica napus]
Length=293

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 162/233 (70%), Gaps = 18/233 (8%)
 Frame = +3

Query  285  TSSEPNLNFD----------------DMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQ  416
            TSS+P+L+ D                + SVQELE+YAV +++ETTK+V  CL++AE+IR 
Sbjct  61   TSSKPSLDLDAKSRYRNGFRDSGGVENQSVQELESYAVYKSQETTKTVQGCLKVAEEIRS  120

Query  417  DGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPK  596
            D A+TL  L++QGE+I RTH+  V++D DLS+GEKLL +L G+FS  WKPKKT+ ITGP 
Sbjct  121  DAARTLVMLNEQGEKITRTHQKTVDIDHDLSRGEKLLGSLAGIFSPTWKPKKTRSITGPV  180

Query  597  TSKDDNNHKGKKGTKEQREKLGLN--TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDD  770
             +K   + K +    E REKLGLN   K +S    P  E  NA QK+EMEKAKQDD L D
Sbjct  181  ITKVGESPKRRVNHLETREKLGLNHLPKPQSRTHEPLPESANAYQKLEMEKAKQDDGLAD  240

Query  771  LSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            LSD+L +LK MA DMGTE+++QN  LD+L  D+DELN RVK +NQRARHLL K
Sbjct  241  LSDLLSELKNMAVDMGTEIERQNNGLDHLQDDVDELNFRVKQSNQRARHLLRK  293



>emb|CDY42860.1| BnaAnng06850D [Brassica napus]
Length=279

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 161/244 (66%), Gaps = 27/244 (11%)
 Frame = +3

Query  276  ARRTSSEPNL------------------NFDD------MSVQELENYAVNQAEETTKSVN  383
            ++RTSSEP+L                  NF D       SVQELE YAV +AEETTKSV 
Sbjct  37   SKRTSSEPSLAIMTNPFDEVEKGHQYKNNFRDSGGVENQSVQELEGYAVYKAEETTKSVQ  96

Query  384  NCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWK  563
             CL++AE+IR D  +TL  LH QGEQI RTH  AVE+D DLS+GEKLL +LGGMFS  WK
Sbjct  97   GCLKVAEEIRSDATRTLVMLHDQGEQITRTHHKAVEIDHDLSRGEKLLGSLGGMFSKTWK  156

Query  564  PKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN--TKGKSAPTTPPNEPQNAMQKVEM  737
            PKKT+ I GP  S+D +  + +    E+REKLGL+   K +S    P  E  +A Q++EM
Sbjct  157  PKKTRPINGPVISRDHSPTR-RVNHLEKREKLGLSPAPKAQSRTREPLPESADAFQRLEM  215

Query  738  EKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARH  917
            EKAKQDD L DLSD+LG+LK MA DMG+E+ +Q   LD+L  D+DELN RV+ +NQRA  
Sbjct  216  EKAKQDDGLSDLSDLLGELKNMAVDMGSEIGRQKDGLDHLHDDVDELNYRVQQSNQRASR  275

Query  918  LLAK  929
            LL K
Sbjct  276  LLRK  279



>gb|EMT24031.1| hypothetical protein F775_02522 [Aegilops tauschii]
Length=820

 Score =   244 bits (623),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 157/209 (75%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
            FD+ SVQELE Y  ++AEE T+ VN CLR+AE+I++D   T+  LHKQG+Q++RTHE A 
Sbjct  583  FDNQSVQELEGYVAHKAEEVTQKVNVCLRLAENIKEDATNTMIALHKQGQQMNRTHETAA  642

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D+DLS+ E LL +LGG FS  WKPKKT++I GP     D+  K +    EQREKLGL+
Sbjct  643  NIDQDLSRSETLLGSLGGFFSKTWKPKKTRQIKGPAVISRDDPFKRRANHLEQREKLGLS  702

Query  669  TK--GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
            +   GKS P    ++P NAM+KV++EK KQD+AL DLSD+LG LKGMA DMG+E+D+QNK
Sbjct  703  SSPVGKSDP-QKYSDPTNAMEKVQVEKDKQDNALSDLSDVLGQLKGMALDMGSEIDRQNK  761

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            A+D L  D++ELNSRVKGANQRAR LL K
Sbjct  762  AMDGLQDDVEELNSRVKGANQRARRLLGK  790



>ref|XP_009130158.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Brassica rapa]
Length=294

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 151/209 (72%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE YAV +AEETTKSV  CL++AE+IR D  +TL  LH QGEQI RTH  AV
Sbjct  87   VENQSVQELEGYAVYKAEETTKSVQGCLKVAEEIRSDATRTLVMLHDQGEQITRTHHKAV  146

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKKT+ I GP  S+D +  + +    E+REKLGL+
Sbjct  147  EIDHDLSRGEKLLGSLGGMFSKTWKPKKTRPINGPVISRDHSPTR-RVNHLEKREKLGLS  205

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               K +S    P  E  +A Q+VEMEKAKQDD L DLSD+LG+LK MA DMG+E++KQ  
Sbjct  206  PAPKAQSRTREPLPESADAYQRVEMEKAKQDDGLSDLSDLLGELKNMAVDMGSEMEKQKD  265

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
             LD+L  D+DELN RV+ +NQRA  LL K
Sbjct  266  GLDHLHDDVDELNYRVQQSNQRASRLLRK  294



>ref|XP_006649622.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Oryza brachyantha]
Length=248

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 156/221 (71%), Gaps = 3/221 (1%)
 Frame = +3

Query  267  PPAARRTSSEPNLNFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLH  446
            P    R  S P +   D S+QELE YAV++AEET+  VN+C+R AE IR+D  KTL TLH
Sbjct  31   PSRPSRAQSVP-VRHIDQSMQELEEYAVHKAEETSSKVNDCVRAAEAIREDATKTLLTLH  89

Query  447  KQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKG  626
            +QGEQI RTH +A ++++DLS  EKLL +LGG+FS  WKPK+ ++I GP +   +N+   
Sbjct  90   RQGEQITRTHRVAADIEQDLSMSEKLLGSLGGLFSKTWKPKRNQQIKGPIS--QNNSFTS  147

Query  627  KKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMA  806
                 EQR++LG+++  + +P      P  A++KV++E AKQDDAL DLS++LG+LK MA
Sbjct  148  SASHMEQRQRLGISSTRQQSPNQVHRSPATAIEKVQVEIAKQDDALSDLSNMLGELKDMA  207

Query  807  TDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
             DMG+E+++QNK+LD    D+DELN RVKGANQR R LL K
Sbjct  208  LDMGSEIERQNKSLDAFGDDVDELNFRVKGANQRGRRLLGK  248



>ref|XP_010491406.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Camelina sativa]
 ref|XP_010491407.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Camelina sativa]
Length=255

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 157/212 (74%), Gaps = 3/212 (1%)
 Frame = +3

Query  300  NLNFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHE  479
            N+  ++ +VQELE+YAV +++ETTK+V  CL++A++IR D  +TL  L++QGEQI RTH 
Sbjct  45   NVEKENQTVQELESYAVYKSQETTKTVQGCLKVAQEIRSDATRTLVMLNEQGEQITRTHH  104

Query  480  MAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKL  659
             AV++D DLS+GEKLL +LGG+FS  WKPKKT+ +TGP  +K D+ ++ +    E REKL
Sbjct  105  KAVDIDHDLSRGEKLLGSLGGIFSRTWKPKKTRSVTGPVITKGDSPNR-RVNYFETREKL  163

Query  660  GLN--TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDK  833
            GLN   K +S    P  E  +A QK+EME AKQD+ L DLSD+LG+LK MA DMGTE+++
Sbjct  164  GLNHLPKPQSRTNEPLPESADAYQKLEMETAKQDEGLSDLSDLLGELKNMAVDMGTEIER  223

Query  834  QNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            QN  LD+L  D++ELN RVK +NQRAR LL K
Sbjct  224  QNHGLDHLQEDVEELNYRVKQSNQRARRLLRK  255



>ref|XP_010452752.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Camelina sativa]
Length=255

 Score =   227 bits (579),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 157/212 (74%), Gaps = 3/212 (1%)
 Frame = +3

Query  300  NLNFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHE  479
            N+  ++ +VQELE+YA+ +++ETTK+V  CL++A++IR D ++TL  L++QGEQI RTH 
Sbjct  45   NVEKENQTVQELESYALYKSQETTKTVQGCLKVAQEIRSDASRTLVMLNEQGEQITRTHH  104

Query  480  MAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKL  659
             AV++D DLS+GEKLL +LGG+FS  WKPKKT+ ITGP  +K D+  K +    E REKL
Sbjct  105  KAVDIDHDLSRGEKLLGSLGGIFSRTWKPKKTRSITGPVITKGDSP-KRRVNHFETREKL  163

Query  660  GLNT--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDK  833
            GLN   K +S    P  E  +A QK+EME AKQD+ L DLSD+LG+LK MA DMGTE+++
Sbjct  164  GLNHLPKQQSRTREPLPESADAYQKLEMETAKQDEGLSDLSDLLGELKNMAVDMGTEIER  223

Query  834  QNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            QN  LD+L  D++ELN RVK +NQRAR LL K
Sbjct  224  QNHGLDHLQEDVEELNYRVKQSNQRARRLLRK  255



>ref|XP_004952388.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Setaria italica]
Length=290

 Score =   228 bits (582),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 154/206 (75%), Gaps = 6/206 (3%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE YA ++AEETT+    C+RIAE +R   +KTL T+H+QG+QIHRTH MAV++D+
Sbjct  88   SVQELEGYAAHKAEETTRRAQGCVRIAEGMRDTASKTLVTVHQQGQQIHRTHMMAVDIDQ  147

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTK-EQREKLGL--NT  671
            DLS+ EKLL +LGG+FS  WKPKK   I GP  S+DD+    +KG+  EQR+KLGL  + 
Sbjct  148  DLSRSEKLLGDLGGLFSKKWKPKKNGTIRGPMLSRDDSFI--RKGSHLEQRQKLGLADHP  205

Query  672  KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALD  851
               +AP    +EP +A +KVEMEKAKQDDAL DLSDIL +LKGMA DMG+E+++Q KA+ 
Sbjct  206  PRLNAPEF-SSEPTSAFEKVEMEKAKQDDALSDLSDILTELKGMAVDMGSEIERQTKAMR  264

Query  852  NLDTDIDELNSRVKGANQRARHLLAK  929
            + + D DELN RVKGAN RAR LL +
Sbjct  265  DAEKDYDELNFRVKGANTRARRLLGR  290



>ref|XP_002316150.2| hypothetical protein POPTR_0010s16780g [Populus trichocarpa]
 gb|EEF02321.2| hypothetical protein POPTR_0010s16780g [Populus trichocarpa]
Length=247

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 139/285 (49%), Positives = 164/285 (58%), Gaps = 80/285 (28%)
 Frame = +3

Query  201  MFGFGKKppasasaspMQSADEPPAA---------------------RRTSSEPNLN---  308
            MFGFGK P  + +    QS+  PPA+                     +R SSE  LN   
Sbjct  1    MFGFGKSPANNKATK--QSSVNPPASSTSNPFDSDDESNAKQTLHLGKRASSESMLNVLD  58

Query  309  --FDD----------------MSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTL  434
              FDD                 SVQELE YA  +AEETT SVNNCLRIAEDI+QD  +TL
Sbjct  59   NAFDDKDRYKNDFRDSGGLENQSVQELEKYAAYKAEETTNSVNNCLRIAEDIKQDATRTL  118

Query  435  ETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDN  614
            ++ +     +                GEKLLNNLGG+FS PWKPKKT++IT P  +    
Sbjct  119  DSRYAACSGM----------------GEKLLNNLGGIFSKPWKPKKTRDITEPLITA---  159

Query  615  NHKGKKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDL  794
                               KG+SA TTPP EP NA+Q+VE+EKAKQDDAL DLS+ILGDL
Sbjct  160  -----------------APKGRSAITTPPPEPTNALQEVEVEKAKQDDALSDLSNILGDL  202

Query  795  KGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            KG A DMG+ELD+QNKALD+L  D+DELNSRVKGANQR RHLL K
Sbjct  203  KGTAVDMGSELDRQNKALDHLGDDVDELNSRVKGANQRTRHLLGK  247



>ref|XP_010423160.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Camelina sativa]
 ref|XP_010423161.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Camelina sativa]
 ref|XP_010423162.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Camelina sativa]
Length=257

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 159/219 (73%), Gaps = 3/219 (1%)
 Frame = +3

Query  279  RRTSSEPNLNFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGE  458
            R  S   N+  ++ +VQELE+YAV++++ETTK+V  CL++A++IR D ++TL  L++QGE
Sbjct  40   RNESGGGNMEKENQTVQELESYAVSKSQETTKTVQGCLKVAQEIRSDASRTLVMLNEQGE  99

Query  459  QIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGT  638
            QI  TH  AV++D DL++GEKLL +LGG+FS  WKPKKT+ ITGP  +K D+  K +   
Sbjct  100  QITSTHHKAVDIDHDLTRGEKLLGSLGGIFSRTWKPKKTRSITGPVITKGDSP-KRRVNH  158

Query  639  KEQREKLGLN--TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATD  812
             E REKLGLN   K +S    P  E  +A QK+EME AKQD+ L DLSD+LG+LK MA D
Sbjct  159  FETREKLGLNHLPKPQSRTREPLPESADAYQKIEMETAKQDEGLSDLSDLLGELKNMAVD  218

Query  813  MGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            MGTE+++QN  LD+L  D++ELN RVK +NQRAR LL K
Sbjct  219  MGTEIERQNHGLDHLQEDVEELNYRVKQSNQRARRLLRK  257



>ref|XP_006647232.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Oryza brachyantha]
Length=296

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 155/205 (76%), Gaps = 4/205 (2%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE YA  +AEETT+ V  C+RIAE++R+  +K+L T+H+QG+QI RTH M +++D+
Sbjct  94   SVQELEGYAAYKAEETTQRVQGCVRIAEEMRETASKSLVTIHQQGQQITRTHMMTLDIDQ  153

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTK-EQREKLGL-NTK  674
            DLS+ EKLL +LGG+FS  WKPKK  EI GP  ++DD+    +KG+  EQR+KLGL +  
Sbjct  154  DLSRSEKLLGDLGGIFSKKWKPKKNGEIRGPMLTRDDSFI--RKGSHLEQRQKLGLADHP  211

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
             +S      +EP +A+QKVEMEKAKQDDAL DLS+IL +LKGMA DMG+E+D+Q KA+ +
Sbjct  212  PRSNARQFHSEPTSALQKVEMEKAKQDDALSDLSNILTELKGMAVDMGSEIDRQTKAMGD  271

Query  855  LDTDIDELNSRVKGANQRARHLLAK  929
             + D DELN R+KGAN RAR LL K
Sbjct  272  SEKDYDELNFRIKGANTRARRLLGK  296



>emb|CDY47025.1| BnaC02g42100D [Brassica napus]
Length=278

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/243 (53%), Positives = 159/243 (65%), Gaps = 26/243 (11%)
 Frame = +3

Query  276  ARRTSSEPNL------------------NFDD------MSVQELENYAVNQAEETTKSVN  383
            ++RTSSEP+L                  NF+D       SVQELE YAV +AEETTKSV 
Sbjct  37   SKRTSSEPSLAIMTNPFDEVEKGYQYKNNFNDSGGVENQSVQELEGYAVYKAEETTKSVQ  96

Query  384  NCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWK  563
              L++AE+IR D  +TL  LH QGEQI RTH  A E+D DLS+GEKLL +LGGMFS  WK
Sbjct  97   GSLKVAEEIRSDATRTLVMLHDQGEQITRTHHKAAEIDHDLSRGEKLLGSLGGMFSKTWK  156

Query  564  PKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN-TKGKSAPTTPPNEPQNAMQKVEME  740
            PKKT+ I GP  ++D +  + +    E+REKLGL+  K +S    P  E  +A Q+VEME
Sbjct  157  PKKTRPINGPVITRDHSPTR-RVNHLEKREKLGLSPPKAQSRTREPLPESADAYQRVEME  215

Query  741  KAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHL  920
            KAKQDD L DLSD+LG+LK MA DMG+E+ +Q   LD L  D+DELN RV+ +NQRA  L
Sbjct  216  KAKQDDGLSDLSDLLGELKNMAVDMGSEIGRQKDGLDYLHDDVDELNYRVQQSNQRASRL  275

Query  921  LAK  929
            L K
Sbjct  276  LRK  278



>ref|XP_006477622.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Citrus sinensis]
Length=305

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 157/209 (75%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV +AE+TTK V+ CL+IAE+IR+D  KTL +LH+QGEQI RTH  A 
Sbjct  98   LENQSVQELENYAVYKAEDTTKQVHGCLKIAEEIREDATKTLVSLHQQGEQITRTHYTAA  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D DLS+GEKLL +LGGMFS  WKPKKT+ I GP  ++DD   + +    EQREKLGLN
Sbjct  158  SIDHDLSRGEKLLGSLGGMFSRTWKPKKTRPIMGPVITRDDPVQR-RGNHLEQREKLGLN  216

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
              +KG+S       EP +A QK+E+EK+KQDDAL +LS ILG+LK MATDMG+E+D+QNK
Sbjct  217  NTSKGQSNTRAQLPEPTDAYQKIEVEKSKQDDALSELSGILGELKNMATDMGSEIDRQNK  276

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            +LD LD D+D LN RVK AN R R LL K
Sbjct  277  SLDYLDDDVDVLNIRVKDANLRGRRLLGK  305



>ref|XP_006837079.1| hypothetical protein AMTR_s00110p00096490 [Amborella trichopoda]
 gb|ERM99932.1| hypothetical protein AMTR_s00110p00096490 [Amborella trichopoda]
Length=438

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 160/210 (76%), Gaps = 8/210 (4%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ +V+ELE YAV ++EETT +VNNCL+IA ++++D  +TL TLH+QGEQIHRTH +A 
Sbjct  204  LENQTVEELEKYAVYKSEETTTTVNNCLKIAGEMKEDATRTLITLHQQGEQIHRTHLVAA  263

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGL-  665
            ++D DLSKGEKLL +LGG+FS  WKPKKT+ I GP   +DD + K +    EQRE+LGL 
Sbjct  264  DIDHDLSKGEKLLGSLGGIFSKTWKPKKTRAIMGPTIVRDD-SFKRRGNHLEQRERLGLS  322

Query  666  -NTKGKSAP---TTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDK  833
             + KG+S+    ++ P  P +A +++E++K KQDDAL DLS++LG+LK MA DMG+E++ 
Sbjct  323  HSPKGRSSSHQRSSAP--PGSAFEQIELQKGKQDDALSDLSNMLGELKDMALDMGSEIEG  380

Query  834  QNKALDNLDTDIDELNSRVKGANQRARHLL  923
            QNKALDNL+ D+DEL  RVK AN R RHLL
Sbjct  381  QNKALDNLNDDVDELGFRVKNANLRGRHLL  410



>emb|CDX99033.1| BnaC09g48020D [Brassica napus]
Length=350

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 154/208 (74%), Gaps = 3/208 (1%)
 Frame = +3

Query  312  DDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVE  491
            ++ +VQELE+YAV ++EETTK+V  CL++A+ IR D  +TL  L++QGE+I RTH  AV+
Sbjct  144  ENQTVQELESYAVYKSEETTKTVQGCLKVAQGIRSDATRTLVMLNEQGEKITRTHHKAVD  203

Query  492  MDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN-  668
            +D DLS+GEKLL +LGG+FS  WKPKKT+ ITGP  ++ ++  K +    E REKLGLN 
Sbjct  204  IDHDLSRGEKLLGSLGGIFSRTWKPKKTRSITGPVITRGESP-KRRVNNLETREKLGLNH  262

Query  669  -TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
              K +S    P  E  +A QK+EMEKAKQDD L DLSD+LG+LK MA DMGTE+++QN  
Sbjct  263  LPKPQSRTNEPLPESADAYQKIEMEKAKQDDGLADLSDLLGELKNMAIDMGTEIERQNNG  322

Query  846  LDNLDTDIDELNSRVKGANQRARHLLAK  929
            LD+L  D+DELN RVK +NQRAR LL K
Sbjct  323  LDHLQDDVDELNFRVKQSNQRARRLLRK  350



>ref|NP_001046737.2| Os02g0437200 [Oryza sativa Japonica Group]
 gb|EAY85665.1| hypothetical protein OsI_07034 [Oryza sativa Indica Group]
 gb|EEE56891.1| hypothetical protein OsJ_06542 [Oryza sativa Japonica Group]
 dbj|BAF08651.2| Os02g0437200 [Oryza sativa Japonica Group]
Length=283

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 152/212 (72%), Gaps = 18/212 (8%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE YA  +AEETT+ V  C+RIAE++R   +K+L T+H+QG+QI RTH M +++D+
Sbjct  81   SVQELEGYAAYKAEETTQRVQGCVRIAEEMRDTASKSLVTIHQQGQQITRTHMMTLDIDQ  140

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTK-EQREKLGLNTKG  677
            DLS+ EKLL +LGG+FS  WKPKK  EI GP  ++DD+    +KG+  EQR KLGL+   
Sbjct  141  DLSRSEKLLGDLGGIFSKKWKPKKNGEIRGPMLTRDDSFI--RKGSHLEQRHKLGLSDH-  197

Query  678  KSAPTTPP--------NEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDK  833
                  PP        +EP +A+QKVEMEKAKQDD L DLS+IL +LKGMA DMGTE+D+
Sbjct  198  ------PPQSNARQFHSEPTSALQKVEMEKAKQDDGLSDLSNILTELKGMAVDMGTEIDR  251

Query  834  QNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            Q KAL + + D DELN R+KGAN RAR LL K
Sbjct  252  QTKALGDSEKDYDELNFRIKGANTRARRLLGK  283



>ref|XP_008651019.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA60390.1| TPA: SNAP25 protein SNAP30 [Zea mays]
Length=284

 Score =   223 bits (569),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 153/211 (73%), Gaps = 16/211 (8%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE YA  +AEETT+    C+RIAE++R   +KTL T+H+QG+QIHRTH MAV++D+
Sbjct  82   SVQELEGYAAYKAEETTRRTRGCVRIAEEMRDTASKTLVTVHQQGQQIHRTHMMAVDIDQ  141

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTK-EQREKLGLNTKG  677
            DLS+ EKLL +LGG+FS  WKPKK   I GP  ++DD+    +KG+  EQR+KLGL    
Sbjct  142  DLSRSEKLLGDLGGLFSKKWKPKKNGAIRGPMLTRDDSFI--RKGSHLEQRQKLGL----  195

Query  678  KSAPTTPP-------NEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQ  836
              A   PP       +EP +A++KVE+EKAKQDD L DLS+IL +LKGMA DMG+E+++Q
Sbjct  196  --ADHPPPSNARQFRSEPSSALEKVEIEKAKQDDDLSDLSNILTELKGMAVDMGSEIERQ  253

Query  837  NKALDNLDTDIDELNSRVKGANQRARHLLAK  929
             KA+ + + D DELN RVKGAN RAR LL +
Sbjct  254  TKAMGDAEKDYDELNFRVKGANTRARRLLGR  284



>ref|XP_003573114.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Brachypodium 
distachyon]
Length=302

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 153/205 (75%), Gaps = 4/205 (2%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE YA  +AEETT+ V+ C++IAE++R   +KTL T+H+QG+QI RTH MAV++D+
Sbjct  100  SVQELEGYAAYKAEETTQRVHGCVKIAEEMRDTASKTLVTVHQQGQQIRRTHAMAVDIDQ  159

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTK-EQREKLGLNTK-  674
            DLS+GEKLL +LGG+FS  WKPKK   I GP  ++DD+    +KG+  EQR+KLGL+   
Sbjct  160  DLSRGEKLLGDLGGIFSKKWKPKKNGAIRGPMLTRDDSFI--RKGSHLEQRQKLGLSDHP  217

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
             +S      +EP + ++KVE+EKAKQDDAL DLSDIL DLKGMA DMG+E+D+Q K L +
Sbjct  218  RRSNARQFQSEPTSGLEKVEVEKAKQDDALSDLSDILSDLKGMAIDMGSEIDRQTKDLGH  277

Query  855  LDTDIDELNSRVKGANQRARHLLAK  929
             + D DELN R+KGA+ R R LL +
Sbjct  278  AEKDFDELNFRMKGASARTRRLLGR  302



>ref|XP_009131020.1| PREDICTED: SNAP25 homologous protein SNAP33 [Brassica rapa]
 ref|XP_009131021.1| PREDICTED: SNAP25 homologous protein SNAP33 [Brassica rapa]
Length=292

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 161/233 (69%), Gaps = 19/233 (8%)
 Frame = +3

Query  285  TSSEPNLNFD----------------DMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQ  416
            TSS+P+L+ D                + SVQELE+YAV +++ETTK+V  CL++AE+IR 
Sbjct  61   TSSKPSLDLDAKSRYRNGFRDSGGVENQSVQELESYAVYKSQETTKTVQGCLKVAEEIRS  120

Query  417  DGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPK  596
            D A+TL  L++QGE+I RTH   V++D DLS+GEKLL +L G+FS  WKPKKT+ ITGP 
Sbjct  121  DAARTLVMLNEQGEKITRTHHKTVDIDHDLSRGEKLLGSLAGIFSPTWKPKKTRSITGPV  180

Query  597  TSKDDNNHKGKKGTKEQREKLGLN--TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDD  770
             +K ++  K +    E REKLGLN   K +S    P  E  +A QK+EMEKAKQDD L D
Sbjct  181  ITKGESP-KRRVNHLETREKLGLNHLPKPQSRTHEPLPESADAYQKLEMEKAKQDDGLAD  239

Query  771  LSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            LSD+L +LK MA DMGTE+++QN  LD+L  D+DELN RVK +NQRAR LL K
Sbjct  240  LSDLLSELKNMAVDMGTEIERQNNGLDHLQDDVDELNFRVKQSNQRARRLLRK  292



>gb|AAW82752.1| SNAP1 [Oryza sativa Japonica Group]
Length=283

 Score =   223 bits (568),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 152/212 (72%), Gaps = 18/212 (8%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE YA  +AEETT+ V  C+RIAE++R   +K+L T+H+QG+QI RTH   +++D+
Sbjct  81   SVQELEGYAAYKAEETTQRVQGCVRIAEEMRDTASKSLVTIHQQGQQITRTHMTTLDIDQ  140

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTK-EQREKLGLNTKG  677
            DLS+ EKLL +LGG+FS  WKPKK  EI GP  ++DD++   +KG+  EQR KLGL+   
Sbjct  141  DLSRSEKLLGDLGGIFSKKWKPKKNGEIRGPMLTRDDSSI--RKGSHLEQRHKLGLSDH-  197

Query  678  KSAPTTPP--------NEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDK  833
                  PP        +EP +A+QKVEMEKAKQDD L DLS+IL +LKGMA DMGTE+D+
Sbjct  198  ------PPQSNARQFHSEPTSALQKVEMEKAKQDDGLSDLSNILTELKGMAVDMGTEIDR  251

Query  834  QNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            Q KAL + + D DELN R+KGAN RAR LL K
Sbjct  252  QTKALGDSEKDYDELNFRIKGANTRARRLLGK  283



>ref|XP_006286625.1| hypothetical protein CARUB_v10002435mg [Capsella rubella]
 gb|EOA19523.1| hypothetical protein CARUB_v10002435mg [Capsella rubella]
Length=255

 Score =   222 bits (566),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 150/212 (71%), Gaps = 15/212 (7%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            +VQELE+YA+ Q+ ETTK+V  CL++AE+IR D ++TL  L++QGEQI RTH+  V++D 
Sbjct  50   TVQELESYALYQSHETTKTVQGCLKVAEEIRSDSSRTLVMLNEQGEQIMRTHQKTVDIDH  109

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDD-------NNHKGKKGTKEQREKL  659
            DLS+GEKLL +LGG+FS  WKPKKT+ +TGP  +K D       NNH       E REKL
Sbjct  110  DLSRGEKLLGSLGGIFSRTWKPKKTRSVTGPVITKGDSPKRRRVNNH------SETREKL  163

Query  660  GLNTKGKSAPTTPPNEPQ--NAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDK  833
            GLN   K    T    P+  +A QK+EME+AKQD+ L DLSD+LG+LK MA DMGTE+ +
Sbjct  164  GLNHLPKPQSRTRDTLPESADAYQKIEMERAKQDEGLSDLSDLLGELKNMALDMGTEIQR  223

Query  834  QNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            QN  LD+L  D++ELN RV  +NQRAR LL K
Sbjct  224  QNHGLDHLHDDVEELNYRVNQSNQRARRLLRK  255



>gb|KDO54588.1| hypothetical protein CISIN_1g021914mg [Citrus sinensis]
Length=305

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 157/209 (75%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE+YAV +AE+TTK V+ CL+IAE+IR+D  KTL +LH+QGEQI RTH  A 
Sbjct  98   LENQSVQELEDYAVYKAEDTTKQVHGCLKIAEEIREDATKTLVSLHQQGEQITRTHYTAA  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D DLS+GEKLL +LGGMFS  WKPKKT+ I GP  ++DD   + +    EQREKLGLN
Sbjct  158  SIDHDLSRGEKLLGSLGGMFSRTWKPKKTRPIMGPVITRDDPVQR-RGNHLEQREKLGLN  216

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
              +KG+S       EP +A QK+E+EK+KQDDAL +LS ILG+LK MATDMG+E+D+QNK
Sbjct  217  NTSKGQSNTRAQLPEPTDAYQKIEVEKSKQDDALSELSGILGELKNMATDMGSEIDRQNK  276

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            +LD LD D+D LN RVK AN R R LL K
Sbjct  277  SLDYLDDDVDVLNIRVKDANLRGRRLLGK  305



>ref|XP_006440694.1| hypothetical protein CICLE_v10021320mg [Citrus clementina]
 gb|ESR53934.1| hypothetical protein CICLE_v10021320mg [Citrus clementina]
Length=305

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 157/209 (75%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELE+YAV +AE+TTK V+ CL+IAE+IR+D  KTL +LH+QGEQI RTH  A 
Sbjct  98   LENQSVQELEDYAVYKAEDTTKQVHGCLKIAEEIREDATKTLVSLHQQGEQITRTHYTAA  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
             +D DLS+GEKLL +LGGMFS  WKPKKT+ I GP  ++DD   + +    EQREKLGLN
Sbjct  158  SIDHDLSRGEKLLGSLGGMFSRTWKPKKTRPIMGPVITRDDPVQR-RGNHLEQREKLGLN  216

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
              +KG+S       EP +A QK+E+EK+KQDDAL +LS ILG+LK MATDMG+E+D+QNK
Sbjct  217  NTSKGQSNTRARLPEPTDAYQKIEVEKSKQDDALSELSGILGELKNMATDMGSEIDRQNK  276

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            +LD LD D+D LN RVK AN R R LL K
Sbjct  277  SLDYLDDDVDVLNIRVKDANLRGRRLLGK  305



>ref|XP_006399270.1| hypothetical protein EUTSA_v10014162mg [Eutrema salsugineum]
 ref|XP_006399271.1| hypothetical protein EUTSA_v10014162mg [Eutrema salsugineum]
 gb|ESQ40723.1| hypothetical protein EUTSA_v10014162mg [Eutrema salsugineum]
 gb|ESQ40724.1| hypothetical protein EUTSA_v10014162mg [Eutrema salsugineum]
Length=312

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 154/208 (74%), Gaps = 3/208 (1%)
 Frame = +3

Query  312  DDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVE  491
            ++ +VQELE+YAV ++EETTK+V  CL++A+ IR D  +TL  L++QGE+I RTH+ AV+
Sbjct  106  ENQTVQELESYAVYKSEETTKTVQGCLKVAQGIRSDATRTLVMLNEQGEKITRTHQKAVD  165

Query  492  MDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN-  668
            +D DLS+GEKLL +LGG+FS  WKPKKT+ I GP  ++ ++  K +    E REKLGLN 
Sbjct  166  IDHDLSRGEKLLGSLGGIFSRTWKPKKTRSIAGPVITRGESP-KRRVNHLETREKLGLNH  224

Query  669  -TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
              K KS    P  E  +A QK+EMEKAKQD+ L DLSD+LG+LK MA DMGTE+++QN  
Sbjct  225  LPKPKSRTREPLPESADAYQKLEMEKAKQDEGLSDLSDLLGELKNMALDMGTEIERQNNG  284

Query  846  LDNLDTDIDELNSRVKGANQRARHLLAK  929
            LD+L  D++ELN RVK +NQRAR LL K
Sbjct  285  LDHLQDDVEELNFRVKQSNQRARRLLRK  312



>gb|KCW48875.1| hypothetical protein EUGRSUZ_K02499 [Eucalyptus grandis]
Length=275

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 135/173 (78%), Gaps = 4/173 (2%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELENYAV +AEETT+SVNNCL+IAE IR+D  KTL TLH+QGEQ+ RTH  A ++D 
Sbjct  102  SVQELENYAVYKAEETTESVNNCLKIAEGIREDATKTLVTLHQQGEQLTRTHMAAADIDH  161

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN--TK  674
            DLS+GEKLL NLGGMFS  WKPKK + I+GP   ++D   KG     EQREKLGL   TK
Sbjct  162  DLSRGEKLLGNLGGMFSKTWKPKKNRPISGPVIMREDVQRKGNH--LEQREKLGLTSATK  219

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDK  833
             +S   TPP EP NA++KVE+EK KQDDAL DLSD+LG+LKGMA DMG+E+++
Sbjct  220  HQSNSRTPPPEPTNAIEKVEVEKVKQDDALSDLSDLLGELKGMAVDMGSEIER  272



>emb|CDX69988.1| BnaA10g23370D [Brassica napus]
Length=342

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 150/208 (72%), Gaps = 2/208 (1%)
 Frame = +3

Query  312  DDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVE  491
            ++ ++QELE+YAV ++EETT++V  CL++A+ IR D  +TL  L++QGE+I RTH  AV+
Sbjct  135  ENQTLQELESYAVYKSEETTRTVQGCLKVAQGIRSDATRTLVMLNEQGEKITRTHHKAVD  194

Query  492  MDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNT  671
            +D DLS+GEK+L +LGG+FS  WKPKKT+ ITGP   ++  + K +    E REKLGLN 
Sbjct  195  IDHDLSRGEKILGSLGGIFSRTWKPKKTRSITGPVIIREGESPKRRVNHLETREKLGLNH  254

Query  672  KGKSAPTT--PPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
              K    T  P  E   A QK+EMEKAKQDD L DLSD+L +LK MA DMGTE+++QN  
Sbjct  255  LPKPHSRTHEPLPESAGAYQKIEMEKAKQDDGLADLSDLLSELKNMAIDMGTEIERQNNG  314

Query  846  LDNLDTDIDELNSRVKGANQRARHLLAK  929
            LD+L  D+DELN RVK +NQRAR LL K
Sbjct  315  LDHLQDDVDELNFRVKQSNQRARRLLRK  342



>ref|XP_008785958.1| PREDICTED: SNAP25 homologous protein SNAP33 [Phoenix dactylifera]
 ref|XP_008785959.1| PREDICTED: SNAP25 homologous protein SNAP33 [Phoenix dactylifera]
 ref|XP_008785960.1| PREDICTED: SNAP25 homologous protein SNAP33 [Phoenix dactylifera]
Length=297

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 155/208 (75%), Gaps = 2/208 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
            F++ SVQELEN+AV +AEETT  +N CL+IAE++R D ++TL +LH+QG++I +TH  A 
Sbjct  91   FENQSVQELENHAVYKAEETTHKINGCLKIAEEMRGDASRTLISLHQQGQKITQTHLTAA  150

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEKLL +LGG+FS  WKPKK +EI GP  ++DD+  + K    EQR+KLGL+
Sbjct  151  DIDHDLSRGEKLLGSLGGIFSKTWKPKKNREIKGPVLTRDDSFIQ-KGSHMEQRQKLGLS  209

Query  669  TK-GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKA  845
                +S P T P+EP +A++KVE+EKAKQ+DAL DLSD+L +LK MA DMG E+++   A
Sbjct  210  GPLCRSNPRTFPSEPTSALEKVEIEKAKQNDALSDLSDLLVELKDMAMDMGGEIERHTGA  269

Query  846  LDNLDTDIDELNSRVKGANQRARHLLAK  929
            LD +  D+D LN RVK AN R R LL K
Sbjct  270  LDRMQDDVDGLNFRVKRANIRGRRLLGK  297



>gb|ACG41627.1| SNAP25 homologous protein SNAP30 [Zea mays]
Length=284

 Score =   221 bits (563),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 152/211 (72%), Gaps = 16/211 (8%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE YA  +AEETT+    C+RIAE++R   +KTL T+H+QG+QIHRTH MAV++D+
Sbjct  82   SVQELEGYAAYKAEETTRRTRGCVRIAEEMRDTASKTLVTVHQQGQQIHRTHMMAVDIDQ  141

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTK-EQREKLGLNTKG  677
            DL + EKLL +LGG+FS  WKPKK   I GP  ++DD+    +KG+  EQR+KLGL    
Sbjct  142  DLFRSEKLLGDLGGLFSKKWKPKKNGAIRGPMLTRDDSFI--RKGSHLEQRQKLGL----  195

Query  678  KSAPTTPP-------NEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQ  836
              A   PP       +EP +A++KVE+EKAKQDD L DLS+IL +LKGMA DMG+E+++Q
Sbjct  196  --ADHPPPSNARQFRSEPSSALEKVEIEKAKQDDDLSDLSNILTELKGMAVDMGSEIERQ  253

Query  837  NKALDNLDTDIDELNSRVKGANQRARHLLAK  929
             KA+ + + D DELN RVKGAN RAR LL +
Sbjct  254  TKAMGDAEKDYDELNFRVKGANTRARRLLGR  284



>ref|XP_004985220.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Setaria italica]
Length=248

 Score =   220 bits (560),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 152/222 (68%), Gaps = 5/222 (2%)
 Frame = +3

Query  267  PPAARRTSSEPNLNFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLH  446
            P    R  S P +   D SVQELE+YA+ +A ETT  VN+C+R AE IR+D  +TL+TLH
Sbjct  31   PSKPSRAQSVP-VKCTDQSVQELEDYAITKARETTHKVNDCVRAAEAIREDATQTLQTLH  89

Query  447  KQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKG  626
            +QGEQI R+H +A ++++DL+  EKLL +LGG+FS  W+PK+ ++I GP +   +N+   
Sbjct  90   RQGEQIMRSHHLAADIEQDLTVSEKLLGSLGGLFSKAWRPKRNQQIKGPVS---ENSFSV  146

Query  627  KKGTK-EQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGM  803
            +     EQR +LG+    +++P++    P  AM K++ EK KQDDAL DLS+ LG LK M
Sbjct  147  RTANHMEQRWRLGIAPTQQNSPSSVQTAPATAMGKIQAEKEKQDDALSDLSNTLGQLKEM  206

Query  804  ATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            A DMGTE+D+QNKAL     D+DELN R+KGANQR R LL K
Sbjct  207  AVDMGTEIDRQNKALVPFSEDVDELNFRLKGANQRGRRLLGK  248



>gb|EMS62124.1| SNAP25 homologous protein SNAP33 [Triticum urartu]
Length=240

 Score =   219 bits (559),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 148/204 (73%), Gaps = 2/204 (1%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE YA  +AEETT+ V+ CLR+AE++R   +KTL  +H+QG+QI RTH MA+++D+
Sbjct  38   SVQELEGYAAYKAEETTRRVDGCLRVAEEMRDTASKTLLQVHQQGQQIRRTHAMALDIDQ  97

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTK-G  677
            DLS+GEKLL +LGG+FS  WKPKK   I GP  ++DD+  + K    EQR KLGL+ +  
Sbjct  98   DLSRGEKLLGDLGGLFSKKWKPKKNGAIRGPMLTRDDSFIR-KGSHMEQRHKLGLSDRPR  156

Query  678  KSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNL  857
            +S      +EP + ++KVE+EKAKQDD L DLSDIL +LKGMA DMGTE++ Q K L + 
Sbjct  157  RSNARQFLSEPTSELEKVEVEKAKQDDGLSDLSDILTELKGMAIDMGTEIEGQTKDLGHA  216

Query  858  DTDIDELNSRVKGANQRARHLLAK  929
            + D DELN RVKGAN R R LL +
Sbjct  217  EKDFDELNYRVKGANTRTRRLLGR  240



>dbj|BAK02929.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=309

 Score =   221 bits (563),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 148/204 (73%), Gaps = 2/204 (1%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE YA  +AEETT+ V+ CLR+AE++R   +KTL  +H+QG+QI RTH MAV++D+
Sbjct  107  SVQELEGYAAYKAEETTRRVDGCLRVAEEMRDTASKTLLQVHQQGQQIRRTHAMAVDIDQ  166

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKG-  677
            DLS+GEKLL +LGG+FS  WKPKK   I GP  ++DD+  + K    EQR KLGL+ +  
Sbjct  167  DLSRGEKLLGDLGGLFSKKWKPKKNGAIRGPMLTRDDSFIR-KGSHMEQRHKLGLSDRPR  225

Query  678  KSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNL  857
            +S      +EP + ++KVE+EKAKQDD L DLSDIL +LKGMA DMGTE++ Q K L + 
Sbjct  226  RSNARQFLSEPTSGLEKVEVEKAKQDDGLSDLSDILTELKGMAIDMGTEIEGQTKDLGHA  285

Query  858  DTDIDELNSRVKGANQRARHLLAK  929
            + D DELN RVKGAN R R LL +
Sbjct  286  EKDFDELNYRVKGANARTRRLLGR  309



>gb|AAP79417.1| SNAP-34 [Hordeum vulgare subsp. vulgare]
Length=309

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 148/204 (73%), Gaps = 2/204 (1%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE YA  +AEETT+ V+ CLR+AE++R   +KTL  +H+QG+QI RTH MAV++D+
Sbjct  107  SVQELEGYAAYKAEETTRRVDGCLRVAEEMRDTASKTLLQVHQQGQQIRRTHAMAVDIDQ  166

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTK-G  677
            DLS+GEKLL +LGG+FS  WKPKK   I GP  ++DD+  + K    EQR KLGL+ +  
Sbjct  167  DLSRGEKLLGDLGGLFSKKWKPKKNGAIRGPMLTRDDSFIR-KGSHMEQRHKLGLSDRPH  225

Query  678  KSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNL  857
            +S      +EP + ++KVE+EKAKQDD L DLSDIL +LKGMA DMGTE++ Q K L + 
Sbjct  226  RSNARQFLSEPTSGLEKVEVEKAKQDDGLSDLSDILTELKGMAIDMGTEIEGQTKDLGHA  285

Query  858  DTDIDELNSRVKGANQRARHLLAK  929
            + D DELN RVKGAN R R LL +
Sbjct  286  EKDFDELNYRVKGANARTRRLLGR  309



>gb|AAP79418.1| SNAP-28 [Hordeum vulgare subsp. vulgare]
 dbj|BAK06276.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=249

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 151/221 (68%), Gaps = 3/221 (1%)
 Frame = +3

Query  267  PPAARRTSSEPNLNFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLH  446
            P    R  S P     + SVQELE+Y + +AEET+  VN+C+R AE IR+D  + L TLH
Sbjct  32   PSRPLRAQSAPT-QHTNQSVQELEDYTLRKAEETSSKVNDCVRAAEAIREDATQILLTLH  90

Query  447  KQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKG  626
            +QGEQI  TH +A +++ DL+  EKLL +LGG+FS  W+PK+++ I GP +  ++++ K 
Sbjct  91   RQGEQITHTHRVAADIEHDLTMSEKLLGSLGGLFSKTWRPKRSQHIKGPVS--ENSSFKS  148

Query  627  KKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMA  806
                 EQR+KLG+ +  + +P++  + P   M K++ EKA+QDDA  DLS+ILG LK MA
Sbjct  149  TSNEMEQRQKLGIASTPQKSPSSVHSAPATEMDKIKAEKARQDDAFADLSNILGGLKDMA  208

Query  807  TDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
             DMGTE+D+QNK+LD    D+DELN RVKGANQR R LL K
Sbjct  209  LDMGTEIDRQNKSLDTFGDDVDELNFRVKGANQRGRRLLGK  249



>gb|AFQ60149.1| SNAP34 [Triticum aestivum]
Length=305

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 148/204 (73%), Gaps = 2/204 (1%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE YA  +AEETT+ V+ CLR+AE++R   +KTL  +H+QG+QI RTH MA+++D+
Sbjct  103  SVQELEGYAAYKAEETTRRVDGCLRVAEEMRDTASKTLLQVHQQGQQIRRTHAMALDIDQ  162

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTK-G  677
            DLS+GEKLL +LGG+FS  WKPKK   I GP  ++DD+  + K    EQR KLGL+ +  
Sbjct  163  DLSRGEKLLGDLGGLFSKKWKPKKNGAIRGPMLTRDDSFIR-KGSHMEQRHKLGLSDRPR  221

Query  678  KSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNL  857
            +S      +EP + ++KVE+EKAKQDD L DLSDIL +LKGMA DMGTE++ Q K L + 
Sbjct  222  RSNARQFLSEPTSELEKVEVEKAKQDDGLSDLSDILTELKGMAIDMGTEIEGQTKDLGHA  281

Query  858  DTDIDELNSRVKGANQRARHLLAK  929
            + D DELN RVKGAN R R LL +
Sbjct  282  EKDFDELNYRVKGANTRTRRLLGR  305



>gb|EMT01836.1| hypothetical protein F775_27154 [Aegilops tauschii]
Length=249

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 150/221 (68%), Gaps = 3/221 (1%)
 Frame = +3

Query  267  PPAARRTSSEPNLNFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLH  446
            P    R  S P     + SVQELE+Y + +AEET+   N+C+R AE IR+D  + L TLH
Sbjct  32   PSRPSRAQSAPT-QHTNQSVQELEDYTLRKAEETSSKANDCVRAAEAIREDATQILLTLH  90

Query  447  KQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKG  626
            +QGEQI  TH +A +++ DL+  EKLL +LGG+FS  W+PK+ + I GP +   +++ K 
Sbjct  91   RQGEQITHTHRVAADIEHDLTMSEKLLGSLGGLFSKTWRPKRNQHIKGPVS--QNSSFKS  148

Query  627  KKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMA  806
                 EQR+ LG+ ++ + +P++  + P  AM K++ EKA+QDDA  DLS++LG+LK MA
Sbjct  149  TSNQMEQRQNLGIGSRPQQSPSSAHSAPATAMDKIKAEKARQDDAFADLSNMLGNLKDMA  208

Query  807  TDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
             DMGTE+D+QNK+LD    D+DELN RVKGANQR R LL K
Sbjct  209  LDMGTEIDRQNKSLDTFSDDVDELNFRVKGANQRGRRLLGK  249



>ref|XP_009122403.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Brassica rapa]
 ref|XP_009122404.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Brassica rapa]
Length=297

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 152/209 (73%), Gaps = 3/209 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ +VQELE+YAV ++EETT++V  CL++ + IR D  +TL  L++QGE+I RTH  AV
Sbjct  90   VENQTVQELESYAVYKSEETTRTVQGCLKVVQGIRSDATRTLVMLNEQGEKITRTHHKAV  149

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEK+L +LGG+FS  WKPKKT+ ITGP  ++ +++ K +    E REKLGLN
Sbjct  150  DIDHDLSRGEKILGSLGGIFSRTWKPKKTRSITGPVITRGESS-KRRVNHLETREKLGLN  208

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               K  S    P  E  +A QK+EMEKAKQDD L DLSD+L +LK MA DMGTE+++QN 
Sbjct  209  HLPKPHSRTHEPLPESADAYQKIEMEKAKQDDGLADLSDLLSELKNMAIDMGTEIERQNN  268

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
             LD+L  D+DELN RVK +NQRAR LL K
Sbjct  269  GLDHLQDDVDELNFRVKQSNQRARRLLRK  297



>gb|ABR17810.1| unknown [Picea sitchensis]
Length=462

 Score =   224 bits (570),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 152/210 (72%), Gaps = 5/210 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
            FD+ SVQELE+YAV ++EETT +VNNCL++AE+I++D  KTL TLH+QGEQI RTH +A 
Sbjct  255  FDNQSVQELESYAVYKSEETTTTVNNCLKLAENIKEDATKTLITLHQQGEQITRTHNVAA  314

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDN-NHKGKKGTKEQREKLGL  665
            ++D +L  GEKLL NLGG+FS  WKP++T+ ITGP  ++DD+   +GK    EQR  LGL
Sbjct  315  DIDYNLKAGEKLLGNLGGIFSRKWKPERTRAITGPVLTRDDSFKRRGKH--MEQRAALGL  372

Query  666  --NTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQN  839
              + KG+S+  T P        ++E+EK KQDDAL DLS++L  LK MA DMG+E+++QN
Sbjct  373  VKSPKGRSSSRTYPLVADTPQVRIEVEKTKQDDALLDLSNVLDQLKEMAVDMGSEIERQN  432

Query  840  KALDNLDTDIDELNSRVKGANQRARHLLAK  929
             ALD L  D+ EL  RVKGAN R R LL K
Sbjct  433  HALDPLADDVTELGYRVKGANARGRRLLGK  462



>emb|CDM84857.1| unnamed protein product [Triticum aestivum]
Length=256

 Score =   218 bits (554),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 159/206 (77%), Gaps = 3/206 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SV+ELENYA  +AEETT ++N CLRIAE+I++D   T+ TL KQGEQI RTHE AV
Sbjct  53   LENQSVEELENYAAYKAEETTDTLNGCLRIAENIKEDATNTMITLQKQGEQISRTHEKAV  112

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D+DL+KGE LLN+LGG FS PWKPKKTK+I     S+DD + K K    EQR+KLGL+
Sbjct  113  EIDQDLTKGEGLLNSLGGFFSKPWKPKKTKKIK-GPVSRDD-SFKKKVNRMEQRDKLGLS  170

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
             +GK   T    E  +AM KV++EK KQDDALDDLS +LG L+GMA DMG+ELD+QNKAL
Sbjct  171  PRGK-GNTREYGEATSAMDKVQLEKKKQDDALDDLSGVLGQLQGMAVDMGSELDRQNKAL  229

Query  849  DNLDTDIDELNSRVKGANQRARHLLA  926
            D++  D++ELNSRVK ANQRAR +LA
Sbjct  230  DDMHGDVEELNSRVKQANQRARKILA  255



>gb|EMS47805.1| SNAP25 homologous protein SNAP33 [Triticum urartu]
Length=392

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 160/206 (78%), Gaps = 3/206 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SV+ELENYA  +AEETT ++N CLRIAE+I++D A T+ TL KQGEQI RTHE AV
Sbjct  189  LENQSVEELENYAAYKAEETTDTLNGCLRIAENIKEDAANTMITLQKQGEQISRTHEKAV  248

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D+DL+KGE LLN+LGG FS PWKPKKTK+I     S+DD + K K    EQR+KLGL+
Sbjct  249  EIDQDLAKGEGLLNSLGGFFSKPWKPKKTKKIK-GPVSRDD-SFKKKTSRMEQRDKLGLS  306

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
             +GK   T    +  NAM KV++EK KQDDALDDLS +LG L+GMA DMG+ELD+QNKAL
Sbjct  307  PRGK-GNTREYGDATNAMDKVQLEKKKQDDALDDLSGVLGQLQGMAVDMGSELDRQNKAL  365

Query  849  DNLDTDIDELNSRVKGANQRARHLLA  926
            D++  D++ELNSRVK ANQRAR +LA
Sbjct  366  DDMHGDVEELNSRVKQANQRARKILA  391



>gb|EMT27772.1| hypothetical protein F775_19680 [Aegilops tauschii]
Length=381

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 151/213 (71%), Gaps = 3/213 (1%)
 Frame = +3

Query  297  PNLN-FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRT  473
            P L   +  SVQELE YA  +AEETT+ V+ CLR+AE++R   +KTL  +H+QG+QI RT
Sbjct  170  PGLGGVEAQSVQELEGYAAYKAEETTRRVDGCLRVAEEMRDTASKTLLQVHQQGQQIRRT  229

Query  474  HEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQRE  653
            H MA+++D+DLS+GEKLL +LGG+FS  WKPKK   I GP  ++DD+  + K    EQR 
Sbjct  230  HAMALDIDQDLSRGEKLLGDLGGLFSKKWKPKKNGAIRGPMLTRDDSFIR-KGSHMEQRH  288

Query  654  KLGLNTK-GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELD  830
            KLGL+ +  +S      +EP + ++KVE+EKAKQDD L DLSDIL +LKGMA DMGTE++
Sbjct  289  KLGLSDRPRRSNARQFLSEPTSELEKVEVEKAKQDDGLSDLSDILTELKGMAIDMGTEIE  348

Query  831  KQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
             Q K L + + D DELN RVKGAN R R LL +
Sbjct  349  GQTKDLGHAEKDFDELNYRVKGANTRTRRLLGR  381



>gb|EMT02830.1| hypothetical protein F775_27735 [Aegilops tauschii]
Length=320

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 159/206 (77%), Gaps = 3/206 (1%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SV+ELENYA  +AEETT ++N CLRIAE+I++D   T+ TL KQGEQI RTHE AV
Sbjct  117  LENQSVEELENYAAYKAEETTDTLNGCLRIAENIKEDATNTMITLQKQGEQISRTHEKAV  176

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D+DL+KGE LLN+LGG FS PWKPKKTK+I     S+DD + K K    EQR+KLGL+
Sbjct  177  EIDQDLTKGEGLLNSLGGFFSKPWKPKKTKKIK-GPVSRDD-SFKKKTSRMEQRDKLGLS  234

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
             +GK   T    E  +AM KV++EK KQDDALDDLS +LG L+GMA DMG+ELD+QNKAL
Sbjct  235  PRGK-GNTREYGEATSAMDKVQLEKKKQDDALDDLSGVLGQLQGMAVDMGSELDRQNKAL  293

Query  849  DNLDTDIDELNSRVKGANQRARHLLA  926
            D++  D++ELNSRVK ANQRAR +LA
Sbjct  294  DDMHGDVEELNSRVKQANQRARKILA  319



>ref|XP_008646186.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008646248.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN34940.1| unknown [Zea mays]
 tpg|DAA44050.1| TPA: SNAP25 protein SNAP29 [Zea mays]
Length=243

 Score =   214 bits (544),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 142/204 (70%), Gaps = 4/204 (2%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE+YA+ +A ETT  VN+C+R AE IR+D  +T+ TLH+QGEQI R+H++A ++++
Sbjct  43   SVQELEDYAITKARETTHKVNDCVRAAEAIREDATQTMLTLHRQGEQIMRSHQVAADIEQ  102

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGT-KEQREKLGLNTKG  677
            DL+  EKLL +LGG+FS  W+PK+  +I GP +    NN+        EQR KLG+    
Sbjct  103  DLTVSEKLLGSLGGLFSKSWRPKRNHQIKGPVSG---NNYSATTANDTEQRGKLGIAPAR  159

Query  678  KSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNL  857
            +  P+     P +AM+KV+ E+ KQDDAL DL   LG LK MA DMGTE+D+QNKAL  L
Sbjct  160  QEYPSHVQTTPVSAMEKVQAERTKQDDALSDLCSTLGQLKEMAVDMGTEIDRQNKALVPL  219

Query  858  DTDIDELNSRVKGANQRARHLLAK  929
              D+DELN R+KGANQR R LL K
Sbjct  220  SDDVDELNFRLKGANQRGRRLLGK  243



>gb|ACG28612.1| SNAP25 homologous protein SNAP29 [Zea mays]
Length=243

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 146/217 (67%), Gaps = 5/217 (2%)
 Frame = +3

Query  282  RTSSEPNLNFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQ  461
            R  S P +   + SVQELE+YA+ +A ETT  VN+C+R AE IR+D  +T+ TLH+QGEQ
Sbjct  31   RAQSVP-VRHTNQSVQELEDYAITKARETTHKVNDCVRAAEAIREDATQTMLTLHRQGEQ  89

Query  462  IHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGT-  638
            I R+H++A ++++DL+  EKLL +LGG+FS  W+PK+  +I GP +    NN+       
Sbjct  90   IMRSHQVAADIEQDLTVSEKLLGSLGGLFSKSWRPKRNHQIKGPVSG---NNYSATTAND  146

Query  639  KEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMG  818
             EQR KLG+    +  P+     P +AM+KV+ E+ KQDDAL DL   LG LK MA DMG
Sbjct  147  TEQRGKLGIAPAHQEYPSHVQTTPVSAMEKVQAERTKQDDALSDLCSTLGQLKEMAVDMG  206

Query  819  TELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            TE+D+QNKAL     D+DELN R+KGANQR R LL K
Sbjct  207  TEIDRQNKALVPFSDDVDELNFRLKGANQRGRRLLGK  243



>ref|XP_002468291.1| hypothetical protein SORBIDRAFT_01g043090 [Sorghum bicolor]
 gb|EER95289.1| hypothetical protein SORBIDRAFT_01g043090 [Sorghum bicolor]
Length=245

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 145/217 (67%), Gaps = 5/217 (2%)
 Frame = +3

Query  282  RTSSEPNLNFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQ  461
            R  S P +   + SVQELE+YA+ +A ETT  VN+C+R AE IR+D  +T+ TLH QGEQ
Sbjct  33   RAQSVP-VRHTNQSVQELEDYAITKARETTHKVNDCVRAAEAIREDATQTMLTLHHQGEQ  91

Query  462  IHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGT-  638
            I R+H++A E+++DL+  EKLL +LGG+FS  W+PK++++I GP +    NN        
Sbjct  92   IMRSHQVAAEIEQDLTVSEKLLGSLGGLFSKSWRPKRSQQIKGPVSG---NNFSATTAND  148

Query  639  KEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMG  818
             EQR KLG+    +  P+     P +AM+K++ E AKQDDAL DL   LG LK MA DMG
Sbjct  149  TEQRWKLGIVPARQERPSHVQTTPVSAMEKIQAETAKQDDALSDLCSTLGQLKEMAVDMG  208

Query  819  TELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
             E+D+QNKAL     D+DELN R+KGANQR R LL K
Sbjct  209  AEIDRQNKALVPFSDDVDELNFRLKGANQRGRRLLGK  245



>gb|KCW86520.1| hypothetical protein EUGRSUZ_B03169 [Eucalyptus grandis]
Length=202

 Score =   210 bits (535),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 142/209 (68%), Gaps = 37/209 (18%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQELENYAV +AEETT +VNNCL+IAEDIR+D  +TL+ LH QGEQ         
Sbjct  29   LENQSVQELENYAVYKAEETTSTVNNCLKIAEDIREDATRTLDMLHNQGEQ---------  79

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
               +D   G     NLGGMFS  WKPKKT+EI+GP                  REKLGL 
Sbjct  80   ---EDPRNG-----NLGGMFSKTWKPKKTREISGP------------------REKLGLA  113

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               KGK    TPP EP NA+QKVE+EKAKQDDAL DLS++LGDLK MA DMG ELD+QNK
Sbjct  114  PVPKGKGTTRTPPPEPTNALQKVEVEKAKQDDALSDLSNVLGDLKNMAVDMGGELDRQNK  173

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ALD+L  D+DELNSRVKGANQR R LL K
Sbjct  174  ALDHLGDDVDELNSRVKGANQRTRRLLGK  202



>ref|XP_003558507.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Brachypodium 
distachyon]
Length=249

 Score =   211 bits (538),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 145/203 (71%), Gaps = 2/203 (1%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE+ AV +AEET+  VN+C+R AE IR+D  + L TLH+QGEQI +TH +AV++++
Sbjct  49   SVQELEDNAVRRAEETSCKVNDCVRAAEAIREDATQILMTLHQQGEQITQTHRVAVDIEQ  108

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKGK  680
            DLS  E+LL +LGG+FS  W+PKK ++I GP +    N+ K      E+R+KLG+ +   
Sbjct  109  DLSVSERLLGSLGGLFSKTWRPKKNQQIKGPIS--QSNSFKSTSYHMEERQKLGIASTPP  166

Query  681  SAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLD  860
             +     + P  A++KV+ EKAKQDDA  DLS+ LG LK MA DMGTE+++QNK+LD L 
Sbjct  167  QSHNPVRHSPATALEKVQAEKAKQDDAFSDLSNSLGQLKLMAMDMGTEIERQNKSLDTLS  226

Query  861  TDIDELNSRVKGANQRARHLLAK  929
             D+DELN R+KGANQR R LL K
Sbjct  227  DDVDELNFRLKGANQRGRRLLGK  249



>ref|XP_009399114.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009399115.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009399116.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Musa acuminata 
subsp. malaccensis]
Length=276

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 153/210 (73%), Gaps = 8/210 (4%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SVQEL+NY+  +AEETT  +N CL+IAE+IR+  + TL TLH+QGEQI RTH+   
Sbjct  72   IENQSVQELQNYSAYKAEETTIKLNGCLKIAEEIREGASNTLVTLHQQGEQITRTHQAVA  131

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            +++ DLS+GEKLL +LGG+FS  WKPKKT +I GP + KDD++ + +    EQR++LGL 
Sbjct  132  DIEPDLSRGEKLLGSLGGLFSKKWKPKKTHKIKGPLSIKDDSSERSRH--LEQRQRLGL-  188

Query  669  TKGKSAPTTPP---NEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQN  839
                  P + P   +EP +A+QKVE+EKAKQDD L DLS++LG+LK MA DMG+E +KQN
Sbjct  189  --AAPLPRSEPQHFSEPASALQKVEIEKAKQDDVLSDLSNLLGELKNMAIDMGSEFEKQN  246

Query  840  KALDNLDTDIDELNSRVKGANQRARHLLAK  929
             ALD    D+DE+N+RV GAN R R LL K
Sbjct  247  VALDRAQDDVDEMNTRVHGANLRGRRLLRK  276



>ref|XP_007157645.1| hypothetical protein PHAVU_002G087000g [Phaseolus vulgaris]
 gb|ESW29639.1| hypothetical protein PHAVU_002G087000g [Phaseolus vulgaris]
Length=258

 Score =   207 bits (526),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 133/177 (75%), Gaps = 3/177 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             +  SVQELE+YAV +AEETTKSVN+CL+IAE++R+D  KTL  LH+QGEQI R+H +A 
Sbjct  83   LESQSVQELEDYAVYKAEETTKSVNSCLKIAEEMREDATKTLVMLHQQGEQITRSHHVAA  142

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D DLS+GEKLL +LGGMFS  WKPKKT  ITGP    DD   + K    EQREKLGL 
Sbjct  143  DIDHDLSRGEKLLGSLGGMFSKTWKPKKTGTITGPVVFGDDPVRR-KGNHLEQREKLGLT  201

Query  669  T--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDK  833
            +  KG+S   T P+E  NA +KVE+EK KQDDAL D+SD+LG+LK MA DMG+EL +
Sbjct  202  SAPKGQSKSRTTPSESTNAFEKVEVEKGKQDDALSDISDLLGELKDMAIDMGSELGR  258



>ref|XP_002873328.1| hypothetical protein ARALYDRAFT_487619 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49587.1| hypothetical protein ARALYDRAFT_487619 [Arabidopsis lyrata subsp. 
lyrata]
Length=259

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 145/215 (67%), Gaps = 7/215 (3%)
 Frame = +3

Query  300  NLNFDD-----MSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQI  464
            +L F D      +VQELE+YAV ++EETTK+V  CL++AE+IR D  KTL  L+ QG+QI
Sbjct  47   SLKFSDAKENHQTVQELESYAVYESEETTKTVKGCLKVAEEIRCDATKTLVMLNDQGDQI  106

Query  465  HRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKE  644
             RTH  AV++D  LS+GEKLL  LGG+FS  WKPKKT+ ITGP  ++ D+  +     K 
Sbjct  107  TRTHHKAVDIDHHLSRGEKLLGRLGGIFSRTWKPKKTRSITGPVRTRGDSPKRRVINLK-  165

Query  645  QREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTE  824
             RE LGLN   K    T   E  +A QK +ME AKQD+ L +LSD+LG+LK MA DMGT 
Sbjct  166  TRENLGLNHSLKPKSRTLA-ESVDAYQKTQMEIAKQDEVLSNLSDLLGELKNMAVDMGTA  224

Query  825  LDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            ++ +N  LD+L  D+DELN RVK +NQRA  LL K
Sbjct  225  IESENHGLDHLQDDVDELNYRVKQSNQRAGRLLRK  259



>ref|NP_196405.1| SNAP25-like protein SNAP29 [Arabidopsis thaliana]
 sp|Q9SD96.1|SNP29_ARATH RecName: Full=SNAP25 homologous protein SNAP29; Short=AtSNAP29; 
AltName: Full=Synaptosomal-associated protein SNAP25-like 
2 [Arabidopsis thaliana]
 emb|CAB62600.1| SNAP25-like protein [Arabidopsis thaliana]
 dbj|BAB09952.1| synaptosomal associated protein SNAP25-like [Arabidopsis thaliana]
 gb|AAY78819.1| putative SNAP25-like protein [Arabidopsis thaliana]
 gb|AED91215.1| SNAP25-like protein SNAP29 [Arabidopsis thaliana]
Length=251

 Score =   204 bits (518),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 154/218 (71%), Gaps = 5/218 (2%)
 Frame = +3

Query  279  RRTSS-EPNLNFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQG  455
            R TSS +P+   ++ +VQELE+YAV  +EETTK+V  CL++AE+IR D +KTL  L++QG
Sbjct  38   RFTSSLKPSGGKENQTVQELESYAVYNSEETTKTVQGCLKVAEEIRCDASKTLVMLNEQG  97

Query  456  EQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKG  635
            +QI RTH+  V++D  LS+GEK+L  LGG+FS  WKPKK++ ITGP  +K D + K K  
Sbjct  98   DQITRTHQKTVDLDHHLSRGEKILGRLGGVFSRTWKPKKSRSITGPVITKGD-SPKRKVI  156

Query  636  TKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDM  815
              + REKLGLN   K    T P E  +A QK ++  AKQD+AL DLS +LG+LK MA DM
Sbjct  157  DLKTREKLGLNPSLKPKSKTLP-EAVDAYQKTQI--AKQDEALTDLSALLGELKNMAVDM  213

Query  816  GTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            GT +++Q   LD+L  + DELN RVK +NQRAR+LL K
Sbjct  214  GTAIERQTNELDHLQDNADELNYRVKQSNQRARYLLRK  251



>ref|XP_002961143.1| hypothetical protein SELMODRAFT_35623, partial [Selaginella moellendorffii]
 gb|EFJ38682.1| hypothetical protein SELMODRAFT_35623, partial [Selaginella moellendorffii]
Length=209

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 138/206 (67%), Gaps = 4/206 (2%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE+YAV +AEETT +    L++AE+I++    T   LH+QG QI RTHE AV++D 
Sbjct  5    SVQELEDYAVQKAEETTVATYKALKLAEEIKESATNTSVMLHEQGHQITRTHETAVDIDH  64

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGL---NT  671
             LS+GEKLL +LGG+FS  WKPKK + ITGP  S+ D+  +   G  EQR  LGL   N+
Sbjct  65   ALSRGEKLLGSLGGLFSKTWKPKKARNITGPMLSRGDSFKRKAYGM-EQRAALGLNRSNS  123

Query  672  KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALD  851
            KGK+  T    +   +  +  +  AKQD+AL DLS++LG LK M  DMG+E+ +Q  AL 
Sbjct  124  KGKTRHTAAVADSSGSQAQTRITFAKQDEALSDLSNVLGQLKEMTIDMGSEIGRQTDALG  183

Query  852  NLDTDIDELNSRVKGANQRARHLLAK  929
            +++ D+ EL SRV+GAN+R R LL +
Sbjct  184  HVEDDVGELGSRVRGANERGRRLLGR  209



>ref|XP_002966868.1| hypothetical protein SELMODRAFT_86628 [Selaginella moellendorffii]
 gb|EFJ31467.1| hypothetical protein SELMODRAFT_86628 [Selaginella moellendorffii]
Length=253

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 138/206 (67%), Gaps = 4/206 (2%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE+YAV +AEETT +    L++AE+I++    T   LH+QG QI RTHE AV++D 
Sbjct  49   SVQELEDYAVQKAEETTVATYKALKLAEEIKESATNTSVMLHEQGHQITRTHETAVDIDH  108

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGL---NT  671
             LS+GEKLL +LGG+FS  WKPKK + ITGP  S+ D+  +   G  EQR  LGL   N+
Sbjct  109  ALSRGEKLLGSLGGLFSKTWKPKKARNITGPMLSRGDSFKRKAYGM-EQRAALGLNRSNS  167

Query  672  KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALD  851
            KGK+  T    +   +  +  +  AKQD+AL DLS++LG LK M  DMG+E+ +Q  AL 
Sbjct  168  KGKTRHTAAVADSSGSQAQTRITFAKQDEALSDLSNVLGQLKEMTIDMGSEIGRQTDALG  227

Query  852  NLDTDIDELNSRVKGANQRARHLLAK  929
            +L+ D+ EL SRV+GAN+R R LL +
Sbjct  228  HLEDDVGELGSRVRGANERGRRLLGR  253



>ref|NP_001137110.1| hypothetical protein [Zea mays]
 gb|ACF83278.1| unknown [Zea mays]
 tpg|DAA60389.1| TPA: hypothetical protein ZEAMMB73_307635 [Zea mays]
Length=295

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 130/179 (73%), Gaps = 16/179 (9%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE YA  +AEETT+    C+RIAE++R   +KTL T+H+QG+QIHRTH MAV++D+
Sbjct  82   SVQELEGYAAYKAEETTRRTRGCVRIAEEMRDTASKTLVTVHQQGQQIHRTHMMAVDIDQ  141

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTK-EQREKLGLNTKG  677
            DLS+ EKLL +LGG+FS  WKPKK   I GP  ++DD+    +KG+  EQR+KLGL    
Sbjct  142  DLSRSEKLLGDLGGLFSKKWKPKKNGAIRGPMLTRDDSFI--RKGSHLEQRQKLGL----  195

Query  678  KSAPTTPP-------NEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDK  833
              A   PP       +EP +A++KVE+EKAKQDD L DLS+IL +LKGMA DMG+E+++
Sbjct  196  --ADHPPPSNARQFRSEPSSALEKVEIEKAKQDDDLSDLSNILTELKGMAVDMGSEIER  252



>ref|XP_009136084.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Brassica rapa]
Length=306

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 134/194 (69%), Gaps = 7/194 (4%)
 Frame = +3

Query  312  DDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVE  491
            ++ +VQELE+YAV  ++ETTK+V  CL++A+ IR D  +TL  L+++GE+I RTH  AV+
Sbjct  114  ENQTVQELESYAVYMSDETTKTVQGCLKVAQGIRSDATRTLVMLNEEGEKITRTHHKAVD  173

Query  492  MDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNT  671
            +D DL++GEKLL +LGG+FS  WKPKKT+ ITGP  ++ ++  K +    E R+KLGLN 
Sbjct  174  LDHDLTQGEKLLGSLGGIFSRTWKPKKTRSITGPVITRGESP-KRRVNNLETRKKLGLNQ  232

Query  672  KGKSAPTTPPNEP----QNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQN  839
              K  P +  NEP     +A QK+EMEKAKQDD   DLSD+L +LK MA DMGTE+++ +
Sbjct  233  LPK--PDSRTNEPLPESADAYQKMEMEKAKQDDGFADLSDLLSELKNMAIDMGTEIERFS  290

Query  840  KALDNLDTDIDELN  881
                N  T I  ++
Sbjct  291  FISLNYCTYIFSMS  304



>ref|XP_002972466.1| hypothetical protein SELMODRAFT_36509, partial [Selaginella moellendorffii]
 gb|EFJ26552.1| hypothetical protein SELMODRAFT_36509, partial [Selaginella moellendorffii]
Length=199

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 129/203 (64%), Gaps = 4/203 (2%)
 Frame = +3

Query  315  DMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEM  494
            D  +QEL+  A+  ++ETT ++ +CLR+AE +R +  +T+  LH+QG+QI RTHE A+ +
Sbjct  1    DEDLQELQQQALGTSQETTSAIQSCLRVAEGMRHEATQTIVQLHEQGQQIRRTHESALVL  60

Query  495  DKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTK  674
            +++L+KGEKLL +LGG+FS PW+PK+ +E++GP     D +H       +++E    N  
Sbjct  61   EQELNKGEKLLASLGGIFSRPWRPKRGQELSGPL----DFHHVHAAAHPDRKEFFEGNGA  116

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
               + ++PP         V+ E+AKQD+AL  LS +L  LK M+  MG EL +QN++L  
Sbjct  117  APKSSSSPPQHASTFQSHVQDERAKQDEALSSLSSVLDQLKEMSATMGDELGRQNESLSR  176

Query  855  LDTDIDELNSRVKGANQRARHLL  923
            L  D+ EL  RVK ANQR   LL
Sbjct  177  LHGDVSELEFRVKNANQREHQLL  199



>ref|XP_007209588.1| hypothetical protein PRUPE_ppa011254mg [Prunus persica]
 gb|EMJ10787.1| hypothetical protein PRUPE_ppa011254mg [Prunus persica]
Length=217

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 112/145 (77%), Gaps = 4/145 (3%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ SV+ELENYAV +AEETTKSVN CL+IAE+IR+D  KTL TLH+QGEQI R+H +A 
Sbjct  75   VENQSVEELENYAVYKAEETTKSVNGCLKIAEEIREDATKTLVTLHQQGEQITRSHMVAA  134

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D+DLS+GEKLL +LGG+FS  WKPKKT+ I+GP  + D+   +G  G  E+REKLGL 
Sbjct  135  DIDQDLSRGEKLLGSLGGIFSKTWKPKKTRPISGPVITGDNAVRRG--GQLEEREKLGLT  192

Query  669  T--KGKSAPTTPPNEPQNAMQKVEM  737
            +  KG+S P T P  P NA+QKVE+
Sbjct  193  SAPKGRSTPQTLPPGPVNALQKVEV  217



>ref|XP_009129438.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Brassica rapa]
Length=383

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 133/190 (70%), Gaps = 7/190 (4%)
 Frame = +3

Query  312  DDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVE  491
            ++ +VQELE+YA+ +++ETTK+V  CL++A+ IR D  +TL  L+++GE+I RTH  AV+
Sbjct  191  ENQTVQELESYAMYKSDETTKTVQGCLKVAQGIRSDATRTLVMLNEEGEKITRTHHKAVD  250

Query  492  MDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNT  671
            +D DL++GEKLL +LGG+FS  WKPKKT+ ITGP  ++ ++  K +    E R+KLGLN 
Sbjct  251  LDHDLTRGEKLLGSLGGIFSRTWKPKKTRSITGPVITRGESP-KRRVNNLETRKKLGLNQ  309

Query  672  KGKSAPTTPPNEP----QNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQN  839
              K  P +  NEP     +A QK+EMEKAKQDD   DLSD+L +LK MA DMGTE+++ +
Sbjct  310  LPK--PDSRTNEPLPESADAYQKMEMEKAKQDDGFADLSDLLSELKNMAIDMGTEIERFS  367

Query  840  KALDNLDTDI  869
                N  T I
Sbjct  368  FISLNYCTYI  377



>emb|CBI15159.3| unnamed protein product [Vitis vinifera]
Length=152

 Score =   164 bits (415),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 111/151 (74%), Gaps = 3/151 (2%)
 Frame = +3

Query  483  AVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLG  662
            A ++D DLS+GEKLL +LGG+FS  WKP KT+ ITGP T++DD +++ K    EQREKLG
Sbjct  3    AADIDHDLSRGEKLLGSLGGIFSKTWKPIKTRPITGPITTRDDLSYR-KGSHMEQREKLG  61

Query  663  LNT--KGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQ  836
            L    KG+ A  TPP EP NA+QKVE+E AKQDD L DLS++L +LK MA DMGTE++  
Sbjct  62   LAPAPKGRLATRTPPPEPTNALQKVEVEHAKQDDTLSDLSNLLDELKYMAVDMGTEIESH  121

Query  837  NKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            N+AL  ++ D+D L+ R+K  NQRAR LL K
Sbjct  122  NRALAPMEDDVDVLSIRIKDGNQRARRLLGK  152



>ref|XP_001774080.1| Qb+Qc-SNARE, SNAP33-family [Physcomitrella patens]
 gb|EDQ61132.1| Qb+Qc-SNARE, SNAP33-family [Physcomitrella patens]
Length=269

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 138/209 (66%), Gaps = 5/209 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
            F + +V +LE +AV +++ET+ ++ NCLR+AED    G++TL +L  QG+QI RTH+ AV
Sbjct  64   FVNQAVADLEKHAVKKSQETSDTLRNCLRVAEDTMAVGSQTLISLVDQGDQITRTHDKAV  123

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++D+ LS+GEKLL +LGG FS  WKP KTK+ITGP   + + N+   K + E RE LGLN
Sbjct  124  DIDQHLSRGEKLLGSLGGFFSKSWKPTKTKKITGPMVGRVNQNN---KESAEDREALGLN  180

Query  669  --TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNK  842
               + K + +   ++ +    ++  E+  QDD LDDLS++L  +K M+ DM  E+++Q  
Sbjct  181  GTNEKKKSGSGSYHDKETFQGQINAERETQDDMLDDLSNVLSVMKEMSMDMNKEIERQAP  240

Query  843  ALDNLDTDIDELNSRVKGANQRARHLLAK  929
             +++L  D++ELN R + AN R + LL +
Sbjct  241  GIEHLREDVEELNRRTRDANIRGQRLLRR  269



>ref|XP_002984296.1| hypothetical protein SELMODRAFT_36511, partial [Selaginella moellendorffii]
 gb|EFJ14806.1| hypothetical protein SELMODRAFT_36511, partial [Selaginella moellendorffii]
Length=204

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 137/208 (66%), Gaps = 9/208 (4%)
 Frame = +3

Query  315  DMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEM  494
            D  +QEL+  A+  ++ETT ++ +CLR+AED+R +  +T+  LH+QG+QI RTHE A+ +
Sbjct  1    DEDLQELQQQALGTSQETTSAIQSCLRVAEDMRHEATQTIVQLHEQGQQIRRTHESALVL  60

Query  495  DKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKL---GL  665
            +++L+KGEKLL +LGG+FS PW+PK+ +E++GP     D +H       +++E     G+
Sbjct  61   EQELNKGEKLLASLGGIFSRPWRPKRGQELSGPL----DFHHVHAAAHPDRKEFFEGNGV  116

Query  666  NTKGKSAPTTPPNEPQNAMQKV--EMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQN  839
              K  S+P    +  Q+ +Q++  + E+AKQD+AL  LS +L  LK M++ MG EL +QN
Sbjct  117  APKSSSSPPQQASTFQSHVQRILGKDERAKQDEALSSLSSVLDQLKEMSSTMGDELGRQN  176

Query  840  KALDNLDTDIDELNSRVKGANQRARHLL  923
            ++L  L  D+ EL  RVK ANQR   LL
Sbjct  177  ESLGRLHGDVSELEFRVKNANQREHQLL  204



>emb|CDX73442.1| BnaC08g25610D [Brassica napus]
Length=207

 Score =   161 bits (407),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 123/190 (65%), Gaps = 14/190 (7%)
 Frame = +3

Query  312  DDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVE  491
            ++ +VQELE+YAV ++EETTK+V       + I            KQGE+I RTH  AV+
Sbjct  21   ENQTVQELESYAVYKSEETTKTVPGISSARDKISLSS--------KQGEKITRTHHKAVD  72

Query  492  MDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNT  671
            +D DL++GEKLL +LGG+FS  WKPKKT+ ITGP  +++  + K +    E REKLGLN 
Sbjct  73   IDHDLTRGEKLLGSLGGIFSRTWKPKKTRSITGPVITREGESPKRRVNNLETREKLGLNQ  132

Query  672  KGKSAPTTPPNEP----QNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQN  839
              K  P +  NEP     +A QK+EMEKAKQDD L DLSD+LG+LK MA DMGTE+++ +
Sbjct  133  LPK--PDSRTNEPLPESADAYQKIEMEKAKQDDGLADLSDLLGELKNMAIDMGTEIERFS  190

Query  840  KALDNLDTDI  869
                N  T I
Sbjct  191  FISLNYCTYI  200



>ref|XP_001778372.1| Qb+Qc-SNARE, SNAP33-family [Physcomitrella patens]
 gb|EDQ56823.1| Qb+Qc-SNARE, SNAP33-family [Physcomitrella patens]
Length=271

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 155/241 (64%), Gaps = 18/241 (7%)
 Frame = +3

Query  252  QSADEPPAARRTSSEP-----------NLNFDDMSVQELENYAVNQAEETTKSVNNCLRI  398
            Q+ADE      +SS+P           +  F + +V +LE +AV +++ETT ++ NCLR+
Sbjct  34   QTADEDELFSYSSSKPKPGYNNGGGEDSEEFVNQAVLDLEKHAVKKSQETTSTLKNCLRV  93

Query  399  AEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTK  578
            AED    GA+TL +LH+QG QI RTHE AV +D+ LS+GEKLL +LGG+FS  WKPKKTK
Sbjct  94   AEDTMGIGAQTLISLHEQGVQIERTHEKAVHIDQHLSRGEKLLGSLGGVFSKSWKPKKTK  153

Query  579  EITGPKTSKDDNNHKGKKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQ----KVEMEKA  746
            +ITGP   + +NN+  K+ + E RE LGLN  G  A  T  +  Q+  +    ++  E+ 
Sbjct  154  KITGPMVGRANNNNNNKE-SAEDREALGLN--GSQAKKTSGSGSQHDRETFQGQIAAERE  210

Query  747  KQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLLA  926
             QDD LDDLS++L  +K M+ DM TE+++Q   +++L  DI E+N+RVK AN R + LL 
Sbjct  211  TQDDMLDDLSNVLSQMKEMSMDMNTEIERQAPGIEHLHDDIQEVNARVKRANIRGQRLLR  270

Query  927  K  929
            +
Sbjct  271  R  271



>ref|XP_006376804.1| hypothetical protein POPTR_0012s06830g [Populus trichocarpa]
 gb|ERP54601.1| hypothetical protein POPTR_0012s06830g [Populus trichocarpa]
Length=249

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 105/145 (72%), Gaps = 3/145 (2%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++  VQELENYAV +AEETTK+VN CL+IAE++R+    TL TLH+QGEQI +TH +AV
Sbjct  98   LENQPVQELENYAVYKAEETTKAVNGCLKIAEEMREGATTTLITLHQQGEQITKTHSVAV  157

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            E+D DLS+GEKLL +LGGMFS  WKPKK + I GP  ++D +  + +    EQREKLGLN
Sbjct  158  EIDHDLSRGEKLLGSLGGMFSKTWKPKKNRAIRGPVITRDASPRR-RGNHLEQREKLGLN  216

Query  669  T--KGKSAPTTPPNEPQNAMQKVEM  737
               K +S+  TP  E  NA QKVE+
Sbjct  217  LAPKERSSTKTPLPETANAFQKVEV  241



>gb|KEH33106.1| soluble N-ethylmaleimide-sensitive factor adaptor protein [Medicago 
truncatula]
Length=260

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 102/141 (72%), Gaps = 3/141 (2%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SV++LE YAV +AEETTKSVNNC +IAE++R+D  KTL  LH QGEQI R+H++A  +D 
Sbjct  93   SVEDLEEYAVYKAEETTKSVNNCRKIAEEMREDATKTLVMLHHQGEQITRSHDIAAGIDH  152

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNT--K  674
            +LS+GEKLL +LGG+FS  WKPKKT  ITGP    DD   K      EQREKLGLN+  K
Sbjct  153  NLSRGEKLLGSLGGIFSKTWKPKKTGTITGPTIFGDDPVRKSANHL-EQREKLGLNSAPK  211

Query  675  GKSAPTTPPNEPQNAMQKVEM  737
            G+S P    +EP NA ++VE+
Sbjct  212  GQSKPRKALSEPTNAFERVEV  232



>ref|NP_001131677.1| hypothetical protein [Zea mays]
 gb|ACF80194.1| unknown [Zea mays]
 tpg|DAA44049.1| TPA: hypothetical protein ZEAMMB73_589554 [Zea mays]
Length=183

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 100/153 (65%), Gaps = 5/153 (3%)
 Frame = +3

Query  282  RTSSEPNLNFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQ  461
            R  S P +   + SVQELE+YA+ +A ETT  VN+C+R AE IR+D  +T+ TLH+QGEQ
Sbjct  31   RAQSVP-VRRTNQSVQELEDYAITKARETTHKVNDCVRAAEAIREDATQTMLTLHRQGEQ  89

Query  462  IHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGT-  638
            I R+H++A ++++DL+  EKLL +LGG+FS  W+PK+  +I GP +    NN+       
Sbjct  90   IMRSHQVAADIEQDLTVSEKLLGSLGGLFSKSWRPKRNHQIKGPVSG---NNYSATTAND  146

Query  639  KEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEM  737
             EQR KLG+    +  P+     P +AM+KV++
Sbjct  147  TEQRGKLGIAPARQEYPSHVQTTPVSAMEKVQV  179



>tpg|DAA44048.1| TPA: hypothetical protein ZEAMMB73_589554 [Zea mays]
Length=140

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  321  SVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            SVQELE+YA+ +A ETT  VN+C+R AE IR+D  +T+ TLH+QGEQI R+H++A ++++
Sbjct  43   SVQELEDYAITKARETTHKVNDCVRAAEAIREDATQTMLTLHRQGEQIMRSHQVAADIEQ  102

Query  501  DLSKGEKLLNNLGGMFSMPWKPKKTKEITGP  593
            DL+  EKLL +LGG+FS  W+PK+  +I GP
Sbjct  103  DLTVSEKLLGSLGGLFSKSWRPKRNHQIKGP  133



>ref|XP_004155053.1| PREDICTED: SNAP25 homologous protein SNAP33-like [Cucumis sativus]
Length=110

 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = +3

Query  642  EQREKLGLNTKGKSAPTTPPN-EPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMG  818
            EQREKLGL+       +  P+ EP N++QKVE+EK KQDDAL DLS+ILG+LK MA DMG
Sbjct  14   EQREKLGLSRAPNPRSSRAPHPEPTNSLQKVEVEKVKQDDALSDLSNILGELKEMAVDMG  73

Query  819  TELDKQNKALDNLDTDIDELNSRVKGANQRARHLLAK  929
            +ELDKQNKALD+L  D +E+  RV  ANQRARHLL K
Sbjct  74   SELDKQNKALDHLFDDANEVTIRVDNANQRARHLLRK  110



>ref|XP_004172346.1| PREDICTED: SNAP25 homologous protein SNAP33-like, partial [Cucumis 
sativus]
Length=183

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             ++ +V+ELE+YAV +AEETT SVNNCL+IAEDIR+D  KTL  LH+QGEQI RTH +  
Sbjct  101  IENQTVEELESYAVYKAEETTNSVNNCLKIAEDIREDATKTLVALHQQGEQITRTHVVTA  160

Query  489  EMDKDLSKGEKLLNNLGGMFS  551
            ++D DLS+GEKLL +LGG+FS
Sbjct  161  DIDNDLSRGEKLLGSLGGIFS  181



>gb|AAP79419.1| SNAP25-like protein C [Hordeum vulgare subsp. vulgare]
Length=101

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 76/104 (73%), Gaps = 3/104 (3%)
 Frame = +3

Query  564  PKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEK  743
            PKKTK+I GP  S+DD+  K K    EQR+KLGL+ +GK   T    E   AM KV++EK
Sbjct  1    PKKTKKIKGP-VSRDDS-FKKKVNRMEQRDKLGLSPRGK-GNTREYGEAGTAMDKVQLEK  57

Query  744  AKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDE  875
             KQDDALDDLS +LG L+GMA DMG+ELD+QNKALD++  D++E
Sbjct  58   KKQDDALDDLSGVLGQLQGMAVDMGSELDRQNKALDDMHGDVEE  101



>ref|XP_009148798.1| PREDICTED: putative SNAP25 homologous protein SNAP30 [Brassica 
rapa]
Length=128

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  696  PPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDE  875
            P N+  +  Q  E +   QDD L DLSDILGDLKGMA D G+ELDKQNKALD+LD DIDE
Sbjct  51   PTNKRFSESQAREGKARVQDDGLSDLSDILGDLKGMAIDTGSELDKQNKALDHLDHDIDE  110

Query  876  LNSRVKGANQRARHLLAK  929
            LNSRVKGANQRA  LL+K
Sbjct  111  LNSRVKGANQRAYQLLSK  128



>ref|XP_002107867.1| SNAP25.2 [Trichoplax adhaerens]
 gb|EDV28665.1| SNAP25.2 [Trichoplax adhaerens]
Length=222

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 73/231 (32%), Positives = 112/231 (48%), Gaps = 36/231 (16%)
 Frame = +3

Query  303  LNFDDMSVQELE------------NYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLH  446
            +N DD ++ E E            N   N++ ++T+ +   L IAE+    G KTLETL+
Sbjct  1    MNIDDTTISEAEMKRQLEDMKERGNKITNESLDSTRRI---LVIAEETHGIGTKTLETLN  57

Query  447  KQGEQIHRTHEMAVEMDKDLSKGEKLLNNL---GGMFSMPWK-------PKKTKEITGPK  596
             QGEQI R  +   +++ D+ + EK L NL    G+   PWK        K  K + GP+
Sbjct  58   TQGEQIDRIEQNMEQINADMHEAEKNLTNLEKCCGLCVCPWKRTENFEKSKDFKRVWGPQ  117

Query  597  TSKDDNNHKGKKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKV--EMEKAKQDDALDD  770
              +  N     + T   R          ++P     +  N +Q+V  ++ + + D  L  
Sbjct  118  NDEVVNYQPVLQSTLTYR---------NTSPNKFMLQNGNYIQRVTNDIREDEMDSNLRQ  168

Query  771  LSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
            +  ++ DLK MA DMG ELDKQNK L  +   +D  + RV GAN RA+ +L
Sbjct  169  VGGLVSDLKSMAVDMGKELDKQNKQLFAMSEKVDMTSDRVDGANVRAKRIL  219



>ref|XP_007244732.1| PREDICTED: synaptosomal-associated protein 23-like isoform X1 
[Astyanax mexicanus]
Length=236

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 68/228 (30%), Positives = 114/228 (50%), Gaps = 8/228 (4%)
 Frame = +3

Query  264  EPPAARRTSSEPNLNFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETL  443
            E  AA +++       +DMSV+E+   A    +E+ +S    L++AE+ ++ G KT+E L
Sbjct  9    ELSAAGKSAKIDTSKMEDMSVEEITMRANQVTDESLESTRRMLQMAEESKETGTKTMEML  68

Query  444  HKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLG---GMFSMPWKPKKTKEITGPK-----T  599
             +QGEQ+ R  +   +++KD+   EK L +L    G+   P    ++ E  G       T
Sbjct  69   DQQGEQLKRVEQGMDQINKDMKAAEKNLTDLSKCCGLCVCPCDRVRSIENDGRYKRTWGT  128

Query  600  SKDDNNHKGKKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSD  779
              D+ + +G +G     +  G      + P +    P       +  + + ++ LD +  
Sbjct  129  GSDNASIEGGEGGVVSSQPTGARNGQAAGPVSSSGGPYIKRITNDAREDEMEENLDQVGS  188

Query  780  ILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
            I+G+LK MA DMG E+DKQNK +D +    D   +R+  ANQRA  LL
Sbjct  189  IIGNLKSMALDMGNEIDKQNKTVDRIIDKADMNKARIDEANQRANKLL  236



>ref|XP_007244733.1| PREDICTED: synaptosomal-associated protein 23-like isoform X2 
[Astyanax mexicanus]
Length=213

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/213 (31%), Positives = 108/213 (51%), Gaps = 8/213 (4%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             +DMSV+E+   A    +E+ +S    L++AE+ ++ G KT+E L +QGEQ+ R  +   
Sbjct  1    MEDMSVEEITMRANQVTDESLESTRRMLQMAEESKETGTKTMEMLDQQGEQLKRVEQGMD  60

Query  489  EMDKDLSKGEKLLNNLG---GMFSMPWKPKKTKEITGPK-----TSKDDNNHKGKKGTKE  644
            +++KD+   EK L +L    G+   P    ++ E  G       T  D+ + +G +G   
Sbjct  61   QINKDMKAAEKNLTDLSKCCGLCVCPCDRVRSIENDGRYKRTWGTGSDNASIEGGEGGVV  120

Query  645  QREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTE  824
              +  G      + P +    P       +  + + ++ LD +  I+G+LK MA DMG E
Sbjct  121  SSQPTGARNGQAAGPVSSSGGPYIKRITNDAREDEMEENLDQVGSIIGNLKSMALDMGNE  180

Query  825  LDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
            +DKQNK +D +    D   +R+  ANQRA  LL
Sbjct  181  IDKQNKTVDRIIDKADMNKARIDEANQRANKLL  213



>gb|KFK25932.1| hypothetical protein AALP_AA8G181900 [Arabis alpina]
Length=604

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 63/91 (69%), Gaps = 1/91 (1%)
 Frame = +3

Query  387  CLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMFSMPWKP  566
            C ++AED+R +  +TL  L+ QGE++ RTH  AV+++++LS+GEK+L  LGG+FS  WKP
Sbjct  106  CFKVAEDMRSNATRTLVKLNDQGEKLTRTHYKAVDINRNLSRGEKILGRLGGIFSRTWKP  165

Query  567  KKTKEITGPKTSKDDNNHKGKKGTKEQREKL  659
            KKT+ I G   ++ + + K +    E REKL
Sbjct  166  KKTRSIIGLVITRGE-SPKRRVNHLESREKL  195



>ref|XP_009066358.1| hypothetical protein LOTGIDRAFT_197810 [Lottia gigantea]
 gb|ESO82990.1| hypothetical protein LOTGIDRAFT_197810 [Lottia gigantea]
Length=204

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 102/205 (50%), Gaps = 9/205 (4%)
 Frame = +3

Query  324  VQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKD  503
            +QEL+  A    +E+ +S    L++ E+ ++ G KTL  L +QGEQ+ R  E   ++++D
Sbjct  5    LQELQMQANLATDESLESTRRMLQMCEESKEAGIKTLVMLDEQGEQLDRIDEGMDQINQD  64

Query  504  LSKGEKLLNNL---GGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTK  674
            +   EK L  +    G+  +PWK  K  E           N  G+      R  +  +  
Sbjct  65   MRDAEKNLEGMEKCCGLCVLPWKRAKNFEKGSDYNKTWKANEDGQVNANGPRITVD-SGN  123

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
            G    +       N  ++ EME     D L ++S ++G+L+ MA DMG+E+  QN+ +D 
Sbjct  124  GAVMSSGFITRVTNDARETEME-----DNLTEVSGMIGNLRNMAIDMGSEIGSQNRQIDR  178

Query  855  LDTDIDELNSRVKGANQRARHLLAK  929
            ++   D LN RV GAN RA  ++ K
Sbjct  179  INQKADSLNVRVDGANTRANRIMRK  203



>ref|XP_010895574.1| PREDICTED: synaptosomal-associated protein 23 isoform X2 [Esox 
lucius]
Length=243

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 69/223 (31%), Positives = 108/223 (48%), Gaps = 21/223 (9%)
 Frame = +3

Query  306  NFD-----DMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHR  470
            NFD     DMSV+E+   A    +E+ +S    L++A++    GAKT E LH+QGEQ+ R
Sbjct  24   NFDSSKMADMSVEEITLRANQVTDESLESTRRMLQMAQESSDTGAKTTEMLHQQGEQLKR  83

Query  471  THEMAVEMDKDLSKGEKLLNNLG---GMFSMPWKPKKTKE------ITGPKTSKDDNNHK  623
            T +   ++++D+ + EK L +L    G+   P     + E       T            
Sbjct  84   TEQGMDQINQDMRQAEKNLTDLSKCCGLCVCPCDRVTSIEHDSKYKRTWGTGDSGSTGGD  143

Query  624  GKKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDA---LDDLSDILGDL  794
            G   T   R+  G+    ++ P     +P     K     A++D+    LD +  I+G+L
Sbjct  144  GMDSTVVSRQPTGV----QNGPQANQQQPSGPYIKRITNDAREDEMEENLDQVGSIIGNL  199

Query  795  KGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
            K MA DMG+E+DKQN  +D + T  D   +R+  ANQ A  L+
Sbjct  200  KNMAIDMGSEIDKQNHHIDRITTKADMNKARIDEANQWANKLI  242



>ref|XP_004540251.1| PREDICTED: synaptosomal-associated protein 23-like isoform X2 
[Maylandia zebra]
 ref|XP_005736640.1| PREDICTED: synaptosomal-associated protein 23-like isoform X2 
[Pundamilia nyererei]
 ref|XP_005926078.1| PREDICTED: synaptosomal-associated protein 23-like isoform X2 
[Haplochromis burtoni]
Length=235

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 111/219 (51%), Gaps = 17/219 (8%)
 Frame = +3

Query  306  NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMA  485
            N DDM+V+++   A    +E+ +S    L++AE+ +Q G  T+  L +QGEQ+ R     
Sbjct  20   NMDDMTVEQMAIRANQVTDESLESTRRMLQMAEESKQTGVNTVVMLDQQGEQLSRVERGM  79

Query  486  VEMDKDLSKGEKLLNNLGGMFSMPWKP----------KKTKEITGPKTSKDDNNHKGKKG  635
             ++++D+ + EK L +L     +   P           + K   G   ++ +N+  G K 
Sbjct  80   DQINQDMRQAEKNLTDLSKCCGICVCPCDRVSSIENDSRYKRTWGTGGTEGENDADGSKV  139

Query  636  TKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDA---LDDLSDILGDLKGMA  806
              +Q   +  N +        P+ P   +Q++    A++D+    L+ +  I+G+LK +A
Sbjct  140  VSKQPSGV-RNGQAAQVNAAGPSGP--YIQRI-TNDAREDEMEENLEAVGSIIGNLKSLA  195

Query  807  TDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
             DMG+E+DKQNK +D ++   D    R+  ANQRA  L+
Sbjct  196  VDMGSEIDKQNKQIDRINDKADMNKLRIDEANQRANKLI  234



>ref|XP_006810171.1| PREDICTED: synaptosomal-associated protein 23-like isoform X2 
[Neolamprologus brichardi]
Length=235

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/222 (29%), Positives = 109/222 (49%), Gaps = 23/222 (10%)
 Frame = +3

Query  306  NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMA  485
            N DDM+V+++   A    +E+ +S    L++AE+ +Q G  T+  L +QGEQ+ R     
Sbjct  20   NMDDMTVEQMAIRANQVTDESLESTRRMLQMAEESKQTGVNTVVMLDQQGEQLSRVERGM  79

Query  486  VEMDKDLSKGEKLLNNLGGMFSMPWKP----------KKTKEITGPKTSKDDNNHKGKKG  635
             ++++D+ + EK L +L     +   P           + K   G   ++ +N+  G K 
Sbjct  80   DQINQDMRQAEKNLTDLSKCCGICVCPCDRVSSIENDSRYKRTWGTGGTEGENDADGSKV  139

Query  636  TKEQ------REKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLK  797
               Q       + + +N  G S P        N  ++ EME     + L+ +  I+G+LK
Sbjct  140  VSMQPSGVRNGQAVQVNAAGPSGPYI--QRITNDAREDEME-----ENLEAVGSIIGNLK  192

Query  798  GMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
             +A DMG+E+DKQNK +D ++   D    R+  ANQRA  L+
Sbjct  193  NLAVDMGSEIDKQNKQIDRINDKADMNKLRIDEANQRANKLI  234



>ref|XP_004540250.1| PREDICTED: synaptosomal-associated protein 23-like isoform X1 
[Maylandia zebra]
 ref|XP_005736639.1| PREDICTED: synaptosomal-associated protein 23-like isoform X1 
[Pundamilia nyererei]
 ref|XP_005926077.1| PREDICTED: synaptosomal-associated protein 23-like isoform X1 
[Haplochromis burtoni]
Length=237

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 111/219 (51%), Gaps = 17/219 (8%)
 Frame = +3

Query  306  NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMA  485
            N DDM+V+++   A    +E+ +S    L++AE+ +Q G  T+  L +QGEQ+ R     
Sbjct  22   NMDDMTVEQMAIRANQVTDESLESTRRMLQMAEESKQTGVNTVVMLDQQGEQLSRVERGM  81

Query  486  VEMDKDLSKGEKLLNNLGGMFSMPWKP----------KKTKEITGPKTSKDDNNHKGKKG  635
             ++++D+ + EK L +L     +   P           + K   G   ++ +N+  G K 
Sbjct  82   DQINQDMRQAEKNLTDLSKCCGICVCPCDRVSSIENDSRYKRTWGTGGTEGENDADGSKV  141

Query  636  TKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDA---LDDLSDILGDLKGMA  806
              +Q   +  N +        P+ P   +Q++    A++D+    L+ +  I+G+LK +A
Sbjct  142  VSKQPSGV-RNGQAAQVNAAGPSGP--YIQRI-TNDAREDEMEENLEAVGSIIGNLKSLA  197

Query  807  TDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
             DMG+E+DKQNK +D ++   D    R+  ANQRA  L+
Sbjct  198  VDMGSEIDKQNKQIDRINDKADMNKLRIDEANQRANKLI  236



>ref|XP_006810170.1| PREDICTED: synaptosomal-associated protein 23-like isoform X1 
[Neolamprologus brichardi]
Length=237

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 64/222 (29%), Positives = 109/222 (49%), Gaps = 23/222 (10%)
 Frame = +3

Query  306  NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMA  485
            N DDM+V+++   A    +E+ +S    L++AE+ +Q G  T+  L +QGEQ+ R     
Sbjct  22   NMDDMTVEQMAIRANQVTDESLESTRRMLQMAEESKQTGVNTVVMLDQQGEQLSRVERGM  81

Query  486  VEMDKDLSKGEKLLNNLGGMFSMPWKP----------KKTKEITGPKTSKDDNNHKGKKG  635
             ++++D+ + EK L +L     +   P           + K   G   ++ +N+  G K 
Sbjct  82   DQINQDMRQAEKNLTDLSKCCGICVCPCDRVSSIENDSRYKRTWGTGGTEGENDADGSKV  141

Query  636  TKEQ------REKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLK  797
               Q       + + +N  G S P        N  ++ EME     + L+ +  I+G+LK
Sbjct  142  VSMQPSGVRNGQAVQVNAAGPSGPYI--QRITNDAREDEME-----ENLEAVGSIIGNLK  194

Query  798  GMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
             +A DMG+E+DKQNK +D ++   D    R+  ANQRA  L+
Sbjct  195  NLAVDMGSEIDKQNKQIDRINDKADMNKLRIDEANQRANKLI  236



>ref|XP_005158781.1| PREDICTED: synaptosomal-associated protein 23 isoform X2 [Danio 
rerio]
 ref|XP_005158782.1| PREDICTED: synaptosomal-associated protein 23 isoform X2 [Danio 
rerio]
Length=237

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 117/227 (52%), Gaps = 16/227 (7%)
 Frame = +3

Query  285  TSSEPNLN---FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQG  455
            T  E NL+     DM+V+++   A    +E+ +S    L++AE+ R+ G KT+  L +QG
Sbjct  13   TGGEANLDTSKMADMTVEDITMRANQVTDESLESTRRMLQMAEESRETGVKTMTMLDEQG  72

Query  456  EQIHRTHEMAVEMDKDLSKGEKLLNNLG---GMFSMPWKPKKTKEITGPK-----TSKDD  611
            EQ+ R  +   ++++D+ + EK L +L    G+   P +   + E  G       T  D+
Sbjct  73   EQLRRVDQGMDQINQDMRQAEKNLTDLSKCCGLCVCPCERVTSIEHDGRYKRTWGTGSDN  132

Query  612  NNHKGKKGTKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDA---LDDLSDI  782
            ++ +GK+G     +   +   G++            ++++    A++D+    LD +  I
Sbjct  133  SSTEGKEGGVVSSQPTAVR-NGQAVSGGSSGASGPYIKRI-TNDAREDEMEENLDQVGSI  190

Query  783  LGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
            +G+LK +A DMG E+DKQNK +D +    D   +R+  ANQRA  LL
Sbjct  191  IGNLKNLALDMGNEIDKQNKTIDRITDKADMNKARIDEANQRANKLL  237



>ref|XP_010895573.1| PREDICTED: synaptosomal-associated protein 23 isoform X1 [Esox 
lucius]
 ref|XP_010895575.1| PREDICTED: synaptosomal-associated protein 23 isoform X1 [Esox 
lucius]
Length=214

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 66/215 (31%), Positives = 105/215 (49%), Gaps = 16/215 (7%)
 Frame = +3

Query  315  DMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEM  494
            DMSV+E+   A    +E+ +S    L++A++    GAKT E LH+QGEQ+ RT +   ++
Sbjct  3    DMSVEEITLRANQVTDESLESTRRMLQMAQESSDTGAKTTEMLHQQGEQLKRTEQGMDQI  62

Query  495  DKDLSKGEKLLNNLG---GMFSMPWKPKKTKE------ITGPKTSKDDNNHKGKKGTKEQ  647
            ++D+ + EK L +L    G+   P     + E       T            G   T   
Sbjct  63   NQDMRQAEKNLTDLSKCCGLCVCPCDRVTSIEHDSKYKRTWGTGDSGSTGGDGMDSTVVS  122

Query  648  REKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDA---LDDLSDILGDLKGMATDMG  818
            R+  G+    ++ P     +P     K     A++D+    LD +  I+G+LK MA DMG
Sbjct  123  RQPTGV----QNGPQANQQQPSGPYIKRITNDAREDEMEENLDQVGSIIGNLKNMAIDMG  178

Query  819  TELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
            +E+DKQN  +D + T  D   +R+  ANQ A  L+
Sbjct  179  SEIDKQNHHIDRITTKADMNKARIDEANQWANKLI  213



>ref|XP_001994750.1| GH14348 [Drosophila grimshawi]
 gb|EDV91379.1| GH14348 [Drosophila grimshawi]
Length=211

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 60/203 (30%), Positives = 108/203 (53%), Gaps = 8/203 (4%)
 Frame = +3

Query  324  VQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKD  503
            +QEL+  +   A+E+ +S    L + ++ ++ G +TL  L  QGEQ+ R  E    ++ D
Sbjct  12   LQELQLKSAQVADESLESTRRMLGLMDESKEAGIRTLVALDDQGEQLDRIEEGMDRINAD  71

Query  504  LSKGEKLLNNL---GGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTK  674
            + + EK L+ +    G+  +PWK    K+  G    K +++ K    ++ QR    ++ +
Sbjct  72   MREAEKNLSGMEKCCGVCVLPWKKVNIKD-DGDNAWKANDDGK-VVASQPQRV---VDER  126

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
             +     PP     A    +  + + D+ L  ++ +LG+L+ MA DMG+EL+ QNK +D 
Sbjct  127  ERGGMGAPPQSGYVARITNDAREDEMDENLGQVNSMLGNLRNMALDMGSELENQNKQVDR  186

Query  855  LDTDIDELNSRVKGANQRARHLL  923
            ++   D  N+R+ G N+RA HLL
Sbjct  187  INAKGDANNTRMDGVNKRANHLL  209



>ref|XP_005477352.1| PREDICTED: synaptosomal-associated protein 23-like isoform X3 
[Oreochromis niloticus]
Length=235

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 110/219 (50%), Gaps = 17/219 (8%)
 Frame = +3

Query  306  NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMA  485
            N DDM+V+++   A    +E+ +S    L++AE+ +Q G  T+  L +QGEQ+ R     
Sbjct  20   NMDDMTVEQMAIRANQVTDESLESTRRMLQMAEESKQTGVNTVVMLDQQGEQLSRVERGM  79

Query  486  VEMDKDLSKGEKLLNNLGGMFSMPWKP----------KKTKEITGPKTSKDDNNHKGKKG  635
             ++++D+ + EK L +L     +   P           + K   G   ++ +N+  G K 
Sbjct  80   DQINQDMRQAEKNLTDLSKCCGICVCPCDRVSSIENDSRYKRTWGTGGTEGENDADGPKV  139

Query  636  TKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDA---LDDLSDILGDLKGMA  806
               Q   +  N +        P+ P   +Q++    A++D+    L+ +  I+G+LK +A
Sbjct  140  VSTQPSGV-RNGQAAQVNAAGPSGP--YIQRI-TNDAREDEMEENLEAVGSIIGNLKNLA  195

Query  807  TDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
             DMG+E+DKQNK +D ++   D    R+  ANQRA  L+
Sbjct  196  VDMGSEIDKQNKQIDRINDKADMNKLRIDEANQRANKLI  234



>ref|XP_005477351.1| PREDICTED: synaptosomal-associated protein 23-like isoform X2 
[Oreochromis niloticus]
Length=237

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 110/219 (50%), Gaps = 17/219 (8%)
 Frame = +3

Query  306  NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMA  485
            N DDM+V+++   A    +E+ +S    L++AE+ +Q G  T+  L +QGEQ+ R     
Sbjct  22   NMDDMTVEQMAIRANQVTDESLESTRRMLQMAEESKQTGVNTVVMLDQQGEQLSRVERGM  81

Query  486  VEMDKDLSKGEKLLNNLGGMFSMPWKP----------KKTKEITGPKTSKDDNNHKGKKG  635
             ++++D+ + EK L +L     +   P           + K   G   ++ +N+  G K 
Sbjct  82   DQINQDMRQAEKNLTDLSKCCGICVCPCDRVSSIENDSRYKRTWGTGGTEGENDADGPKV  141

Query  636  TKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDA---LDDLSDILGDLKGMA  806
               Q   +  N +        P+ P   +Q++    A++D+    L+ +  I+G+LK +A
Sbjct  142  VSTQPSGV-RNGQAAQVNAAGPSGP--YIQRI-TNDAREDEMEENLEAVGSIIGNLKNLA  197

Query  807  TDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
             DMG+E+DKQNK +D ++   D    R+  ANQRA  L+
Sbjct  198  VDMGSEIDKQNKQIDRINDKADMNKLRIDEANQRANKLI  236



>gb|EKC25321.1| Synaptosomal-associated protein 25 [Crassostrea gigas]
Length=217

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/200 (33%), Positives = 99/200 (50%), Gaps = 15/200 (8%)
 Frame = +3

Query  333  LENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSK  512
            L+N  V   E T + +N C    E+ +  G KT+  L +QGEQ+ R  E   ++++D+  
Sbjct  27   LDNANVESLESTRRMLNMC----EESQDVGIKTIVMLDQQGEQLDRIEEGMDQINQDMRD  82

Query  513  GEKLLNNL---GGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKGKS  683
             EK L  L    G+  +PWK  K  E  G        +  GK  T   R  +G N  G  
Sbjct  83   AEKNLEGLEKCCGLCVLPWKRAKNFERGGDYDKTWKASEDGKVNTNGPRVIVGENA-GPQ  141

Query  684  APTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDT  863
             P        N  ++ EME     + L  +S +LG+L+ MA DMG+E++ QN+ +D ++ 
Sbjct  142  GPIIT--RITNDAREDEME-----ENLTQVSGMLGNLRNMAIDMGSEIESQNRQVDRINN  194

Query  864  DIDELNSRVKGANQRARHLL  923
                  SR++ ANQRAR +L
Sbjct  195  KTQSNESRIQEANQRARKIL  214



>ref|NP_956484.1| synaptosomal-associated protein 23 [Danio rerio]
 ref|XP_005158784.1| PREDICTED: synaptosomal-associated protein 23 isoform X1 [Danio 
rerio]
 gb|AAH45896.1| Zgc:56072 [Danio rerio]
 gb|AAI65419.1| Zgc:56072 protein [Danio rerio]
Length=214

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/214 (29%), Positives = 112/214 (52%), Gaps = 13/214 (6%)
 Frame = +3

Query  315  DMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEM  494
            DM+V+++   A    +E+ +S    L++AE+ R+ G KT+  L +QGEQ+ R  +   ++
Sbjct  3    DMTVEDITMRANQVTDESLESTRRMLQMAEESRETGVKTMTMLDEQGEQLRRVDQGMDQI  62

Query  495  DKDLSKGEKLLNNLG---GMFSMPWKPKKTKEITGPK-----TSKDDNNHKGKKGTKEQR  650
            ++D+ + EK L +L    G+   P +   + E  G       T  D+++ +GK+G     
Sbjct  63   NQDMRQAEKNLTDLSKCCGLCVCPCERVTSIEHDGRYKRTWGTGSDNSSTEGKEGGVVSS  122

Query  651  EKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDA---LDDLSDILGDLKGMATDMGT  821
            +   +   G++            ++++    A++D+    LD +  I+G+LK +A DMG 
Sbjct  123  QPTAVR-NGQAVSGGSSGASGPYIKRI-TNDAREDEMEENLDQVGSIIGNLKNLALDMGN  180

Query  822  ELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
            E+DKQNK +D +    D   +R+  ANQRA  LL
Sbjct  181  EIDKQNKTIDRITDKADMNKARIDEANQRANKLL  214



>ref|XP_005175414.1| PREDICTED: synaptosomal-associated protein 25-like [Musca domestica]
Length=211

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 105/203 (52%), Gaps = 8/203 (4%)
 Frame = +3

Query  324  VQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKD  503
            +Q+L+  A   A+E+ +S    L   E+ ++ G +TL  L  QGEQ+ R  E    ++ D
Sbjct  12   LQDLQMKATQVADESVESTRRMLAYMEESKEAGIRTLVALDDQGEQLDRIEEGMDRINAD  71

Query  504  LSKGEKLLNNL---GGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTK  674
            + + EK L+ +    G+  +PWK    K+       K+D+     K    Q +++ ++ +
Sbjct  72   MKEAEKNLSGMEKCCGICVLPWKKVSIKDDADNAWKKNDDG----KIVNNQPQRV-IDER  126

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
             +     PP     A    +  + + D+ L  ++ +LG+L+ MA DMG+EL+ QN  +D 
Sbjct  127  ERGGMGQPPQTGYIARITNDAREDEMDENLGQVNAMLGNLRNMALDMGSELENQNIQIDR  186

Query  855  LDTDIDELNSRVKGANQRARHLL  923
            ++   D  N+R+ G NQRA +LL
Sbjct  187  INAKGDANNARMSGVNQRANNLL  209



>ref|XP_004540252.1| PREDICTED: synaptosomal-associated protein 23-like isoform X3 
[Maylandia zebra]
 ref|XP_005736641.1| PREDICTED: synaptosomal-associated protein 23-like isoform X3 
[Pundamilia nyererei]
 ref|XP_005926079.1| PREDICTED: synaptosomal-associated protein 23-like isoform X3 
[Haplochromis burtoni]
 ref|XP_005926080.1| PREDICTED: synaptosomal-associated protein 23-like isoform X4 
[Haplochromis burtoni]
Length=215

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/218 (28%), Positives = 110/218 (50%), Gaps = 17/218 (8%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             DDM+V+++   A    +E+ +S    L++AE+ +Q G  T+  L +QGEQ+ R      
Sbjct  1    MDDMTVEQMAIRANQVTDESLESTRRMLQMAEESKQTGVNTVVMLDQQGEQLSRVERGMD  60

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKP----------KKTKEITGPKTSKDDNNHKGKKGT  638
            ++++D+ + EK L +L     +   P           + K   G   ++ +N+  G K  
Sbjct  61   QINQDMRQAEKNLTDLSKCCGICVCPCDRVSSIENDSRYKRTWGTGGTEGENDADGSKVV  120

Query  639  KEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDA---LDDLSDILGDLKGMAT  809
             +Q   +  N +        P+ P   +Q++    A++D+    L+ +  I+G+LK +A 
Sbjct  121  SKQPSGV-RNGQAAQVNAAGPSGP--YIQRI-TNDAREDEMEENLEAVGSIIGNLKSLAV  176

Query  810  DMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
            DMG+E+DKQNK +D ++   D    R+  ANQRA  L+
Sbjct  177  DMGSEIDKQNKQIDRINDKADMNKLRIDEANQRANKLI  214



>ref|XP_006810172.1| PREDICTED: synaptosomal-associated protein 23-like isoform X3 
[Neolamprologus brichardi]
Length=215

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/221 (29%), Positives = 108/221 (49%), Gaps = 23/221 (10%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             DDM+V+++   A    +E+ +S    L++AE+ +Q G  T+  L +QGEQ+ R      
Sbjct  1    MDDMTVEQMAIRANQVTDESLESTRRMLQMAEESKQTGVNTVVMLDQQGEQLSRVERGMD  60

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKP----------KKTKEITGPKTSKDDNNHKGKKGT  638
            ++++D+ + EK L +L     +   P           + K   G   ++ +N+  G K  
Sbjct  61   QINQDMRQAEKNLTDLSKCCGICVCPCDRVSSIENDSRYKRTWGTGGTEGENDADGSKVV  120

Query  639  KEQ------REKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKG  800
              Q       + + +N  G S P        N  ++ EME     + L+ +  I+G+LK 
Sbjct  121  SMQPSGVRNGQAVQVNAAGPSGPYIQ--RITNDAREDEME-----ENLEAVGSIIGNLKN  173

Query  801  MATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
            +A DMG+E+DKQNK +D ++   D    R+  ANQRA  L+
Sbjct  174  LAVDMGSEIDKQNKQIDRINDKADMNKLRIDEANQRANKLI  214



>emb|CDQ81912.1| unnamed protein product [Oncorhynchus mykiss]
Length=214

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 106/220 (48%), Gaps = 22/220 (10%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
              DMS +E+   A    +E+ +     L++AE+ R+ G  T++ L +QGEQ+ RT +   
Sbjct  1    MSDMSAEEITVRANQVTDESLECTRRMLQMAEETRETGVNTIDMLDQQGEQLRRTEKGMD  60

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            ++++D+ K EK L +L     +   P         + +  +++ K K+      +  G  
Sbjct  61   QINEDMRKAEKNLTDLSKCCGLCVCP-------CDRVTSIEHDSKYKRTWGTGDDGTGEG  113

Query  669  TKGKSAPTTPP---NEPQNAMQ---------KVEMEKAKQDDA---LDDLSDILGDLKGM  803
              G      PP   N   N  Q         K     A++D+    LD +  I+G+LK M
Sbjct  114  GDGSVVSRQPPGIHNGKANQQQPMGGSGPYIKRITNDAREDEMEENLDQVGSIIGNLKNM  173

Query  804  ATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
            A+DMG+ELDKQNK +D +    D   +R+  ANQRA  LL
Sbjct  174  ASDMGSELDKQNKHIDCITEKADRNKARIDEANQRANKLL  213



>ref|XP_002000068.1| GI24884 [Drosophila mojavensis]
 gb|EDW15529.1| GI24884 [Drosophila mojavensis]
Length=212

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 106/203 (52%), Gaps = 8/203 (4%)
 Frame = +3

Query  324  VQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKD  503
            +QEL+  +   A+E+ +S    L + ++ ++ G +TL  L  QGEQ+ R  E    ++ D
Sbjct  13   LQELQLKSAQVADESLESTRRMLSLMDESKEAGIRTLVALDDQGEQLDRIEEGMDRINAD  72

Query  504  LSKGEKLLNNL---GGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTK  674
            + + EK L+ +    G+  +PWK    K+ +      +D+     K    Q +++ ++ +
Sbjct  73   MREAEKNLSGMEKCCGICVLPWKKVNIKDDSDSAWKANDDG----KVVASQPQRV-IDER  127

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
             +     PP     A    +  + + D+ L  ++ +LG+L+ MA DMG+EL+ QNK +D 
Sbjct  128  ERGGMGAPPQSGYIARITNDAREDEMDENLGQVNSMLGNLRNMALDMGSELENQNKQIDR  187

Query  855  LDTDIDELNSRVKGANQRARHLL  923
            ++   D  N R+ G N+RA +LL
Sbjct  188  INAKGDANNIRMDGVNKRANNLL  210



>ref|XP_009028652.1| hypothetical protein HELRODRAFT_155336, partial [Helobdella robusta]
 gb|ESN93193.1| hypothetical protein HELRODRAFT_155336, partial [Helobdella robusta]
Length=198

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/208 (32%), Positives = 104/208 (50%), Gaps = 23/208 (11%)
 Frame = +3

Query  324  VQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKD  503
            +QEL+     + +E+  S    L + E+    GAKTL  L  QGE++ R  E   ++++D
Sbjct  5    LQELQKQINIKTDESLDSTRRMLALVEESSDAGAKTLTMLDIQGEKLDRIEEGMTQINQD  64

Query  504  LSKGEKLLNNL---GGMFSMPWKPKKT--KEITGPKTSKDDNNHKGKKGTKEQREKLG--  662
            + + EK L  +    G+  +PWK  KT  KE +  KT++D      K  T   R  +G  
Sbjct  65   MKEAEKNLEGMEKCCGLCVLPWKRGKTAKKEESAWKTNED-----CKVNTDGPRMVVGDA  119

Query  663  -LNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQN  839
              N +G        +  ++ M++           L D+S +LG+LK MA DM  E+D QN
Sbjct  120  SHNIQGGFVTRITNDAREDEMEQ----------NLVDVSSMLGNLKNMAIDMHNEIDSQN  169

Query  840  KALDNLDTDIDELNSRVKGANQRARHLL  923
            + LD ++T    L+ RV+ AN RA  +L
Sbjct  170  RQLDRINTQAIVLDERVQSANSRATKIL  197



>ref|XP_003442937.1| PREDICTED: synaptosomal-associated protein 23-like isoform X1 
[Oreochromis niloticus]
Length=215

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 61/218 (28%), Positives = 109/218 (50%), Gaps = 17/218 (8%)
 Frame = +3

Query  309  FDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAV  488
             DDM+V+++   A    +E+ +S    L++AE+ +Q G  T+  L +QGEQ+ R      
Sbjct  1    MDDMTVEQMAIRANQVTDESLESTRRMLQMAEESKQTGVNTVVMLDQQGEQLSRVERGMD  60

Query  489  EMDKDLSKGEKLLNNLGGMFSMPWKP----------KKTKEITGPKTSKDDNNHKGKKGT  638
            ++++D+ + EK L +L     +   P           + K   G   ++ +N+  G K  
Sbjct  61   QINQDMRQAEKNLTDLSKCCGICVCPCDRVSSIENDSRYKRTWGTGGTEGENDADGPKVV  120

Query  639  KEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDA---LDDLSDILGDLKGMAT  809
              Q   +  N +        P+ P   +Q++    A++D+    L+ +  I+G+LK +A 
Sbjct  121  STQPSGV-RNGQAAQVNAAGPSGP--YIQRI-TNDAREDEMEENLEAVGSIIGNLKNLAV  176

Query  810  DMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
            DMG+E+DKQNK +D ++   D    R+  ANQRA  L+
Sbjct  177  DMGSEIDKQNKQIDRINDKADMNKLRIDEANQRANKLI  214



>ref|XP_002054565.1| GJ24526 [Drosophila virilis]
 gb|EDW68085.1| GJ24526 [Drosophila virilis]
Length=212

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 108/203 (53%), Gaps = 8/203 (4%)
 Frame = +3

Query  324  VQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKD  503
            +QEL+  +   A+E+ +S    L + ++ ++ G +TL  L  QGEQ+ R  E    ++ D
Sbjct  13   LQELQLKSAQVADESLESTRRMLSLMDESKEAGIRTLVALDDQGEQLDRIEEGMDRINAD  72

Query  504  LSKGEKLLNNL---GGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTK  674
            + + EK L+ +    G+  +PWK    K+  G    K +++ K    ++ QR    ++ +
Sbjct  73   MREAEKNLSGMEKCCGVCVLPWKKVNIKD-DGDSAWKANDDGK-VVASQPQRV---IDER  127

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
             +     PP     A    +  + + D+ L  ++ +LG+L+ MA DMG+EL+ QNK +D 
Sbjct  128  ERGGMGAPPQSGYIARITNDAREDEMDENLGQVNSMLGNLRNMALDMGSELENQNKQVDR  187

Query  855  LDTDIDELNSRVKGANQRARHLL  923
            ++   D  N+R+ G N+RA +LL
Sbjct  188  INAKGDANNTRMDGVNKRANNLL  210



>ref|XP_001635030.1| predicted protein [Nematostella vectensis]
 gb|EDO42967.1| predicted protein [Nematostella vectensis]
Length=188

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/193 (30%), Positives = 96/193 (50%), Gaps = 35/193 (18%)
 Frame = +3

Query  360  EETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNL-  536
            +E+ +S    LR+AE+ +  G KT+  + +QGEQ+ R  E   +++ D+ + E+ L  + 
Sbjct  23   DESLESTRRMLRMAEESQDTGIKTMVMIDEQGEQLDRVEEGLDQINADMKEAERNLTGME  82

Query  537  --GGMFSMPWKPKKTKEI--TGPKTSKDDNNHKGKKGTKEQREKLGLNTKGKSAPTTPPN  704
               G+   PWK  K  E   T  K  K+++N  G + T + RE                 
Sbjct  83   KCCGLCVCPWKKSKRYEKSDTYKKAFKNNHNEDGVRITNDDRED----------------  126

Query  705  EPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNS  884
                          + D+ L  +S+I+G+LK MA DMG EL+ QN+ LD ++   +  ++
Sbjct  127  --------------EMDENLGQVSNIIGNLKSMAVDMGQELETQNRQLDRINAKAESNDT  172

Query  885  RVKGANQRARHLL  923
            R+  AN+RAR +L
Sbjct  173  RIHVANKRARDIL  185



>ref|XP_010731393.1| PREDICTED: synaptosomal-associated protein 25-A-like isoform 
X1 [Larimichthys crocea]
 ref|XP_010731394.1| PREDICTED: synaptosomal-associated protein 25-A-like isoform 
X1 [Larimichthys crocea]
 ref|XP_010731395.1| PREDICTED: synaptosomal-associated protein 25-A-like isoform 
X1 [Larimichthys crocea]
 ref|XP_010731396.1| PREDICTED: synaptosomal-associated protein 25-A-like isoform 
X1 [Larimichthys crocea]
Length=204

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 102/203 (50%), Gaps = 17/203 (8%)
 Frame = +3

Query  330  ELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLS  509
            +L+  A   A+E+ +S    L + E+ +  G +TL  L +QGEQ+ R  E   +++KD+ 
Sbjct  13   DLQTRADQIADESLESTRRMLALVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMK  72

Query  510  KGEKLLNNLG---GMFSMPW-KPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKG  677
              EK LNNLG   G+ S P  K K   +  G       N+  G +   ++RE++ ++  G
Sbjct  73   DAEKNLNNLGQFCGLCSCPCNKIKGGGQAWGANQDGVVNSQPGAR-VVDEREQMAIS--G  129

Query  678  KSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNL  857
                    +  +N M          D+ L+ +  I+G+L+ MA DMG E+D QN+ +D +
Sbjct  130  GFIRRVTDDARENEM----------DENLEQVGGIIGNLRHMALDMGQEIDTQNRQIDRI  179

Query  858  DTDIDELNSRVKGANQRARHLLA  926
                D   +R+  ANQRA  +L 
Sbjct  180  MEKADSNKTRIDEANQRATKMLG  202



>ref|XP_010877747.1| PREDICTED: synaptosomal-associated protein 25-A-like isoform 
X1 [Esox lucius]
Length=204

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/206 (32%), Positives = 103/206 (50%), Gaps = 20/206 (10%)
 Frame = +3

Query  330  ELENY---AVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDK  500
            ELEN    A   A+E+ +S    L + E+ +  G +TL  L +QGEQ+ R  E   +++K
Sbjct  10   ELENLQAKADQIADESLESTRRMLAMVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINK  69

Query  501  DLSKGEKLLNNLG---GMFSMPW-KPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLN  668
            D+   EK LNNLG   G+ S P  K K   +  G       N+  G +   ++RE++ ++
Sbjct  70   DMKDAEKNLNNLGQFCGLCSCPCNKIKGGGQAWGANQDGVVNSQPGAR-VVDEREQMAIS  128

Query  669  TKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKAL  848
              G        +  +N M          D+ L+ +  I+G+L+ MA DMG E+D QN+ +
Sbjct  129  --GGFIRRVTDDARENEM----------DENLEQVGGIIGNLRHMALDMGNEIDTQNRQI  176

Query  849  DNLDTDIDELNSRVKGANQRARHLLA  926
            D +    D   +R+  ANQRA  +L 
Sbjct  177  DRIMDKADSNKTRIDEANQRATKMLG  202



>ref|XP_001964463.1| GF23192 [Drosophila ananassae]
 gb|EDV30259.1| GF23192 [Drosophila ananassae]
Length=212

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 107/203 (53%), Gaps = 8/203 (4%)
 Frame = +3

Query  324  VQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKD  503
            +QEL+  +   A+E+ +S    L + ++ ++ G +TL  L  QGEQ+ R  E    ++ D
Sbjct  13   LQELQLKSAQVADESLESTRRMLSLMDESKEAGIRTLVALDDQGEQLDRIEEGMDRINAD  72

Query  504  LSKGEKLLNNL---GGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTK  674
            + + EK L+ +    G+  +PWK    K+  G    K +++ K    ++ QR    ++ +
Sbjct  73   MREAEKNLSGMEKCCGICVLPWKKVNIKD-DGDSAWKANDDGK-IVASQPQRV---IDER  127

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
             +     PP     A    +  + + D+ L  ++ +LG+L+ MA DMG+EL+ QNK +D 
Sbjct  128  ERGGMGAPPQSGYVARITNDAREDEMDENLGQVNSMLGNLRNMALDMGSELENQNKQVDR  187

Query  855  LDTDIDELNSRVKGANQRARHLL  923
            ++   D  N R+ G N+RA +LL
Sbjct  188  INAKGDANNIRMDGVNKRANNLL  210



>emb|CAH92726.1| hypothetical protein [Pongo abelii]
Length=206

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/209 (29%), Positives = 105/209 (50%), Gaps = 23/209 (11%)
 Frame = +3

Query  324  VQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKD  503
            ++E++  A   A+E+ +S    L++ E+ +  G +TL  L +QGEQ+ R  E    +++D
Sbjct  11   LEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQD  70

Query  504  LSKGEKLLNNLG---GMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTK-----EQREKL  659
            + + EK L +LG   G+F  P    K+ +          NN  G   ++     ++RE++
Sbjct  71   MKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWG---NNQDGVVASQPARVVDEREQM  127

Query  660  GLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQN  839
             ++  G        +  +N M          D+ LD +S I+G+L+ MA DMG E+D QN
Sbjct  128  AIS--GGFIRRVTNDARENEM----------DENLDQVSGIIGNLRHMALDMGNEIDTQN  175

Query  840  KALDNLDTDIDELNSRVKGANQRARHLLA  926
            + +D +    D   +R+  ANQRA  +L 
Sbjct  176  RQIDRIMEKADSNKTRIDEANQRATKMLG  204



>gb|ERE71497.1| synaptosomal-associated protein 25 [Cricetulus griseus]
Length=246

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 114/251 (45%), Gaps = 22/251 (9%)
 Frame = +3

Query  204  FGFGKKppasasaspMQSADEPPAARRTSSEPNLNFD---DM--SVQELENYAVNQAEET  368
              FGK            +    PA R     P +      DM   ++E++  A   A+E+
Sbjct  6    LAFGKHQRILTGRCKGVNFSNSPAVRGAQQPPTITMAEDADMRNELEEMQRRADQLADES  65

Query  369  TKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLSKGEKLLNNLGGMF  548
             +S    L++ E+ +  G +TL  L +QGEQ+ R  E   +++KD+ + EK L +LG   
Sbjct  66   LESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFC  125

Query  549  SMPWKPKKTKEITGPKTSKDDNNHKGKKGTK-----EQREKLGLNTKGKSAPTTPPNEPQ  713
             +   P    + +        NN  G   ++     ++RE++ ++  G        +  +
Sbjct  126  GLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAIS--GGFIRRVTNDARE  183

Query  714  NAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNLDTDIDELNSRVK  893
            N M          D+ L+ +S I+G+L+ MA DMG E+D QN+ +D +    D   +R+ 
Sbjct  184  NEM----------DENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRID  233

Query  894  GANQRARHLLA  926
             ANQRA  +L 
Sbjct  234  EANQRATKMLG  244



>ref|XP_003969482.1| PREDICTED: synaptosomal-associated protein 25-A-like [Takifugu 
rubripes]
Length=204

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 102/203 (50%), Gaps = 17/203 (8%)
 Frame = +3

Query  330  ELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLS  509
            +L+  A   A+E+ +S    L + E+ +  G +TL  L +QGEQ+ R  E   +++KD+ 
Sbjct  13   DLQTRADQIADESLESTRRMLALVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMK  72

Query  510  KGEKLLNNLG---GMFSMPW-KPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKG  677
              EK LNNLG   G+ S P  K K   +  G       N+  G +   ++RE++ ++  G
Sbjct  73   DAEKNLNNLGQFCGLCSCPCNKIKGGGQAWGGNQDGVVNSQPGAR-VMDEREQMAIS--G  129

Query  678  KSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNL  857
                    +  +N M          D+ L+ +  I+G+L+ MA DMG E+D QN+ +D +
Sbjct  130  GFIRRVTDDARENEM----------DENLEQVGGIIGNLRHMALDMGQEIDTQNRQIDRI  179

Query  858  DTDIDELNSRVKGANQRARHLLA  926
                D   +R+  ANQRA  +L 
Sbjct  180  MEKADSNKTRIDEANQRATKMLG  202



>ref|XP_003962445.1| PREDICTED: synaptosomal-associated protein 23-like [Takifugu 
rubripes]
Length=237

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/220 (29%), Positives = 104/220 (47%), Gaps = 19/220 (9%)
 Frame = +3

Query  306  NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMA  485
            N  DM+V+++   A    +E+ +S    L++AE+ +Q G  T+  L +QGEQ+ R  E  
Sbjct  22   NMADMTVEQMAMRANQVTDESLESTRRMLQMAEESKQTGVNTMVMLDQQGEQLKRVDEGM  81

Query  486  VEMDKDLSKGEKLLNNLGGMFSMPWKP----------KKTKEITGPKTSKDDNNHKGKKG  635
             ++++D+ + EK L +L     +   P           + K   G   +  +    G K 
Sbjct  82   DQINQDMRQAEKNLTDLSKCCGLCVCPCDRVSSIEHDSRYKRTWGVGGADGEAGANGSKV  141

Query  636  TKEQREKL--GLNTKGKSAPTTPP--NEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGM  803
               Q   +  G   +  +  T+ P      N  ++ EME     + L  +  I+G+LK M
Sbjct  142  VSRQPSGVHNGQTVQVSAGGTSGPYIKRITNDAREDEME-----ENLGAVGSIIGNLKSM  196

Query  804  ATDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
            A DMG E+DKQN+ +DN+    D    R+  ANQRA  L+
Sbjct  197  AVDMGNEIDKQNRQIDNITEKADMNKVRIDEANQRANKLI  236



>ref|XP_008309039.1| PREDICTED: synaptosomal-associated protein 25-A-like isoform 
X1 [Cynoglossus semilaevis]
Length=204

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 102/203 (50%), Gaps = 17/203 (8%)
 Frame = +3

Query  330  ELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLS  509
            +L+  A   A+E+ +S    L + E+ +  G +TL  L +QGEQ+ R  E   +++KD+ 
Sbjct  13   DLQTRADQIADESLESTRRMLALVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMM  72

Query  510  KGEKLLNNLG---GMFSMPW-KPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKG  677
              EK LNNLG   G+ S P  K K   +  G       N+  G +   ++RE++ ++  G
Sbjct  73   DAEKNLNNLGQFCGLCSCPCNKIKGGGQAWGGNQDGVVNSQPGAR-VVDEREQMAIS--G  129

Query  678  KSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNL  857
                    +  +N M          D+ L+ +  I+G+L+ MA DMG E+D QN+ +D +
Sbjct  130  GFIRRVTDDARENEM----------DENLEQVGGIIGNLRHMALDMGQEIDTQNRQIDRI  179

Query  858  DTDIDELNSRVKGANQRARHLLA  926
                D   +R+  ANQRA  +L 
Sbjct  180  MEKADSNKTRIDEANQRATKMLG  202



>ref|NP_524298.1| Synaptosomal-associated protein 24kDa [Drosophila melanogaster]
 ref|XP_002097008.1| GE24734 [Drosophila yakuba]
 gb|AAF73834.1|AF187106_1 SNAP-24 protein [Drosophila melanogaster]
 gb|AAF54443.1| Synaptosomal-associated protein 24kDa [Drosophila melanogaster]
 gb|EDW96720.1| GE24734 [Drosophila yakuba]
Length=212

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 107/203 (53%), Gaps = 8/203 (4%)
 Frame = +3

Query  324  VQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKD  503
            +QEL+  +   A+E+ +S    L + ++ ++ G +TL  L  QGEQ+ R  E    ++ D
Sbjct  13   LQELQFKSGQVADESLESTRRMLALMDESKEAGIRTLVALDDQGEQLDRIEEGMDRINAD  72

Query  504  LSKGEKLLNNL---GGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTK  674
            + + EK L+ +    G+  +PWK    K+  G    K +++ K    ++ QR    ++ +
Sbjct  73   MREAEKNLSGMEKCCGICVLPWKKVNIKD-DGESAWKANDDGK-IVASQPQRV---IDER  127

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
             +     PP     A    +  + + D+ L  ++ +LG+L+ MA DMG+EL+ QNK +D 
Sbjct  128  ERGGMGAPPQSGYVARITNDAREDEMDENLGQVNSMLGNLRNMALDMGSELENQNKQVDR  187

Query  855  LDTDIDELNSRVKGANQRARHLL  923
            ++   D  N R+ G N+RA +LL
Sbjct  188  INAKGDANNIRMDGVNKRANNLL  210



>ref|XP_003437735.1| PREDICTED: synaptosomal-associated protein 25-B-like isoform 
X1 [Oreochromis niloticus]
Length=204

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 102/203 (50%), Gaps = 17/203 (8%)
 Frame = +3

Query  330  ELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLS  509
            +L+  A   A+E+ +S    L + E+ +  G +TL  L +QGEQ+ R  E   +++KD+ 
Sbjct  13   DLQTRADQIADESLESTRRMLALVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMK  72

Query  510  KGEKLLNNLG---GMFSMPW-KPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKG  677
              EK LNNLG   G+ S P  K K   +  G       N+  G +   ++RE++ ++  G
Sbjct  73   DAEKNLNNLGQFCGLCSCPCNKIKGGGQAWGGNQDGVVNSQPGAR-VVDEREQMAIS--G  129

Query  678  KSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNL  857
                    +  +N M          D+ L+ +  I+G+L+ MA DMG E+D QN+ +D +
Sbjct  130  GFIRRVTDDARENEM----------DENLEQVGGIIGNLRHMALDMGQEIDTQNRQIDRI  179

Query  858  DTDIDELNSRVKGANQRARHLLA  926
                D   +R+  ANQRA  +L 
Sbjct  180  MDKADSNKTRIDEANQRATKMLG  202



>ref|XP_004539800.1| PREDICTED: synaptosomal-associated protein 25-B-like isoform 
X1 [Maylandia zebra]
 ref|XP_005727634.1| PREDICTED: synaptosomal-associated protein 25-B-like isoform 
X1 [Pundamilia nyererei]
 ref|XP_006779796.1| PREDICTED: synaptosomal-associated protein 25-B-like isoform 
X1 [Neolamprologus brichardi]
Length=204

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 102/203 (50%), Gaps = 17/203 (8%)
 Frame = +3

Query  330  ELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKDLS  509
            +L+  A   A+E+ +S    L + E+ +  G +TL  L +QGEQ+ R  E   +++KD+ 
Sbjct  13   DLQTRADQIADESLESTRRMLALVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMK  72

Query  510  KGEKLLNNLG---GMFSMPW-KPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTKG  677
              EK LNNLG   G+ S P  K K   +  G       N+  G +   ++RE++ ++  G
Sbjct  73   DAEKNLNNLGQFCGLCSCPCNKIKGGGQAWGGNQDGVVNSQPGAR-VVDEREQMAIS--G  129

Query  678  KSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDNL  857
                    +  +N M          D+ L+ +  I+G+L+ MA DMG E+D QN+ +D +
Sbjct  130  GFIRRVTNDARENEM----------DENLEQVGGIIGNLRHMALDMGQEIDTQNRQIDRI  179

Query  858  DTDIDELNSRVKGANQRARHLLA  926
                D   +R+  ANQRA  +L 
Sbjct  180  MDKADSNKTRIDEANQRATKMLG  202



>ref|XP_008397391.1| PREDICTED: synaptosomal-associated protein 23 isoform X1 [Poecilia 
reticulata]
Length=231

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 106/216 (49%), Gaps = 15/216 (7%)
 Frame = +3

Query  306  NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMA  485
            N DDMSV+++   A    +E+ +S    L++AE+ +Q G KT+E L  QGEQ+    +  
Sbjct  20   NMDDMSVEQMAVRANQLTDESLESTRRMLQMAEESQQTGNKTMEMLDHQGEQLRNVEQGM  79

Query  486  VEMDKDLSKGEKLLNNLG---GMFSMPW-KPKKTKEITGPKTSKDDNNHKGKKGTKEQRE  653
             ++++D+   EK L +L    G+   P  +    +  +  K +  +    GK      R+
Sbjct  80   DQINQDMRTAEKNLTDLSKCCGLCVCPCDRVSSIENDSRYKRTWGEGEGDGKGSNVVSRQ  139

Query  654  KLGLNT-----KGKSAPTTPP-NEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDM  815
              G+          +AP+ P  N   N  ++ EME     D L  +  I+G+LK MA +M
Sbjct  140  PSGVRNGQTAQTNAAAPSGPYINRVTNDAREDEME-----DNLQAVGGIIGNLKDMAMNM  194

Query  816  GTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
            G E+DKQN  +D ++   D    R+  AN RA  L+
Sbjct  195  GNEIDKQNAQIDRINDKADMTKIRIDEANTRANKLI  230



>ref|XP_004082207.1| PREDICTED: synaptosomal-associated protein 23-like isoform 2 
[Oryzias latipes]
Length=239

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 107/219 (49%), Gaps = 13/219 (6%)
 Frame = +3

Query  306  NFDDMSVQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMA  485
            N +DMSV+++   A    +E+ +S     ++AE+ ++ G KTL+ L  QGEQ+ R  E  
Sbjct  20   NMEDMSVEQMALRANQLTDESLESTRRMRQLAEESQETGGKTLDMLDMQGEQLKRVEEGM  79

Query  486  VEMDKDLSKGEKLLNNLG---GMFSMPW-------KPKKTKEITGPKTSKDDNNHKGKKG  635
             ++++D+ + EK LN+L    G+ + P          ++ K+  G    + +N+  G K 
Sbjct  80   EQINEDMKQAEKNLNDLNKCCGLCTCPCDRVTSLENDQRYKKTWGTGGLEGENDGDGSKV  139

Query  636  TKEQREKLGLNTKGKSAPTTPPNEPQNAMQKVEMEKAKQDDA---LDDLSDILGDLKGMA  806
               Q  +       ++A       P     +     A++D+    L+ +  I+ +LKGMA
Sbjct  140  VSRQPSRTRNGQPAQTAARGTAAAPSGPYIQRVTNDAREDEMEENLEAVGGIISNLKGMA  199

Query  807  TDMGTELDKQNKALDNLDTDIDELNSRVKGANQRARHLL  923
              MG E+DKQN  +D +    D    R+  ANQRA  L+
Sbjct  200  MTMGHEIDKQNVQIDRITDKADMNKMRIDDANQRANKLI  238



>ref|XP_001980757.1| GG17329 [Drosophila erecta]
 gb|EDV49715.1| GG17329 [Drosophila erecta]
Length=212

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 107/203 (53%), Gaps = 8/203 (4%)
 Frame = +3

Query  324  VQELENYAVNQAEETTKSVNNCLRIAEDIRQDGAKTLETLHKQGEQIHRTHEMAVEMDKD  503
            +QEL+  +   A+E+ +S    L + ++ ++ G +TL  L  QGEQ+ R  E    ++ D
Sbjct  13   LQELQLKSGQVADESLESTRRMLALMDESKEAGIRTLVALDDQGEQLDRIEEGMDRINAD  72

Query  504  LSKGEKLLNNL---GGMFSMPWKPKKTKEITGPKTSKDDNNHKGKKGTKEQREKLGLNTK  674
            + + EK L+ +    G+  +PWK    K+  G    K +++ K    ++ QR    ++ +
Sbjct  73   MREAEKNLSGMEKCCGICVLPWKKVNIKD-DGESAWKANDDGK-IVASQPQRV---IDER  127

Query  675  GKSAPTTPPNEPQNAMQKVEMEKAKQDDALDDLSDILGDLKGMATDMGTELDKQNKALDN  854
             +     PP     A    +  + + D+ L  ++ +LG+L+ MA DMG+EL+ QNK +D 
Sbjct  128  ERGGMGAPPQSGYVARITNDAREDEMDENLGQVNSMLGNLRNMALDMGSELENQNKQVDR  187

Query  855  LDTDIDELNSRVKGANQRARHLL  923
            ++   D  N R+ G N+RA +LL
Sbjct  188  INAKGDANNIRMDGVNKRANNLL  210



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2290717995426