BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15448_g2_i1 len=2208 path=[1:0-329 331:330-579 581:580-2207]

Length=2208
                                                                      Score     E

ref|XP_004234480.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...   1014   0.0     
ref|XP_006343292.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...   1011   0.0     
ref|XP_009760612.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...   1003   0.0     
ref|XP_006348105.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    998   0.0     
ref|XP_004232719.1|  PREDICTED: UPF0051 protein ABCI8, chloroplastic    993   0.0     
ref|XP_011096078.1|  PREDICTED: UPF0051 protein ABCI8, chloroplastic    990   0.0     
ref|XP_009789020.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    983   0.0     
ref|XP_009595799.1|  PREDICTED: UPF0051 protein ABCI8, chloroplastic    979   0.0     
gb|AAX36074.1|  non-intrinsic ABC protein                               978   0.0     Nicotiana benthamiana
emb|CDP09652.1|  unnamed protein product                                971   0.0     
gb|EYU27801.1|  hypothetical protein MIMGU_mgv1a004043mg                964   0.0     
ref|XP_002272917.1|  PREDICTED: UPF0051 protein ABCI8, chloroplastic    931   0.0     Vitis vinifera
emb|CAN76788.1|  hypothetical protein VITISV_038836                     929   0.0     Vitis vinifera
ref|XP_010693663.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    924   0.0     
ref|XP_002518497.1|  Protein sufB, putative                             920   0.0     Ricinus communis
gb|EPS64176.1|  hypothetical protein M569_10603                         920   0.0     
ref|XP_008441129.1|  PREDICTED: UPF0051 protein ABCI8, chloroplastic    917   0.0     
ref|XP_004145110.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    917   0.0     
ref|XP_010093279.1|  UPF0051 protein ABCI8                              916   0.0     
ref|XP_002305582.1|  ATP-binding-cassette transporter family protein    915   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010278707.1|  PREDICTED: UPF0051 protein ABCI8, chloroplastic    910   0.0     
gb|AIU41658.1|  ABC transporter family protein                          909   0.0     
ref|XP_011037664.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    908   0.0     
gb|KDP20760.1|  hypothetical protein JCGZ_21231                         906   0.0     
gb|KHG25347.1|  chloroplastic protein                                   906   0.0     
ref|XP_007026052.1|  ATP binding cassette protein 1                     903   0.0     
gb|KDO75461.1|  hypothetical protein CISIN_1g008725mg                   903   0.0     
ref|XP_006468027.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    902   0.0     
ref|XP_006287351.1|  hypothetical protein CARUB_v10000549mg             902   0.0     
ref|XP_006449034.1|  hypothetical protein CICLE_v10014785mg             900   0.0     
ref|XP_007024120.1|  ATP binding cassette protein 1 isoform 1           898   0.0     
ref|XP_007212381.1|  hypothetical protein PRUPE_ppa003788mg             897   0.0     
ref|XP_002874814.1|  ATABC1                                             897   0.0     
ref|XP_008224818.1|  PREDICTED: UPF0051 protein ABCI8, chloroplastic    896   0.0     
ref|XP_010432374.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    896   0.0     
ref|XP_006396667.1|  hypothetical protein EUTSA_v10028516mg             895   0.0     
dbj|BAJ34164.1|  unnamed protein product                                895   0.0     
ref|XP_010455778.1|  PREDICTED: UPF0051 protein ABCI8, chloroplastic    895   0.0     
ref|XP_009362114.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    895   0.0     
ref|XP_010422308.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    894   0.0     
ref|XP_010538915.1|  PREDICTED: UPF0051 protein ABCI8, chloroplastic    892   0.0     
ref|XP_009357441.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    890   0.0     
ref|XP_008371099.1|  PREDICTED: UPF0051 protein ABCI8, chloroplastic    890   0.0     
ref|NP_192386.1|  ATP binding cassette protein 1                        888   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008349301.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    888   0.0     
ref|XP_007155095.1|  hypothetical protein PHAVU_003G172700g             885   0.0     
ref|XP_003622190.1|  ATP-binding cassette transporter subfamily I...    882   0.0     
ref|XP_009114550.1|  PREDICTED: UPF0051 protein ABCI8, chloroplastic    882   0.0     
ref|XP_006600720.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    882   0.0     
ref|XP_004494771.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    881   0.0     
ref|XP_004293279.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    876   0.0     
ref|XP_010059622.1|  PREDICTED: UPF0051 protein ABCI8, chloroplastic    875   0.0     
ref|XP_009345544.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    874   0.0     
gb|KEH18443.1|  iron-regulated ABC transporter membrane component...    874   0.0     
ref|XP_003542663.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    872   0.0     
emb|CBI23255.3|  unnamed protein product                                858   0.0     
ref|XP_009630331.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    855   0.0     
ref|XP_007024121.1|  ATP binding cassette protein 1 isoform 2           835   0.0     
ref|XP_006854593.1|  hypothetical protein AMTR_s00030p00124490          830   0.0     
gb|KCW75329.1|  hypothetical protein EUGRSUZ_E04076                     824   0.0     
ref|XP_010922565.1|  PREDICTED: UPF0051 protein in atpA 3'region-...    818   0.0     
ref|XP_008805252.1|  PREDICTED: UPF0051 protein in atpA 3'region-...    817   0.0     
ref|XP_001751223.1|  ATP-binding cassette transporter, subfamily ...    811   0.0     
ref|XP_001759559.1|  ATP-binding cassette transporter, subfamily ...    806   0.0     
ref|XP_010907405.1|  PREDICTED: UPF0051 protein in atpA 3'region-...    803   0.0     
ref|XP_008805012.1|  PREDICTED: UPF0051 protein in atpA 3'region-...    802   0.0     
ref|XP_009398358.1|  PREDICTED: UPF0051 protein in atpA 3'region-...    800   0.0     
ref|XP_009392243.1|  PREDICTED: UPF0051 protein in atpA 3'region-...    796   0.0     
ref|XP_002973895.1|  hypothetical protein SELMODRAFT_173820             791   0.0     
ref|XP_002969166.1|  ATP-binding cassette transporter, subfamily ...    791   0.0     
ref|XP_002952498.1|  iron-sulfur cluster assembly protein               776   0.0     
ref|XP_004153240.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    771   0.0     
ref|XP_003564527.1|  PREDICTED: UPF0051 protein ABCI8, chloroplastic    765   0.0     
ref|XP_011037665.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    763   0.0     
dbj|BAJ90146.1|  predicted protein                                      764   0.0     
dbj|BAJ88923.1|  predicted protein                                      762   0.0     
ref|XP_002458708.1|  hypothetical protein SORBIDRAFT_03g038740          762   0.0     Sorghum bicolor [broomcorn]
ref|NP_001044693.1|  Os01g0830000                                       758   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|NP_001143087.1|  uncharacterized protein LOC100275561               758   0.0     Zea mays [maize]
ref|XP_004970442.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    757   0.0     
gb|KFM28399.1|  hypothetical protein F751_5312                          750   0.0     
ref|XP_007513604.1|  cysteine desulfurase activator complex subun...    739   0.0     
emb|CEG01320.1|  SUF system FeS cluster assembly, SufBD                 736   0.0     
ref|XP_001419047.1|  ABC(membrane) family transporter (Fe-S assem...    729   0.0     Ostreococcus lucimarinus CCE9901
ref|WP_011056341.1|  cysteine desulfurase activator complex subun...    729   0.0     
ref|XP_003057567.1|  ATP-binding cassette superfamily                   733   0.0     
ref|WP_024125377.1|  iron-sulfur cluster assembly protein SufB          729   0.0     
ref|XP_005647845.1|  ABC family transporter (Fe-S assembly/SufBCD...    722   0.0     
ref|XP_005852172.1|  hypothetical protein CHLNCDRAFT_29265              721   0.0     
ref|WP_015154063.1|  iron-regulated ABC transporter membrane comp...    720   0.0     
ref|WP_039714289.1|  cysteine desulfurase                               720   0.0     
ref|WP_015190665.1|  Iron-regulated ABC transporter membrane comp...    719   0.0     
ref|WP_027843139.1|  cysteine desulfurase                               716   0.0     
ref|WP_009632056.1|  FeS assembly protein SufB                          716   0.0     
ref|XP_003080587.1|  ABC transporter subunit (ISS)                      734   0.0     
ref|WP_026098480.1|  cysteine desulfurase                               715   0.0     
ref|WP_039741125.1|  cysteine desulfurase                               712   0.0     
ref|WP_029632972.1|  cysteine desulfurase [                             710   0.0     
ref|WP_017713634.1|  cysteine desulfurase activator complex subun...    710   0.0     
ref|WP_012628835.1|  cysteine desulfurase activator complex subun...    710   0.0     
ref|WP_017655181.1|  cysteine desulfurase activator complex subun...    708   0.0     
ref|WP_019502103.1|  cysteine desulfurase activator complex subun...    707   0.0     
ref|WP_009767622.1|  Iron-regulated ABC transporter membrane comp...    707   0.0     
ref|WP_026093781.1|  cysteine desulfurase                               707   0.0     
ref|WP_015165175.1|  iron-regulated ABC transporter membrane comp...    707   0.0     
ref|WP_036003790.1|  cysteine desulfurase                               707   0.0     
ref|WP_009458254.1|  MULTISPECIES: cysteine desulfurase activator...    706   0.0     
ref|WP_006277481.1|  cysteine desulfurase activator complex subun...    706   0.0     
ref|WP_011244666.1|  cysteine desulfurase activator complex subun...    706   0.0     
emb|CDM82944.1|  unnamed protein product                                703   0.0     
ref|WP_013190242.1|  cysteine desulfurase activator complex subun...    705   0.0     
ref|WP_015125085.1|  iron-regulated ABC transporter membrane comp...    705   0.0     
ref|WP_026721840.1|  cysteine desulfurase                               705   0.0     
ref|WP_036535504.1|  cysteine desulfurase                               705   0.0     
ref|WP_017322263.1|  cysteine desulfurase activator complex subun...    704   0.0     
ref|WP_026731385.1|  cysteine desulfurase                               704   0.0     
ref|WP_015122735.1|  iron-regulated ABC transporter membrane comp...    704   0.0     
ref|XP_010688022.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    706   0.0     
ref|WP_017316116.1|  cysteine desulfurase activator complex subun...    703   0.0     
ref|WP_026102049.1|  cysteine desulfurase                               703   0.0     
gb|AIU44588.1|  putative ABC transporter                                703   0.0     
ref|WP_015140225.1|  FeS assembly protein SufB                          703   0.0     
ref|WP_006101632.1|  cysteine desulfurase activator complex subun...    703   0.0     
ref|WP_008316689.1|  FeS assembly protein SufB                          703   0.0     
ref|WP_015202046.1|  FeS assembly protein SufB                          703   0.0     
ref|WP_006634911.1|  cysteine desulfurase activator complex subun...    703   0.0     
ref|WP_038081908.1|  cysteine desulfurase                               702   0.0     
ref|WP_011317308.1|  cysteine desulfurase activator complex subun...    702   0.0     
ref|WP_009343208.1|  cysteine desulfurase activator complex subun...    702   0.0     
ref|WP_027401841.1|  cysteine desulfurase                               702   0.0     
ref|WP_015176922.1|  Iron-regulated ABC transporter membrane comp...    702   0.0     
ref|WP_015151527.1|  iron-regulated ABC transporter membrane comp...    702   0.0     
ref|WP_011433021.1|  cysteine desulfurase activator complex subun...    702   0.0     
ref|WP_016951202.1|  cysteine desulfurase activator complex subun...    702   0.0     
ref|WP_015080912.1|  FeS assembly protein SufB                          702   0.0     
ref|WP_016863450.1|  cysteine desulfurase activator complex subun...    702   0.0     
ref|WP_015112308.1|  iron-regulated ABC transporter membrane comp...    702   0.0     
gb|ACF84872.1|  unknown                                                 700   0.0     Zea mays [maize]
ref|WP_014855025.1|  cysteine desulfurase activator complex subun...    702   0.0     
ref|WP_015130440.1|  iron-regulated ABC transporter membrane comp...    701   0.0     
ref|WP_028082495.1|  cysteine desulfurase                               701   0.0     
ref|WP_015200448.1|  iron-regulated ABC transporter membrane comp...    701   0.0     
ref|WP_010996648.1|  cysteine desulfurase activator complex subun...    701   0.0     
ref|WP_006194430.1|  cysteine desulfurase activator complex subun...    701   0.0     
ref|WP_016876439.1|  cysteine desulfurase activator complex subun...    701   0.0     
ref|WP_011431003.1|  cysteine desulfurase activator complex subun...    701   0.0     
ref|WP_015169618.1|  FeS assembly protein SufB                          701   0.0     
ref|WP_015223946.1|  iron-regulated ABC transporter membrane comp...    701   0.0     
ref|WP_015211234.1|  Iron-regulated ABC transporter membrane comp...    701   0.0     
ref|WP_028089116.1|  cysteine desulfurase                               700   0.0     
ref|WP_012307425.1|  MULTISPECIES: cysteine desulfurase activator...    700   0.0     
gb|KDD76926.1|  UPF0051 hypothetical protein                            699   0.0     
ref|WP_012593789.1|  cysteine desulfurase activator complex subun...    699   0.0     
ref|WP_015213829.1|  Iron-regulated ABC transporter membrane comp...    698   0.0     
ref|WP_017309174.1|  cysteine desulfurase activator complex subun...    698   0.0     
ref|WP_016868020.1|  cysteine desulfurase activator complex subun...    698   0.0     
ref|WP_007307555.1|  cysteine desulfurase activator complex subun...    698   0.0     
ref|WP_015220402.1|  iron-regulated ABC transporter membrane comp...    697   0.0     
ref|WP_012796795.1|  cysteine desulfurase activator complex subun...    697   0.0     
ref|WP_012411125.1|  cysteine desulfurase activator complex subun...    697   0.0     
ref|NP_043219.1|  putative ABC transporter                              697   0.0     Cyanophora paradoxa
ref|WP_028836742.1|  cysteine desulfurase                               697   0.0     
ref|WP_010480924.1|  cysteine desulfurase activator complex subun...    697   0.0     
ref|WP_024546352.1|  cysteine desulfurase                               697   0.0     
ref|XP_006644946.1|  PREDICTED: UPF0051 protein ABCI8, chloroplas...    695   0.0     
ref|WP_015192676.1|  Iron-regulated ABC transporter membrane comp...    696   0.0     
ref|WP_017286400.1|  cysteine desulfurase activator complex subun...    696   0.0     
ref|WP_015172281.1|  iron-regulated ABC transporter membrane comp...    696   0.0     
ref|WP_035154703.1|  cysteine desulfurase                               696   0.0     
ref|WP_017746897.1|  cysteine desulfurase activator complex subun...    695   0.0     
emb|CDM64966.1|  Iron-regulated ABC transporter membrane componen...    695   0.0     
ref|WP_006515514.1|  Iron-regulated ABC transporter membrane comp...    695   0.0     
ref|WP_007353113.1|  MULTISPECIES: cysteine desulfurase activator...    695   0.0     
ref|WP_015157720.1|  FeS assembly protein SufB                          694   0.0     
ref|WP_013408499.1|  cysteine desulfurase activator complex subun...    693   0.0     
ref|WP_012161807.1|  cysteine desulfurase activator complex subun...    693   0.0     
ref|WP_009627514.1|  Iron-regulated ABC transporter membrane comp...    694   0.0     
ref|WP_017297931.1|  cysteine desulfurase activator complex subun...    693   0.0     
ref|WP_015956672.1|  cysteine desulfurase activator complex subun...    693   0.0     
ref|WP_023074234.1|  iron-regulated abc transporter membrane comp...    692   0.0     
ref|WP_015184215.1|  iron-regulated ABC transporter membrane comp...    692   0.0     
ref|WP_023471975.1|  FeS cluster assembly protein SufB                  692   0.0     
ref|WP_038650668.1|  cysteine desulfurase                               692   0.0     
ref|WP_036483053.1|  cysteine desulfurase                               692   0.0     
ref|WP_039726650.1|  cysteine desulfurase                               691   0.0     
ref|WP_009545929.1|  cysteine desulfurase activator complex subun...    691   0.0     
ref|WP_026788521.1|  MULTISPECIES: cysteine desulfurase                 691   0.0     
ref|WP_008187504.1|  cysteine desulfurase activator complex subun...    691   0.0     
ref|WP_012361428.1|  cysteine desulfurase activator complex subun...    691   0.0     
gb|ETZ23616.1|  cysteine desulfurase activator complex subunit SufB     691   0.0     
gb|AIE73525.1|  Iron-sulfur cluster assembly protein SufB               690   0.0     
ref|WP_010873770.1|  cysteine desulfurase activator complex subun...    690   0.0     
ref|WP_008278529.1|  cysteine desulfurase activator complex subun...    690   0.0     
ref|WP_025040285.1|  cysteine desulfurase                               689   0.0     
ref|WP_008236070.1|  Iron-sulfur cluster assembly protein SufB          689   0.0     
ref|WP_017303873.1|  cysteine desulfurase activator complex subun...    689   0.0     
ref|WP_029526761.1|  cysteine desulfurase                               689   0.0     
ref|WP_017326755.1|  cysteine desulfurase activator complex subun...    689   0.0     
ref|WP_015145949.1|  FeS assembly protein SufB                          688   0.0     
ref|WP_011294068.1|  cysteine desulfurase activator complex subun...    688   0.0     
ref|WP_011822933.1|  cysteine desulfurase activator complex subun...    688   0.0     
ref|WP_019508529.1|  cysteine desulfurase activator complex subun...    688   0.0     
ref|WP_006511582.1|  FeS assembly protein SufB                          688   0.0     
ref|WP_015132392.1|  iron-regulated ABC transporter membrane comp...    688   0.0     
ref|WP_011584370.1|  cysteine desulfurase activator complex subun...    688   0.0     
ref|WP_013323186.1|  cysteine desulfurase activator complex subun...    687   0.0     
ref|WP_035990856.1|  cysteine desulfurase                               687   0.0     
ref|WP_018342941.1|  cysteine desulfurase activator complex subun...    687   0.0     
gb|KFA90312.1|  cysteine desulfurase                                    687   0.0     
gb|AIA21269.1|  cysteine desulfurase activator complex subunit SufB     687   0.0     
ref|WP_009194364.1|  FeS cluster assembly protein sufB                  687   0.0     
ref|WP_022604423.1|  FeS assembly protein SufB                          687   0.0     
ref|WP_002747962.1|  feS assembly protein SufB                          687   0.0     
ref|WP_028461197.1|  cysteine desulfurase                               686   0.0     
ref|WP_006456920.1|  cysteine desulfurase activator complex subun...    686   0.0     
gb|EMS62812.1|  UPF0051 protein ABCI8, chloroplastic                    684   0.0     
ref|WP_028979421.1|  cysteine desulfurase                               686   0.0     
ref|WP_026473878.1|  cysteine desulfurase                               686   0.0     
ref|WP_002747747.1|  cysteine desulfurase activator complex subun...    686   0.0     
ref|WP_002758413.1|  cysteine desulfurase activator complex subun...    686   0.0     
ref|NP_053850.1|  putative ABC transporter                              686   0.0     Porphyra purpurea
ref|WP_011380053.1|  cysteine desulfurase activator complex subun...    685   0.0     
ref|WP_002738588.1|  feS assembly protein SufB                          685   0.0     
ref|WP_036904809.1|  cysteine desulfurase                               685   0.0     
ref|WP_018400764.1|  cysteine desulfurase activator complex subun...    685   0.0     
ref|WP_004174036.1|  Iron-sulfur cluster assembly protein SufB          685   0.0     
ref|WP_002783201.1|  cysteine desulfurase activator complex subun...    685   0.0     
ref|WP_038032565.1|  cysteine desulfurase                               685   0.0     
ref|WP_036395285.1|  cysteine desulfurase                               684   0.0     
ref|WP_017662637.1|  cysteine desulfurase activator complex subun...    684   0.0     
ref|WP_002632528.1|  Iron-sulfur cluster assembly protein SufB          684   0.0     
ref|YP_009027524.1|  cysteine desulfurase activator complex subun...    684   0.0     
ref|WP_016481997.1|  Iron-regulated ABC transporter membrane comp...    684   0.0     
ref|WP_009582772.1|  Iron-sulfur cluster assembly protein SufB          684   0.0     
ref|WP_026778678.1|  cysteine desulfurase                               683   0.0     
gb|AIA20016.1|  cysteine desulfurase activator complex subunit SufB     684   0.0     
ref|WP_002804340.1|  cysteine desulfurase activator complex subun...    683   0.0     
gb|AFC39909.1|  putative ABC transporter                                684   0.0     
ref|WP_014216531.1|  cysteine desulfurase activator complex subun...    683   0.0     
ref|WP_013966069.1|  cysteine desulfurase activator complex subun...    683   0.0     
ref|WP_013742323.1|  cysteine desulfurase activator complex subun...    684   0.0     
ref|WP_015226195.1|  iron-regulated ABC transporter membrane comp...    683   0.0     
ref|YP_007947769.1|  putative ABC transporter                           683   0.0     
gb|EPF24305.1|  FeS cluster assembly protein sufB                       685   0.0     
ref|WP_008202041.1|  cysteine desulfurase activator complex subun...    682   0.0     
dbj|GAL85044.1|  cysteine desulfurase activator complex subunit SufB    682   0.0     
ref|WP_002756125.1|  cysteine desulfurase activator complex subun...    684   0.0     
ref|WP_015228979.1|  FeS assembly protein SufB                          682   0.0     
ref|YP_536921.1|  putative ABC transporter                              682   0.0     Pyropia yezoensis
ref|XP_002501970.1|  ATP-binding cassette superfamily                   680   0.0     Micromonas commoda
ref|WP_011395351.1|  cysteine desulfurase activator complex subun...    682   0.0     
gb|AIA21475.1|  cysteine desulfurase activator complex subunit SufB     682   0.0     
ref|WP_011613673.1|  cysteine desulfurase activator complex subun...    682   0.0     
ref|WP_036880506.1|  cysteine desulfurase                               681   0.0     
ref|WP_014101148.1|  cysteine desulfurase activator complex subun...    681   0.0     
ref|WP_002778369.1|  cysteine desulfurase activator complex subun...    683   0.0     
ref|WP_027003282.1|  cysteine desulfurase                               681   0.0     
ref|WP_015808847.1|  cysteine desulfurase activator complex subun...    681   0.0     
ref|WP_009787483.1|  cysteine desulfurase activator complex subun...    680   0.0     
ref|WP_006620652.1|  MULTISPECIES: cysteine desulfurase activator...    680   0.0     
gb|KFF41477.1|  Iron-regulated ABC transporter membrane component...    680   0.0     
ref|WP_006530313.1|  FeS assembly protein SufB                          679   0.0     
ref|YP_003002182.1|  ABC transporter                                    679   0.0     Aureoumbra lagunensis
ref|WP_002795092.1|  cysteine desulfurase activator complex subun...    681   0.0     
ref|WP_007098981.1|  cysteine desulfurase activator complex subun...    679   0.0     
ref|WP_006909624.1|  cysteine desulfurase activator complex subun...    679   0.0     
ref|WP_006617211.1|  cysteine desulfurase activator complex subun...    679   0.0     
ref|WP_028526487.1|  cysteine desulfurase                               679   0.0     
ref|WP_026998851.1|  cysteine desulfurase                               678   0.0     
ref|WP_011620385.1|  cysteine desulfurase activator complex subun...    678   0.0     
ref|WP_004333924.1|  FeS assembly protein SufB                          679   0.0     
ref|WP_009664744.1|  cysteine desulfurase activator complex subun...    677   0.0     
ref|WP_015109145.1|  FeS assembly protein SufB                          678   0.0     
ref|YP_009093334.1|  iron-sulfur cluster formation ABC transporter      678   0.0     
ref|WP_010313045.1|  cysteine desulfurase activator complex subun...    678   0.0     
ref|WP_036916380.1|  MULTISPECIES: cysteine desulfurase                 677   0.0     
ref|WP_026441893.1|  cysteine desulfurase                               677   0.0     
ref|WP_013648240.1|  cysteine desulfurase activator complex subun...    677   0.0     
gb|AIA17014.1|  Helix-turn-helix domain protein                         677   0.0     
ref|WP_036929743.1|  cysteine desulfurase                               677   0.0     
ref|WP_026309711.1|  cysteine desulfurase                               677   0.0     
ref|YP_008965819.1|  ABC transporter subunit                            677   0.0     
ref|WP_026032828.1|  cysteine desulfurase                               676   0.0     
ref|WP_031526708.1|  cysteine desulfurase                               676   0.0     
ref|WP_013031762.1|  cysteine desulfurase activator complex subun...    676   0.0     
ref|WP_025763935.1|  cysteine desulfurase                               676   0.0     
ref|WP_010526209.1|  cysteine desulfurase activator complex subun...    676   0.0     
ref|WP_012954121.1|  cysteine desulfurase activator complex subun...    676   0.0     
ref|WP_015471022.1|  cysteine desulfurase activator complex subun...    676   0.0     
ref|WP_011464154.1|  cysteine desulfurase activator complex subun...    676   0.0     
ref|WP_011634313.1|  cysteine desulfurase activator complex subun...    676   0.0     
ref|YP_003002043.1|  ABC transporter                                    676   0.0     
ref|WP_019477977.1|  cysteine desulfurase activator complex subun...    676   0.0     
ref|WP_023065591.1|  feS assembly protein SufB                          676   0.0     
ref|WP_035834079.1|  cysteine desulfurase                               676   0.0     
ref|WP_020410056.1|  cysteine desulfurase activator complex subun...    675   0.0     
ref|WP_002610653.1|  cysteine desulfurase activator complex subun...    675   0.0     
ref|WP_026994685.1|  cysteine desulfurase                               675   0.0     
ref|WP_006854488.1|  cysteine desulfurase activator complex subun...    674   0.0     
ref|WP_039141994.1|  cysteine desulfurase                               674   0.0     
ref|WP_035895338.1|  cysteine desulfurase                               674   0.0     
ref|WP_035889420.1|  cysteine desulfurase                               674   0.0     
gb|ETO92628.1|  iron-regulated ABC transporter membrane component...    674   0.0     
ref|WP_013186653.1|  cysteine desulfurase activator complex subun...    674   0.0     
ref|WP_019476254.1|  cysteine desulfurase activator complex subun...    674   0.0     
ref|WP_028969786.1|  cysteine desulfurase                               674   0.0     
gb|AHF14997.1|  cysteine desulfurase activator complex subunit SufB     674   0.0     
ref|WP_019990486.1|  cysteine desulfurase activator complex subun...    674   0.0     
ref|YP_008144904.1|  UPF0051 protein ycf24                              674   0.0     
ref|WP_014702906.1|  cysteine desulfurase activator complex subun...    674   0.0     
gb|EPZ16068.1|  cysteine desulfurase activator complex subunit SufB     674   0.0     
ref|WP_011127193.1|  cysteine desulfurase activator complex subun...    673   0.0     
ref|WP_036922293.1|  cysteine desulfurase                               673   0.0     
ref|WP_002998127.1|  cysteine desulfurase activator complex subun...    674   0.0     
gb|KFL90341.1|  Iron-sulfur cluster assembly protein SufB               674   0.0     
ref|WP_003009134.1|  cysteine desulfurase activator complex subun...    674   0.0     
ref|WP_028794401.1|  cysteine desulfurase                               673   0.0     
ref|WP_010304576.1|  cysteine desulfurase activator complex subun...    673   0.0     
ref|WP_004312932.1|  FeS assembly protein SufB                          674   0.0     
ref|WP_014843446.1|  cysteine desulfurase activator complex subun...    673   0.0     
ref|WP_004369371.1|  FeS assembly protein SufB                          674   0.0     
ref|WP_011934038.1|  cysteine desulfurase activator complex subun...    673   0.0     
ref|WP_017730793.1|  cysteine desulfurase activator complex subun...    673   0.0     
ref|WP_011112018.1|  cysteine desulfurase activator complex subun...    672   0.0     
ref|WP_025972785.1|  cysteine desulfurase                               672   0.0     
ref|WP_011945764.1|  cysteine desulfurase activator complex subun...    673   0.0     
ref|WP_009054720.1|  cysteine desulfurase activator complex subun...    672   0.0     
ref|WP_014841090.1|  cysteine desulfurase activator complex subun...    672   0.0     
ref|WP_027228415.1|  cysteine desulfurase                               672   0.0     
ref|WP_012585243.1|  cysteine desulfurase activator complex subun...    673   0.0     
ref|WP_011365214.1|  cysteine desulfurase activator complex subun...    672   0.0     
ref|WP_020533781.1|  cysteine desulfurase activator complex subun...    672   0.0     
gb|EKD42736.1|  hypothetical protein ACD_73C00038G0002                  672   0.0     
ref|WP_036824900.1|  cysteine desulfurase                               672   0.0     
ref|WP_005005661.1|  Iron-sulfur cluster assembly protein SufB          672   0.0     
ref|NP_043655.1|  putative ABC transporter                              672   0.0     
ref|WP_025887416.1|  cysteine desulfurase                               672   0.0     
ref|WP_028377347.1|  cysteine desulfurase                               672   0.0     
ref|WP_009432565.1|  cysteine desulfurase activator complex subun...    672   0.0     
ref|WP_038837596.1|  cysteine desulfurase                               672   0.0     
ref|WP_026159046.1|  cysteine desulfurase                               671   0.0     
ref|WP_009283901.1|  cysteine desulfurase activator complex subun...    671   0.0     
ref|WP_038553037.1|  cysteine desulfurase                               671   0.0     
ref|WP_010960295.1|  cysteine desulfurase activator complex subun...    671   0.0     
ref|WP_033563697.1|  cysteine desulfurase                               671   0.0     
ref|WP_011141370.1|  cysteine desulfurase activator complex subun...    671   0.0     
ref|WP_028787314.1|  cysteine desulfurase                               671   0.0     
gb|AHE67826.1|  FeS assembly protein SufB                               671   0.0     
ref|WP_011213209.1|  cysteine desulfurase activator complex subun...    671   0.0     
gb|AIA14901.1|  FeS assembly protein SufB                               669   0.0     
ref|WP_006043129.1|  cysteine desulfurase activator complex subun...    671   0.0     
ref|WP_034932950.1|  cysteine desulfurase                               671   0.0     
ref|WP_027266083.1|  cysteine desulfurase                               671   0.0     
ref|WP_019940694.1|  cysteine desulfurase activator complex subun...    671   0.0     
ref|WP_006172105.1|  cysteine desulfurase activator complex subun...    671   0.0     
ref|WP_008673283.1|  cysteine desulfurase activator complex subun...    671   0.0     
ref|WP_027266690.1|  cysteine desulfurase                               670   0.0     
gb|KDU79213.1|  FeS assembly protein SufB                               670   0.0     
ref|WP_002810842.1|  cysteine desulfurase activator complex subun...    670   0.0     
ref|WP_017522548.1|  cysteine desulfurase activator complex subun...    670   0.0     
ref|WP_025967368.1|  cysteine desulfurase                               670   0.0     
ref|WP_028665640.1|  cysteine desulfurase                               670   0.0     
ref|WP_039054629.1|  cysteine desulfurase                               670   0.0     
gb|AII46188.1|  cysteine desulfurase activator complex subunit SufB     670   0.0     
ref|WP_027220464.1|  cysteine desulfurase                               670   0.0     
ref|WP_032523856.1|  cysteine desulfurase                               670   0.0     
ref|WP_018614157.1|  cysteine desulfurase activator complex subun...    670   0.0     
ref|WP_025945572.1|  cysteine desulfurase                               670   0.0     
ref|WP_015266854.1|  FeS assembly protein SufB                          670   0.0     
ref|WP_003800345.1|  cysteine desulfurase activator complex subun...    670   0.0     
gb|KGN98880.1|  cysteine desulfurase                                    669   0.0     
ref|WP_025922002.1|  MULTISPECIES: cysteine desulfurase                 669   0.0     
ref|WP_027219374.1|  cysteine desulfurase                               669   0.0     
ref|WP_025958165.1|  cysteine desulfurase                               669   0.0     
ref|WP_020080099.1|  cysteine desulfurase activator complex subun...    669   0.0     
ref|WP_036120702.1|  cysteine desulfurase                               669   0.0     
dbj|BAO54949.1|  iron-sulfur cluster assembly protein SufB              669   0.0     
ref|YP_007627437.1|  cysteine desulfurase activator complex subun...    669   0.0     
ref|WP_025980130.1|  cysteine desulfurase                               669   0.0     
ref|WP_013219705.1|  cysteine desulfurase activator complex subun...    669   0.0     
ref|WP_025924032.1|  cysteine desulfurase                               669   0.0     
ref|WP_026776246.1|  cysteine desulfurase                               669   0.0     
ref|WP_008630656.1|  Iron-sulfur cluster assembly protein SufB          669   0.0     
ref|WP_015812042.1|  cysteine desulfurase activator complex subun...    669   0.0     
ref|WP_025934682.1|  MULTISPECIES: cysteine desulfurase                 669   0.0     
ref|WP_025813024.1|  cysteine desulfurase                               670   0.0     
gb|AIQ94120.1|  Iron-sulfur cluster assembly protein SufB               669   0.0     
ref|YP_001936388.1|  putative ABC transporter                           669   0.0     
ref|WP_019540843.1|  cysteine desulfurase activator complex subun...    669   0.0     
ref|WP_025944987.1|  MULTISPECIES: cysteine desulfurase                 669   0.0     
ref|WP_006930149.1|  cysteine desulfurase activator complex subun...    669   0.0     
ref|WP_025890243.1|  MULTISPECIES: cysteine desulfurase                 669   0.0     
gb|KFE65437.1|  Iron-sulfur cluster assembly protein SufB               669   0.0     
ref|WP_011817563.1|  cysteine desulfurase activator complex subun...    669   0.0     
ref|WP_014104869.1|  cysteine desulfarase                               669   0.0     
ref|WP_025963455.1|  cysteine desulfurase                               669   0.0     
ref|WP_004569445.1|  cysteine desulfurase activator complex subun...    669   0.0     
ref|WP_025962109.1|  cysteine desulfurase                               669   0.0     
ref|YP_009092930.1|  iron-sulfur cluster formation ABC transporter      669   0.0     
ref|WP_028892187.1|  cysteine desulfurase                               669   0.0     
ref|WP_007101520.1|  cysteine desulfurase activator complex subun...    669   0.0     
ref|WP_011689309.1|  cysteine desulfurase activator complex subun...    669   0.0     
ref|WP_025965162.1|  cysteine desulfurase                               668   0.0     
gb|AHF64685.1|  FeS assembly protein SufB                               668   0.0     
ref|WP_024741056.1|  cysteine desulfurase                               668   0.0     
ref|WP_014561735.1|  cysteine desulfurase activator complex subun...    668   0.0     
ref|WP_025941147.1|  cysteine desulfurase                               668   0.0     
ref|WP_010665522.1|  cysteine desulfurase activator complex subun...    668   0.0     
ref|WP_029923359.1|  cysteine desulfurase                               668   0.0     
ref|WP_010946338.1|  cysteine desulfurase activator complex subun...    668   0.0     
ref|WP_036911608.1|  MULTISPECIES: cysteine desulfurase                 668   0.0     
ref|WP_015481354.1|  cysteine desulfurase activator complex subun...    668   0.0     
ref|WP_026965951.1|  cysteine desulfurase                               668   0.0     
ref|WP_009454374.1|  MULTISPECIES: hypothetical protein                 668   0.0     
ref|WP_036784466.1|  cysteine desulfurase                               668   0.0     
ref|WP_011131711.1|  cysteine desulfurase activator complex subun...    668   0.0     
ref|WP_011710979.1|  cysteine desulfurase activator complex subun...    668   0.0     
ref|WP_007399806.1|  cysteine desulfarase                               668   0.0     
gb|KGN84070.1|  cysteine desulfurase                                    668   0.0     
ref|WP_011375639.1|  cysteine desulfurase activator complex subun...    667   0.0     
ref|WP_021071084.1|  cysteine desulfurase activator complex subun...    667   0.0     
ref|YP_009029216.1|  iron-sulfur cluster formation ABC transporter      668   0.0     
ref|WP_011485150.1|  cysteine desulfurase activator complex subun...    667   0.0     
ref|WP_011359229.1|  cysteine desulfurase activator complex subun...    667   0.0     
dbj|BAP18453.1|  cysteine desulfurase activator complex subunit SufB    667   0.0     
ref|WP_009790591.1|  cysteine desulfurase activator complex subun...    667   0.0     
ref|WP_026870539.1|  cysteine desulfurase                               667   0.0     
ref|WP_028380800.1|  cysteine desulfurase                               667   0.0     
ref|WP_028483637.1|  cysteine desulfurase                               667   0.0     
ref|WP_021667690.1|  FeS assembly protein SufB                          667   0.0     
ref|WP_006558284.1|  cysteine desulfarase                               668   0.0     
ref|WP_011985218.1|  cysteine desulfurase activator complex subun...    667   0.0     
ref|WP_025931240.1|  MULTISPECIES: cysteine desulfurase                 667   0.0     
ref|WP_036519505.1|  cysteine desulfurase                               667   0.0     
ref|WP_025959587.1|  MULTISPECIES: cysteine desulfurase                 667   0.0     
ref|WP_027223651.1|  cysteine desulfurase                               667   0.0     
ref|WP_010421725.1|  cysteine desulfurase activator complex subun...    667   0.0     
dbj|GAK44610.1|  FeS assembly protein SufB                              667   0.0     
ref|WP_011214820.1|  cysteine desulfurase activator complex subun...    667   0.0     
ref|WP_025880123.1|  MULTISPECIES: cysteine desulfurase                 667   0.0     
ref|WP_032519816.1|  cysteine desulfurase                               667   0.0     
ref|WP_017774003.1|  cysteine desulfurase activator complex subun...    667   0.0     
ref|WP_011124241.1|  MULTISPECIES: cysteine desulfurase activator...    667   0.0     
ref|WP_026980627.1|  cysteine desulfurase                               667   0.0     
ref|WP_025932908.1|  cysteine desulfurase                               667   0.0     
ref|WP_028212498.1|  cysteine desulfurase                               667   0.0     
gb|KGG22384.1|  Iron-sulfur cluster assembly protein SufB               667   0.0     
ref|WP_032515486.1|  cysteine desulfurase                               667   0.0     
ref|WP_023572585.1|  cysteine desulfurase activator complex subun...    667   0.0     
ref|WP_024302717.1|  cysteine desulfurase                               667   0.0     
ref|WP_032525778.1|  cysteine desulfurase                               666   0.0     
ref|WP_026631702.1|  cysteine desulfurase                               667   0.0     
emb|CEA15783.1|  UPF0051 protein                                        667   0.0     
ref|WP_025937880.1|  cysteine desulfurase                               666   0.0     
ref|YP_002049286.1|  FeS assembly protein SufB                          666   0.0     
ref|WP_013929527.1|  cysteine desulfurase activator complex subun...    666   0.0     
ref|WP_036313855.1|  cysteine desulfurase                               666   0.0     
ref|WP_011824982.1|  cysteine desulfurase activator complex subun...    666   0.0     
ref|WP_032523003.1|  cysteine desulfurase                               666   0.0     
ref|WP_028729843.1|  cysteine desulfurase                               666   0.0     
emb|CEG60306.1|  component of SufBCD complex                            666   0.0     
ref|WP_025964043.1|  cysteine desulfurase                               666   0.0     
ref|WP_005468047.1|  FeS assembly protein SufB                          666   0.0     
ref|WP_027271320.1|  cysteine desulfurase                               666   0.0     
ref|WP_036901764.1|  cysteine desulfurase                               666   0.0     
ref|WP_023578248.1|  cysteine desulfurase activator complex subun...    666   0.0     
ref|WP_032516837.1|  cysteine desulfurase                               665   0.0     
ref|WP_011936432.1|  cysteine desulfurase activator complex subun...    666   0.0     
ref|WP_009096800.1|  cysteine desulfurase activator complex subun...    666   0.0     
ref|WP_038080979.1|  cysteine desulfurase                               665   0.0     
ref|WP_012524952.1|  cysteine desulfurase activator complex subun...    665   0.0     
ref|WP_003634653.1|  cysteine desulfurase activator complex subun...    665   0.0     
ref|WP_027414221.1|  cysteine desulfurase                               665   0.0     
ref|WP_026952105.1|  cysteine desulfurase                               665   0.0     
ref|WP_022806965.1|  cysteine desulfurase activator complex subun...    665   0.0     
ref|WP_014326640.1|  cysteine desulfurase activator complex subun...    665   0.0     
ref|WP_025951758.1|  cysteine desulfurase                               665   0.0     
ref|WP_027329051.1|  cysteine desulfurase                               665   0.0     
ref|WP_034842048.1|  cysteine desulfurase                               665   0.0     
ref|WP_024768559.1|  cysteine desulfurase                               665   0.0     
ref|YP_003735010.1|  iron-sulfur cluster formation ABC transporter      665   0.0     
ref|WP_028071043.1|  cysteine desulfurase                               665   0.0     
ref|WP_023173300.1|  cysteine desulfurase activator complex subun...    665   0.0     
ref|WP_012554878.1|  cysteine desulfarase                               665   0.0     
ref|WP_025528879.1|  cysteine desulfurase                               665   0.0     
ref|WP_010512921.1|  cysteine desulfarase                               665   0.0     
ref|WP_036602980.1|  cysteine desulfurase                               665   0.0     
ref|WP_021999138.1|  feS assembly protein SufB                          665   0.0     
ref|WP_008611624.1|  cysteine desulfurase activator complex subun...    664   0.0     
ref|WP_028952850.1|  cysteine desulfurase                               664   0.0     
ref|WP_026465052.1|  cysteine desulfurase                               664   0.0     
ref|WP_012227382.1|  cysteine desulfarase                               665   0.0     
ref|WP_014243902.1|  cysteine desulfurase activator complex subun...    664   0.0     
ref|WP_008291349.1|  cysteine desulfurase activator complex subun...    664   0.0     
ref|WP_008943375.1|  cysteine desulfarase                               664   0.0     
ref|WP_015436401.1|  cysteine desulfurase activator complex subun...    664   0.0     
ref|WP_028372688.1|  cysteine desulfurase                               664   0.0     
ref|WP_013667267.1|  cysteine desulfurase activator complex subun...    664   0.0     
ref|WP_015030795.1|  cysteine desulfurase activator complex subun...    664   0.0     
ref|WP_002807626.1|  cysteine desulfurase activator complex subun...    664   0.0     



>ref|XP_004234480.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Solanum 
lycopersicum]
Length=548

 Score =  1014 bits (2623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/545 (88%), Positives = 513/545 (94%), Gaps = 3/545 (1%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNFKVRAEA---KVTIDAPGKQ  1820
             L+T GIS FS QP+ E PK  K SQ L K +N R  N R  KV+A     + TID+PGK+
Sbjct  4     LVTNGISCFSPQPITEQPKLSKGSQFLLKLANPRNPNSRILKVKAAELSYEATIDSPGKE  63

Query  1819  PSPSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRL  1640
              S STSNE+DPLQKFLKRDYKWGFNQEIDSF+LPKGLS ET++LIS RKNEP+WMLEFRL
Sbjct  64    SSVSTSNENDPLQKFLKRDYKWGFNQEIDSFSLPKGLSAETVKLISGRKNEPNWMLEFRL  123

Query  1639  KSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPL  1460
             KSYE+F+ MKEPKWSDNRYPEI+FQDICYYSEPKKKPTLNSLDEADPELIKYF+KLGVPL
Sbjct  124   KSYEKFLKMKEPKWSDNRYPEISFQDICYYSEPKKKPTLNSLDEADPELIKYFDKLGVPL  183

Query  1459  NERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSE  1280
             NERNRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAIREYPDLV+KYLGRVVP E
Sbjct  184   NERNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIREYPDLVKKYLGRVVPPE  243

Query  1279  DNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYL  1100
             DNFY ALNSAVFSDGSFVY+PKNTRCPMQISTYFRINAMETGQFERT+I+A++ SFVEYL
Sbjct  244   DNFYAALNSAVFSDGSFVYIPKNTRCPMQISTYFRINAMETGQFERTVIIAEEGSFVEYL  303

Query  1099  EGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGS  920
             EGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGI+NFVTKRG+CAG+
Sbjct  304   EGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIYNFVTKRGICAGA  363

Query  919   RSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRS  740
             RSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRS
Sbjct  364   RSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRS  423

Query  739   RIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSAR  560
             RIISKGISAGHSRNCYRGLVQV+SSADNA+NSSQCDSMLIG+ AAANTYPYIQ+KNP+AR
Sbjct  424   RIISKGISAGHSRNCYRGLVQVLSSADNAKNSSQCDSMLIGDTAAANTYPYIQSKNPTAR  483

Query  559   IEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKL  380
             IEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKL
Sbjct  484   IEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKL  543

Query  379   EGSVG  365
             EGSVG
Sbjct  544   EGSVG  548



>ref|XP_006343292.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Solanum 
tuberosum]
Length=548

 Score =  1011 bits (2615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/545 (88%), Positives = 510/545 (94%), Gaps = 3/545 (1%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNFKVRAEA---KVTIDAPGKQ  1820
             LLT GIS FS QP+ E PK  K SQ L K +N R  N R  KV+A     + TID PGK+
Sbjct  4     LLTNGISCFSPQPITEQPKLPKGSQFLLKLANPRNPNSRILKVKAAELSYEATIDTPGKE  63

Query  1819  PSPSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRL  1640
              S STSNE+DPLQKFLKRDYKWGFNQEIDSF+LPKGLS ET++LIS RKNEP WMLEFRL
Sbjct  64    SSVSTSNENDPLQKFLKRDYKWGFNQEIDSFSLPKGLSAETVKLISGRKNEPSWMLEFRL  123

Query  1639  KSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPL  1460
             KSYE+F+ MKEPKWSDN+YPEI+FQDICYYSEPKKKPTLNSLDEADPELIKYFEKLG+PL
Sbjct  124   KSYEKFLKMKEPKWSDNKYPEISFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGIPL  183

Query  1459  NERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSE  1280
             NERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLV+KYLGRVVP E
Sbjct  184   NERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVKKYLGRVVPPE  243

Query  1279  DNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYL  1100
             DNFY ALNSAVFSDGSFVY+PKNTRCPMQISTYFRINAMETGQFERT+I+A++ SFVEYL
Sbjct  244   DNFYAALNSAVFSDGSFVYIPKNTRCPMQISTYFRINAMETGQFERTVIIAEEGSFVEYL  303

Query  1099  EGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGS  920
             EGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEG GGI+NFVTKRG+CAG+
Sbjct  304   EGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGVGGIYNFVTKRGICAGA  363

Query  919   RSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRS  740
             RSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRS
Sbjct  364   RSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRS  423

Query  739   RIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSAR  560
             RIISKGISAGHSRNCYRGLVQV+SSADNA+NSSQCDSMLIG+ AAANTYPYIQ+KNP+AR
Sbjct  424   RIISKGISAGHSRNCYRGLVQVLSSADNAKNSSQCDSMLIGDTAAANTYPYIQSKNPTAR  483

Query  559   IEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKL  380
             +EHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKL
Sbjct  484   MEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKL  543

Query  379   EGSVG  365
             EGSVG
Sbjct  544   EGSVG  548



>ref|XP_009760612.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Nicotiana 
sylvestris]
Length=546

 Score =  1003 bits (2593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/544 (89%), Positives = 509/544 (94%), Gaps = 3/544 (1%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNFKVRAEAKVTID--APGKQP  1817
             LLT GIS F  Q + E PK  K S  L K    R  N  NFK+RA A V+ D  APGK+ 
Sbjct  4     LLTNGISSFCPQHITEQPKLSKGSNFLLKSPAPRCPNSANFKIRA-ADVSYDVMAPGKES  62

Query  1816  SPSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLK  1637
             S STSNEDDPLQKFLKRDYKWGFN++I+SF+LPKGLSEETIRLISSRKNEPDWMLE+RLK
Sbjct  63    SFSTSNEDDPLQKFLKRDYKWGFNEKIESFSLPKGLSEETIRLISSRKNEPDWMLEYRLK  122

Query  1636  SYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLN  1457
             SYE+F+ MKEPKWSDN+YPEINFQDI YYSEPKKKPTLNSLDEADPEL++YF+KLGVPLN
Sbjct  123   SYEKFVKMKEPKWSDNKYPEINFQDIVYYSEPKKKPTLNSLDEADPELVRYFDKLGVPLN  182

Query  1456  ERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSED  1277
             ERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIRE+PDLVRKYL RVVP ED
Sbjct  183   ERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREHPDLVRKYLFRVVPPED  242

Query  1276  NFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLE  1097
             NFY ALNSAVFSDGSFVY+PKNT+CPMQISTYFRINAMETGQFERTLIVAD+ SFVEYLE
Sbjct  243   NFYAALNSAVFSDGSFVYIPKNTKCPMQISTYFRINAMETGQFERTLIVADEGSFVEYLE  302

Query  1096  GCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSR  917
             GCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGI+NFVTKRGLCAG+R
Sbjct  303   GCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIYNFVTKRGLCAGAR  362

Query  916   SKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSR  737
             SKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSR
Sbjct  363   SKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSR  422

Query  736   IISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARI  557
             IISKGISAGHSRNCYRGLVQV+S+A+NARNSSQCDSMLIG+NAAANTYPYIQ KNPSARI
Sbjct  423   IISKGISAGHSRNCYRGLVQVLSNAENARNSSQCDSMLIGDNAAANTYPYIQAKNPSARI  482

Query  556   EHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLE  377
             EHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLE
Sbjct  483   EHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLE  542

Query  376   GSVG  365
             GSVG
Sbjct  543   GSVG  546



>ref|XP_006348105.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Solanum 
tuberosum]
Length=546

 Score =   998 bits (2579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/543 (87%), Positives = 508/543 (94%), Gaps = 1/543 (0%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNFKVRA-EAKVTIDAPGKQPS  1814
             LLT GIS F  Q + E PK  K S  LP P   R  N  NFK++A +AK T++ PGK+ S
Sbjct  4     LLTNGISRFCPQSITEQPKLPKGSNFLPNPPAPRISNSGNFKIKAADAKATVEVPGKESS  63

Query  1813  PSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKS  1634
              S SNE+DPLQKFLKRDYKWGFN+ I+SF LPKGLSEETIRLISSRKNEP+WMLE+RLKS
Sbjct  64    LSISNENDPLQKFLKRDYKWGFNENIESFALPKGLSEETIRLISSRKNEPEWMLEYRLKS  123

Query  1633  YERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNE  1454
             YE+F+ MKEPKWSDN+YPEI+FQ+ICYYSEPKKKPTL+SLDEADPEL++YF+KLG+PLNE
Sbjct  124   YEKFVKMKEPKWSDNQYPEIDFQNICYYSEPKKKPTLDSLDEADPELVRYFDKLGIPLNE  183

Query  1453  RNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDN  1274
             RNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYL RVVP EDN
Sbjct  184   RNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLFRVVPPEDN  243

Query  1273  FYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEG  1094
             FY ALNSAVFSDGSFVY+PKNT+CPMQISTYFRINAMETGQFERTLIVAD+ SFVEYLEG
Sbjct  244   FYAALNSAVFSDGSFVYIPKNTKCPMQISTYFRINAMETGQFERTLIVADEGSFVEYLEG  303

Query  1093  CTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRS  914
             CTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGI+NFVTKRG+CAG+RS
Sbjct  304   CTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIYNFVTKRGICAGARS  363

Query  913   KISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRI  734
             KISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRI
Sbjct  364   KISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRI  423

Query  733   ISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIE  554
             ISKGISAG+SRNCYRGLVQV+SSA+NARNSSQCDSMLIG+ AAANTYPYIQ KNPSA+IE
Sbjct  424   ISKGISAGNSRNCYRGLVQVLSSAENARNSSQCDSMLIGDKAAANTYPYIQAKNPSAQIE  483

Query  553   HEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEG  374
             HEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEG
Sbjct  484   HEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEG  543

Query  373   SVG  365
             SVG
Sbjct  544   SVG  546



>ref|XP_004232719.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic [Solanum lycopersicum]
Length=546

 Score =   993 bits (2567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/543 (87%), Positives = 506/543 (93%), Gaps = 1/543 (0%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNFKVRA-EAKVTIDAPGKQPS  1814
             LLT GIS F  Q + E PK  K    LP     +  NP NFK++A +AK T++ PGK+ S
Sbjct  4     LLTNGISHFCPQSIAEQPKLPKGYNFLPNSPGPKISNPGNFKIKAADAKATVEVPGKESS  63

Query  1813  PSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKS  1634
              S SNE DPLQKFLKRDYKWGFN+ I+SF LPKGLSE+TIRLISSRKNEP+WMLE+RLKS
Sbjct  64    LSISNEGDPLQKFLKRDYKWGFNENIESFALPKGLSEDTIRLISSRKNEPEWMLEYRLKS  123

Query  1633  YERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNE  1454
             YE+F+ MKEPKWSDN+YPEI+FQ+ICYYSEPKKKPTL+SLDEADPEL++YF+KLG+PLNE
Sbjct  124   YEKFVKMKEPKWSDNQYPEIDFQNICYYSEPKKKPTLDSLDEADPELVRYFDKLGIPLNE  183

Query  1453  RNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDN  1274
             RNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYL RVVP EDN
Sbjct  184   RNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLFRVVPPEDN  243

Query  1273  FYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEG  1094
             FY ALNSAVFSDGSFVY+PKNT+CPMQISTYFRINAMETGQFERTLIVAD+ SFVEYLEG
Sbjct  244   FYAALNSAVFSDGSFVYIPKNTKCPMQISTYFRINAMETGQFERTLIVADEGSFVEYLEG  303

Query  1093  CTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRS  914
             CTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGI+NFVTKRG+CAG+RS
Sbjct  304   CTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIYNFVTKRGICAGARS  363

Query  913   KISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRI  734
             KISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKM+HKGKNTRSRI
Sbjct  364   KISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMVHKGKNTRSRI  423

Query  733   ISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIE  554
             ISKGISAG+SRNCYRGLVQV+SSA+NARNSSQCDSMLIG+ AAANTYPYIQ KNPSARIE
Sbjct  424   ISKGISAGNSRNCYRGLVQVLSSAENARNSSQCDSMLIGDKAAANTYPYIQAKNPSARIE  483

Query  553   HEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEG  374
             HEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEG
Sbjct  484   HEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEG  543

Query  373   SVG  365
             SVG
Sbjct  544   SVG  546



>ref|XP_011096078.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic [Sesamum indicum]
Length=545

 Score =   990 bits (2560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/547 (87%), Positives = 505/547 (92%), Gaps = 10/547 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPR-NFKVRA----EAKVTIDAPG  1826
             LLT GIS FS QPV E  K   +    PK    R  + R +FK+RA    E K TID+PG
Sbjct  4     LLTNGISPFSSQPVSELAKG-SSLHFTPKSPVYRNPSSRTSFKIRADVGYEPKTTIDSPG  62

Query  1825  KQPSPSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEF  1646
             K+    +S++DDPLQKFLKRDYKWGF QEIDSF++PKGLSEETIRLISSRK EPDWMLEF
Sbjct  63    KK----SSDDDDPLQKFLKRDYKWGFTQEIDSFSIPKGLSEETIRLISSRKGEPDWMLEF  118

Query  1645  RLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGV  1466
             RLKSYE+F+ MKEPKWSDN+YP I+FQDICYYSEPKKKPTLNSLDEADPELI+YF+KLGV
Sbjct  119   RLKSYEKFVKMKEPKWSDNQYPRIDFQDICYYSEPKKKPTLNSLDEADPELIRYFDKLGV  178

Query  1465  PLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVP  1286
             PLNERNRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAIREYPDL+RKYLGRVVP
Sbjct  179   PLNERNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIREYPDLIRKYLGRVVP  238

Query  1285  SEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVE  1106
             ++DNFY ALNSAVFSDGSFVY+PKNT+CPMQISTYFRINAMETGQFERTLIVAD+ SFVE
Sbjct  239   ADDNFYAALNSAVFSDGSFVYIPKNTKCPMQISTYFRINAMETGQFERTLIVADEGSFVE  298

Query  1105  YLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCA  926
             YLEGCTAPSYDTNQLHAAVVELYCH  AEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLC 
Sbjct  299   YLEGCTAPSYDTNQLHAAVVELYCHAAAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCE  358

Query  925   GSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNT  746
             G RSKISWTQVETGSAITWKYPSV+LEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNT
Sbjct  359   GPRSKISWTQVETGSAITWKYPSVILEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNT  418

Query  745   RSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPS  566
             RSRIISKGISAGHSRNCYRGLVQVMS+ADNARNSSQCDSMLIG+ AAANTYPYIQTKNP+
Sbjct  419   RSRIISKGISAGHSRNCYRGLVQVMSNADNARNSSQCDSMLIGDKAAANTYPYIQTKNPT  478

Query  565   ARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSL  386
             ARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSL
Sbjct  479   ARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSL  538

Query  385   KLEGSVG  365
             KLEGSVG
Sbjct  539   KLEGSVG  545



>ref|XP_009789020.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Nicotiana 
sylvestris]
Length=546

 Score =   983 bits (2541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/544 (86%), Positives = 504/544 (93%), Gaps = 3/544 (1%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNFKVRAE--AKVTIDAPGKQP  1817
             L+T GIS FS Q + E PK  K  Q L K +  R  N RN KV+A   A  T+D PGK  
Sbjct  4     LVTNGISCFSPQQITEQPKLPKGCQFLQKSAVPRNPNSRNLKVKAAELANTTLDTPGKDS  63

Query  1816  SPSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLK  1637
             S ST NE DPLQKFLKRDYKWGFN++I+SF LPKGLSEET++LIS++KNEP WMLEFRLK
Sbjct  64    SFST-NEIDPLQKFLKRDYKWGFNEKIESFALPKGLSEETVKLISAKKNEPSWMLEFRLK  122

Query  1636  SYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLN  1457
             +YE+F+ MKEP WSDNRYPEINFQDI YYSEPKKKPTLNSLDEADPELIKYF+KLGVPLN
Sbjct  123   AYEKFIKMKEPNWSDNRYPEINFQDIVYYSEPKKKPTLNSLDEADPELIKYFDKLGVPLN  182

Query  1456  ERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSED  1277
             ERNRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAIREYPDLV+KYLGRVVP ED
Sbjct  183   ERNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIREYPDLVKKYLGRVVPPED  242

Query  1276  NFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLE  1097
             NFY ALNSAVFSDGSFVY+PKNTRCPMQISTYFRINAMETGQFERT+I+A++ SFVEYLE
Sbjct  243   NFYAALNSAVFSDGSFVYIPKNTRCPMQISTYFRINAMETGQFERTVIIAEEGSFVEYLE  302

Query  1096  GCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSR  917
             GCTAP+YDTNQLHAAVVELYC EGAEIKYSTVQNWYAGDEEG+GGI+NFVTKRGLCAG+R
Sbjct  303   GCTAPAYDTNQLHAAVVELYCDEGAEIKYSTVQNWYAGDEEGKGGIYNFVTKRGLCAGAR  362

Query  916   SKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSR  737
             SKISWTQVETGSAITWKYPSV+LEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSR
Sbjct  363   SKISWTQVETGSAITWKYPSVLLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSR  422

Query  736   IISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARI  557
             IISKGISAGHSRNCYRGLVQV+S+A+NA+NSSQCDSMLIG+ AAANTYPYIQ+KNP+ARI
Sbjct  423   IISKGISAGHSRNCYRGLVQVLSNAENAKNSSQCDSMLIGDTAAANTYPYIQSKNPTARI  482

Query  556   EHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLE  377
             EHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLE
Sbjct  483   EHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLE  542

Query  376   GSVG  365
             GSVG
Sbjct  543   GSVG  546



>ref|XP_009595799.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic [Nicotiana tomentosiformis]
Length=546

 Score =   979 bits (2531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/544 (86%), Positives = 500/544 (92%), Gaps = 3/544 (1%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNFKVRAE--AKVTIDAPGKQP  1817
             L+T GIS  S Q + E PK  K  Q   K +  R  N RN KV+A   A  T++ PGK  
Sbjct  4     LVTNGISCLSPQQITEQPKLPKGCQFFQKSATPRNPNSRNLKVKAAELANTTLETPGKDS  63

Query  1816  SPSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLK  1637
             S ST NE DPLQKFLKRDYKWGFN+ I+SF LPKGLSEET++LIS RKNEP WMLEFRLK
Sbjct  64    SFST-NEIDPLQKFLKRDYKWGFNENIESFALPKGLSEETVKLISLRKNEPSWMLEFRLK  122

Query  1636  SYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLN  1457
             SYE+F+ MKEP WSDNRYPEINFQDI YYSEPKKKPTLNSLDEADPELIKYF+KLGVPLN
Sbjct  123   SYEKFIKMKEPNWSDNRYPEINFQDIVYYSEPKKKPTLNSLDEADPELIKYFDKLGVPLN  182

Query  1456  ERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSED  1277
             ERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLV+KYLGRVVP ED
Sbjct  183   ERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVKKYLGRVVPPED  242

Query  1276  NFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLE  1097
             NFY ALNSAVFSDGSFVY+PK+TRCPMQISTYFRINAMETGQFERT+I+A++ SFVEYLE
Sbjct  243   NFYAALNSAVFSDGSFVYIPKHTRCPMQISTYFRINAMETGQFERTVIIAEEGSFVEYLE  302

Query  1096  GCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSR  917
             GCTAP+YDTNQLHAAVVELYC EGAEIKYSTVQNWYAGDEEG+GGI+NFVTKRGLCAG+R
Sbjct  303   GCTAPAYDTNQLHAAVVELYCDEGAEIKYSTVQNWYAGDEEGKGGIYNFVTKRGLCAGAR  362

Query  916   SKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSR  737
             SKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSR
Sbjct  363   SKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSR  422

Query  736   IISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARI  557
             IISKGISAGHSRNCYRGLVQV+S+A+NA+NSSQCDSMLIG+ AAANTYPYIQ+KNP+ARI
Sbjct  423   IISKGISAGHSRNCYRGLVQVLSNAENAKNSSQCDSMLIGDTAAANTYPYIQSKNPTARI  482

Query  556   EHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLE  377
             EHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLE
Sbjct  483   EHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLE  542

Query  376   GSVG  365
             GSVG
Sbjct  543   GSVG  546



>gb|AAX36074.1| non-intrinsic ABC protein [Nicotiana benthamiana]
Length=546

 Score =   978 bits (2527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/544 (86%), Positives = 503/544 (92%), Gaps = 3/544 (1%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNFKVRAE--AKVTIDAPGKQP  1817
             L+T GIS FS Q + E PK  K  Q L K +  R  N RN KV+A      T++ PGK  
Sbjct  4     LVTNGISCFSPQQITEQPKLPKGCQFLQKSATSRYPNSRNLKVKAAELTSSTLETPGKDS  63

Query  1816  SPSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLK  1637
             S ST NE+D LQKFLKRDYKWGFN++I+SF LPKGLSEET++LIS++K+EP WMLEFRLK
Sbjct  64    SFST-NENDQLQKFLKRDYKWGFNEKIESFALPKGLSEETVKLISAKKSEPSWMLEFRLK  122

Query  1636  SYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLN  1457
             SYE+F+ MKEP WSDNRYP+I+FQDI YYSEPKKKPTLNSLDEADPELIKYF+KLGVPLN
Sbjct  123   SYEKFIKMKEPNWSDNRYPDIDFQDIVYYSEPKKKPTLNSLDEADPELIKYFDKLGVPLN  182

Query  1456  ERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSED  1277
             ERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLV+KYLGRVVP ED
Sbjct  183   ERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVKKYLGRVVPPED  242

Query  1276  NFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLE  1097
             NFY ALNSAVFSDGSFVY+PKNTRCPMQISTYFRINAMETGQFERT+I+A++ SFVEYLE
Sbjct  243   NFYAALNSAVFSDGSFVYIPKNTRCPMQISTYFRINAMETGQFERTVIIAEEGSFVEYLE  302

Query  1096  GCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSR  917
             GCTAP+YDTNQLHAAVVELYC EGAEIKYSTVQNWYAGDEEG+GGI+NFVTKRGLCAG+R
Sbjct  303   GCTAPAYDTNQLHAAVVELYCDEGAEIKYSTVQNWYAGDEEGKGGIYNFVTKRGLCAGAR  362

Query  916   SKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSR  737
             SKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSR
Sbjct  363   SKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSR  422

Query  736   IISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARI  557
             IISKGISAGHSRNCYRGLVQV+S+A+NA+NSSQCDSMLIG+ AAANTYPYIQ+KNP+ARI
Sbjct  423   IISKGISAGHSRNCYRGLVQVLSNAENAKNSSQCDSMLIGDTAAANTYPYIQSKNPTARI  482

Query  556   EHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLE  377
             EHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLE
Sbjct  483   EHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLE  542

Query  376   GSVG  365
             GSVG
Sbjct  543   GSVG  546



>emb|CDP09652.1| unnamed protein product [Coffea canephora]
Length=554

 Score =   971 bits (2510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/551 (86%), Positives = 511/551 (93%), Gaps = 9/551 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQV-LPK--PSNLRTQ-NPRNFKVRA----EAKVTID  1835
             LL  GIS FS Q + EPPK  K     +PK  P++++ Q + R  ++RA    E K T+D
Sbjct  4     LLANGISSFSPQSLAEPPKISKGFLFRIPKLSPNHVKVQQSSRMVRIRADVSYEPKTTMD  63

Query  1834  APGKQPSPSTSNEDD-PLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDW  1658
             APGK  S STS+++D PLQKFL+R+YKWGF QEIDSF++PKGLSEETIRLISSRK EPDW
Sbjct  64    APGKDSSTSTSSDEDDPLQKFLRREYKWGFTQEIDSFSIPKGLSEETIRLISSRKKEPDW  123

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             MLEFRLKSY++F  MKEPKWSDN+YP I+FQ+ICYYSEPKKKPTLNSLDEADPELI+YF+
Sbjct  124   MLEFRLKSYDKFGRMKEPKWSDNKYPPIDFQNICYYSEPKKKPTLNSLDEADPELIRYFD  183

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             +LGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAI+EYPDLV KYLG
Sbjct  184   RLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIKEYPDLVGKYLG  243

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
             RVVP +DNFY +LNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVAD+ 
Sbjct  244   RVVPPDDNFYASLNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADEG  303

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEG+GGIFNFVTKR
Sbjct  304   SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGKGGIFNFVTKR  363

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             GLCAG+RSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK
Sbjct  364   GLCAGARSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  423

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQT  578
             GKNTRSRIISKGISAGHSRNCYRGLVQVMS+ADNARNSSQCDSMLIG+NAAANTYPYIQT
Sbjct  424   GKNTRSRIISKGISAGHSRNCYRGLVQVMSNADNARNSSQCDSMLIGDNAAANTYPYIQT  483

Query  577   KNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  398
             KNP ARIEHEATTSKIGEDQLFYFQQRGI+YEKAMAAMISGFCRDVFNELPDEFGAEVNQ
Sbjct  484   KNPGARIEHEATTSKIGEDQLFYFQQRGIEYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  543

Query  397   LMSLKLEGSVG  365
             LMSLKLEGSVG
Sbjct  544   LMSLKLEGSVG  554



>gb|EYU27801.1| hypothetical protein MIMGU_mgv1a004043mg [Erythranthe guttata]
Length=547

 Score =   964 bits (2492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/549 (84%), Positives = 502/549 (91%), Gaps = 12/549 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPK-SLKASQVLPKPSNLRTQNPR-NFKVRA-----EAKVTIDA  1832
             LLT GIS FS Q V E  K SL         +  R  N R + K+RA     E+K T+D 
Sbjct  4     LLTNGISPFSSQTVSEFSKGSLLYFHPSLNSTVCRNPNSRASLKIRAADVGYESKTTVDY  63

Query  1831  PGKQPSPSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWML  1652
             P K+     S+ DDPLQKFLKRDYKWGF QEIDSFT+PKGLSEET+RLIS+RKNEPDWML
Sbjct  64    PAKK-----SDNDDPLQKFLKRDYKWGFTQEIDSFTIPKGLSEETVRLISARKNEPDWML  118

Query  1651  EFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKL  1472
             EFRLKSYE+F+NMKEP WSDNRYP I+FQ++CYYSEPK KPTLNSL+EADPEL++YF+KL
Sbjct  119   EFRLKSYEKFINMKEPNWSDNRYPRIDFQNLCYYSEPKNKPTLNSLEEADPELVRYFDKL  178

Query  1471  GVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRV  1292
             G+PLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEA+++YPDL++KYLGRV
Sbjct  179   GIPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAVKDYPDLIKKYLGRV  238

Query  1291  VPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSF  1112
             VP++DNFY ALN+AVFSDGSFVY+PK+T+CPMQISTYFRINAMETGQFERTLIVA++ SF
Sbjct  239   VPADDNFYSALNAAVFSDGSFVYIPKDTKCPMQISTYFRINAMETGQFERTLIVAEEGSF  298

Query  1111  VEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGL  932
             VEYLEGCTAPSYDTNQLHAAVVELYCH GA+IKYSTVQNWYAGDEEG+GGI+NFVTKRGL
Sbjct  299   VEYLEGCTAPSYDTNQLHAAVVELYCHAGAQIKYSTVQNWYAGDEEGKGGIYNFVTKRGL  358

Query  931   CAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGK  752
             CAG+RSKISWTQVETGSAITWKYPSV+LEGDESVGEFYSVALTNNYQQADTGTKMIHKGK
Sbjct  359   CAGARSKISWTQVETGSAITWKYPSVILEGDESVGEFYSVALTNNYQQADTGTKMIHKGK  418

Query  751   NTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKN  572
             NT+SRIISKGISAGHSRNCYRGLVQVMSSADNA+NSSQCDSMLIG+ AAANTYPYIQ KN
Sbjct  419   NTKSRIISKGISAGHSRNCYRGLVQVMSSADNAKNSSQCDSMLIGDGAAANTYPYIQAKN  478

Query  571   PSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLM  392
             P+ARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLM
Sbjct  479   PTARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLM  538

Query  391   SLKLEGSVG  365
             SLKLEGSVG
Sbjct  539   SLKLEGSVG  547



>ref|XP_002272917.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic [Vitis vinifera]
Length=554

 Score =   931 bits (2406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/556 (81%), Positives = 492/556 (88%), Gaps = 19/556 (3%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRN--------FKVRAEAKV---  1844
             LL  G+  FS     + PK        PK  +L++ NP+         FKVRA+      
Sbjct  4     LLANGLPRFSPSETPKFPKGF-----CPKLESLKSLNPKTPKNPTSSVFKVRADVGFESK  58

Query  1843  TIDAPGKQPSP---STSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRK  1673
             TID+     SP   +TS+ DD LQK L RDYKWG+ + IDS  +PKGLSE+TIR+IS RK
Sbjct  59    TIDSDSPTASPGKHATSSTDDKLQKILNRDYKWGWFENIDSDAIPKGLSEKTIRMISERK  118

Query  1672  NEPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPEL  1493
             NEPDWMLEFRLKSYE+F+ MKEPKWSDNRYP I+FQD+CYYSEPKKKP+LNSLDEADPEL
Sbjct  119   NEPDWMLEFRLKSYEKFLKMKEPKWSDNRYPPIDFQDMCYYSEPKKKPSLNSLDEADPEL  178

Query  1492  IKYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLV  1313
             ++YF+KLGVPLNE+NRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAIREYPDLV
Sbjct  179   LRYFDKLGVPLNEQNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIREYPDLV  238

Query  1312  RKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLI  1133
             RKYLGRVVPS+DN+Y ALNSAVFSDGSF YVPK+T+CPMQISTYFRINA+ETGQFERTLI
Sbjct  239   RKYLGRVVPSDDNYYAALNSAVFSDGSFCYVPKDTKCPMQISTYFRINALETGQFERTLI  298

Query  1132  VADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFN  953
             VADD SFVEYLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDEEGRGGI+N
Sbjct  299   VADDRSFVEYLEGCTAPSYDRNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEEGRGGIYN  358

Query  952   FVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGT  773
             FVTKRGLC+G+RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQQADTGT
Sbjct  359   FVTKRGLCSGARSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGT  418

Query  772   KMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTY  593
             KMIHKGKNTRSRIISKGISAG+SRNCYRGLVQV S A NARNSSQCDSMLIG+NAAANTY
Sbjct  419   KMIHKGKNTRSRIISKGISAGNSRNCYRGLVQVQSKAKNARNSSQCDSMLIGDNAAANTY  478

Query  592   PYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFG  413
             PYIQ KNP+ARIEHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFC+DVFNELPDEFG
Sbjct  479   PYIQVKNPTARIEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCKDVFNELPDEFG  538

Query  412   AEVNQLMSLKLEGSVG  365
             AEVNQLMSLKLEGSVG
Sbjct  539   AEVNQLMSLKLEGSVG  554



>emb|CAN76788.1| hypothetical protein VITISV_038836 [Vitis vinifera]
Length=554

 Score =   929 bits (2400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/556 (81%), Positives = 491/556 (88%), Gaps = 19/556 (3%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRN--------FKVRAEAKV---  1844
             LL  G+  FS     + PK        PK  +L++ NP+         FKVRA+      
Sbjct  4     LLANGLPRFSPSETPKFPKGF-----CPKLESLKSLNPKTPKNPTSSVFKVRADVGFESK  58

Query  1843  TIDAPGKQPSP---STSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRK  1673
             TID+     SP   +TS+ DD LQK L RDYKWG+ + IDS  +PKGLSE+TIR+IS RK
Sbjct  59    TIDSDSPTASPGKXATSSTDDKLQKILNRDYKWGWFENIDSDAIPKGLSEKTIRMISERK  118

Query  1672  NEPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPEL  1493
             NEP WMLEFRLKSYE+F+ MKEPKWSDNRYP I+FQD+CYYSEPKKKP+LNSLDEADPEL
Sbjct  119   NEPXWMLEFRLKSYEKFLKMKEPKWSDNRYPPIDFQDMCYYSEPKKKPSLNSLDEADPEL  178

Query  1492  IKYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLV  1313
             ++YF+KLGVPLNE+NRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAIREYPDLV
Sbjct  179   LRYFDKLGVPLNEQNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIREYPDLV  238

Query  1312  RKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLI  1133
             RKYLGRVVPS+DN+Y ALNSAVFSDGSF YVPK+T+CPMQISTYFRINA+ETGQFERTLI
Sbjct  239   RKYLGRVVPSDDNYYAALNSAVFSDGSFCYVPKDTKCPMQISTYFRINALETGQFERTLI  298

Query  1132  VADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFN  953
             VADD SFVEYLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDEEGRGGI+N
Sbjct  299   VADDRSFVEYLEGCTAPSYDRNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEEGRGGIYN  358

Query  952   FVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGT  773
             FVTKRGLC+G+RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQQADTGT
Sbjct  359   FVTKRGLCSGARSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGT  418

Query  772   KMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTY  593
             KMIHKGKNTRSRIISKGISAG+SRNCYRGLVQV S A NARNSSQCDSMLIG+NAAANTY
Sbjct  419   KMIHKGKNTRSRIISKGISAGNSRNCYRGLVQVQSKAXNARNSSQCDSMLIGDNAAANTY  478

Query  592   PYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFG  413
             PYIQ KNP+ARIEHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFC+DVFNELPDEFG
Sbjct  479   PYIQVKNPTARIEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCKDVFNELPDEFG  538

Query  412   AEVNQLMSLKLEGSVG  365
             AEVNQLMSLKLEGSVG
Sbjct  539   AEVNQLMSLKLEGSVG  554



>ref|XP_010693663.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=558

 Score =   924 bits (2387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/559 (80%), Positives = 492/559 (88%), Gaps = 21/559 (4%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRT----QNPRNFKVRAEA---KVTIDA  1832
             LL  GIS FS++P  +PP +L    + PK   L+     ++P+  ++RAE      TID+
Sbjct  4     LLANGISSFSLKPCHDPPSTL----IHPKLETLKITTIPRSPKLTRIRAEVGYESTTIDS  59

Query  1831  -PGKQPSP---STSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEP  1664
              PGK  SP   S  ++DDPLQKFLKR+YKWGF ++IDSF +PKGLSEETIR+ISS K EP
Sbjct  60    DPGKSISPAVISKKDDDDPLQKFLKREYKWGFTEKIDSFAIPKGLSEETIRMISSLKEEP  119

Query  1663  DWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKY  1484
             DWMLEFRL SY +F+ M EPKWSDNR+P INFQD+CYYS PKKKPTLNSLDEADPEL+KY
Sbjct  120   DWMLEFRLNSYHKFLKMVEPKWSDNRHPPINFQDMCYYSAPKKKPTLNSLDEADPELLKY  179

Query  1483  FEKLGVPLNERNRLANV------AVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYP  1322
             F+KLGVPL E++RLANV      A+DAVLDSVSIATTHRK LEK GVIFCSISEAI+EYP
Sbjct  180   FDKLGVPLTEQHRLANVSSNKNVAIDAVLDSVSIATTHRKALEKVGVIFCSISEAIKEYP  239

Query  1321  DLVRKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFER  1142
             DLVRKYLG+VV ++DN+Y ALNSAVFSDGSFVY+PK TRCPMQISTYFRINA +TGQFER
Sbjct  240   DLVRKYLGKVVATDDNYYAALNSAVFSDGSFVYIPKGTRCPMQISTYFRINAFDTGQFER  299

Query  1141  TLIVADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGG  962
             TLIV D+ SFVEYLEGCTAPSYDTNQLHAAVVELY  + AEIKYSTVQNWYAGDEEG+GG
Sbjct  300   TLIVGDEGSFVEYLEGCTAPSYDTNQLHAAVVELYAADDAEIKYSTVQNWYAGDEEGKGG  359

Query  961   IFNFVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQAD  782
             I+NFVTKRGLCAG+RSKISWTQVETGSAITWKYPSVVLEGD+SVGEFYSVALTNNYQQAD
Sbjct  360   IYNFVTKRGLCAGARSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQAD  419

Query  781   TGTKMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAA  602
             TGTKMIHKGKNTRSRIISKGISAG+SRN YRGLVQ++S ADNARNSSQCDSMLIG+ AAA
Sbjct  420   TGTKMIHKGKNTRSRIISKGISAGYSRNVYRGLVQILSRADNARNSSQCDSMLIGDKAAA  479

Query  601   NTYPYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPD  422
             NTYPYIQ KNPSAR+EHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPD
Sbjct  480   NTYPYIQVKNPSARVEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPD  539

Query  421   EFGAEVNQLMSLKLEGSVG  365
             EFGAEVNQLMSLKLEGSVG
Sbjct  540   EFGAEVNQLMSLKLEGSVG  558



>ref|XP_002518497.1| Protein sufB, putative [Ricinus communis]
 gb|EEF43884.1| Protein sufB, putative [Ricinus communis]
Length=553

 Score =   920 bits (2378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/550 (81%), Positives = 490/550 (89%), Gaps = 8/550 (1%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNF-KVRAE----AKVTIDAPG  1826
             LL  GIS FS QP+ +  K  K   +  KP+  +   P NF K+RA+    +K      G
Sbjct  4     LLANGISRFSPQPISDSAKLHKPFSLPLKPAFNKAPKPANFVKIRADVGFDSKTRNTDSG  63

Query  1825  KQPSPSTSNEDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWM  1655
                S ST++ DD +++ L+ RDY  K+GF  +IDS+++PKGLSEETIRLISS K EPDWM
Sbjct  64    NNISTSTTSSDDKIREILRNRDYDKKFGFTMDIDSYSIPKGLSEETIRLISSLKEEPDWM  123

Query  1654  LEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEK  1475
             LEFRL ++E+F+ +KEPKWSDNRYP I+FQDICYYS PKKKPTLNSLDEADPEL+ YF++
Sbjct  124   LEFRLNAFEKFLKLKEPKWSDNRYPSIDFQDICYYSAPKKKPTLNSLDEADPELLMYFDR  183

Query  1474  LGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGR  1295
             LGVPLNERNRLANVAVDAVLDSVSIATTHR+TLEK+GVIFCSISEAI+EYPDLVRKYLGR
Sbjct  184   LGVPLNERNRLANVAVDAVLDSVSIATTHRQTLEKAGVIFCSISEAIKEYPDLVRKYLGR  243

Query  1294  VVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSS  1115
             VVPSEDN+Y ALNSAVFSDGSF Y+PK+T+CPMQISTYFRINAMETGQFERTLIVADD S
Sbjct  244   VVPSEDNYYAALNSAVFSDGSFCYIPKDTKCPMQISTYFRINAMETGQFERTLIVADDRS  303

Query  1114  FVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRG  935
             FVEYLEGCTAPSYDTNQLHAAVVELYC EGAEIKYSTVQNWYAGDEEGRGGI+NFVTKRG
Sbjct  304   FVEYLEGCTAPSYDTNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEEGRGGIYNFVTKRG  363

Query  934   LCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKG  755
             LC+G RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQQADTGTKMIHKG
Sbjct  364   LCSGDRSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGTKMIHKG  423

Query  754   KNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTK  575
             KNTRSRIISKGISAG+SRNCYRGLVQ+ S A+NARN SQCDSMLIG+ AAANTYPYIQ K
Sbjct  424   KNTRSRIISKGISAGNSRNCYRGLVQIQSKAENARNLSQCDSMLIGDTAAANTYPYIQVK  483

Query  574   NPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQL  395
             NP+AR+EHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFC+DVFNELPDEFGAEVNQL
Sbjct  484   NPTARVEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCQDVFNELPDEFGAEVNQL  543

Query  394   MSLKLEGSVG  365
             MSLKLEGSVG
Sbjct  544   MSLKLEGSVG  553



>gb|EPS64176.1| hypothetical protein M569_10603 [Genlisea aurea]
Length=547

 Score =   920 bits (2377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/518 (84%), Positives = 480/518 (93%), Gaps = 5/518 (1%)
 Frame = -3

Query  1903  PSNLRTQNPRN-FKVRAEAKVTIDAPGKQPSP----STSNEDDPLQKFLKRDYKWGFNQE  1739
             P   R  N R+ F++RAE +     P  + SP    S+ + DDPLQKFLKRDYKWGF+++
Sbjct  30    PCVSRYPNSRSLFRIRAEVRYDSKTPPLEDSPVKNFSSGDGDDPLQKFLKRDYKWGFSED  89

Query  1738  IDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDI  1559
             IDS ++PKGLSEET+RLISS KNEPDWML+FRLKS+E+F+ MKEPKWSDNRYPEI+FQDI
Sbjct  90    IDSLSIPKGLSEETVRLISSMKNEPDWMLQFRLKSFEKFVGMKEPKWSDNRYPEIDFQDI  149

Query  1558  CYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKT  1379
             CYYSEPKKKPTLNSLDEADPEL++YF+KLGVPLNERNRLANVAVDAVLDSVSIATTHR T
Sbjct  150   CYYSEPKKKPTLNSLDEADPELVRYFDKLGVPLNERNRLANVAVDAVLDSVSIATTHRDT  209

Query  1378  LEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCP  1199
             L+KSGVIFCSISEAIRE+PDL+RKYLGRVVP++DNFY ALNSAVFSDGSFVY+PKNT+CP
Sbjct  210   LQKSGVIFCSISEAIREHPDLIRKYLGRVVPADDNFYAALNSAVFSDGSFVYIPKNTKCP  269

Query  1198  MQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAE  1019
             M ISTYFRINAMETGQFERTLIVAD+ SFVEYLEGCTAPSYD NQLHAAVVELY H  +E
Sbjct  270   MPISTYFRINAMETGQFERTLIVADEGSFVEYLEGCTAPSYDKNQLHAAVVELYGHSDSE  329

Query  1018  IKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGD  839
             IKYSTVQNWY+GDE+GRGGI+NFVTKRG+CAG RSKISWTQVETGSAITWKYPSV+LEGD
Sbjct  330   IKYSTVQNWYSGDEKGRGGIYNFVTKRGMCAGPRSKISWTQVETGSAITWKYPSVILEGD  389

Query  838   ESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSAD  659
              SVGEFYSVALT +YQQADTGTKMIH+GKNTRSRIISKGISAG+SRNCYRGLV++MS AD
Sbjct  390   GSVGEFYSVALTKDYQQADTGTKMIHRGKNTRSRIISKGISAGNSRNCYRGLVRMMSGAD  449

Query  658   NARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEK  479
             NARNSSQCDSMLIG++A ANTYPYIQ+KNPSARIEHEATTSKIGEDQLFYF+QRGIDYEK
Sbjct  450   NARNSSQCDSMLIGDHAEANTYPYIQSKNPSARIEHEATTSKIGEDQLFYFRQRGIDYEK  509

Query  478   AMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             AMAAMISGFCRDVFNELP+EFGAEVNQLMSLKLEGSVG
Sbjct  510   AMAAMISGFCRDVFNELPNEFGAEVNQLMSLKLEGSVG  547



>ref|XP_008441129.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic [Cucumis melo]
Length=554

 Score =   917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/551 (80%), Positives = 485/551 (88%), Gaps = 9/551 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNFKVRAEA----KVTIDAPGK  1823
             LL  GIS F   P  E  K        P+ +NL+    + F+VRA+     K     P  
Sbjct  4     LLANGISRFPHNPTWELQKDAIPKLQSPRIANLKISKSKPFRVRADVGYDPKTANSGPIS  63

Query  1822  Q--PSPSTSNEDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDW  1658
             Q   SPS++  D+ +Q  L+ RDY  K+GF  +IDSF++PKGLS+ETIRLISS K EPDW
Sbjct  64    QGKSSPSSTTTDEKIQDILRNRDYDRKFGFTVDIDSFSIPKGLSKETIRLISSLKEEPDW  123

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             MLEFRL ++E+F+ MKEP WSDNRYP I+FQD+CYYS PKKKPTLNSLDEADPEL+ YF+
Sbjct  124   MLEFRLNAFEKFLKMKEPTWSDNRYPPIDFQDVCYYSAPKKKPTLNSLDEADPELLMYFD  183

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             +LGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAI+EYPDLVRKYLG
Sbjct  184   RLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIKEYPDLVRKYLG  243

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
             RVVPSEDNFY ALNSAVFSDGSF Y+PK+T+CPMQISTYFRINA+ETGQFERTLIVADD 
Sbjct  244   RVVPSEDNFYAALNSAVFSDGSFCYIPKDTKCPMQISTYFRINALETGQFERTLIVADDR  303

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             SFVEYLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDEEG+GG++NFVTKR
Sbjct  304   SFVEYLEGCTAPSYDRNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEEGKGGVYNFVTKR  363

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             GLCAG RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQQADTGTKMIHK
Sbjct  364   GLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGTKMIHK  423

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQT  578
             GKNTRSRIISKGISAG+SRNCYRGLVQV S ADNA+NSSQCDSMLIG++AAANTYPYIQ 
Sbjct  424   GKNTRSRIISKGISAGNSRNCYRGLVQVQSKADNAKNSSQCDSMLIGDSAAANTYPYIQV  483

Query  577   KNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  398
             KNP+ARIEHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ
Sbjct  484   KNPTARIEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  543

Query  397   LMSLKLEGSVG  365
             LMSLKLEGSVG
Sbjct  544   LMSLKLEGSVG  554



>ref|XP_004145110.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004158013.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Cucumis 
sativus]
 gb|KGN64528.1| hypothetical protein Csa_1G063520 [Cucumis sativus]
Length=554

 Score =   917 bits (2370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/551 (80%), Positives = 485/551 (88%), Gaps = 9/551 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNFKVRAEA----KVTIDAPGK  1823
             LL  GIS F   P  E  K        P+ +NL+    + F+VRA+     K     P  
Sbjct  4     LLANGISRFPHNPTWELHKDAIPKLHSPRIANLKISKSKPFRVRADVGYDPKTANSGPIS  63

Query  1822  Q--PSPSTSNEDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDW  1658
             Q   SPS++  D+ +Q  L+ RDY  K+GF  +IDSF++PKGLS+ETIRLISS K EPDW
Sbjct  64    QGKSSPSSTTTDEKIQDILRNRDYDRKFGFTVDIDSFSIPKGLSKETIRLISSLKEEPDW  123

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             MLEFRL ++E+F+ MKEP WSDNRYP I+FQD+CYYS PKKKPTLNSLDEADPEL+ YF+
Sbjct  124   MLEFRLNAFEKFLKMKEPTWSDNRYPPIDFQDVCYYSAPKKKPTLNSLDEADPELLMYFD  183

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             +LGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAI+EYPDLVRKYLG
Sbjct  184   RLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIKEYPDLVRKYLG  243

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
             RVVPSEDNFY ALNSAVFSDGSF Y+PK+T+CPMQISTYFRINA+ETGQFERTLIVADD 
Sbjct  244   RVVPSEDNFYAALNSAVFSDGSFCYIPKDTKCPMQISTYFRINALETGQFERTLIVADDR  303

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             SFVEYLEGCTAPSYD NQLHAAVVELYC EGA+IKYSTVQNWYAGDEEG+GG++NFVTKR
Sbjct  304   SFVEYLEGCTAPSYDRNQLHAAVVELYCAEGAQIKYSTVQNWYAGDEEGKGGVYNFVTKR  363

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             GLCAG RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQQADTGTKMIHK
Sbjct  364   GLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGTKMIHK  423

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQT  578
             GKNTRSRIISKGISAG+SRNCYRGLVQV S ADNA+NSSQCDSMLIG+NAAANTYPYIQ 
Sbjct  424   GKNTRSRIISKGISAGNSRNCYRGLVQVQSKADNAKNSSQCDSMLIGDNAAANTYPYIQV  483

Query  577   KNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  398
             KNP+ARIEHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ
Sbjct  484   KNPTARIEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  543

Query  397   LMSLKLEGSVG  365
             LMSLKLEGSVG
Sbjct  544   LMSLKLEGSVG  554



>ref|XP_010093279.1| UPF0051 protein ABCI8 [Morus notabilis]
 gb|EXB53804.1| UPF0051 protein ABCI8 [Morus notabilis]
Length=560

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/559 (80%), Positives = 493/559 (88%), Gaps = 19/559 (3%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNP------RNFKVRAEA---KVTI  1838
             LL  GIS FS QPV E   S+ +    PK   L+  NP      R F+VRA+    + TI
Sbjct  4     LLANGISSFSPQPVSE--SSMFSKGFHPKLEILKLSNPKSPASRRVFRVRADVGYDQKTI  61

Query  1837  DA-----PGKQPSPSTSNEDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLIS  1682
             +      PGK  + S++  DD +Q+ L  RDY  K+GF+ +IDSF++PKGLS+ETIRLIS
Sbjct  62    NPDLGSLPGKLSTSSSTRTDDKIQEILHNRDYDKKFGFSIDIDSFSIPKGLSKETIRLIS  121

Query  1681  SRKNEPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEAD  1502
             + K EPDWMLEFRL ++E+F+ MKEPKWSDNRYP I+FQD+CYYS PKKKPTLNSLDEAD
Sbjct  122   TLKEEPDWMLEFRLNAFEKFLKMKEPKWSDNRYPPIDFQDMCYYSAPKKKPTLNSLDEAD  181

Query  1501  PELIKYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYP  1322
             PELIKYF++LGVPLNE+NRLANVAVDAVLDSVSIATTHRKTLE +GVIFCSISEAIREYP
Sbjct  182   PELIKYFDRLGVPLNEQNRLANVAVDAVLDSVSIATTHRKTLEAAGVIFCSISEAIREYP  241

Query  1321  DLVRKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFER  1142
             DLVRKYLGRVVPS+DN+Y ALNSAVFSDGSF Y+PK+T+CPMQISTYFRINA+ETGQFER
Sbjct  242   DLVRKYLGRVVPSDDNYYAALNSAVFSDGSFCYIPKDTKCPMQISTYFRINALETGQFER  301

Query  1141  TLIVADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGG  962
             TLIVADD SFVEYLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDEEG GG
Sbjct  302   TLIVADDRSFVEYLEGCTAPSYDRNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEEGNGG  361

Query  961   IFNFVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQAD  782
             I+NFVTKRGLCAG RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNN+QQAD
Sbjct  362   IYNFVTKRGLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNHQQAD  421

Query  781   TGTKMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAA  602
             TGTKMIHKGKNTRSRIISKGISAG SRNCYRGLV+V S A+NARNSSQCDSMLIG+NAAA
Sbjct  422   TGTKMIHKGKNTRSRIISKGISAGKSRNCYRGLVKVQSRAENARNSSQCDSMLIGDNAAA  481

Query  601   NTYPYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPD  422
             NTYPYI+ KNP+ARIEHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPD
Sbjct  482   NTYPYIEVKNPTARIEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPD  541

Query  421   EFGAEVNQLMSLKLEGSVG  365
             EFGAEVNQLMSLKLEGSVG
Sbjct  542   EFGAEVNQLMSLKLEGSVG  560



>ref|XP_002305582.1| ATP-binding-cassette transporter family protein [Populus trichocarpa]
 gb|EEE86093.1| ATP-binding-cassette transporter family protein [Populus trichocarpa]
Length=554

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/551 (80%), Positives = 486/551 (88%), Gaps = 9/551 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNFKVRA----EAKVTIDAPGK  1823
             LL+  IS FS +P+ + PK  K      KP   +      FK+RA    E+K     PG 
Sbjct  4     LLSNTISHFSPKPIKDSPKLNKPFSFQIKPIFFKPSKLNLFKIRADVGFESKTVKTVPGN  63

Query  1822  QPSPSTSN--EDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDW  1658
               +  TS+   DD +++ L+ RDY  K+GFN +IDSFT+PKGLS+ETIRLISS K EPDW
Sbjct  64    SAATGTSSTSSDDKIREILRNRDYNEKFGFNMDIDSFTIPKGLSKETIRLISSLKEEPDW  123

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             ML+FRL ++ERF+ +KEPKWSDN YP I+FQD+CYYS PKKKPT+NSL+EADPELIKYF+
Sbjct  124   MLDFRLNAFERFLKLKEPKWSDNEYPIIDFQDMCYYSAPKKKPTVNSLEEADPELIKYFD  183

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             +LG+PL ERNRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAI++YPDLVRKYLG
Sbjct  184   RLGIPLTERNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIQKYPDLVRKYLG  243

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
             RVVPSEDN+Y ALNSAVFSDGSF YVPK+T+CPMQISTYFRINAMETGQFERTLIVADD 
Sbjct  244   RVVPSEDNYYAALNSAVFSDGSFCYVPKDTKCPMQISTYFRINAMETGQFERTLIVADDR  303

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             SFVEYLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDE+G+GGI+NFVTKR
Sbjct  304   SFVEYLEGCTAPSYDKNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEQGKGGIYNFVTKR  363

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             GLCAG RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQQADTGTKMIHK
Sbjct  364   GLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGTKMIHK  423

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQT  578
             GKNTRSRIISKGIS GHSRNCYRGLVQV S ADNARNSSQCDSMLIG+ AAANTYPYIQ 
Sbjct  424   GKNTRSRIISKGISVGHSRNCYRGLVQVQSKADNARNSSQCDSMLIGDTAAANTYPYIQV  483

Query  577   KNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  398
             KNP+AR+EHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFG+EVNQ
Sbjct  484   KNPTARVEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGSEVNQ  543

Query  397   LMSLKLEGSVG  365
             LMSLKLEGSVG
Sbjct  544   LMSLKLEGSVG  554



>ref|XP_010278707.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic [Nelumbo nucifera]
Length=554

 Score =   910 bits (2353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/553 (79%), Positives = 487/553 (88%), Gaps = 13/553 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRN------FKVRAEA--KVTID  1835
             LL  G+S FS Q   E  K+LK     PK   L+T  PR        KVRA+   +    
Sbjct  4     LLANGVSHFSPQSPPETTKALKGFS--PKFDALKTLKPRRSTGSKFLKVRADVGYESKTI  61

Query  1834  APGKQPSP---STSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEP  1664
             AP + PSP   S    DDP+QKFLKRDYKWGF   I+S  +PKGLSEETIRLIS+RKNEP
Sbjct  62    APDQNPSPGKPSRPVSDDPIQKFLKRDYKWGFVSNIESSAIPKGLSEETIRLISARKNEP  121

Query  1663  DWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKY  1484
             +WMLE+RL ++E+F+ M EPKWSDNRYP I+FQDICYYSEPKKKP+LNSL+EADPEL++Y
Sbjct  122   EWMLEYRLSAFEKFLKMDEPKWSDNRYPPIDFQDICYYSEPKKKPSLNSLEEADPELLRY  181

Query  1483  FEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKY  1304
             F+KLG+PLNERNRLANVAVDAVLDSVSIATTHR+TL  +GVIFCSISEAIREYPDLVRKY
Sbjct  182   FDKLGIPLNERNRLANVAVDAVLDSVSIATTHRETLAAAGVIFCSISEAIREYPDLVRKY  241

Query  1303  LGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVAD  1124
             LG+VVPS+DN+Y ALNSAVFSDGSF Y+PKNTRCPM +STYFRINA+ETGQFERTLIVAD
Sbjct  242   LGKVVPSDDNYYAALNSAVFSDGSFCYIPKNTRCPMPVSTYFRINALETGQFERTLIVAD  301

Query  1123  DSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVT  944
             + SFVEYLEGCTAPSYD NQLHAAVVELYC   AEIKYSTVQNWYAGDEEG GGI+NFVT
Sbjct  302   EGSFVEYLEGCTAPSYDRNQLHAAVVELYCMNDAEIKYSTVQNWYAGDEEGIGGIYNFVT  361

Query  943   KRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMI  764
             KRGLCAG+RSKISWTQVETGSAITWKYPSV+LEGD++VGEFYSVALTNNYQQADTGTKMI
Sbjct  362   KRGLCAGARSKISWTQVETGSAITWKYPSVILEGDDTVGEFYSVALTNNYQQADTGTKMI  421

Query  763   HKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYI  584
             HKGKNTRSRI+SKGISAG+S+NCYRGLVQVMS A+NARNSSQCDSMLIG+NAAANTYPYI
Sbjct  422   HKGKNTRSRIVSKGISAGNSQNCYRGLVQVMSKAENARNSSQCDSMLIGDNAAANTYPYI  481

Query  583   QTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEV  404
             Q KNP+ARIEHEA+TSKIGEDQLFYFQQRGID+E+AM AMISGFC+DVF++LPDEFGAEV
Sbjct  482   QAKNPTARIEHEASTSKIGEDQLFYFQQRGIDHERAMRAMISGFCKDVFDKLPDEFGAEV  541

Query  403   NQLMSLKLEGSVG  365
             NQLMSLKLEGSVG
Sbjct  542   NQLMSLKLEGSVG  554



>gb|AIU41658.1| ABC transporter family protein [Hevea brasiliensis]
Length=553

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/550 (81%), Positives = 489/550 (89%), Gaps = 8/550 (1%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRN-FKVRA----EAKVTIDAPG  1826
             LL  G+S FS Q   +  K  K      KP+  +T  P N FK+RA    E+K      G
Sbjct  4     LLANGMSSFSPQSFSDSAKLSKPFSFPLKPAFPKTPRPANLFKIRADVGFESKTINTNSG  63

Query  1825  KQPSPSTSNEDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWM  1655
                S ST++ D+ +++ L+ RDY  K+GFN +IDSF++PKGLS+ETIRLISS K EPDWM
Sbjct  64    NSASTSTTSSDEKIREILRNRDYDKKFGFNVDIDSFSIPKGLSKETIRLISSLKEEPDWM  123

Query  1654  LEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEK  1475
             LEFRL ++E+F+ MKEPKWSDN YP I+FQDICYYS PKKKPTLNSLDEADPEL+ YF++
Sbjct  124   LEFRLNAFEKFLKMKEPKWSDNMYPPIDFQDICYYSAPKKKPTLNSLDEADPELLMYFDR  183

Query  1474  LGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGR  1295
             LGVPLNERNRLANVAVDAVLDSVSIATTHR+TLEK+GVIFCSISEAI++YPDLVRKYLGR
Sbjct  184   LGVPLNERNRLANVAVDAVLDSVSIATTHRQTLEKAGVIFCSISEAIKKYPDLVRKYLGR  243

Query  1294  VVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSS  1115
             VVPSEDN+Y ALNSAVFSDGSF Y+PK+T+CPMQISTYFRINAMETGQFERTLIVADD S
Sbjct  244   VVPSEDNYYAALNSAVFSDGSFCYIPKDTKCPMQISTYFRINAMETGQFERTLIVADDRS  303

Query  1114  FVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRG  935
             FVEYLEGCTAPSYDTNQLHAAVVELYC EGAEIKYSTVQNWYAGDEEG+GGI+NFVTKRG
Sbjct  304   FVEYLEGCTAPSYDTNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEEGKGGIYNFVTKRG  363

Query  934   LCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKG  755
             LCAG RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQQADTGTKMIHKG
Sbjct  364   LCAGDRSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGTKMIHKG  423

Query  754   KNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTK  575
             KNTRSRIISKGISAG+SRNCYRGLVQ+ S ADNARNSSQCDSMLIG+ AAANTYPYIQ K
Sbjct  424   KNTRSRIISKGISAGNSRNCYRGLVQIQSKADNARNSSQCDSMLIGDTAAANTYPYIQVK  483

Query  574   NPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQL  395
             NP+AR+EHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFC+DVFNELPDEFGAEVNQL
Sbjct  484   NPTARVEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCQDVFNELPDEFGAEVNQL  543

Query  394   MSLKLEGSVG  365
             MSLKLEGSVG
Sbjct  544   MSLKLEGSVG  553



>ref|XP_011037664.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic isoform X1 [Populus 
euphratica]
Length=554

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/551 (80%), Positives = 483/551 (88%), Gaps = 9/551 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNFKVRA----EAKVTIDAPGK  1823
             LL+  I  FS +P+ +  K  K      KP   +      FK+RA    E+K     PG 
Sbjct  4     LLSNTIPHFSPKPIKDSSKLNKPFFFQIKPIFFKPSKLNLFKIRADVGFESKTVKSVPGN  63

Query  1822  QPSPSTSN--EDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDW  1658
               +  TS+   DD +++ L+ RDY  K+GFN +IDSF +PKGLS+ETIRLISS K EPDW
Sbjct  64    SAATGTSSTSSDDKIREILRNRDYNEKFGFNMDIDSFAIPKGLSKETIRLISSLKEEPDW  123

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             ML+FRL ++ERF+ +KEPKWSDN YP I+FQDICYYS PKKKPT+NSL+EADPELIKYF+
Sbjct  124   MLDFRLNAFERFLKLKEPKWSDNEYPIIDFQDICYYSAPKKKPTVNSLEEADPELIKYFD  183

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             +LG+PL ERNRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAI++YPDLVRKYLG
Sbjct  184   RLGIPLTERNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIQKYPDLVRKYLG  243

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
             RVVPSEDN+Y ALNSAVFSDGSF YVPK+T+CPMQISTYFRINAMETGQFERTLIVADD 
Sbjct  244   RVVPSEDNYYAALNSAVFSDGSFCYVPKDTKCPMQISTYFRINAMETGQFERTLIVADDR  303

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             SFVEYLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDE+G+GGI+NFVTKR
Sbjct  304   SFVEYLEGCTAPSYDRNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEQGKGGIYNFVTKR  363

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             GLCAG RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQQADTGTKMIHK
Sbjct  364   GLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGTKMIHK  423

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQT  578
             GKNTRSRIISKGIS GHSRNCYRGLVQV S ADNARNSSQCDSMLIG+ AAANTYPYIQ 
Sbjct  424   GKNTRSRIISKGISVGHSRNCYRGLVQVQSKADNARNSSQCDSMLIGDTAAANTYPYIQV  483

Query  577   KNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  398
             KNP+AR+EHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFG+EVNQ
Sbjct  484   KNPTARVEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGSEVNQ  543

Query  397   LMSLKLEGSVG  365
             LMSLKLEGSVG
Sbjct  544   LMSLKLEGSVG  554



>gb|KDP20760.1| hypothetical protein JCGZ_21231 [Jatropha curcas]
Length=553

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/550 (80%), Positives = 488/550 (89%), Gaps = 8/550 (1%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNF-KVRA----EAKVTIDAPG  1826
             LL  GIS FS QP  +  K  K+     KP+  R   P N  ++RA    E+K      G
Sbjct  4     LLANGISSFSPQPNLDSAKLTKSFSFPLKPAIARIPRPANLVRIRADVGFESKTLNSDSG  63

Query  1825  KQPSPSTSNEDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWM  1655
                + STS+ D+ +++ L+ RDY  K+GF  +IDSF++PKGLS+ETIRLISS K EP WM
Sbjct  64    NSATTSTSSSDEKIKEILRNRDYDKKFGFTMDIDSFSIPKGLSKETIRLISSLKEEPVWM  123

Query  1654  LEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEK  1475
             LEFRL ++E+F+ M+EPKWSDN YP I+FQDICYYS PKKKPTLNSLDEADPEL+KYF++
Sbjct  124   LEFRLNAFEKFLKMREPKWSDNMYPTIDFQDICYYSAPKKKPTLNSLDEADPELLKYFDR  183

Query  1474  LGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGR  1295
             LGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAI++YPDLV+KYLGR
Sbjct  184   LGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIKKYPDLVKKYLGR  243

Query  1294  VVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSS  1115
             VVPSEDN+Y ALNSAVFSDGSF Y+PK+T+CPMQISTYFRINAMETGQFERTLIVADD S
Sbjct  244   VVPSEDNYYAALNSAVFSDGSFCYIPKDTKCPMQISTYFRINAMETGQFERTLIVADDRS  303

Query  1114  FVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRG  935
             FVEYLEGCTAPSYDTNQLHAAVVELYC EGAEIKYSTVQNWYAGDEEG+GG++NFVTKRG
Sbjct  304   FVEYLEGCTAPSYDTNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEEGKGGVYNFVTKRG  363

Query  934   LCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKG  755
             LCAG RSKISWTQVETGSAITWKYPSV+LEG+++VGEFYSVALTNNYQQADTGTKMIHKG
Sbjct  364   LCAGDRSKISWTQVETGSAITWKYPSVILEGNDTVGEFYSVALTNNYQQADTGTKMIHKG  423

Query  754   KNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTK  575
             KNTRSRIISKGISAG+SRNCYRGLVQ+ S ADNARNSSQCDSMLIG+ AAANTYPYIQ K
Sbjct  424   KNTRSRIISKGISAGNSRNCYRGLVQIQSKADNARNSSQCDSMLIGDTAAANTYPYIQVK  483

Query  574   NPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQL  395
             NP+AR+EHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFC+DVFNELPDEFGAEVNQL
Sbjct  484   NPTARVEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCQDVFNELPDEFGAEVNQL  543

Query  394   MSLKLEGSVG  365
             MSLKLEGSVG
Sbjct  544   MSLKLEGSVG  553



>gb|KHG25347.1| chloroplastic protein [Gossypium arboreum]
Length=552

 Score =   906 bits (2341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/558 (80%), Positives = 482/558 (86%), Gaps = 25/558 (4%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLR-----TQNPRNFKVRAEAKVTIDAPG  1826
              L  GIS FS QP  +  K LK     PK  +++      Q+ R  KVRA+        G
Sbjct  4     FLANGISSFSPQPTSDSTKFLKG--FFPKLDSVKYITPKLQSSRLLKVRADV-------G  54

Query  1825  KQPSPSTSNE--------DDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISS  1679
               P   TS+         DD +Q+ L+ RDY  K+GF  +IDSF +PKGLS ETIRLISS
Sbjct  55    FDPQTLTSDPSSSSGKSYDDKIQEILRNRDYDKKFGFTMDIDSFAIPKGLSAETIRLISS  114

Query  1678  RKNEPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADP  1499
              K EPDWM+E RL +YE+F+ MKEPKWSDNRYP I+FQDICYYS PKKKP LNSLDEADP
Sbjct  115   LKEEPDWMVELRLDAYEKFLKMKEPKWSDNRYPPIDFQDICYYSAPKKKPALNSLDEADP  174

Query  1498  ELIKYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPD  1319
             EL+KYF++LGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAIREYPD
Sbjct  175   ELLKYFDRLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIREYPD  234

Query  1318  LVRKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERT  1139
             LVRKYLGRVVPSEDN+Y ALNSAVFSDGSF Y+PK+T+CPM ISTYFRINA+ETGQFERT
Sbjct  235   LVRKYLGRVVPSEDNYYTALNSAVFSDGSFCYIPKDTKCPMPISTYFRINALETGQFERT  294

Query  1138  LIVADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGI  959
             LIVAD+ SFVEYLEGCTAPSYD NQLHAAVVELYC +GAEIKYSTVQNWYAGDEEG+GGI
Sbjct  295   LIVADEGSFVEYLEGCTAPSYDRNQLHAAVVELYCAKGAEIKYSTVQNWYAGDEEGKGGI  354

Query  958   FNFVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADT  779
             +NFVTKRGLCAG RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQQADT
Sbjct  355   YNFVTKRGLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADT  414

Query  778   GTKMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAAN  599
             GTKMIHKGKNTRSRIISKGIS GHSRNCYRGLVQV S A+NARNSSQCDSMLIG+NAAAN
Sbjct  415   GTKMIHKGKNTRSRIISKGISVGHSRNCYRGLVQVQSKAENARNSSQCDSMLIGDNAAAN  474

Query  598   TYPYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDE  419
             TYPYIQ KNPSAR+EHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDE
Sbjct  475   TYPYIQVKNPSARVEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDE  534

Query  418   FGAEVNQLMSLKLEGSVG  365
             FGAEVNQLMSLKLEGSVG
Sbjct  535   FGAEVNQLMSLKLEGSVG  552



>ref|XP_007026052.1| ATP binding cassette protein 1 [Theobroma cacao]
 gb|EOY28674.1| ATP binding cassette protein 1 [Theobroma cacao]
Length=577

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/556 (80%), Positives = 483/556 (87%), Gaps = 21/556 (4%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEP--------PKSLKASQVLPKPSNLRTQNPRNFKVRAEAKVTID  1835
             LL  GIS FS QP  +         PK      + PKP N R      FKVRA+  V  D
Sbjct  29    LLANGISSFSPQPTSDSTKFAKGFYPKLDSVKPITPKPPNSRL-----FKVRAD--VGFD  81

Query  1834  A---PGKQPSPSTSNEDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRK  1673
             +        S S  + D+ +Q+ L+ RDY  K+GF  +IDSF++PKGLS+ETIRLISS K
Sbjct  82    SQTLTSDPSSSSGKSYDEKIQEILRNRDYDKKFGFTMDIDSFSIPKGLSKETIRLISSLK  141

Query  1672  NEPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPEL  1493
              EPDWMLEFRL +YE+F+ M EPKWSDNRYP INFQDICYYS PKKKPTLNSLDEADPEL
Sbjct  142   EEPDWMLEFRLHAYEKFLKMNEPKWSDNRYPPINFQDICYYSAPKKKPTLNSLDEADPEL  201

Query  1492  IKYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLV  1313
             +KYF++LGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAIREYPDLV
Sbjct  202   LKYFDRLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIREYPDLV  261

Query  1312  RKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLI  1133
             RKYLGRVVPSEDN+Y ALNSAVFSDGSF Y+PK+T+CPM ISTYFRINA+ETGQFERTLI
Sbjct  262   RKYLGRVVPSEDNYYAALNSAVFSDGSFCYIPKDTKCPMPISTYFRINALETGQFERTLI  321

Query  1132  VADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFN  953
             VAD+ SFVEYLEGCTAPSYD NQLHAAVVEL+C  GAEIKYSTVQNWYAGDEEG+GGI+N
Sbjct  322   VADEGSFVEYLEGCTAPSYDRNQLHAAVVELHCANGAEIKYSTVQNWYAGDEEGKGGIYN  381

Query  952   FVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGT  773
             FVTKRGLCAG  SKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQQADTGT
Sbjct  382   FVTKRGLCAGDHSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGT  441

Query  772   KMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTY  593
             KMIHKG+NTRSRIISKGISAG+SRNCYRGLVQV S A+NARNSSQCDSMLIG+ AAANTY
Sbjct  442   KMIHKGRNTRSRIISKGISAGNSRNCYRGLVQVQSKAENARNSSQCDSMLIGDMAAANTY  501

Query  592   PYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFG  413
             PYIQ KNPSAR+EHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFG
Sbjct  502   PYIQVKNPSARVEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFG  561

Query  412   AEVNQLMSLKLEGSVG  365
             AEVNQLMSLKLEGSVG
Sbjct  562   AEVNQLMSLKLEGSVG  577



>gb|KDO75461.1| hypothetical protein CISIN_1g008725mg [Citrus sinensis]
Length=556

 Score =   903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/554 (80%), Positives = 483/554 (87%), Gaps = 13/554 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQ-VLPKPSNLRTQNPRNFKVRAEA--------KVTI  1838
             LL  GIS FS QP  + PK  K     L  P  +  ++ R FKVRA+             
Sbjct  4     LLANGISSFSPQPTVDSPKLSKGFHPKLENPKFIVPKSSRLFKVRADVGYGSSTISSDPS  63

Query  1837  DAPGKQPSPSTSNEDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNE  1667
              +PG   S ST + DD +Q+ L+ RDY  K+GFN +IDS T+PKGL++ETI LISS K E
Sbjct  64    SSPGNL-STSTQSSDDKIQEILRNRDYDKKFGFNWDIDSVTIPKGLTKETIHLISSLKEE  122

Query  1666  PDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIK  1487
             P WMLE+RL ++E+F+ MKEP WSDNRYP INFQD+CYYS PKKKPTLNSLDEADPELI+
Sbjct  123   PAWMLEYRLSAFEKFLKMKEPNWSDNRYPPINFQDMCYYSAPKKKPTLNSLDEADPELIR  182

Query  1486  YFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRK  1307
             YF+KLGVPLNE+NRLANVAVDAVLDSVSIATTHRKTLE++GVIFCSISEAIRE+PDLVRK
Sbjct  183   YFDKLGVPLNEQNRLANVAVDAVLDSVSIATTHRKTLEEAGVIFCSISEAIREHPDLVRK  242

Query  1306  YLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVA  1127
             YLGRVVPSEDN+Y ALN+AVFSDGSF Y+PKNT+CPM ISTYFRINAMETGQFERTLIVA
Sbjct  243   YLGRVVPSEDNYYAALNAAVFSDGSFCYIPKNTKCPMPISTYFRINAMETGQFERTLIVA  302

Query  1126  DDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFV  947
             D+ SFVEYLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDEEG GGI+NFV
Sbjct  303   DEGSFVEYLEGCTAPSYDRNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEEGNGGIYNFV  362

Query  946   TKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKM  767
             TKRGLCAG RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQQADTGTKM
Sbjct  363   TKRGLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGTKM  422

Query  766   IHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPY  587
             IHKGKNTRSRIISKGIS G+SRNCYRGLVQV S A+NARNSSQCDSML+G+ AAANTYPY
Sbjct  423   IHKGKNTRSRIISKGISVGNSRNCYRGLVQVQSKAENARNSSQCDSMLLGDTAAANTYPY  482

Query  586   IQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAE  407
             IQ KNP+AR+EHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAE
Sbjct  483   IQVKNPTARVEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAE  542

Query  406   VNQLMSLKLEGSVG  365
             VNQLMSLKLEGSVG
Sbjct  543   VNQLMSLKLEGSVG  556



>ref|XP_006468027.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Citrus 
sinensis]
Length=556

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/554 (79%), Positives = 483/554 (87%), Gaps = 13/554 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQ-VLPKPSNLRTQNPRNFKVRAEA--------KVTI  1838
             LL  GIS FS QP  + PK  K     L  P  +  ++ R FKVRA+             
Sbjct  4     LLANGISSFSPQPTVDSPKLSKGFHPKLENPKFIVPKSSRLFKVRADVGYGSSTISSDPS  63

Query  1837  DAPGKQPSPSTSNEDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNE  1667
              +PG   S +T + DD +Q+ L+ RDY  K+GFN +IDS T+PKGL++ETI LISS K E
Sbjct  64    SSPGNL-STTTQSSDDKIQEILRNRDYDKKFGFNWDIDSVTIPKGLTKETIHLISSLKEE  122

Query  1666  PDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIK  1487
             P WMLE+RL ++E+F+ MKEP WSDNRYP INFQD+CYYS PKKKPTLNSLDEADPELI+
Sbjct  123   PAWMLEYRLSAFEKFLKMKEPNWSDNRYPPINFQDMCYYSAPKKKPTLNSLDEADPELIR  182

Query  1486  YFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRK  1307
             YF+KLGVPLNE+NRLANVAVDAVLDSVSIATTHRKTLE++GVIFCSISEAIRE+PDLVRK
Sbjct  183   YFDKLGVPLNEQNRLANVAVDAVLDSVSIATTHRKTLEEAGVIFCSISEAIREHPDLVRK  242

Query  1306  YLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVA  1127
             YLGRVVPSEDN+Y ALN+AVFSDGSF Y+PKNT+CPM ISTYFRINAMETGQFERTLIVA
Sbjct  243   YLGRVVPSEDNYYAALNAAVFSDGSFCYIPKNTKCPMPISTYFRINAMETGQFERTLIVA  302

Query  1126  DDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFV  947
             D+ SFVEYLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDEEG GGI+NFV
Sbjct  303   DEGSFVEYLEGCTAPSYDRNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEEGNGGIYNFV  362

Query  946   TKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKM  767
             TKRGLCAG RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQQADTGTKM
Sbjct  363   TKRGLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGTKM  422

Query  766   IHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPY  587
             IHKGKNTRSRIISKGIS G+SRNCYRGLVQV S A+NARNSSQCDSML+G+ AAANTYPY
Sbjct  423   IHKGKNTRSRIISKGISVGNSRNCYRGLVQVQSKAENARNSSQCDSMLLGDTAAANTYPY  482

Query  586   IQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAE  407
             IQ KNP+AR+EHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAE
Sbjct  483   IQVKNPTARVEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAE  542

Query  406   VNQLMSLKLEGSVG  365
             VNQLMSLKLEGSVG
Sbjct  543   VNQLMSLKLEGSVG  556



>ref|XP_006287351.1| hypothetical protein CARUB_v10000549mg, partial [Capsella rubella]
 gb|EOA20249.1| hypothetical protein CARUB_v10000549mg, partial [Capsella rubella]
Length=585

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/555 (78%), Positives = 485/555 (87%), Gaps = 15/555 (3%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLR-----TQNPRN--FKVRAEAKVT---  1841
             LL  GIS FS QP  +  KS K     PKP + +     T NP    FK+RA+  +    
Sbjct  33    LLANGISGFSPQPTSDSSKSPKGFH--PKPESFKFPSSKTLNPTRPLFKIRADVGIDSRP  90

Query  1840  IDAPGKQPSPSTSNEDDPLQKF---LKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKN  1670
             I A     S +T +  D LQ++   L  D K+GF ++IDSFT+PKGLSEETIRLIS  K 
Sbjct  91    IGAESGAASSATVSSTDKLQQYFQNLDYDKKYGFVEDIDSFTIPKGLSEETIRLISKLKE  150

Query  1669  EPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELI  1490
             EPDWMLEFR K+YE+F+ ++EPKWSDNRYP INFQD+CYYS PKKKPTLNSLDEADP+L+
Sbjct  151   EPDWMLEFRFKAYEKFLKLEEPKWSDNRYPSINFQDMCYYSAPKKKPTLNSLDEADPQLL  210

Query  1489  KYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVR  1310
             +YF+KLGVPL E+ RLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDL++
Sbjct  211   EYFDKLGVPLTEQKRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLIK  270

Query  1309  KYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIV  1130
             KYLGRVVPS+DN+Y ALNSAVFSDGSF Y+PKNTRCPM ISTYFRINAMETGQFERTLIV
Sbjct  271   KYLGRVVPSDDNYYAALNSAVFSDGSFCYIPKNTRCPMPISTYFRINAMETGQFERTLIV  330

Query  1129  ADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNF  950
             A++ SFVEYLEGCTAPSYDTNQLHAAVVELYC EGAEIKYSTVQNWYAGDE+G+GGI+NF
Sbjct  331   AEEGSFVEYLEGCTAPSYDTNQLHAAVVELYCGEGAEIKYSTVQNWYAGDEQGKGGIYNF  390

Query  949   VTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTK  770
             VTKRGLCAG R+KISWTQVETGSAITWKYPSV+LEGD+SVGEFYSVALTNNYQQADTGTK
Sbjct  391   VTKRGLCAGDRAKISWTQVETGSAITWKYPSVILEGDDSVGEFYSVALTNNYQQADTGTK  450

Query  769   MIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYP  590
             MIHKGKNT+SRIISKGISAGHSRNCYRGLVQV S A+NA+N+S CDSMLIG+ AAANTYP
Sbjct  451   MIHKGKNTKSRIISKGISAGHSRNCYRGLVQVQSRAENAKNTSTCDSMLIGDKAAANTYP  510

Query  589   YIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGA  410
             YIQ KNPSA++EHEA+TSKIGEDQLFYFQQRGID+E+A+AAMISGFCRDVFN+LPDEFGA
Sbjct  511   YIQVKNPSAKVEHEASTSKIGEDQLFYFQQRGIDHERALAAMISGFCRDVFNKLPDEFGA  570

Query  409   EVNQLMSLKLEGSVG  365
             EVNQLMS+KLEGSVG
Sbjct  571   EVNQLMSIKLEGSVG  585



>ref|XP_006449034.1| hypothetical protein CICLE_v10014785mg [Citrus clementina]
 gb|ESR62274.1| hypothetical protein CICLE_v10014785mg [Citrus clementina]
Length=556

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/554 (79%), Positives = 482/554 (87%), Gaps = 13/554 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQ-VLPKPSNLRTQNPRNFKVRAEA--------KVTI  1838
             LL  GIS FS QP  + PK  K     L  P  +  ++ R FKVRA+             
Sbjct  4     LLANGISSFSPQPTVDSPKLSKGFHPKLENPKFIVPKSSRLFKVRADVGYGSSTISSDPS  63

Query  1837  DAPGKQPSPSTSNEDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNE  1667
              +PG   S ST + DD +Q+ L+ RDY  K+GFN +IDS T+PKGL++ETI LISS K E
Sbjct  64    SSPGNL-STSTQSSDDKIQEILRNRDYDKKFGFNWDIDSVTIPKGLTKETIHLISSLKEE  122

Query  1666  PDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIK  1487
             P WMLE+RL ++E+F+ MKEP WSDNRYP INFQD+CYYS PKKKPTLNSLDEADPELI+
Sbjct  123   PAWMLEYRLSAFEKFLKMKEPNWSDNRYPPINFQDMCYYSAPKKKPTLNSLDEADPELIR  182

Query  1486  YFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRK  1307
             YF+KLGVPLNE+NRLANVAVDAVLDSVSIATTHRKTLE++GVIFCSISEAIRE+PDLVRK
Sbjct  183   YFDKLGVPLNEQNRLANVAVDAVLDSVSIATTHRKTLEEAGVIFCSISEAIREHPDLVRK  242

Query  1306  YLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVA  1127
             YLGRVVPSEDN+Y ALN+AVFSDGSF Y+PKNT+CPM ISTYFRINAMETGQFERTLIVA
Sbjct  243   YLGRVVPSEDNYYAALNAAVFSDGSFCYIPKNTKCPMPISTYFRINAMETGQFERTLIVA  302

Query  1126  DDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFV  947
             D+ SFVEYLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDEEG GGI+NFV
Sbjct  303   DEGSFVEYLEGCTAPSYDRNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEEGNGGIYNFV  362

Query  946   TKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKM  767
             TKRGLCAG RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNN+QQADTGTKM
Sbjct  363   TKRGLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNHQQADTGTKM  422

Query  766   IHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPY  587
             IHKGKNTRSRIISKGIS G+SRNCYRGLVQV S A+NARNSSQCDSML+G+  AANTYPY
Sbjct  423   IHKGKNTRSRIISKGISVGNSRNCYRGLVQVQSKAENARNSSQCDSMLLGDTGAANTYPY  482

Query  586   IQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAE  407
             IQ KNP+AR+EHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAE
Sbjct  483   IQVKNPTARVEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAE  542

Query  406   VNQLMSLKLEGSVG  365
             VNQLMSLKLEGSVG
Sbjct  543   VNQLMSLKLEGSVG  556



>ref|XP_007024120.1| ATP binding cassette protein 1 isoform 1 [Theobroma cacao]
 gb|EOY26742.1| ATP binding cassette protein 1 isoform 1 [Theobroma cacao]
Length=552

 Score =   898 bits (2320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/551 (80%), Positives = 480/551 (87%), Gaps = 11/551 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRN---FKVRAEAKVTIDA---P  1829
             LL  GIS F+ QP  +  K  K            TQ P N   FKVRA+  V  D+    
Sbjct  4     LLANGISSFTTQPTSDSTKFAKGFYQKLDSVKTMTQKPPNSRLFKVRAD--VGFDSQTLT  61

Query  1828  GKQPSPSTSNEDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDW  1658
                 S S  + D+ +Q+ L+ RDY  K+GF  +IDSF++PKGL +ETIRLISS K EPDW
Sbjct  62    SDPSSSSGKSYDEKIQEILRNRDYNKKFGFTMDIDSFSIPKGLCKETIRLISSLKEEPDW  121

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             MLEFRL +Y +F+ MKEPKWSDNRYP INFQDICYYS PKKKPTLNSLDEADPEL+KYF+
Sbjct  122   MLEFRLNAYGKFLKMKEPKWSDNRYPPINFQDICYYSAPKKKPTLNSLDEADPELLKYFD  181

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             +LGV LNERNRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAIREYPDLVRKYLG
Sbjct  182   RLGVSLNERNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIREYPDLVRKYLG  241

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
             RVVP EDN+Y ALNSAVFSDGSF Y+PK+T+CPM ISTYFRINA+ETGQFERTLIVAD+ 
Sbjct  242   RVVPIEDNYYAALNSAVFSDGSFCYIPKDTKCPMPISTYFRINALETGQFERTLIVADEG  301

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             SFVEYLEGCTAPSY+ NQLHAAVVELYC +GAEIKYSTVQNWYAGDEEG+GGI+NFVTKR
Sbjct  302   SFVEYLEGCTAPSYERNQLHAAVVELYCAKGAEIKYSTVQNWYAGDEEGKGGIYNFVTKR  361

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             GLCAG  SKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQQADTGTKMIHK
Sbjct  362   GLCAGDHSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGTKMIHK  421

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQT  578
             G+NTRSRIISKGISAG+SRNCYRGLVQV S A+NARNSSQCDSMLIG+NAAANTYPYIQ 
Sbjct  422   GENTRSRIISKGISAGNSRNCYRGLVQVQSKAENARNSSQCDSMLIGDNAAANTYPYIQV  481

Query  577   KNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  398
             KNPSAR+EHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ
Sbjct  482   KNPSARVEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  541

Query  397   LMSLKLEGSVG  365
             LMSLKLEGSVG
Sbjct  542   LMSLKLEGSVG  552



>ref|XP_007212381.1| hypothetical protein PRUPE_ppa003788mg [Prunus persica]
 gb|EMJ13580.1| hypothetical protein PRUPE_ppa003788mg [Prunus persica]
Length=549

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/550 (79%), Positives = 480/550 (87%), Gaps = 12/550 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSL----KASQVLPKPSNLRTQNP-RNFKVRAEAKVTIDAPG  1826
             LL  GIS F  Q   E PK L           K S ++T  P R FKVRA+    +    
Sbjct  4     LLANGISSFCPQAASEQPKLLPKGFHPKLDFLKLSGVKTSVPKRVFKVRAD----VGYDP  59

Query  1825  KQPSPSTSNEDDPLQKFLKR---DYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWM  1655
             K   P  S     +++FL+    D K+GFN +IDSF++PKGLS ETIRLISS K EPDWM
Sbjct  60    KTIYPDVSQGKLSIEEFLRNREYDKKFGFNIDIDSFSIPKGLSRETIRLISSLKEEPDWM  119

Query  1654  LEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEK  1475
             LEFRL ++E+F+ MKEPKWSDNRYP INFQD+CYYS PKKKP LNSLDEADPEL+KYF++
Sbjct  120   LEFRLNAFEKFLTMKEPKWSDNRYPVINFQDMCYYSAPKKKPALNSLDEADPELLKYFDR  179

Query  1474  LGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGR  1295
             LGVPLNE+NRLANVAVDAVLDSVSIATTHRK LE+ GVIFCSISEAIREYPDLV+KYLGR
Sbjct  180   LGVPLNEQNRLANVAVDAVLDSVSIATTHRKALEEKGVIFCSISEAIREYPDLVKKYLGR  239

Query  1294  VVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSS  1115
             VVP+ DN+Y ALNSAVFSDGSF Y+PK+T+CPMQISTYFRINA+ETGQFERTLIVADD S
Sbjct  240   VVPTGDNYYAALNSAVFSDGSFCYIPKDTKCPMQISTYFRINALETGQFERTLIVADDRS  299

Query  1114  FVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRG  935
             FVEYLEGCTAPSYDTNQLHAAVVELYC EGAEIKYSTVQNWYAGDE+G+GGI+NFVTKRG
Sbjct  300   FVEYLEGCTAPSYDTNQLHAAVVELYCGEGAEIKYSTVQNWYAGDEQGKGGIYNFVTKRG  359

Query  934   LCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKG  755
             LCAG+RSKISWTQVETGSAITWKYPSV+LEGD+SVGEFYSVALTNNYQQADTGTKMIHKG
Sbjct  360   LCAGARSKISWTQVETGSAITWKYPSVILEGDDSVGEFYSVALTNNYQQADTGTKMIHKG  419

Query  754   KNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTK  575
             KNTRSRIISKGISAG+SRNCYRGLVQV S ADNA+NSSQCDSMLIG++AAANTYPYIQ K
Sbjct  420   KNTRSRIISKGISAGNSRNCYRGLVQVQSKADNAKNSSQCDSMLIGDSAAANTYPYIQVK  479

Query  574   NPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQL  395
             NPSARIEHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFC+DVFNELPDEFG+EVNQL
Sbjct  480   NPSARIEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCQDVFNELPDEFGSEVNQL  539

Query  394   MSLKLEGSVG  365
             + LKLEGSVG
Sbjct  540   IGLKLEGSVG  549



>ref|XP_002874814.1| ATABC1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51073.1| ATABC1 [Arabidopsis lyrata subsp. lyrata]
Length=556

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/555 (78%), Positives = 486/555 (88%), Gaps = 15/555 (3%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRN-------FKVRAEAKVTIDA  1832
             LL  GIS FS QP  +  KS K     PKP +L+  +P++       FKVRA   V ID+
Sbjct  4     LLANGISCFSPQPTSDSSKSPKGFH--PKPESLKFPSPKSLNPTRPVFKVRAADVVGIDS  61

Query  1831  ---PGKQPSPSTSNEDDPLQKF---LKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKN  1670
                  +    ST +  D LQ++   L  D K+GF ++IDSFT+PKGLSEETIRLIS  K 
Sbjct  62    RPIGAESSGTSTVSSTDKLQQYFQNLDYDKKYGFVEDIDSFTIPKGLSEETIRLISKLKE  121

Query  1669  EPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELI  1490
             EPDWMLEFR K+Y +F+ ++EPKWSDNRYP INFQD+CYYS PKKKPTLNSLDEADP+L+
Sbjct  122   EPDWMLEFRFKAYAKFLKLEEPKWSDNRYPSINFQDMCYYSAPKKKPTLNSLDEADPQLL  181

Query  1489  KYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVR  1310
             +YF+KLGVPL E+ RLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDL++
Sbjct  182   EYFDKLGVPLTEQKRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLIK  241

Query  1309  KYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIV  1130
             KYLGRVVPS+DN+Y +LNSAVFSDGSF Y+PKNTRCPM ISTYFRINAMETGQFERTLIV
Sbjct  242   KYLGRVVPSDDNYYASLNSAVFSDGSFCYIPKNTRCPMPISTYFRINAMETGQFERTLIV  301

Query  1129  ADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNF  950
             A++ SFVEYLEGCTAPSYDTNQLHAAVVELYC +GAEIKYSTVQNWYAGDE+G+GGI+NF
Sbjct  302   AEEGSFVEYLEGCTAPSYDTNQLHAAVVELYCGKGAEIKYSTVQNWYAGDEQGKGGIYNF  361

Query  949   VTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTK  770
             VTKRGLCAG RSKISWTQVETGSAITWKYPSVVLEGD+SVGEFYSVALTNNYQQADTGTK
Sbjct  362   VTKRGLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGTK  421

Query  769   MIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYP  590
             MIHKGKNT+SRIISKGISAGHSRNCYRGLVQV S A+NA+N+S CDSMLIG+ AAANTYP
Sbjct  422   MIHKGKNTKSRIISKGISAGHSRNCYRGLVQVQSKAENAKNTSTCDSMLIGDKAAANTYP  481

Query  589   YIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGA  410
             YIQ KNPSA++EHEA+TSKIGEDQLFYFQQRGID+E+A+AAMISGFCRDVFN+LPDEFGA
Sbjct  482   YIQVKNPSAKVEHEASTSKIGEDQLFYFQQRGIDHERALAAMISGFCRDVFNKLPDEFGA  541

Query  409   EVNQLMSLKLEGSVG  365
             EVNQLMS+KLEGSVG
Sbjct  542   EVNQLMSIKLEGSVG  556



>ref|XP_008224818.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic [Prunus mume]
Length=549

 Score =   896 bits (2316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/550 (79%), Positives = 479/550 (87%), Gaps = 12/550 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSL----KASQVLPKPSNLRTQNP-RNFKVRAEAKVTIDAPG  1826
             LL  GIS F  Q   E PK L           K S ++T  P R FKVRA+    +    
Sbjct  4     LLANGISSFCPQAASEQPKLLPKGFHPKLDFLKLSGVKTSVPKRVFKVRAD----VGYDP  59

Query  1825  KQPSPSTSNEDDPLQKFLKR---DYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWM  1655
             K   P  S     +++FL+    D K+GFN +IDSF++PKGLS ETIRLISS K EPDWM
Sbjct  60    KTIDPDVSQGKLSIEEFLRNREYDKKFGFNIDIDSFSIPKGLSRETIRLISSLKEEPDWM  119

Query  1654  LEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEK  1475
             LEFRL ++E+F+ MKEPKWSDNRYP INFQD+CYYS PKKKP LNSLDEADPEL+KYF++
Sbjct  120   LEFRLNAFEKFLTMKEPKWSDNRYPVINFQDMCYYSAPKKKPALNSLDEADPELLKYFDR  179

Query  1474  LGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGR  1295
             LGVPLNE+NRLANVAVDAVLDSVSIATTHRK LE+ GVIFCSISEAIREYPDLV+KYLGR
Sbjct  180   LGVPLNEQNRLANVAVDAVLDSVSIATTHRKALEEKGVIFCSISEAIREYPDLVKKYLGR  239

Query  1294  VVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSS  1115
             VVP+ DN+Y ALNSAVFSDGSF Y+PK+T+CPMQISTYFRINA+ETGQFERTLIVADD S
Sbjct  240   VVPTGDNYYAALNSAVFSDGSFCYIPKDTKCPMQISTYFRINALETGQFERTLIVADDRS  299

Query  1114  FVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRG  935
             FVEYLEGCTAPSYDTNQLHAAVVELYC EGAEIKYSTVQNWYAGDE+G+GGI+NFVTKRG
Sbjct  300   FVEYLEGCTAPSYDTNQLHAAVVELYCGEGAEIKYSTVQNWYAGDEQGKGGIYNFVTKRG  359

Query  934   LCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKG  755
             LCAG+ SKISWTQVETGSAITWKYPSV+LEGD+SVGEFYSVALTNNYQQADTGTKMIHKG
Sbjct  360   LCAGAHSKISWTQVETGSAITWKYPSVILEGDDSVGEFYSVALTNNYQQADTGTKMIHKG  419

Query  754   KNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTK  575
             KNTRSRIISKGISAG+SRNCYRGLVQV S A+NA+NSSQCDSMLIG++AAANTYPYIQ K
Sbjct  420   KNTRSRIISKGISAGNSRNCYRGLVQVQSKAENAKNSSQCDSMLIGDSAAANTYPYIQVK  479

Query  574   NPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQL  395
             NPSARIEHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFG+EVNQL
Sbjct  480   NPSARIEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGSEVNQL  539

Query  394   MSLKLEGSVG  365
             + LKLEGSVG
Sbjct  540   IGLKLEGSVG  549



>ref|XP_010432374.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Camelina 
sativa]
Length=552

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/553 (78%), Positives = 487/553 (88%), Gaps = 15/553 (3%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRN-------FKVRAEAKVTIDA  1832
             LL  GIS FS QP  +  KS K     PKP + +  +P++       FK+RA+  V ID+
Sbjct  4     LLANGISGFSPQPTSDSSKSPKGFH--PKPESFKFPSPKSLIPTRPLFKIRAD--VGIDS  59

Query  1831  -PGKQPSPSTSNEDDPLQKF---LKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEP  1664
              P  + + ++S   D LQ++   L  D K+GF ++IDSFT+PKGLSEETIR IS  K EP
Sbjct  60    RPTIEATDTSSTSADKLQQYFQNLDYDKKYGFVEDIDSFTIPKGLSEETIRSISKLKEEP  119

Query  1663  DWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKY  1484
             +WMLEFR K+YE+F+ ++EPKWSDNRYP INFQD+CYYS PKKKPTLNSLDEADP+L++Y
Sbjct  120   EWMLEFRFKAYEKFLKLEEPKWSDNRYPSINFQDMCYYSAPKKKPTLNSLDEADPQLLEY  179

Query  1483  FEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKY  1304
             F+KLGVPL E+ RLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDL++KY
Sbjct  180   FDKLGVPLTEQKRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLIKKY  239

Query  1303  LGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVAD  1124
             LGRVVPS+DN+Y ALN+AVFSDGSF Y+PKNTRCPM ISTYFRINAMETGQFERTLIVA+
Sbjct  240   LGRVVPSDDNYYAALNAAVFSDGSFCYIPKNTRCPMPISTYFRINAMETGQFERTLIVAE  299

Query  1123  DSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVT  944
             + SFVEYLEGCTAPSYD NQLHAAVVELYC +GAEIKYSTVQNWYAGD+EG+GGI+NFVT
Sbjct  300   EGSFVEYLEGCTAPSYDKNQLHAAVVELYCGKGAEIKYSTVQNWYAGDQEGKGGIYNFVT  359

Query  943   KRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMI  764
             KRGLCAG RSKISWTQVETGSAITWKYPSVVLEGD+SVGEFYSVALTNNYQQADTGTKMI
Sbjct  360   KRGLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGTKMI  419

Query  763   HKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYI  584
             HKGKNT+SRIISKGISAGHSRNCYRGLVQV S A+NA+N+S CDSMLIG+ AAANTYPYI
Sbjct  420   HKGKNTKSRIISKGISAGHSRNCYRGLVQVQSRAENAKNTSTCDSMLIGDKAAANTYPYI  479

Query  583   QTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEV  404
             Q KNPSA++EHEA+TSKIGEDQLFYFQQRGID+E+A+AAMISGFCRDVFN+LPDEFGAEV
Sbjct  480   QVKNPSAKVEHEASTSKIGEDQLFYFQQRGIDHERALAAMISGFCRDVFNKLPDEFGAEV  539

Query  403   NQLMSLKLEGSVG  365
             NQLMS+KLEGSVG
Sbjct  540   NQLMSIKLEGSVG  552



>ref|XP_006396667.1| hypothetical protein EUTSA_v10028516mg [Eutrema salsugineum]
 gb|ESQ38120.1| hypothetical protein EUTSA_v10028516mg [Eutrema salsugineum]
Length=625

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/565 (78%), Positives = 486/565 (86%), Gaps = 25/565 (4%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLR-----TQNP-----------RNFKVR  1859
             LL  GIS FS QP  +  K  K     PKP +L+     T NP           R FKVR
Sbjct  63    LLANGISGFSPQPTPDSSKLPKGFH--PKPESLKFPSPKTLNPSSAATTTTTTTRLFKVR  120

Query  1858  AEAKVT---IDAPGKQPS--PSTSNEDDPLQKFLKRDY--KWGFNQEIDSFTLPKGLSEE  1700
             A+ ++    I A    PS  P+ S+ D   Q F  +DY  K+GF +EIDSFT+PKGLSEE
Sbjct  121   ADFEIDPRPIGAESGIPSAKPTVSSTDKLKQYFQNQDYDKKYGFVEEIDSFTIPKGLSEE  180

Query  1699  TIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLN  1520
             TIR IS  KNEPDWMLEFR K+Y +F+ ++EPKWSDNRYP INFQD+CYYS PKKKPTLN
Sbjct  181   TIRSISKLKNEPDWMLEFRFKAYAKFLKLEEPKWSDNRYPSINFQDMCYYSAPKKKPTLN  240

Query  1519  SLDEADPELIKYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISE  1340
             SLDEA+P+L++YF+KLGVPL E+ RLANVAVDAVLDSVSIATTHRKTLEKSGVIFC ISE
Sbjct  241   SLDEANPQLLEYFDKLGVPLTEQKRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCPISE  300

Query  1339  AIREYPDLVRKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAME  1160
             AIREYPDL++KYLGRVVPS+DN+Y ALNSAVFSDGSF Y+PKNTRCPM ISTYFRINAME
Sbjct  301   AIREYPDLIKKYLGRVVPSDDNYYAALNSAVFSDGSFCYIPKNTRCPMPISTYFRINAME  360

Query  1159  TGQFERTLIVADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGD  980
             TGQFERTLIVA++ SFVEYLEGCTAPSYDTNQLHAAVVELYC EGAEIKYSTVQNWYAGD
Sbjct  361   TGQFERTLIVAEEGSFVEYLEGCTAPSYDTNQLHAAVVELYCGEGAEIKYSTVQNWYAGD  420

Query  979   EEGRGGIFNFVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTN  800
             EEG+GGI+NFVTKRGLCAG RSKISWTQVETGSAITWKYPSVVLEGD+SVGEFYSVALTN
Sbjct  421   EEGKGGIYNFVTKRGLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTN  480

Query  799   NYQQADTGTKMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLI  620
             NYQQADTGTKMIHKGKNT+SRIISKGISAGHSRNCYRGLVQV S A+NA+N+S CDSMLI
Sbjct  481   NYQQADTGTKMIHKGKNTKSRIISKGISAGHSRNCYRGLVQVQSKAENAKNTSTCDSMLI  540

Query  619   GNNAAANTYPYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDV  440
             G+ AAANTYPYIQ KNPSA++EHEA+TSKIGEDQLFYFQQRGID+E+A+AAMISGFCRDV
Sbjct  541   GDKAAANTYPYIQVKNPSAKVEHEASTSKIGEDQLFYFQQRGIDHERALAAMISGFCRDV  600

Query  439   FNELPDEFGAEVNQLMSLKLEGSVG  365
             FN+LPDEFGAEVNQLMS+KLEGSVG
Sbjct  601   FNKLPDEFGAEVNQLMSIKLEGSVG  625



>dbj|BAJ34164.1| unnamed protein product [Thellungiella halophila]
Length=566

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/565 (78%), Positives = 486/565 (86%), Gaps = 25/565 (4%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLR-----TQNP-----------RNFKVR  1859
             LL  GIS FS QP  +  K  K     PKP +L+     T NP           R FKVR
Sbjct  4     LLANGISGFSPQPTPDSSKLPKGFH--PKPESLKFPSPKTLNPSSAATTTTTTTRLFKVR  61

Query  1858  AEAKVT---IDAPGKQPS--PSTSNEDDPLQKFLKRDY--KWGFNQEIDSFTLPKGLSEE  1700
             A+ ++    I A    PS  P+ S+ D   Q F  +DY  K+GF +EIDSFT+PKGLSEE
Sbjct  62    ADFEIDPRPIGAESGIPSAKPTVSSTDKLKQYFQNQDYDKKYGFVEEIDSFTIPKGLSEE  121

Query  1699  TIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLN  1520
             TIR IS  KNEPDWMLEFR K+Y +F+ ++EPKWSDNRYP INFQD+CYYS PKKKPTLN
Sbjct  122   TIRSISKLKNEPDWMLEFRFKAYAKFLKLEEPKWSDNRYPSINFQDMCYYSAPKKKPTLN  181

Query  1519  SLDEADPELIKYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISE  1340
             SLDEA+P+L++YF+KLGVPL E+ RLANVAVDAVLDSVSIATTHRKTLEKSGVIFC ISE
Sbjct  182   SLDEANPQLLEYFDKLGVPLTEQKRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCPISE  241

Query  1339  AIREYPDLVRKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAME  1160
             AIREYPDL++KYLGRVVPS+DN+Y ALNSAVFSDGSF Y+PKNTRCPM ISTYFRINAME
Sbjct  242   AIREYPDLIKKYLGRVVPSDDNYYAALNSAVFSDGSFCYIPKNTRCPMPISTYFRINAME  301

Query  1159  TGQFERTLIVADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGD  980
             TGQFERTLIVA++ SFVEYLEGCTAPSYDTNQLHAAVVELYC EGAEIKYSTVQNWYAGD
Sbjct  302   TGQFERTLIVAEEGSFVEYLEGCTAPSYDTNQLHAAVVELYCGEGAEIKYSTVQNWYAGD  361

Query  979   EEGRGGIFNFVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTN  800
             EEG+GGI+NFVTKRGLCAG RSKISWTQVETGSAITWKYPSVVLEGD+SVGEFYSVALTN
Sbjct  362   EEGKGGIYNFVTKRGLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTN  421

Query  799   NYQQADTGTKMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLI  620
             NYQQADTGTKMIHKGKNT+SRIISKGISAGHSRNCYRGLVQV S A+NA+N+S CDSMLI
Sbjct  422   NYQQADTGTKMIHKGKNTKSRIISKGISAGHSRNCYRGLVQVQSKAENAKNTSTCDSMLI  481

Query  619   GNNAAANTYPYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDV  440
             G+ AAANTYPYIQ KNPSA++EHEA+TSKIGEDQLFYFQQRGID+E+A+AAMISGFCRDV
Sbjct  482   GDKAAANTYPYIQVKNPSAKVEHEASTSKIGEDQLFYFQQRGIDHERALAAMISGFCRDV  541

Query  439   FNELPDEFGAEVNQLMSLKLEGSVG  365
             FN+LPDEFGAEVNQLMS+KLEGSVG
Sbjct  542   FNKLPDEFGAEVNQLMSIKLEGSVG  566



>ref|XP_010455778.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic [Camelina sativa]
Length=550

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/551 (78%), Positives = 485/551 (88%), Gaps = 13/551 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRN-------FKVRAEAKVTIDA  1832
             LL  G+S FS QP  +  KS K     PKP + +  +P++       FK+RA+  V ID+
Sbjct  4     LLANGVSSFSPQPTSDSSKSPKGFH--PKPESFKFPSPKSLNPTRPLFKIRAD--VGIDS  59

Query  1831  PGKQPSPSTSNEDDPLQKFLKRDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDW  1658
                + + S+S+ D   Q F   DY  K+GF ++IDSFT+PKGLSEETIR IS  K EP+W
Sbjct  60    RPIEATESSSSADKLQQYFQNLDYDKKYGFVEDIDSFTIPKGLSEETIRSISKLKEEPEW  119

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             MLEFR K+YE+F+ ++EPKWSDNRYP INFQD+CYYS PKKKPTLNSLDEADP+L++YF+
Sbjct  120   MLEFRFKAYEKFLKLEEPKWSDNRYPSINFQDMCYYSAPKKKPTLNSLDEADPQLLEYFD  179

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             KLGVPL E+ RLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDL++KYLG
Sbjct  180   KLGVPLTEQKRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLIKKYLG  239

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
             RVVPS+DN+Y ALN+AVFSDGSF Y+PKNTRCPM ISTYFRINAMETGQFERTLIVA++ 
Sbjct  240   RVVPSDDNYYAALNAAVFSDGSFCYIPKNTRCPMPISTYFRINAMETGQFERTLIVAEEG  299

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             SFVEYLEGCTAPSYD NQLHAAVVELYC +GAEIKYSTVQNWYAGD+EG+GGI+NFVTKR
Sbjct  300   SFVEYLEGCTAPSYDKNQLHAAVVELYCGKGAEIKYSTVQNWYAGDQEGKGGIYNFVTKR  359

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             GLCAG RSKISWTQVETGSAITWKYPSVVLEGD+SVGEFYSVALTNNYQQADTGTKMIHK
Sbjct  360   GLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGTKMIHK  419

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQT  578
             GKNT+SRIISKGISAGHSRNCYRGLVQV S A+NA+N+S CDSMLIG+ AAANTYPYIQ 
Sbjct  420   GKNTKSRIISKGISAGHSRNCYRGLVQVQSRAENAKNTSTCDSMLIGDKAAANTYPYIQV  479

Query  577   KNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  398
             KNPSA++EHEA+TSKIGEDQLFYFQQRGID+E+A+AAMISGFCRDVFN+LPDEFGAEVNQ
Sbjct  480   KNPSAKVEHEASTSKIGEDQLFYFQQRGIDHERALAAMISGFCRDVFNKLPDEFGAEVNQ  539

Query  397   LMSLKLEGSVG  365
             LMS+KLEGSVG
Sbjct  540   LMSIKLEGSVG  550



>ref|XP_009362114.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Pyrus x 
bretschneideri]
Length=549

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/551 (79%), Positives = 485/551 (88%), Gaps = 14/551 (3%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLR-----TQNP-RNFKVRAEAKVTIDAP  1829
             LLT GIS FS Q   EPPK  K     PK  +L+     T  P R F+VRA+  V  +  
Sbjct  4     LLTNGISSFSPQAASEPPKFPKGFH--PKLDSLKFSGQKTSAPKRVFRVRAD--VGYEPK  59

Query  1828  GKQPSPSTSNEDDPLQKFLKR---DYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDW  1658
               +  PST+ +   +++FL+    D K+GFN +IDSF++PKGLS ETI LISS K EPDW
Sbjct  60    TVESDPSTAGKLS-IEEFLRNREYDKKFGFNIDIDSFSIPKGLSRETIELISSLKGEPDW  118

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             MLEFRL ++E+F+ MKEP+WSDNRYP INFQD+CY+S PKKKP LNSLDEADPEL+KYF+
Sbjct  119   MLEFRLNAFEKFLTMKEPQWSDNRYPVINFQDMCYFSAPKKKPALNSLDEADPELLKYFD  178

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             +LGVPLNE+NRLANVAVDAVLDSVSIATTHRK LE+ GVIFCSISEAIREYPDLVRKYLG
Sbjct  179   RLGVPLNEQNRLANVAVDAVLDSVSIATTHRKALEEKGVIFCSISEAIREYPDLVRKYLG  238

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
             +VVP+ DN+Y ALNSAVFSDGSF Y+PK+T+CPMQISTYFRINA+ETGQFERTLIVADD 
Sbjct  239   KVVPTGDNYYAALNSAVFSDGSFCYIPKDTKCPMQISTYFRINALETGQFERTLIVADDR  298

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             SFVEYLEGCTAPSYDTNQLHAAVVELYC EGAEIKYSTVQNWYAGDE+G+GGI+NFVTKR
Sbjct  299   SFVEYLEGCTAPSYDTNQLHAAVVELYCREGAEIKYSTVQNWYAGDEQGKGGIYNFVTKR  358

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             GLCAG+RSKISWTQVETGSAITWKYPSVVLEGD+SVGEFYSVALTNNYQQADTGTKMIHK
Sbjct  359   GLCAGARSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGTKMIHK  418

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQT  578
             GKNTRSRIISKGISAG+SRNCYRGLVQV S A+NA+NSSQCDSMLIG+ AAANTYPYIQ 
Sbjct  419   GKNTRSRIISKGISAGNSRNCYRGLVQVQSKAENAKNSSQCDSMLIGDTAAANTYPYIQV  478

Query  577   KNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  398
             KNP+ARIEHEA+TSKIGEDQLFYFQQRGI+YEKAMAAMISGFCRDVFNELPDEFG+EVNQ
Sbjct  479   KNPTARIEHEASTSKIGEDQLFYFQQRGIEYEKAMAAMISGFCRDVFNELPDEFGSEVNQ  538

Query  397   LMSLKLEGSVG  365
             L+ LKLE SVG
Sbjct  539   LIGLKLENSVG  549



>ref|XP_010422308.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Camelina 
sativa]
Length=551

 Score =   894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/552 (78%), Positives = 485/552 (88%), Gaps = 14/552 (3%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRN-------FKVRAEAKVTIDA  1832
             LL  GIS FS QP  +  KS K     P P + +  +P++       FK+RA+  V ID+
Sbjct  4     LLANGISGFSPQPTSDSSKSPKGFH--PNPESFKFPSPKSINPTRPLFKIRAD--VGIDS  59

Query  1831  PGKQPSPSTSNEDDPLQKF---LKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPD  1661
                + + S ++  D LQ++   L  D K+GF ++IDSFT+PKGLSEETIR IS  K EP+
Sbjct  60    RPIEATESGTSSADKLQQYFQNLDYDKKYGFVEDIDSFTIPKGLSEETIRSISKLKEEPE  119

Query  1660  WMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYF  1481
             WMLEFR K+YE+F+ ++EPKWSDNRYP INFQD+CYYS PKKKPTLNSLDEADP+L++YF
Sbjct  120   WMLEFRFKAYEKFLKLEEPKWSDNRYPSINFQDMCYYSAPKKKPTLNSLDEADPQLLEYF  179

Query  1480  EKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYL  1301
             +KLGVPL E+ RLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDL++KYL
Sbjct  180   DKLGVPLTEQKRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLIKKYL  239

Query  1300  GRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADD  1121
             GRVVPS+DN+Y ALN+AVFSDGSF Y+PKNTRCPM ISTYFRINAMETGQFERTLIVA++
Sbjct  240   GRVVPSDDNYYAALNAAVFSDGSFCYIPKNTRCPMPISTYFRINAMETGQFERTLIVAEE  299

Query  1120  SSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTK  941
              SFVEYLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGD+EG+GGI+NFVTK
Sbjct  300   GSFVEYLEGCTAPSYDKNQLHAAVVELYCGEGAEIKYSTVQNWYAGDQEGKGGIYNFVTK  359

Query  940   RGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIH  761
             RGLCAG RSKISWTQVETGSAITWKYPSVVLEGD+SVGEFYSVALTNNYQQADTGTKMIH
Sbjct  360   RGLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGTKMIH  419

Query  760   KGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQ  581
             KGKNT+SRIISKGISAGHSRNCYRGLVQV S A+NA+N+S CDSMLIG+ AAANTYPYIQ
Sbjct  420   KGKNTKSRIISKGISAGHSRNCYRGLVQVQSRAENAKNTSTCDSMLIGDEAAANTYPYIQ  479

Query  580   TKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVN  401
              KNPSA++EHEA+TSKIGEDQLFYFQQRGID+E+A+AAMISGFCRDVFN+LPDEFGAEVN
Sbjct  480   VKNPSAKVEHEASTSKIGEDQLFYFQQRGIDHERALAAMISGFCRDVFNKLPDEFGAEVN  539

Query  400   QLMSLKLEGSVG  365
             QLMS+KLEGSVG
Sbjct  540   QLMSIKLEGSVG  551



>ref|XP_010538915.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic [Tarenaya hassleriana]
Length=563

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/562 (77%), Positives = 479/562 (85%), Gaps = 22/562 (4%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNFK------VRAEAKVTIDA-  1832
             LL  GIS FS+QP  + PK  K     PKP NL+    +         VR  A V  ++ 
Sbjct  4     LLANGISRFSLQPPIDSPKLPKGFH--PKPENLKLPPQKTLIPTATRIVRVRADVGFESR  61

Query  1831  ----------PGKQPSPSTSNEDDPLQKF---LKRDYKWGFNQEIDSFTLPKGLSEETIR  1691
                       PGK  + +  N  D LQ++   L  D K+GF +EIDSFT+PKGLSE TI 
Sbjct  62    TVGTESESASPGKSSAGTALNSSDKLQQYFQNLDYDKKYGFVEEIDSFTIPKGLSEVTIG  121

Query  1690  LISSRKNEPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLD  1511
              IS  K EPDWML+FRLK+YE+FM MKEP+WSDNRYP INFQDICYYS PKK PTLNSLD
Sbjct  122   SISKLKEEPDWMLDFRLKAYEKFMKMKEPRWSDNRYPPINFQDICYYSAPKKNPTLNSLD  181

Query  1510  EADPELIKYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIR  1331
             EADP+L++YF+KLGVPL E+ RLANVAVDAVLDSVSIATTHRKTLEK+GVIFC ISEA+R
Sbjct  182   EADPKLLEYFDKLGVPLTEQKRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCPISEAVR  241

Query  1330  EYPDLVRKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQ  1151
             EYPDLV+KYLGRVVPS+DN+Y ALNSAVFSDGSF Y+PKNT+CPM ISTYFRINA+ETGQ
Sbjct  242   EYPDLVKKYLGRVVPSDDNYYAALNSAVFSDGSFCYIPKNTKCPMPISTYFRINALETGQ  301

Query  1150  FERTLIVADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEG  971
             FERTLIVAD+ SFVEYLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDEEG
Sbjct  302   FERTLIVADEGSFVEYLEGCTAPSYDRNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEEG  361

Query  970   RGGIFNFVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQ  791
             RGG++NFVTKRGLCAG+RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQ
Sbjct  362   RGGVYNFVTKRGLCAGARSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQ  421

Query  790   QADTGTKMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNN  611
             QADTGTKMIHKGKNTRSRIISKGISAG+SRNCYRGLVQV S A+NA+N+S CDSMLIG+N
Sbjct  422   QADTGTKMIHKGKNTRSRIISKGISAGNSRNCYRGLVQVQSKAENAKNTSTCDSMLIGDN  481

Query  610   AAANTYPYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNE  431
             AAANTYPYIQ KNP+AR+EHEA+TSKIGEDQLFYFQQRGID+EKA+AAMISGFC DVFNE
Sbjct  482   AAANTYPYIQVKNPTARVEHEASTSKIGEDQLFYFQQRGIDHEKALAAMISGFCSDVFNE  541

Query  430   LPDEFGAEVNQLMSLKLEGSVG  365
             LP EFGAEVNQLMS+KLEGSVG
Sbjct  542   LPQEFGAEVNQLMSIKLEGSVG  563



>ref|XP_009357441.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Pyrus x 
bretschneideri]
Length=549

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/555 (78%), Positives = 482/555 (87%), Gaps = 22/555 (4%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLR-----TQNP-RNFKVRAEAKVTIDAP  1829
             LL  GIS FS Q   EPPK  K   V PK  +L+     T  P R F+VRA+        
Sbjct  4     LLANGISSFSPQAAAEPPKFPKG--VHPKLDSLKLSGQKTPTPKRVFRVRADV-------  54

Query  1828  GKQPSPSTSNEDDP----LQKFLKR---DYKWGFNQEIDSFTLPKGLSEETIRLISSRKN  1670
             G  P P  S+        +++FL+    D K+GFN +IDSF++PKGLS ETIRLI + K 
Sbjct  55    GYDPKPIESDSGTSGKLSIEEFLRNREYDKKFGFNIDIDSFSIPKGLSRETIRLIWTLKG  114

Query  1669  EPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELI  1490
             EPDWMLEFRL ++E+F+ MKEP+WSDNRYP INFQD+CYYS PKKKPTL +LDEADPEL+
Sbjct  115   EPDWMLEFRLNAFEKFLTMKEPQWSDNRYPAINFQDMCYYSAPKKKPTLKNLDEADPELL  174

Query  1489  KYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVR  1310
             KYF++LGVPLNE+NRLANVAVDAVLDSVSIATTHRK LE+ GVIFCSISEAIREYPDLVR
Sbjct  175   KYFDRLGVPLNEQNRLANVAVDAVLDSVSIATTHRKALEEKGVIFCSISEAIREYPDLVR  234

Query  1309  KYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIV  1130
             K+LGRVVP+ DN+Y ALNSAVFSDGSF Y+PK+T+CPMQISTYFRINA+ETGQFERTLIV
Sbjct  235   KHLGRVVPTGDNYYAALNSAVFSDGSFCYIPKDTKCPMQISTYFRINALETGQFERTLIV  294

Query  1129  ADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNF  950
             ADD SFVEYLEGCTAPSYDTNQLHAAVVELYC EGAEIKYSTVQNWYAGDE+G+GGI+NF
Sbjct  295   ADDRSFVEYLEGCTAPSYDTNQLHAAVVELYCGEGAEIKYSTVQNWYAGDEQGKGGIYNF  354

Query  949   VTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTK  770
             VTKRGLCAG+RSKISWTQVETGSAITWKYPSVVLEGD+SVGEFYSVALTNNYQQADTGTK
Sbjct  355   VTKRGLCAGARSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGTK  414

Query  769   MIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYP  590
             MIHKGKNTRSRIISKGISAG+SRNCYRGLVQV S A+NA+NSSQCDSMLIG+ AAANTYP
Sbjct  415   MIHKGKNTRSRIISKGISAGNSRNCYRGLVQVQSKAENAKNSSQCDSMLIGDTAAANTYP  474

Query  589   YIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGA  410
             YIQ KNP+ARIEHEA+TSKIGEDQLFYFQQRGI+YEKAMAAMISGFCRDVFNELPDEFG+
Sbjct  475   YIQVKNPTARIEHEASTSKIGEDQLFYFQQRGIEYEKAMAAMISGFCRDVFNELPDEFGS  534

Query  409   EVNQLMSLKLEGSVG  365
             EVNQL+ LKLE SVG
Sbjct  535   EVNQLIGLKLENSVG  549



>ref|XP_008371099.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic [Malus domestica]
Length=548

 Score =   890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/550 (79%), Positives = 481/550 (87%), Gaps = 13/550 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLR-----TQNPRNFKVRAEAKVTIDAPG  1826
             LL  GIS FS Q   EPPK  K     PK  +L+     T   R F+VRA+  V  +   
Sbjct  4     LLANGISSFSPQAASEPPKFPKGFH--PKLDSLKFSGQKTSPKRVFRVRAD--VGYEPKT  59

Query  1825  KQPSPSTSNEDDPLQKFLKR---DYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWM  1655
              +  PSTS +   +++FL+    D K+GFN +IDSF++PKGLS ETI LISS K EPDWM
Sbjct  60    VESDPSTSGKLS-IEEFLRNREYDKKFGFNIDIDSFSIPKGLSRETIELISSLKGEPDWM  118

Query  1654  LEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEK  1475
             LEFRL ++E+F+ MKEP+WSDNRYP INFQD+CY+S PKKKP LNSLDEADPEL+KYF++
Sbjct  119   LEFRLNAFEKFLTMKEPQWSDNRYPAINFQDMCYFSAPKKKPALNSLDEADPELLKYFDR  178

Query  1474  LGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGR  1295
             LGVPLNE+NRLANVAVDAVLDSVSIATTHRK LE+ GVIFCSISEAIREYPDLV K LGR
Sbjct  179   LGVPLNEQNRLANVAVDAVLDSVSIATTHRKALEEKGVIFCSISEAIREYPDLVXKXLGR  238

Query  1294  VVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSS  1115
             VVP+ DN+Y ALNSAVFSDGSF Y+PK+T+CPMQISTYFRINA+ETGQFERTLIVADD S
Sbjct  239   VVPTGDNYYAALNSAVFSDGSFCYIPKDTKCPMQISTYFRINALETGQFERTLIVADDRS  298

Query  1114  FVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRG  935
             FVEYLEGCTAPSYDTNQLHAAVVELYC EGAEIKYSTVQNWYAGDE+G+GGI+NFVTKRG
Sbjct  299   FVEYLEGCTAPSYDTNQLHAAVVELYCGEGAEIKYSTVQNWYAGDEQGKGGIYNFVTKRG  358

Query  934   LCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKG  755
             LCAG+RSKISWTQVETGSAITWKYPSVVLEGD+SVGEFYSVALTNNYQQADTGTKMIHKG
Sbjct  359   LCAGARSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGTKMIHKG  418

Query  754   KNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTK  575
             KNTRSRIISKGISAG+SRNCYRGLVQV S A+NA+NSSQCDSMLIG+ AAANTYPYIQ K
Sbjct  419   KNTRSRIISKGISAGNSRNCYRGLVQVQSKAENAKNSSQCDSMLIGDTAAANTYPYIQVK  478

Query  574   NPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQL  395
             NP+ARIEHEA+TSKIGEDQLFYFQQRGI+YEKAMAAMISGFCRDVFNELPDEFG+EVNQL
Sbjct  479   NPTARIEHEASTSKIGEDQLFYFQQRGIEYEKAMAAMISGFCRDVFNELPDEFGSEVNQL  538

Query  394   MSLKLEGSVG  365
             + LKLE SVG
Sbjct  539   IGLKLENSVG  548



>ref|NP_192386.1| ATP binding cassette protein 1 [Arabidopsis thaliana]
 sp|Q9ZS97.1|AB8I_ARATH RecName: Full=UPF0051 protein ABCI8, chloroplastic; AltName: 
Full=ABC transporter I family member 8; Short=ABC transporter 
ABCI.8; Short=AtABCI8; AltName: Full=Non-intrinsic ABC protein 
1; Short=Protein ABC1; AltName: Full=Plastid sufB-like 
protein; AltName: Full=Protein LONG AFTER FAR-RED 6; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD03441.1| contains similarity to Guillardia theta ABC transporter (GB:AF041468) 
[Arabidopsis thaliana]
 emb|CAB80842.1| putative ABC transporter [Arabidopsis thaliana]
 gb|AAK97666.1| AT4g04770/T4B21_16 [Arabidopsis thaliana]
 gb|AAL08266.1| AT4g04770/T4B21_16 [Arabidopsis thaliana]
 gb|AAM98333.1| At4g04770/T4B21_16 [Arabidopsis thaliana]
 tpg|DAA01952.1| TPA_exp: putative ABC transporter 1 [Arabidopsis thaliana]
 gb|AEE82423.1| ATP binding cassette protein 1 [Arabidopsis thaliana]
Length=557

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/556 (77%), Positives = 482/556 (87%), Gaps = 16/556 (3%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRN-------FKVRAEAKVTIDA  1832
             LL  GIS FS QP  +  KS K     PKP +L+  +P++       FK+RA+  +    
Sbjct  4     LLANGISSFSPQPTSDSSKSPKGFH--PKPESLKFPSPKSLNPTRPIFKLRADVGIDSRP  61

Query  1831  PG----KQPSPSTSNEDDPLQKF---LKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRK  1673
              G         ST +  D LQ++   L  D K+GF ++IDSFT+PKGLSEETIRLIS  K
Sbjct  62    IGASESSSSGTSTVSSTDKLQQYFQNLDYDKKYGFVEDIDSFTIPKGLSEETIRLISKLK  121

Query  1672  NEPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPEL  1493
              EPDWMLEFR K+Y +F+ ++EPKWSDNRYP INFQD+CYYS PKKKPTLNSLDE DP+L
Sbjct  122   EEPDWMLEFRFKAYAKFLKLEEPKWSDNRYPSINFQDMCYYSAPKKKPTLNSLDEVDPQL  181

Query  1492  IKYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLV  1313
             ++YF+KLGVPL E+ RLANVAVDAV+DSVSIATTHRKTLEKSGVIFCSISEAIREYPDL+
Sbjct  182   LEYFDKLGVPLTEQKRLANVAVDAVIDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLI  241

Query  1312  RKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLI  1133
             +KYLGRVVPS+DN+Y ALNSAVFSDGSF Y+PKNTRCPM ISTYFRINAMETGQFERTLI
Sbjct  242   KKYLGRVVPSDDNYYAALNSAVFSDGSFCYIPKNTRCPMPISTYFRINAMETGQFERTLI  301

Query  1132  VADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFN  953
             VA++ SFVEYLEGCTAPSYDTNQLHAAVVELYC +GAEIKYSTVQNWYAGDE+G+GGI+N
Sbjct  302   VAEEGSFVEYLEGCTAPSYDTNQLHAAVVELYCGKGAEIKYSTVQNWYAGDEQGKGGIYN  361

Query  952   FVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGT  773
             FVTKRGLCAG RSKISWTQVETGSAITWKYPSVVLEGD+SVGEFYSVALTNNYQQADTGT
Sbjct  362   FVTKRGLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGT  421

Query  772   KMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTY  593
             KMIHKGKNT+SRIISKGISAGHSRNCYRGLVQV S A+ A+N+S CDSMLIG+ AAANTY
Sbjct  422   KMIHKGKNTKSRIISKGISAGHSRNCYRGLVQVQSKAEGAKNTSTCDSMLIGDKAAANTY  481

Query  592   PYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFG  413
             PYIQ KNPSA++EHEA+TSKIGEDQLFYFQQRGID+E+A+AAMISGFCRDVFN+LPDEFG
Sbjct  482   PYIQVKNPSAKVEHEASTSKIGEDQLFYFQQRGIDHERALAAMISGFCRDVFNKLPDEFG  541

Query  412   AEVNQLMSLKLEGSVG  365
             AEVNQLMS+KLEGSVG
Sbjct  542   AEVNQLMSIKLEGSVG  557



>ref|XP_008349301.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Malus domestica]
Length=549

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/555 (78%), Positives = 480/555 (86%), Gaps = 22/555 (4%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLR-----TQNPRN-FKVRAEAKVTIDAP  1829
             LL  GIS FS Q   EPPK  K     PK  +L+     T  P+  F+VRA+        
Sbjct  4     LLANGISXFSXQSAAEPPKFPKGXH--PKLDSLKLSGQKTPAPKXVFRVRADV-------  54

Query  1828  GKQPSPSTSNEDDP----LQKFLKR---DYKWGFNQEIDSFTLPKGLSEETIRLISSRKN  1670
             G  P P  S+        +++FL+    D K+GFN +IDSF++PKGLS ETIRLI + K 
Sbjct  55    GYDPKPIESDSGTSGKLSIEEFLRNREYDKKFGFNIDIDSFSIPKGLSRETIRLIWTLKG  114

Query  1669  EPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELI  1490
             EPDWMLEFRL ++E+F+ MKEP+WSDNRYP INFQD+CYYS PKKKPTL +LDEADPEL+
Sbjct  115   EPDWMLEFRLNAFEKFLTMKEPQWSDNRYPAINFQDMCYYSAPKKKPTLKNLDEADPELL  174

Query  1489  KYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVR  1310
             KYF++LGVPLNE+NRLANVAVDAVLDSVSIATTHRK LE+ GVIFCSISEAIREYPDLVR
Sbjct  175   KYFDRLGVPLNEQNRLANVAVDAVLDSVSIATTHRKALEEKGVIFCSISEAIREYPDLVR  234

Query  1309  KYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIV  1130
             K+LGRVVP+ DN+Y ALNSAVFSDGSF Y+PK+T+CPMQISTYFRINA+ETGQFERTLIV
Sbjct  235   KHLGRVVPTGDNYYAALNSAVFSDGSFCYIPKDTKCPMQISTYFRINALETGQFERTLIV  294

Query  1129  ADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNF  950
             ADD SFVEYLEGCTAPSYDTNQLHAAVVELYC EGAEIKYSTVQNWYAGDE+G+GGI+NF
Sbjct  295   ADDRSFVEYLEGCTAPSYDTNQLHAAVVELYCGEGAEIKYSTVQNWYAGDEQGKGGIYNF  354

Query  949   VTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTK  770
             VTKRGLCAG+RSKISWTQVETGSAITWKYPSVVLEGD+SVGEFYSVALTNNYQQADTGTK
Sbjct  355   VTKRGLCAGARSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGTK  414

Query  769   MIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYP  590
             MIHKGKNTRSRIISKGISAG+SRNCYRGLVQV S A+NA+NSSQCDSMLIG+ AAANTYP
Sbjct  415   MIHKGKNTRSRIISKGISAGNSRNCYRGLVQVQSKAENAKNSSQCDSMLIGDTAAANTYP  474

Query  589   YIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGA  410
             YIQ KNP+ARIEHEA+TSKIGEDQLFYFQQRGI+YEKAMAAMISGFCRD FNELPDEFG+
Sbjct  475   YIQVKNPTARIEHEASTSKIGEDQLFYFQQRGIEYEKAMAAMISGFCRDXFNELPDEFGS  534

Query  409   EVNQLMSLKLEGSVG  365
             EVNQL+ LKLE SVG
Sbjct  535   EVNQLIGLKLENSVG  549



>ref|XP_007155095.1| hypothetical protein PHAVU_003G172700g [Phaseolus vulgaris]
 gb|ESW27089.1| hypothetical protein PHAVU_003G172700g [Phaseolus vulgaris]
Length=538

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/546 (78%), Positives = 483/546 (88%), Gaps = 16/546 (3%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNP-RNFKVRAEAKVTIDAPGKQPS  1814
             L   G+SL  + P  +P +  K   +LP   N++   P R+F VRAE K T        +
Sbjct  5     LRCNGLSLSPLPP--QPTRHPKF--ILPPTLNIKPPKPSRHFTVRAEVKET--------A  52

Query  1813  PSTSNEDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFR  1643
              + +  D+ +++ L+ RDY  K+GF+ +IDSF++PKGLS+ETIR+ISS K EP WMLEFR
Sbjct  53    ATATTSDEKIREILRNRDYDKKFGFSVDIDSFSIPKGLSKETIRVISSLKEEPQWMLEFR  112

Query  1642  LKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVP  1463
             LK++E+F++MK P WSDN YP I+FQ+ICYYS PKKKP+L SLDEADPEL++YF+KLGVP
Sbjct  113   LKAFEKFLSMKLPTWSDNTYPPIDFQNICYYSAPKKKPSLQSLDEADPELLRYFDKLGVP  172

Query  1462  LNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPS  1283
             LNE+ RLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAI+EYP+LVRKYLGRVVPS
Sbjct  173   LNEQKRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIKEYPELVRKYLGRVVPS  232

Query  1282  EDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEY  1103
             +DN+Y ALNSAVFSDGSF Y+PK+T+CPMQISTYFRINA+ETGQFERTLIVADD S VEY
Sbjct  233   DDNYYAALNSAVFSDGSFCYIPKDTKCPMQISTYFRINALETGQFERTLIVADDRSAVEY  292

Query  1102  LEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAG  923
             LEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDE G+GG++NFVTKRG+C G
Sbjct  293   LEGCTAPSYDRNQLHAAVVELYCGEGAEIKYSTVQNWYAGDENGKGGVYNFVTKRGVCDG  352

Query  922   SRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTR  743
             +RSKISWTQVETGSAITWKYPSVVLEGD+SVGEFYSVALTNNYQQADTGTKMIHKGKNTR
Sbjct  353   ARSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGTKMIHKGKNTR  412

Query  742   SRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSA  563
             SRIISKGIS GHSRNCYRGLVQV+S ADNARNSSQCDSMLIG+NAAANTYPYIQ KNP+A
Sbjct  413   SRIISKGISVGHSRNCYRGLVQVLSKADNARNSSQCDSMLIGDNAAANTYPYIQVKNPTA  472

Query  562   RIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLK  383
             RIEHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFG+EVNQLMSLK
Sbjct  473   RIEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGSEVNQLMSLK  532

Query  382   LEGSVG  365
             LEGSVG
Sbjct  533   LEGSVG  538



>ref|XP_003622190.1| ATP-binding cassette transporter subfamily I member 15 ABC component 
protein PpABCI15 [Medicago truncatula]
 gb|AES78408.1| iron-regulated ABC transporter membrane component SufB [Medicago 
truncatula]
 gb|KEH22288.1| iron-regulated ABC transporter membrane component SufB [Medicago 
truncatula]
Length=547

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/547 (77%), Positives = 474/547 (87%), Gaps = 8/547 (1%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEP--PKSLKASQVLPKPSNLRTQNPRNFKVRAEAKVTIDAPGKQP  1817
             LL   +S    QP       K+L      P     + ++P +  V+  + V+ +     P
Sbjct  4     LLNGSVSSLHPQPTQTSFSKKALLHQTHFPISKTPKQKSPLSKTVKIRSDVSYEKRNTSP  63

Query  1816  SPSTSNEDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEF  1646
             + ST   DD +++ L+ RDY  K+GFN  IDSFT+PKGLS ETIRLIS+ K+EPDWML F
Sbjct  64    TSST---DDKIREILRNRDYDKKFGFNINIDSFTIPKGLSTETIRLISALKSEPDWMLNF  120

Query  1645  RLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGV  1466
             RL ++E+F+ MKEP WSDN YP I+FQDICYYS PK KP++NSL+EADPEL++YF+KLGV
Sbjct  121   RLNAFEKFVKMKEPNWSDNTYPTIDFQDICYYSAPKNKPSINSLEEADPELLRYFDKLGV  180

Query  1465  PLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVP  1286
             PLNE+NRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSIS+A++EYPDLVR YLG+VVP
Sbjct  181   PLNEQNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISDAVKEYPDLVRSYLGQVVP  240

Query  1285  SEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVE  1106
             SEDN+Y ALN+AVFSDGSF Y+PK  +CPMQISTYFRINA+ETGQFERTLIVADD S VE
Sbjct  241   SEDNYYAALNAAVFSDGSFCYIPKGVKCPMQISTYFRINALETGQFERTLIVADDRSMVE  300

Query  1105  YLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCA  926
             YLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDE G+GGI+NFVTKRGLCA
Sbjct  301   YLEGCTAPSYDKNQLHAAVVELYCGEGAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCA  360

Query  925   GSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNT  746
             G +SKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNT
Sbjct  361   GKKSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNT  420

Query  745   RSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPS  566
             +SRIISKGISAGHSRNCYRGLVQV S A+NA+NSSQCDSMLIG++AAANTYPYIQ KNPS
Sbjct  421   KSRIISKGISAGHSRNCYRGLVQVQSKAENAKNSSQCDSMLIGDSAAANTYPYIQVKNPS  480

Query  565   ARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSL  386
             ARIEHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFG+EVNQLMSL
Sbjct  481   ARIEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGSEVNQLMSL  540

Query  385   KLEGSVG  365
             KLEGSVG
Sbjct  541   KLEGSVG  547



>ref|XP_009114550.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic [Brassica rapa]
Length=552

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/554 (77%), Positives = 479/554 (86%), Gaps = 17/554 (3%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQ---------NPRNFKVRAEAKVTI  1838
             LL  GIS FS QP  +  KS K+    PKP + +            PR  KVRA+     
Sbjct  4     LLANGISSFSPQPTPDSSKSPKSFH--PKPDSFKFPSSSSKTLIPTPRLVKVRADVGTIE  61

Query  1837  DAPGKQPSPSTSNEDDPLQKF---LKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNE  1667
               P      S+S+  D LQ++   L  D K+GF ++IDSFT+PKGLSEETIR IS+ K+E
Sbjct  62    SNPAGN---SSSSSTDKLQQYFQNLDYDKKYGFVEDIDSFTIPKGLSEETIRSISTLKDE  118

Query  1666  PDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIK  1487
             PDWML+FR K+Y +F+ +KEP+WSDNRYP I+F ++CYYS PKKKPTLNSLDEADP+L+ 
Sbjct  119   PDWMLDFRFKAYAKFLTLKEPQWSDNRYPPIDFNNMCYYSAPKKKPTLNSLDEADPQLLD  178

Query  1486  YFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRK  1307
             YF+KLGVPL E+ RLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDL++K
Sbjct  179   YFDKLGVPLTEQKRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLIKK  238

Query  1306  YLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVA  1127
             YLGRVVP +DN+Y ALNSAVFSDGSF Y+PKNTRCPM ISTYFRINAMETGQFERTLIVA
Sbjct  239   YLGRVVPIDDNYYAALNSAVFSDGSFCYIPKNTRCPMPISTYFRINAMETGQFERTLIVA  298

Query  1126  DDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFV  947
             ++ SFVEYLEGCTAPSYDTNQLHAAVVELYC EGAEIKYSTVQNWYAGDEEG+GGI+NFV
Sbjct  299   EEGSFVEYLEGCTAPSYDTNQLHAAVVELYCGEGAEIKYSTVQNWYAGDEEGKGGIYNFV  358

Query  946   TKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKM  767
             TKRGLCAG RSKISWTQVETGSAITWKYPSVVLEGD+SVGEFYSVALTNNYQQADTGTKM
Sbjct  359   TKRGLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGTKM  418

Query  766   IHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPY  587
             IHKGKNT+SRIISKGISAG+SRNCYRGLVQV S A+NA+N+S CDSMLIG+ AAANTYPY
Sbjct  419   IHKGKNTKSRIISKGISAGNSRNCYRGLVQVQSKAENAKNTSVCDSMLIGDKAAANTYPY  478

Query  586   IQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAE  407
             IQ KNPSA++EHEA+TSKIGEDQLFYFQQRGID+E+A+AAMISGFCRDVFN+LPDEFGAE
Sbjct  479   IQVKNPSAKVEHEASTSKIGEDQLFYFQQRGIDHERALAAMISGFCRDVFNKLPDEFGAE  538

Query  406   VNQLMSLKLEGSVG  365
             VNQLMS+KLEGSVG
Sbjct  539   VNQLMSIKLEGSVG  552



>ref|XP_006600720.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Glycine 
max]
Length=530

 Score =   882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/542 (79%), Positives = 474/542 (87%), Gaps = 24/542 (4%)
 Frame = -3

Query  1978  GISLFSV--QPVCEPPKSLKASQVLPKPSNLRTQNPRNFKVRAEAKVTIDAPGKQPSPST  1805
             G+SLF +  QP  +P        +LPKPS L T       VRAE K T       P+ +T
Sbjct  9     GVSLFPLPSQPTRDP--------ILPKPSRLVT-------VRAEVKET-----SAPAAAT  48

Query  1804  SNEDDPLQKFLKRDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSY  1631
             S+++   +    RDY  K+GF+ EI+S T+PKGLS+ETI LISS K EP WMLEFRLK+ 
Sbjct  49    SSDEKIREILRNRDYDKKFGFSVEIESLTIPKGLSKETIGLISSLKEEPHWMLEFRLKAL  108

Query  1630  ERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNER  1451
             ++F++MKEP WSDN YP I+ Q+ICYYS PK KP+L SLD+ADPEL++YFEKLGVPLNE+
Sbjct  109   DKFLSMKEPTWSDNTYPPIDLQNICYYSAPKNKPSLQSLDDADPELLRYFEKLGVPLNEQ  168

Query  1450  NRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNF  1271
              RLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAI+EYPDLV+KYLG+VVPS+DN+
Sbjct  169   KRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIKEYPDLVKKYLGKVVPSDDNY  228

Query  1270  YGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGC  1091
             Y ALN+AVFSDGSF Y+PK+T+CPMQISTYFRINA+ETGQFERTLIVADD S VEYLEGC
Sbjct  229   YAALNAAVFSDGSFCYIPKDTKCPMQISTYFRINALETGQFERTLIVADDRSSVEYLEGC  288

Query  1090  TAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSK  911
             TAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDEEG+GG++NFVTKRGLC G+ SK
Sbjct  289   TAPSYDRNQLHAAVVELYCGEGAEIKYSTVQNWYAGDEEGKGGVYNFVTKRGLCGGAGSK  348

Query  910   ISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRII  731
             ISWTQVETGSAITWKYPSVVLEGD SVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRII
Sbjct  349   ISWTQVETGSAITWKYPSVVLEGDGSVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRII  408

Query  730   SKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEH  551
             SKGIS GHSRNCYRGLVQV+S ADNARNSSQCDSMLIG+NAAANTYPYIQ KNP+ARIEH
Sbjct  409   SKGISVGHSRNCYRGLVQVLSKADNARNSSQCDSMLIGDNAAANTYPYIQVKNPTARIEH  468

Query  550   EATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGS  371
             EA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFG+EVNQLMSLKLEGS
Sbjct  469   EASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGSEVNQLMSLKLEGS  528

Query  370   VG  365
             VG
Sbjct  529   VG  530



>ref|XP_004494771.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Cicer arietinum]
Length=547

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/551 (77%), Positives = 477/551 (87%), Gaps = 16/551 (3%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSN-------LRTQNPRNFKVRAEAKVTIDA  1832
             LL  G+S     P     KS   ++ L  P+N        + Q P + K+R+ + V+ + 
Sbjct  4     LLNSGVSPLHPHPT---QKSSNLTKFLLHPNNNFPISIPPKHQKPFSVKIRSSSDVSYE-  59

Query  1831  PGKQPSPSTSNEDDPLQKFLKRDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDW  1658
                Q + ST+ +D   +    RDY  K+GFN +IDSFT+PKGLS+ETIRLISS K+EPDW
Sbjct  60    ---QRNNSTTTDDKIREILRNRDYDKKFGFNIDIDSFTIPKGLSQETIRLISSLKHEPDW  116

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             ML FRL ++++F  MK P WSDN YP I+FQDICYYS PK KP+LNSL EADPEL++YF+
Sbjct  117   MLNFRLNAFDKFSKMKPPNWSDNTYPSIDFQDICYYSAPKTKPSLNSLQEADPELLRYFD  176

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             KLGVPLNE+NRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAI+EYPDLV+ YLG
Sbjct  177   KLGVPLNEQNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIKEYPDLVKSYLG  236

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
             +VV S+DN+Y ALNSAVFSDGSF Y+PK+T+CPMQISTYFRINA+ETGQFERTLIVADD 
Sbjct  237   KVVASDDNYYAALNSAVFSDGSFCYIPKDTKCPMQISTYFRINALETGQFERTLIVADDR  296

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             S VEYLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDE+G GGI+NFVTKR
Sbjct  297   SSVEYLEGCTAPSYDKNQLHAAVVELYCREGAEIKYSTVQNWYAGDEKGIGGIYNFVTKR  356

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             G+CAG+RSKISWTQVETGSAITWKYPSVVLEGD+SVGEFYSVALTNNYQQADTGTKMIHK
Sbjct  357   GVCAGARSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGTKMIHK  416

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQT  578
             GKNT+SRIISKGISAGHSRNCYRGLVQV S A+NARNSSQCDSMLIG+NAAANTYPYIQ 
Sbjct  417   GKNTKSRIISKGISAGHSRNCYRGLVQVQSKAENARNSSQCDSMLIGDNAAANTYPYIQV  476

Query  577   KNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  398
             KNP+ARIEHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFG+EVNQ
Sbjct  477   KNPTARIEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGSEVNQ  536

Query  397   LMSLKLEGSVG  365
             LMSLKLEGSVG
Sbjct  537   LMSLKLEGSVG  547



>ref|XP_004293279.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=546

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/551 (78%), Positives = 482/551 (87%), Gaps = 17/551 (3%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKP-SNLRTQNP-----RNFKVRAEAKVTIDAP  1829
             LL   ISLFS QP  + PK  K   + P    NL T  P     +  KVRA+ + T    
Sbjct  4     LLANSISLFSPQPTPDSPKFPKPFFLHPHNFLNLPTHKPSFSSSQILKVRADVEPT----  59

Query  1828  GKQPSPSTSNEDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDW  1658
                PSP ++ E   +++FL+ RDY  K+GFN EIDS ++PKGLS+ET+RLIS  K EP W
Sbjct  60    ---PSPESA-EKFTIEEFLRNRDYDTKFGFNIEIDSTSIPKGLSKETVRLISQIKQEPAW  115

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             MLEFRL++YE+F+ MKEP WSDNRYP+++FQD+CYYS P +K TL SLDEADPEL+KYFE
Sbjct  116   MLEFRLQAYEKFIAMKEPNWSDNRYPKVDFQDMCYYSAPTQKKTLGSLDEADPELLKYFE  175

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             +LGVPLNE+NRLANVAVDAVLDSVSIATTHRKTLE++GVIFCSISEAIREYPDLVR+YLG
Sbjct  176   RLGVPLNEQNRLANVAVDAVLDSVSIATTHRKTLEEAGVIFCSISEAIREYPDLVREYLG  235

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
             +VVP+ DN+Y ALN+AVFSDGSF YVPK+T+CPMQISTYFRINA+ETGQFERTLIVA+D 
Sbjct  236   KVVPAGDNYYAALNAAVFSDGSFCYVPKDTKCPMQISTYFRINALETGQFERTLIVAEDR  295

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             SFVEYLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDEEG+GGI+NFVTKR
Sbjct  296   SFVEYLEGCTAPSYDRNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEEGKGGIYNFVTKR  355

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             G CAG+RSKISWTQVETGSAITWKYPSVVLEGD+SVGEFYSVALTNNYQQADTGTKMIHK
Sbjct  356   GRCAGARSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGTKMIHK  415

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQT  578
             GKNTRSRIISKGISAG+SRNCYRGLVQV S A+NARNSSQCDSMLIG+ AAANTYPYI+ 
Sbjct  416   GKNTRSRIISKGISAGNSRNCYRGLVQVFSQAENARNSSQCDSMLIGDKAAANTYPYIEV  475

Query  577   KNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  398
             KNP+ARIEHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFC+ VFNELPDEFG+EVNQ
Sbjct  476   KNPTARIEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCQAVFNELPDEFGSEVNQ  535

Query  397   LMSLKLEGSVG  365
             L+ LKLEG+VG
Sbjct  536   LIGLKLEGTVG  546



>ref|XP_010059622.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic, partial [Eucalyptus 
grandis]
Length=553

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/471 (87%), Positives = 444/471 (94%), Gaps = 0/471 (0%)
 Frame = -3

Query  1777  FLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKW  1598
             F   D K+GFN +IDSF++PKGLS ET+RLIS  K EP+WMLEFRL ++E+F+ MKEP+W
Sbjct  83    FNDYDEKYGFNVDIDSFSIPKGLSRETVRLISQLKEEPEWMLEFRLSAFEKFLKMKEPQW  142

Query  1597  SDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAVDAV  1418
             SDN YP I+FQD+CYYS PKKKP LNSLDEADPEL+KYF++LG+PLNERNRLANVAVDAV
Sbjct  143   SDNAYPSIDFQDVCYYSAPKKKPALNSLDEADPELVKYFDRLGIPLNERNRLANVAVDAV  202

Query  1417  LDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFSD  1238
             LDSVSIATTHR+TL K+GVIFCSISEAI+EYPDLVRKYLGRVVPSEDN+Y ALNSAVFSD
Sbjct  203   LDSVSIATTHRETLHKAGVIFCSISEAIKEYPDLVRKYLGRVVPSEDNYYAALNSAVFSD  262

Query  1237  GSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQLH  1058
             GSF Y+PK+T+CPMQISTYFRINAMETGQFERTLIVA+D SFVEYLEGCTAPSYD NQLH
Sbjct  263   GSFCYIPKDTKCPMQISTYFRINAMETGQFERTLIVAEDRSFVEYLEGCTAPSYDRNQLH  322

Query  1057  AAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVETGSA  878
             AAVVELYC EGAEIKYSTVQNWYAGDE G+GGI+NFVTKRGLCAG+RSKISWTQVETGSA
Sbjct  323   AAVVELYCAEGAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCAGNRSKISWTQVETGSA  382

Query  877   ITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGHSRN  698
             ITWKYPSVVLEGD++VGEFYSVALTNN+QQADTGTKMIHKGKNTRSRIISKGISAG SRN
Sbjct  383   ITWKYPSVVLEGDDTVGEFYSVALTNNHQQADTGTKMIHKGKNTRSRIISKGISAGFSRN  442

Query  697   CYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIGEDQ  518
             CYRGLVQV S A+NARNSSQCDSMLIG+ AAANTYPYIQ KNP+ARIEHEA+TSKIGEDQ
Sbjct  443   CYRGLVQVQSKAENARNSSQCDSMLIGDKAAANTYPYIQVKNPTARIEHEASTSKIGEDQ  502

Query  517   LFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             LFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEV+QLMSLKLEGSVG
Sbjct  503   LFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVHQLMSLKLEGSVG  553



>ref|XP_009345544.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Pyrus x 
bretschneideri]
Length=537

 Score =   874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/539 (79%), Positives = 475/539 (88%), Gaps = 14/539 (3%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLR-----TQNP-RNFKVRAEAKVTIDAP  1829
             LLT GIS FS Q   EPPK  K     PK  +L+     T  P R F+VRA+  V  +  
Sbjct  4     LLTNGISSFSPQAASEPPKFPKGFH--PKRDSLKFSGQKTSAPKRVFRVRAD--VGYEPK  59

Query  1828  GKQPSPSTSNEDDPLQKFLKR---DYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDW  1658
               +  PST+ +   +++FL+    D K+GFN +IDSF++PKGLS ETI LISS K EPDW
Sbjct  60    TVESDPSTAGKLS-IEEFLRNREYDKKFGFNIDIDSFSIPKGLSRETIELISSLKGEPDW  118

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             MLEFRL ++E+F+ MKEP+WSDNRYP INFQD+CY+S PKKKP LNSLDEADPEL+KYF+
Sbjct  119   MLEFRLNAFEKFLTMKEPQWSDNRYPVINFQDMCYFSAPKKKPALNSLDEADPELLKYFD  178

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             +LGVPLNE+NRLANVAVDAVLDSVSIATTHRK LE+ GVIFCSISEAIREYP+LVRKYLG
Sbjct  179   RLGVPLNEQNRLANVAVDAVLDSVSIATTHRKALEEKGVIFCSISEAIREYPNLVRKYLG  238

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
             +VVP+ DN+Y ALNSAVFSDGSF Y+PK+T+CPMQISTYFRINA+ETGQFERTLIVADD 
Sbjct  239   KVVPTGDNYYAALNSAVFSDGSFCYIPKDTKCPMQISTYFRINALETGQFERTLIVADDR  298

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             SFVEYLEGCTAPSYDTNQLHAAVVELYC EGAEIKYSTVQNWYAGDE+G+GGI+NFVTKR
Sbjct  299   SFVEYLEGCTAPSYDTNQLHAAVVELYCGEGAEIKYSTVQNWYAGDEQGKGGIYNFVTKR  358

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             GLCAG+RSKISWTQVETGSAITWKYPSVVLEGD+SVGEFYSVALTNNYQQADTGTKMIHK
Sbjct  359   GLCAGARSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGTKMIHK  418

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQT  578
             GKNTRSRIISKGISAG+SRNCYRGLVQV S A+NA+NSSQCDSMLIG+ AAANTYPYIQ 
Sbjct  419   GKNTRSRIISKGISAGNSRNCYRGLVQVQSKAENAKNSSQCDSMLIGDTAAANTYPYIQV  478

Query  577   KNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVN  401
             KNP+ARIEHEA+TSKIGEDQLFYFQQRGI+YEKAMAAMISGFCRDVFNELPDEFG+EVN
Sbjct  479   KNPTARIEHEASTSKIGEDQLFYFQQRGIEYEKAMAAMISGFCRDVFNELPDEFGSEVN  537



>gb|KEH18443.1| iron-regulated ABC transporter membrane component SufB [Medicago 
truncatula]
Length=546

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/546 (77%), Positives = 472/546 (86%), Gaps = 7/546 (1%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQN-PRNFKVRAEAKVTIDAPGKQPS  1814
             LL   +S    QP      S     +L +   L   N P++    ++  V I +     S
Sbjct  4     LLNGNVSSLHSQPT---QTSFSKKPLLHQTHFLPISNTPKHKSPLSKTTVQIRSDVSYDS  60

Query  1813  PSTSNEDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFR  1643
             P++S+ DD +++ L+ RDY  K+GFN +IDS T+PKGLS +TI LIS+ K+EP WML FR
Sbjct  61    PTSSSTDDKIREILRNRDYDKKFGFNIDIDSVTIPKGLSTQTIHLISALKSEPHWMLNFR  120

Query  1642  LKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVP  1463
             L ++E+F  MKEP WSDN YP I+FQDICYYS PK KP +NSL+EADPEL++YF+KLGVP
Sbjct  121   LNAFEKFAKMKEPNWSDNTYPTIDFQDICYYSAPKNKPEINSLEEADPELLRYFDKLGVP  180

Query  1462  LNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPS  1283
             LNE+NRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSIS+A++EYPDLVR YLG+VVPS
Sbjct  181   LNEQNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISDAVKEYPDLVRTYLGKVVPS  240

Query  1282  EDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEY  1103
             +DN+Y ALN+AVFSDGSFVY+PK  +CPMQISTYFRINA+ETGQFERTLIVADD S VEY
Sbjct  241   DDNYYAALNAAVFSDGSFVYIPKGVKCPMQISTYFRINALETGQFERTLIVADDRSMVEY  300

Query  1102  LEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAG  923
             LEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDE G+GGI+NFVTKRGLCAG
Sbjct  301   LEGCTAPSYDKNQLHAAVVELYCGEGAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCAG  360

Query  922   SRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTR  743
              +SKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNT+
Sbjct  361   KKSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTK  420

Query  742   SRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSA  563
             SRIISKGISAGHSRNCYRGLVQV S A+NA+NSSQCDSMLIG++AAANTYPYIQ KNP+A
Sbjct  421   SRIISKGISAGHSRNCYRGLVQVQSKAENAKNSSQCDSMLIGDSAAANTYPYIQVKNPTA  480

Query  562   RIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLK  383
             RIEHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFG+EVNQLMSLK
Sbjct  481   RIEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGSEVNQLMSLK  540

Query  382   LEGSVG  365
             LEGSVG
Sbjct  541   LEGSVG  546



>ref|XP_003542663.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Glycine 
max]
Length=544

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/536 (80%), Positives = 476/536 (89%), Gaps = 14/536 (3%)
 Frame = -3

Query  1957  QPVCEP--PKSLKASQVLPKPSNLRTQNPRNFKVRAEAKVTIDAPGKQPSPSTSNEDDPL  1784
             QP  +P  PK        PKPS L T       VRAE K T  A     + +T++ DD +
Sbjct  18    QPRRDPILPKFFLPQSPNPKPSRLLT-------VRAEVKETSSA--AATTTTTTSSDDKI  68

Query  1783  QKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNM  1613
             ++ L+ RDY  K+GF+ +I+S T+PKGLS+ETIRLISS K EP WMLEFRLK++E+F++M
Sbjct  69    REILRNRDYDKKFGFSVDIESLTIPKGLSKETIRLISSLKEEPQWMLEFRLKAFEKFLSM  128

Query  1612  KEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANV  1433
             KEP WSDN YP I+FQ+ICYYS PK KP+L SLD+ADPEL++YF+KLGVPLNE+ RLANV
Sbjct  129   KEPTWSDNTYPPIDFQNICYYSAPKNKPSLQSLDDADPELLRYFDKLGVPLNEQKRLANV  188

Query  1432  AVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNS  1253
             AVDAVLDSVSIATTHRKTLEK+GVIFCSISEAI+EYPDLVRK+LGRVVPS+DN+Y ALN+
Sbjct  189   AVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIKEYPDLVRKHLGRVVPSDDNYYAALNA  248

Query  1252  AVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYD  1073
             AVFSDGSF Y+PK+T+CPMQISTYFRINA+ETGQFERTLIVADD S VEYLEGCTAPSYD
Sbjct  249   AVFSDGSFCYIPKDTKCPMQISTYFRINALETGQFERTLIVADDRSSVEYLEGCTAPSYD  308

Query  1072  TNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQV  893
              NQLHAAVVELYC EGAEIKYSTVQNWYAGDEEG+GG++NFVTKRGLCAG+ SKISWTQV
Sbjct  309   RNQLHAAVVELYCGEGAEIKYSTVQNWYAGDEEGKGGVYNFVTKRGLCAGAGSKISWTQV  368

Query  892   ETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISA  713
             ETGSAITWKYPSVVLEGD SVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGIS 
Sbjct  369   ETGSAITWKYPSVVLEGDGSVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISV  428

Query  712   GHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSK  533
             GHSRNCYRGLVQV+S A+NARNSSQCDSMLIG+NAAANTYPYIQ KNP+ARIEHEA+TSK
Sbjct  429   GHSRNCYRGLVQVLSKAENARNSSQCDSMLIGDNAAANTYPYIQVKNPTARIEHEASTSK  488

Query  532   IGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             IGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFG+EVNQLMSLKLEGSVG
Sbjct  489   IGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGSEVNQLMSLKLEGSVG  544



>emb|CBI23255.3| unnamed protein product [Vitis vinifera]
Length=511

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/550 (77%), Positives = 461/550 (84%), Gaps = 50/550 (9%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRN--------FKVRAEAKVTID  1835
             LL  G+  FS     + PK        PK  +L++ NP+         FKVRA+      
Sbjct  4     LLANGLPRFSPSETPKFPKGF-----CPKLESLKSLNPKTPKNPTSSVFKVRADH-----  53

Query  1834  APGKQPSPSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWM  1655
                     +TS+ DD LQK L RDYKWG+ + IDS  +PKGLSE+TIR+IS RKNEPDWM
Sbjct  54    --------ATSSTDDKLQKILNRDYKWGWFENIDSDAIPKGLSEKTIRMISERKNEPDWM  105

Query  1654  LEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEK  1475
             LEFRLKSYE+F+ MKEPKWSDNRYP I+FQD+CYYSEPKKKP+LNSLDEADPEL++YF+K
Sbjct  106   LEFRLKSYEKFLKMKEPKWSDNRYPPIDFQDMCYYSEPKKKPSLNSLDEADPELLRYFDK  165

Query  1474  LGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGR  1295
             LGVPLNE+NRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAIREYPDLVRKYLGR
Sbjct  166   LGVPLNEQNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIREYPDLVRKYLGR  225

Query  1294  VVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSS  1115
             VVPS+DN+Y ALNSAVFSDGSF YVPK+T+                         ADD S
Sbjct  226   VVPSDDNYYAALNSAVFSDGSFCYVPKDTK------------------------FADDRS  261

Query  1114  FVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRG  935
             FVEYLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDEEGRGGI+NFVTKRG
Sbjct  262   FVEYLEGCTAPSYDRNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEEGRGGIYNFVTKRG  321

Query  934   LCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKG  755
             LC+G+RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQQADTGTKMIHKG
Sbjct  322   LCSGARSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGTKMIHKG  381

Query  754   KNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTK  575
             KNTRSRIISKGISAG+SRNCYRGLVQV S A NARNSSQCDSMLIG+NAAANTYPYIQ K
Sbjct  382   KNTRSRIISKGISAGNSRNCYRGLVQVQSKAKNARNSSQCDSMLIGDNAAANTYPYIQVK  441

Query  574   NPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQL  395
             NP+ARIEHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFC+DVFNELPDEFGAEVNQL
Sbjct  442   NPTARIEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCKDVFNELPDEFGAEVNQL  501

Query  394   MSLKLEGSVG  365
             MSLKLEGSVG
Sbjct  502   MSLKLEGSVG  511



>ref|XP_009630331.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=479

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/473 (87%), Positives = 439/473 (93%), Gaps = 3/473 (1%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNFKVRAEAKVTID--APGKQP  1817
             LLT GIS F  QP+ E PK  K S  L K    R  N  NFK+RA A V+ D  APGK+ 
Sbjct  4     LLTNGISSFCPQPITEQPKLSKGSNFLLKSPAPRCPNSANFKIRA-ADVSYDVMAPGKES  62

Query  1816  SPSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLK  1637
             S +TSNEDDPLQKFLKRDYKWGFN++I+SF+LPKGLSEETIRLISSRKNEPDWMLE+RLK
Sbjct  63    SFATSNEDDPLQKFLKRDYKWGFNEKIESFSLPKGLSEETIRLISSRKNEPDWMLEYRLK  122

Query  1636  SYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLN  1457
             SYE+F+ MKEPKWSDN+YPEINFQDI YYSEPKKKPTLNSLDEADPEL++YF+KLGVPLN
Sbjct  123   SYEKFVKMKEPKWSDNKYPEINFQDIVYYSEPKKKPTLNSLDEADPELVRYFDKLGVPLN  182

Query  1456  ERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSED  1277
             ERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIRE+PDLVRKYL RVVP ED
Sbjct  183   ERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREHPDLVRKYLFRVVPPED  242

Query  1276  NFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLE  1097
             NFY ALNSAVFSDGSFVY+PKNT+CPMQISTYFRINAMETGQFERTLIVAD+ SFVEYLE
Sbjct  243   NFYAALNSAVFSDGSFVYIPKNTKCPMQISTYFRINAMETGQFERTLIVADEGSFVEYLE  302

Query  1096  GCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSR  917
             GCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGI+NFVTKRGLCAG+R
Sbjct  303   GCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIYNFVTKRGLCAGAR  362

Query  916   SKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSR  737
             SKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSR
Sbjct  363   SKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSR  422

Query  736   IISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQT  578
             IISKGISAGHSRNCYRGLVQV+S+A+NARNSSQCDSMLIG+NAAANTYPYIQ 
Sbjct  423   IISKGISAGHSRNCYRGLVQVLSNAENARNSSQCDSMLIGDNAAANTYPYIQV  475



>ref|XP_007024121.1| ATP binding cassette protein 1 isoform 2 [Theobroma cacao]
 gb|EOY26743.1| ATP binding cassette protein 1 isoform 2 [Theobroma cacao]
Length=503

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/545 (76%), Positives = 445/545 (82%), Gaps = 48/545 (9%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRN---FKVRAEAKVTIDAPGKQ  1820
             LL  GIS F+ QP  +  K  K            TQ P N   FKVRA+           
Sbjct  4     LLANGISSFTTQPTSDSTKFAKGFYQKLDSVKTMTQKPPNSRLFKVRADV----------  53

Query  1819  PSPSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRL  1640
                                                G   +T+    S  +EPDWMLEFRL
Sbjct  54    -----------------------------------GFDSQTLTSDPSSSSEPDWMLEFRL  78

Query  1639  KSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPL  1460
              +Y +F+ MKEPKWSDNRYP INFQDICYYS PKKKPTLNSLDEADPEL+KYF++LGV L
Sbjct  79    NAYGKFLKMKEPKWSDNRYPPINFQDICYYSAPKKKPTLNSLDEADPELLKYFDRLGVSL  138

Query  1459  NERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSE  1280
             NERNRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAIREYPDLVRKYLGRVVP E
Sbjct  139   NERNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIREYPDLVRKYLGRVVPIE  198

Query  1279  DNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYL  1100
             DN+Y ALNSAVFSDGSF Y+PK+T+CPM ISTYFRINA+ETGQFERTLIVAD+ SFVEYL
Sbjct  199   DNYYAALNSAVFSDGSFCYIPKDTKCPMPISTYFRINALETGQFERTLIVADEGSFVEYL  258

Query  1099  EGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGS  920
             EGCTAPSY+ NQLHAAVVELYC +GAEIKYSTVQNWYAGDEEG+GGI+NFVTKRGLCAG 
Sbjct  259   EGCTAPSYERNQLHAAVVELYCAKGAEIKYSTVQNWYAGDEEGKGGIYNFVTKRGLCAGD  318

Query  919   RSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRS  740
              SKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQQADTGTKMIHKG+NTRS
Sbjct  319   HSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGTKMIHKGENTRS  378

Query  739   RIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSAR  560
             RIISKGISAG+SRNCYRGLVQV S A+NARNSSQCDSMLIG+NAAANTYPYIQ KNPSAR
Sbjct  379   RIISKGISAGNSRNCYRGLVQVQSKAENARNSSQCDSMLIGDNAAANTYPYIQVKNPSAR  438

Query  559   IEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKL  380
             +EHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKL
Sbjct  439   VEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKL  498

Query  379   EGSVG  365
             EGSVG
Sbjct  499   EGSVG  503



>ref|XP_006854593.1| hypothetical protein AMTR_s00030p00124490 [Amborella trichopoda]
 gb|ERN16060.1| hypothetical protein AMTR_s00030p00124490 [Amborella trichopoda]
Length=555

 Score =   830 bits (2144),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/534 (75%), Positives = 450/534 (84%), Gaps = 11/534 (2%)
 Frame = -3

Query  1945  EPPKSLKASQVLPK--PSNLRTQNPRNFKVRAEAK-----VTIDAPGKQPSPSTSNEDDP  1787
              P  SL  +  L K  P+  R + PR  K+RAEA        ++    + +PS+    D 
Sbjct  26    HPSNSLSRTTYLCKLFPTR-RWKAPRLLKLRAEAAEVSETTVLERDASKGNPSSK---DA  81

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +QK L+R+YKWGF  +I+SF++PKGLSEETIRLIS+RKNEPDWML FRL ++ +++ M E
Sbjct  82    IQKLLQREYKWGFRSDIESFSIPKGLSEETIRLISARKNEPDWMLAFRLNAFNQWLKMTE  141

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             PKWSDN+YP INFQD+CYYSEPK++    SLDE DP+L++ F+KLG+PL E+ RLANVAV
Sbjct  142   PKWSDNQYPPINFQDMCYYSEPKQQAKKKSLDEVDPQLLETFQKLGIPLTEQKRLANVAV  201

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVSIATTHRKTLE +GVIFCSISEAIREYPDLVRKYLG+VVP  DNFY ALNSAV
Sbjct  202   DAVFDSVSIATTHRKTLEAAGVIFCSISEAIREYPDLVRKYLGKVVPPSDNFYSALNSAV  261

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSF Y+PK+T  PM ISTYFRINA+ETGQFERTLIVAD+ SFV YLEGCTAPSYD N
Sbjct  262   FSDGSFCYIPKDTVSPMDISTYFRINALETGQFERTLIVADERSFVGYLEGCTAPSYDKN  321

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL+C EGAEIKYSTVQNWYAGDEEGRGGI+NFVTKRGLC G  SKISWTQVET
Sbjct  322   QLHAAVVELFCAEGAEIKYSTVQNWYAGDEEGRGGIYNFVTKRGLCDGDNSKISWTQVET  381

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPSVVL G  SVGEFYSVALTNN QQADTGTKMIH G NTRSRI+SKGISAG 
Sbjct  382   GSAITWKYPSVVLRGKNSVGEFYSVALTNNCQQADTGTKMIHLGTNTRSRIVSKGISAGK  441

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             SRNCYRGLV+V   A NARN SQCDSMLIG+NAAANTYPY+Q  NP+AR+EHEA+TSKIG
Sbjct  442   SRNCYRGLVEVRPHAQNARNFSQCDSMLIGDNAAANTYPYMQVMNPTARVEHEASTSKIG  501

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYFQQRGID+EKA+AA+I GFCRDVFNELP EF AEVNQLMSLKLEGSVG
Sbjct  502   EDQLFYFQQRGIDHEKAVAAIIGGFCRDVFNELPLEFSAEVNQLMSLKLEGSVG  555



>gb|KCW75329.1| hypothetical protein EUGRSUZ_E04076 [Eucalyptus grandis]
Length=431

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/431 (89%), Positives = 413/431 (96%), Gaps = 0/431 (0%)
 Frame = -3

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             MLEFRL ++E+F+ MKEP+WSDN YP I+FQD+CYYS PKKKP LNSLDEADPEL+KYF+
Sbjct  1     MLEFRLSAFEKFLKMKEPQWSDNAYPSIDFQDVCYYSAPKKKPALNSLDEADPELVKYFD  60

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             +LG+PLNERNRLANVAVDAVLDSVSIATTHR+TL K+GVIFCSISEAI+EYPDLVRKYLG
Sbjct  61    RLGIPLNERNRLANVAVDAVLDSVSIATTHRETLHKAGVIFCSISEAIKEYPDLVRKYLG  120

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
             RVVPSEDN+Y ALNSAVFSDGSF Y+PK+T+CPMQISTYFRINAMETGQFERTLIVA+D 
Sbjct  121   RVVPSEDNYYAALNSAVFSDGSFCYIPKDTKCPMQISTYFRINAMETGQFERTLIVAEDR  180

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             SFVEYLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDE G+GGI+NFVTKR
Sbjct  181   SFVEYLEGCTAPSYDRNQLHAAVVELYCAEGAEIKYSTVQNWYAGDENGKGGIYNFVTKR  240

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             GLCAG+RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNN+QQADTGTKMIHK
Sbjct  241   GLCAGNRSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNHQQADTGTKMIHK  300

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQT  578
             GKNTRSRIISKGISAG SRNCYRGLVQV S A+NARNSSQCDSMLIG+ AAANTYPYIQ 
Sbjct  301   GKNTRSRIISKGISAGFSRNCYRGLVQVQSKAENARNSSQCDSMLIGDKAAANTYPYIQV  360

Query  577   KNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  398
             KNP+ARIEHEA+TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEV+Q
Sbjct  361   KNPTARIEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVHQ  420

Query  397   LMSLKLEGSVG  365
             LMSLKLEGSVG
Sbjct  421   LMSLKLEGSVG  431



>ref|XP_010922565.1| PREDICTED: UPF0051 protein in atpA 3'region-like [Elaeis guineensis]
Length=555

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/506 (75%), Positives = 438/506 (87%), Gaps = 0/506 (0%)
 Frame = -3

Query  1882  NPRNFKVRAEAKVTIDAPGKQPSPSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSE  1703
             +P+   +R  A  T   P + P      +DDP+Q+FLKRDYKWGF  +I+SF++PKGLSE
Sbjct  50    HPKKSSLRVRAVQTDRQPSRPPGGGGRVDDDPIQRFLKRDYKWGFVSDIESFSIPKGLSE  109

Query  1702  ETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTL  1523
             +TIR IS+ K+EP+WML FRL +  RF+++ EP+WSDNRY  I+FQ ICYYSEPK+KP L
Sbjct  110   DTIRSISALKDEPEWMLRFRLDALRRFLSLCEPRWSDNRYKPIDFQSICYYSEPKRKPKL  169

Query  1522  NSLDEADPELIKYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSIS  1343
             +SLDE DPEL+  F++LG+PLNE+ RL NVAVDAVLDS SIATTHR+ L + GVIFCSIS
Sbjct  170   HSLDEVDPELLATFDRLGIPLNEQKRLTNVAVDAVLDSTSIATTHREALAEKGVIFCSIS  229

Query  1342  EAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAM  1163
             EAIREYPDLVR+YLGRVVP  DNFY ALNSAVFSDGSF Y+PK+T  PM+ISTYFRIN  
Sbjct  230   EAIREYPDLVRRYLGRVVPPGDNFYAALNSAVFSDGSFCYIPKDTVSPMEISTYFRINDR  289

Query  1162  ETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAG  983
             +TGQFERTLI+AD+ S+V YLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAG
Sbjct  290   DTGQFERTLIIADERSYVSYLEGCTAPSYDRNQLHAAVVELYCAEGAEIKYSTVQNWYAG  349

Query  982   DEEGRGGIFNFVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALT  803
             DEEG GGI+NFVTKRGLC G+RSKISWTQVETGSAITWKYPSVVL+GD++VGEFYSVALT
Sbjct  350   DEEGNGGIYNFVTKRGLCDGNRSKISWTQVETGSAITWKYPSVVLKGDDTVGEFYSVALT  409

Query  802   NNYQQADTGTKMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSML  623
              +YQQADTGTKMIH GKN+RSRIISKGISAG SRNCYRGLVQV   A+NARN SQCDSML
Sbjct  410   KDYQQADTGTKMIHVGKNSRSRIISKGISAGKSRNCYRGLVQVQPQAENARNFSQCDSML  469

Query  622   IGNNAAANTYPYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRD  443
             IG+ A ANTYPYIQ KNP+AR+EHEA+TSKIGEDQLFYFQQRGID+EKA+AAMI GFCRD
Sbjct  470   IGDTAGANTYPYIQVKNPTARVEHEASTSKIGEDQLFYFQQRGIDHEKAVAAMIGGFCRD  529

Query  442   VFNELPDEFGAEVNQLMSLKLEGSVG  365
             VF++LP EF +EVN LM+LKLEGSVG
Sbjct  530   VFDKLPLEFASEVNALMNLKLEGSVG  555



>ref|XP_008805252.1| PREDICTED: UPF0051 protein in atpA 3'region-like [Phoenix dactylifera]
Length=555

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/506 (75%), Positives = 437/506 (86%), Gaps = 0/506 (0%)
 Frame = -3

Query  1882  NPRNFKVRAEAKVTIDAPGKQPSPSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSE  1703
             +P+   +R  A  T   P + P      +DDP+Q+FLKRDYKWGF  +I++F++PKGLSE
Sbjct  50    HPKKPSLRIRAVQTDRRPSRPPGDGGREDDDPIQRFLKRDYKWGFVSDIETFSIPKGLSE  109

Query  1702  ETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTL  1523
             +T+R IS+ K EP+WML FRL +  RF++++EP+WSDNRYP I+FQ  CYYSEPK+KP L
Sbjct  110   DTVRSISTLKGEPEWMLRFRLDALRRFLSLREPRWSDNRYPPIDFQSFCYYSEPKRKPKL  169

Query  1522  NSLDEADPELIKYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSIS  1343
             +SLDEADPEL+  F++LG+PLNE+ RL NVAVDAVLDS SIATTHR+ L + GVIFCSIS
Sbjct  170   HSLDEADPELLATFDRLGIPLNEQKRLTNVAVDAVLDSTSIATTHREALAEKGVIFCSIS  229

Query  1342  EAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAM  1163
             EAIREYPDLVR+YLGRVVP  DNFY ALNSAVFSDGSF Y+PK+T  PM+ISTYFRIN  
Sbjct  230   EAIREYPDLVRRYLGRVVPPGDNFYAALNSAVFSDGSFCYIPKDTVSPMEISTYFRINDR  289

Query  1162  ETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAG  983
             ETGQFERTLI+AD+ S+V YLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAG
Sbjct  290   ETGQFERTLIIADERSYVSYLEGCTAPSYDKNQLHAAVVELYCAEGAEIKYSTVQNWYAG  349

Query  982   DEEGRGGIFNFVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALT  803
             DEEG GGI+NFVTKRGLC G+RSKISWTQVETGSAITWKYPSVVL+GD+++GEFYSVALT
Sbjct  350   DEEGNGGIYNFVTKRGLCDGNRSKISWTQVETGSAITWKYPSVVLKGDDTMGEFYSVALT  409

Query  802   NNYQQADTGTKMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSML  623
              +YQQADTGTKMIH GKN+RSRIISKGISAG SRNCYRGLVQV   A NARN SQCDSML
Sbjct  410   KDYQQADTGTKMIHVGKNSRSRIISKGISAGKSRNCYRGLVQVQPQAANARNFSQCDSML  469

Query  622   IGNNAAANTYPYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRD  443
             IG+ A ANTYPYI  KNP+AR+EHEA+TSKIGEDQLFYFQQRGID+EKA+AAMI GFCRD
Sbjct  470   IGDTAGANTYPYILVKNPTARVEHEASTSKIGEDQLFYFQQRGIDHEKAVAAMIGGFCRD  529

Query  442   VFNELPDEFGAEVNQLMSLKLEGSVG  365
             VF++LP EF +EVN LM+LKLEGSVG
Sbjct  530   VFDKLPLEFASEVNALMNLKLEGSVG  555



>ref|XP_001751223.1| ATP-binding cassette transporter, subfamily I, member 15, ABC 
component protein PpABCI15 [Physcomitrella patens]
 gb|EDQ83540.1| ATP-binding cassette transporter, subfamily I, member 15, ABC 
component protein PpABCI15 [Physcomitrella patens]
Length=480

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/477 (79%), Positives = 428/477 (90%), Gaps = 0/477 (0%)
 Frame = -3

Query  1795  DDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMN  1616
             DD +Q+FLKRDYK+GF  +I+S ++PKGLSEET+RLIS++KNEP+WML FRL +++++  
Sbjct  4     DDTIQQFLKRDYKYGFVSDIESVSIPKGLSEETVRLISAKKNEPEWMLNFRLNAFKQWQK  63

Query  1615  MKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLAN  1436
             MKEP WSDN+YP+I+FQD+CYY+EPKKK T  SLDE DP+L++ F KLG+PL+E+ RLAN
Sbjct  64    MKEPTWSDNKYPQIDFQDVCYYTEPKKKETKQSLDEVDPDLLETFAKLGIPLSEQKRLAN  123

Query  1435  VAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALN  1256
             VAVDAV DSVSIATTHRKTL  +GVIFCSISEAIREYPDLV+KYLG+VVP  DN+Y ALN
Sbjct  124   VAVDAVFDSVSIATTHRKTLMAAGVIFCSISEAIREYPDLVKKYLGKVVPVADNYYAALN  183

Query  1255  SAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSY  1076
             SAVFSDGSF YVPK+T  PM+ISTYFRINAMETGQFERTLIV D++++V YLEGCTAP+Y
Sbjct  184   SAVFSDGSFCYVPKDTVSPMEISTYFRINAMETGQFERTLIVCDENAYVSYLEGCTAPAY  243

Query  1075  DTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQ  896
             D NQLHAAVVELYC  GAEIKYSTVQNWYAGD EG+GGI+NFVTKRGLC G+RSKISWTQ
Sbjct  244   DKNQLHAAVVELYCASGAEIKYSTVQNWYAGDSEGKGGIYNFVTKRGLCDGARSKISWTQ  303

Query  895   VETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGIS  716
             VETGSAITWKYPSVVL+GD S+GEFYSVALTNN QQADTGTKMIH GKNTRSRI+SKGIS
Sbjct  304   VETGSAITWKYPSVVLKGDNSIGEFYSVALTNNKQQADTGTKMIHVGKNTRSRIVSKGIS  363

Query  715   AGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTS  536
             AG+S NCYRGLVQV  SA NARN SQCDSMLIG+ A ANTYPYI  K+PSAR+EHEA+TS
Sbjct  364   AGNSVNCYRGLVQVQPSAHNARNFSQCDSMLIGDQAGANTYPYITVKDPSARVEHEASTS  423

Query  535   KIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             KIGEDQLFYFQQRGID EKA+AA+I GFCR+VF ELP EF AEVNQLMSLKLEGSVG
Sbjct  424   KIGEDQLFYFQQRGIDAEKAVAAIIGGFCREVFKELPLEFAAEVNQLMSLKLEGSVG  480



>ref|XP_001759559.1| ATP-binding cassette transporter, subfamily I, member 11, ABC 
component protein PpABCI11 [Physcomitrella patens]
 gb|EDQ75471.1| ATP-binding cassette transporter, subfamily I, member 11, ABC 
component protein PpABCI11 [Physcomitrella patens]
Length=480

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/477 (78%), Positives = 427/477 (90%), Gaps = 0/477 (0%)
 Frame = -3

Query  1795  DDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMN  1616
             DD +Q+FLKRDYK+GF  +I+S ++PKGLSE T+RLIS++KNEP+WML FRL +++++  
Sbjct  4     DDTIQQFLKRDYKYGFVSDIESVSIPKGLSENTVRLISAKKNEPEWMLNFRLNAFKQWQK  63

Query  1615  MKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLAN  1436
             MKEP WSDN+YP+I+FQD+CYY+EPKKK T  SLDE DP+L++ F KLG+PL+E+ RLAN
Sbjct  64    MKEPTWSDNKYPQIDFQDVCYYTEPKKKETKQSLDEVDPDLLETFAKLGIPLSEQKRLAN  123

Query  1435  VAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALN  1256
             VAVDAV DSVSIATTHRKTL  +GVIFCSISEAIREYPDLV+K+LG+VVP  DN+Y ALN
Sbjct  124   VAVDAVFDSVSIATTHRKTLMAAGVIFCSISEAIREYPDLVKKHLGKVVPVADNYYAALN  183

Query  1255  SAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSY  1076
             SAVFSDGSF YVPK+T  PM+ISTYFRINAMETGQFERTLIV D++++V YLEGCTAP+Y
Sbjct  184   SAVFSDGSFCYVPKDTVSPMEISTYFRINAMETGQFERTLIVCDENAYVSYLEGCTAPAY  243

Query  1075  DTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQ  896
             D NQLHAAVVELYC  GAEIKYSTVQNWYAGD EG+GGI+NFVTKRGLC G++SKISWTQ
Sbjct  244   DKNQLHAAVVELYCASGAEIKYSTVQNWYAGDSEGKGGIYNFVTKRGLCDGAKSKISWTQ  303

Query  895   VETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGIS  716
             VETGSAITWKYPSVVL+GD S+GEFYSVALTNN QQADTGTKMIH GKNTRSRI+SKGIS
Sbjct  304   VETGSAITWKYPSVVLKGDGSIGEFYSVALTNNKQQADTGTKMIHVGKNTRSRIVSKGIS  363

Query  715   AGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTS  536
             AG+S NCYRGLVQV  SA NARN SQCDSMLIG+ A ANTYPYI  K+PSAR+EHEA+TS
Sbjct  364   AGNSVNCYRGLVQVQPSAHNARNFSQCDSMLIGDQAGANTYPYITVKDPSARVEHEASTS  423

Query  535   KIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             KIGEDQLFYFQQRGID EKA+AA+I GFCR+VF ELP EF AEVNQLMSLKLEGSVG
Sbjct  424   KIGEDQLFYFQQRGIDAEKAVAAIIGGFCREVFKELPLEFAAEVNQLMSLKLEGSVG  480



>ref|XP_010907405.1| PREDICTED: UPF0051 protein in atpA 3'region-like [Elaeis guineensis]
Length=556

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/505 (75%), Positives = 436/505 (86%), Gaps = 0/505 (0%)
 Frame = -3

Query  1879  PRNFKVRAEAKVTIDAPGKQPSPSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEE  1700
             P    +R  A  T   P + P     + DDP+Q+FLKRDYKWGF  +I+SF++PKGLSE+
Sbjct  52    PTKPSLRIRAVQTDRRPSRPPGGGGDSGDDPIQRFLKRDYKWGFVSDIESFSIPKGLSED  111

Query  1699  TIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLN  1520
             T+R IS+ K EP+WML FRL +  RF++++EP+WSDNRY  I+FQ ICYYSEPK+KP L+
Sbjct  112   TVRSISALKGEPEWMLRFRLDALRRFLSLREPRWSDNRYAPIDFQSICYYSEPKRKPKLH  171

Query  1519  SLDEADPELIKYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISE  1340
             SL+EADPEL+  F++LG+PLNE+ RLANVAVDAV DS SIATTHR+ L + GVIFCSISE
Sbjct  172   SLEEADPELLATFDRLGIPLNEQKRLANVAVDAVFDSTSIATTHREALAEKGVIFCSISE  231

Query  1339  AIREYPDLVRKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAME  1160
             AIREYPDLVR+YLGRVVP  DN+Y ALNSAVFSDGSF Y+PK+T  PM+ISTYFRIN  E
Sbjct  232   AIREYPDLVRRYLGRVVPPGDNYYAALNSAVFSDGSFCYIPKDTISPMEISTYFRINDRE  291

Query  1159  TGQFERTLIVADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGD  980
             TGQFERTLI+A++ S+V YLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGD
Sbjct  292   TGQFERTLIIAEERSYVSYLEGCTAPSYDKNQLHAAVVELYCAEGAEIKYSTVQNWYAGD  351

Query  979   EEGRGGIFNFVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTN  800
             EEG GGIFNFVTKRGLC G RSKISWTQVETGSAITWKYPSVVL+G+++VGEFYSVALT 
Sbjct  352   EEGNGGIFNFVTKRGLCDGDRSKISWTQVETGSAITWKYPSVVLKGNDTVGEFYSVALTK  411

Query  799   NYQQADTGTKMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLI  620
             +YQQADTGTKMIH GKN+RSRIISKGISAG SRNCYRGLVQV   A+NARN SQCDSMLI
Sbjct  412   DYQQADTGTKMIHVGKNSRSRIISKGISAGKSRNCYRGLVQVQPQAENARNFSQCDSMLI  471

Query  619   GNNAAANTYPYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDV  440
             G+ A ANTYPYIQ KNPSAR+EHEA+TSKIGEDQLFYFQQRGID+EKA+AAMI GFCRDV
Sbjct  472   GDTAGANTYPYIQVKNPSARVEHEASTSKIGEDQLFYFQQRGIDHEKAVAAMIGGFCRDV  531

Query  439   FNELPDEFGAEVNQLMSLKLEGSVG  365
             F++LP EF +EVN LM+LKLEGSVG
Sbjct  532   FDKLPLEFASEVNALMNLKLEGSVG  556



>ref|XP_008805012.1| PREDICTED: UPF0051 protein in atpA 3'region-like [Phoenix dactylifera]
Length=553

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/505 (74%), Positives = 435/505 (86%), Gaps = 0/505 (0%)
 Frame = -3

Query  1879  PRNFKVRAEAKVTIDAPGKQPSPSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEE  1700
             P+   +R  A  T   P + P       DD +Q+FLKRDYKWGF  +I+SF++PKGLSE+
Sbjct  49    PKKPSLRIRAVQTDRRPSRPPGGGGDAGDDAIQRFLKRDYKWGFVSDIESFSIPKGLSED  108

Query  1699  TIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLN  1520
             T+R IS+ K EP+WML FRL +  RF++++EP+WSDNRY  I+FQ +CYYSEPK+KP L+
Sbjct  109   TVRSISALKGEPEWMLRFRLDALRRFLSLREPRWSDNRYAPIDFQSMCYYSEPKRKPKLD  168

Query  1519  SLDEADPELIKYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISE  1340
             SL+ ADPEL+  F++LG+PLNE+ RLANVAVDAV+DS SIATTHR+ L + GVIFCSISE
Sbjct  169   SLEGADPELLATFDRLGIPLNEQKRLANVAVDAVMDSTSIATTHREALAEKGVIFCSISE  228

Query  1339  AIREYPDLVRKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAME  1160
             AIREYPDLVR+YLGRVVP  DN+Y ALNSAVFSDGSF Y+PK+T  PM+ISTYFRIN  E
Sbjct  229   AIREYPDLVRRYLGRVVPPGDNYYAALNSAVFSDGSFCYIPKDTVSPMEISTYFRINDRE  288

Query  1159  TGQFERTLIVADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGD  980
             TGQFERTLI+AD+ S+V YLEGCTAPSYD NQLHAAVVELYC +GAEIKYSTVQNWYAGD
Sbjct  289   TGQFERTLIIADERSYVSYLEGCTAPSYDKNQLHAAVVELYCADGAEIKYSTVQNWYAGD  348

Query  979   EEGRGGIFNFVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTN  800
             EEG GGI+NFVTKRGLC G RSKISWTQVETGSAITWKYPSVVL+G++++GEFYSVALT 
Sbjct  349   EEGNGGIYNFVTKRGLCDGDRSKISWTQVETGSAITWKYPSVVLKGNDTLGEFYSVALTK  408

Query  799   NYQQADTGTKMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLI  620
             +YQQADTGTKMIH GKN+RSRIISKGISAG SRNCYRGLVQV   A+NARN SQCDSMLI
Sbjct  409   DYQQADTGTKMIHVGKNSRSRIISKGISAGRSRNCYRGLVQVQPQAENARNFSQCDSMLI  468

Query  619   GNNAAANTYPYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDV  440
             G+ A ANTYPYIQ KNP+AR+EHEA+TSKIGEDQLFYFQQRGID+EKA+AAMI GFCRDV
Sbjct  469   GDTAGANTYPYIQVKNPTARVEHEASTSKIGEDQLFYFQQRGIDHEKAVAAMIGGFCRDV  528

Query  439   FNELPDEFGAEVNQLMSLKLEGSVG  365
             F++LP EF +EVN LM+LKLEGSVG
Sbjct  529   FDKLPLEFASEVNALMNLKLEGSVG  553



>ref|XP_009398358.1| PREDICTED: UPF0051 protein in atpA 3'region-like [Musa acuminata 
subsp. malaccensis]
Length=564

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/519 (73%), Positives = 442/519 (85%), Gaps = 6/519 (1%)
 Frame = -3

Query  1915  VLPKPSNLRTQNPRNFKVRAEAKVTIDAPGKQPSPSTSNED-DPLQKFLKRDY-KWGFNQ  1742
             ++P P   R+  PR+  +RA    T   P + P+     ED DP+++FLKRDY +WGF  
Sbjct  50    LIPVPPPQRS--PRSDPIRAVQ--TDRKPSRSPNDGGGKEDGDPIERFLKRDYSQWGFVS  105

Query  1741  EIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQD  1562
             +I+S ++PKGL E T+RLIS++K EPDWML+FRL+++ RF  M+EP+WSDNRYP I+ Q 
Sbjct  106   DIESVSIPKGLDEGTVRLISAKKGEPDWMLQFRLRAFRRFQAMREPQWSDNRYPPIDLQS  165

Query  1561  ICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRK  1382
             ICYYSEPK+KP L SLDE DP+L++ F++LG+PLNE+ RLANVAVDAV+DS SIATTHR 
Sbjct  166   ICYYSEPKRKPKLGSLDEVDPKLLETFDRLGIPLNEQKRLANVAVDAVIDSTSIATTHRA  225

Query  1381  TLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRC  1202
              L + GVIFCSISEAIREYPDLVR+YLG VVP  DN+Y ALNSAVFSDGSF Y+PK+T  
Sbjct  226   ALAEKGVIFCSISEAIREYPDLVRRYLGEVVPPGDNYYAALNSAVFSDGSFCYIPKDTVS  285

Query  1201  PMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGA  1022
             PM+ISTYFRIN  ETGQFERTLI+AD+ S+V YLEGCTAPSYD NQLHAAVVELYCHEGA
Sbjct  286   PMEISTYFRINDRETGQFERTLIIADERSYVSYLEGCTAPSYDKNQLHAAVVELYCHEGA  345

Query  1021  EIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEG  842
             EIKYSTVQNWYAGDE+G GGI+NFVTKRGLC G  SKISWTQVETGSAITWKYPSV+L G
Sbjct  346   EIKYSTVQNWYAGDEQGIGGIYNFVTKRGLCQGKGSKISWTQVETGSAITWKYPSVILRG  405

Query  841   DESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSA  662
             D++VGEFYSVALT ++QQADTGTKMIH+GKNTRSRI+SKGISAG SRNCYRGLV+V   A
Sbjct  406   DDTVGEFYSVALTKDFQQADTGTKMIHQGKNTRSRIVSKGISAGKSRNCYRGLVKVQPDA  465

Query  661   DNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYE  482
             +NARN SQCDSMLIG+ A ANTYPYI+ KNP+A +EHEA+TSKIGEDQLFYFQQRGID+E
Sbjct  466   ENARNFSQCDSMLIGDTAGANTYPYIEVKNPTACVEHEASTSKIGEDQLFYFQQRGIDHE  525

Query  481   KAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             KA+AAMI GFCRDVF++LP EF +EVN LM+LKLEGSVG
Sbjct  526   KAVAAMIGGFCRDVFDKLPLEFASEVNALMNLKLEGSVG  564



>ref|XP_009392243.1| PREDICTED: UPF0051 protein in atpA 3'region-like [Musa acuminata 
subsp. malaccensis]
Length=562

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/519 (72%), Positives = 438/519 (84%), Gaps = 6/519 (1%)
 Frame = -3

Query  1915  VLPKPSNLRTQNPRNFKVRAEAKVTIDAPGKQPSPSTSNED-DPLQKFLKRDY-KWGFNQ  1742
             ++P PS  R   P + +    A  T   P +  +     ED DP+++FLKRDY +WGF  
Sbjct  48    LIPTPSPQRNSRPDSIR----AVQTDRTPSRPSNEGGGKEDADPIERFLKRDYSQWGFVS  103

Query  1741  EIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQD  1562
             +I+S ++PKGL++ TIRLIS++K EP+WML+ RL+++ RF +M+EP WSDN YP I+ Q 
Sbjct  104   DIESVSIPKGLNDGTIRLISAKKGEPEWMLQLRLRAFRRFQSMREPHWSDNCYPPIDLQS  163

Query  1561  ICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRK  1382
             ICYYSEPK+KP L SLDE DP+L++ F++LG+PLNE+ RLANVAVDAV+DS SIATTHR 
Sbjct  164   ICYYSEPKRKPKLGSLDEVDPKLLETFDRLGIPLNEQKRLANVAVDAVIDSTSIATTHRA  223

Query  1381  TLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRC  1202
              L + GVIFCSISEAIREYP+LVR+YLG VVP  DN+Y ALNSAVFSDGSF Y+PK+  C
Sbjct  224   ALAEKGVIFCSISEAIREYPELVRRYLGEVVPPGDNYYAALNSAVFSDGSFCYIPKDIVC  283

Query  1201  PMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGA  1022
             PM+ISTYFRIN  ETGQFERTLI+AD+ S+V YLEGCTAPSYD NQLHAAVVELYCHEGA
Sbjct  284   PMEISTYFRINDRETGQFERTLIIADERSYVSYLEGCTAPSYDKNQLHAAVVELYCHEGA  343

Query  1021  EIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEG  842
             EIKYSTVQNWYAGDEEG GGI+NFVTKRGLC G  SKISWTQVETGSAITWKYPSV+L G
Sbjct  344   EIKYSTVQNWYAGDEEGNGGIYNFVTKRGLCQGKGSKISWTQVETGSAITWKYPSVILRG  403

Query  841   DESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSA  662
             D+S+GEFYSVALT N+QQADTGTKMIH+GKNTRSRI+SKGISAG S NCYRGLV+V   A
Sbjct  404   DDSMGEFYSVALTKNFQQADTGTKMIHQGKNTRSRIVSKGISAGKSTNCYRGLVKVQPDA  463

Query  661   DNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYE  482
             +N+RN SQCDSMLIG+ A ANTYPYI+ KNP+AR+EHEA+TSKIGEDQLFYFQQRGID+E
Sbjct  464   ENSRNFSQCDSMLIGDAAGANTYPYIEVKNPTARVEHEASTSKIGEDQLFYFQQRGIDHE  523

Query  481   KAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             KA+AAMI GFCRDVFN+LP EF +EVN LM+LKLEGSVG
Sbjct  524   KAVAAMIGGFCRDVFNKLPLEFASEVNALMNLKLEGSVG  562



>ref|XP_002973895.1| hypothetical protein SELMODRAFT_173820 [Selaginella moellendorffii]
 gb|EFJ24850.1| hypothetical protein SELMODRAFT_173820 [Selaginella moellendorffii]
Length=532

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/477 (77%), Positives = 417/477 (87%), Gaps = 0/477 (0%)
 Frame = -3

Query  1795  DDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMN  1616
             D+ +++FL RDYKWGF   + S ++PKGL E T+RLISS+K EPDW+L+FRL +Y +++ 
Sbjct  56    DETIRQFLDRDYKWGFVSNVASESIPKGLDESTVRLISSKKKEPDWLLQFRLNAYRQWLK  115

Query  1615  MKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLAN  1436
             M+EP WSDN YP+I+FQD CYY+ PK+K    SLDE DPEL++ F KLG+PL E+ RLAN
Sbjct  116   MEEPSWSDNTYPKIDFQDFCYYTAPKQKEVKQSLDEVDPELLETFRKLGIPLTEQKRLAN  175

Query  1435  VAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALN  1256
             VAVDAV DSVSIATTHRKTLE +GVIFCSISEA+  +P+LV+KYLG VVP  DN+Y ALN
Sbjct  176   VAVDAVFDSVSIATTHRKTLEAAGVIFCSISEAVHRFPELVKKYLGSVVPVADNYYAALN  235

Query  1255  SAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSY  1076
             SAVFSDGSF Y+PKNT  PM+ISTYFRINA+ETGQFERTLI+AD+ SFV YLEGCTAPSY
Sbjct  236   SAVFSDGSFCYIPKNTVSPMEISTYFRINALETGQFERTLIIADEKSFVSYLEGCTAPSY  295

Query  1075  DTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQ  896
             D NQLHAAVVELYC EGAEIKYSTVQNWYAGD +GRGGI+NFVTKRGLCAG +SKISWTQ
Sbjct  296   DKNQLHAAVVELYCAEGAEIKYSTVQNWYAGDAQGRGGIYNFVTKRGLCAGKKSKISWTQ  355

Query  895   VETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGIS  716
             VETGSAITWKYPSV+L GD+SVGEFYSVA+TNN QQADTGTKMIH GKN+RSRI+SKGIS
Sbjct  356   VETGSAITWKYPSVILRGDDSVGEFYSVAVTNNRQQADTGTKMIHVGKNSRSRIVSKGIS  415

Query  715   AGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTS  536
             AG SRNCYRGLVQ+  +ADN+R+ SQCDSMLIGNN  ANTYPY Q KNPSAR+EHEATTS
Sbjct  416   AGESRNCYRGLVQIQPTADNSRSFSQCDSMLIGNNCVANTYPYTQDKNPSARVEHEATTS  475

Query  535   KIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             KIGEDQLFYFQQRGI+ EKA+A +I GFCR+VFNELP EF AEVNQLMSLKLE SVG
Sbjct  476   KIGEDQLFYFQQRGIEPEKAVATIIGGFCREVFNELPLEFAAEVNQLMSLKLENSVG  532



>ref|XP_002969166.1| ATP-binding cassette transporter, subfamily I, member 12, SmABCI12 
[Selaginella moellendorffii]
 gb|EFJ30282.1| ATP-binding cassette transporter, subfamily I, member 12, SmABCI12 
[Selaginella moellendorffii]
Length=532

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/477 (77%), Positives = 417/477 (87%), Gaps = 0/477 (0%)
 Frame = -3

Query  1795  DDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMN  1616
             D+ +++FL RDYKWGF   + S ++PKGL E T+RLISS+K EPDW+L+FRL +Y +++ 
Sbjct  56    DETIRQFLDRDYKWGFVSNVASESIPKGLDESTVRLISSKKKEPDWLLQFRLNAYRQWLK  115

Query  1615  MKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLAN  1436
             M+EP WSDN YP+I+FQD CYY+ PK+K    SLDE DPEL++ F KLG+PL E+ RLAN
Sbjct  116   MEEPSWSDNTYPKIDFQDFCYYTAPKQKEVKQSLDEVDPELLETFRKLGIPLTEQKRLAN  175

Query  1435  VAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALN  1256
             VAVDAV DSVSIATTHRKTLE +GVIFCSISEA+  +P+LV+KYLG VVP  DN+Y ALN
Sbjct  176   VAVDAVFDSVSIATTHRKTLEAAGVIFCSISEAVHRFPELVKKYLGSVVPVADNYYAALN  235

Query  1255  SAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSY  1076
             SAVFSDGSF Y+PKNT  PM+ISTYFRINA+ETGQFERTLI+AD+ SFV YLEGCTAPSY
Sbjct  236   SAVFSDGSFCYIPKNTVSPMEISTYFRINALETGQFERTLIIADEKSFVSYLEGCTAPSY  295

Query  1075  DTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQ  896
             D NQLHAAVVELYC EGAEIKYSTVQNWYAGD +GRGGI+NFVTKRGLCAG +SKISWTQ
Sbjct  296   DKNQLHAAVVELYCAEGAEIKYSTVQNWYAGDAQGRGGIYNFVTKRGLCAGKKSKISWTQ  355

Query  895   VETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGIS  716
             VETGSAITWKYPSV+L GD+SVGEFYSVA+TNN QQADTGTKMIH GKN+RSRI+SKGIS
Sbjct  356   VETGSAITWKYPSVILRGDDSVGEFYSVAVTNNRQQADTGTKMIHVGKNSRSRIVSKGIS  415

Query  715   AGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTS  536
             AG SRNCYRGLVQ+  +ADN+R+ SQCDSMLIGNN  ANTYPY Q KNPSAR+EHEATTS
Sbjct  416   AGESRNCYRGLVQIQPTADNSRSFSQCDSMLIGNNCVANTYPYTQDKNPSARVEHEATTS  475

Query  535   KIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             KIGEDQLFYFQQRGI+ EKA+A +I GFCR+VFNELP EF AEVNQLMSLKLE SVG
Sbjct  476   KIGEDQLFYFQQRGIEPEKAVATIIGGFCREVFNELPLEFAAEVNQLMSLKLENSVG  532



>ref|XP_002952498.1| iron-sulfur cluster assembly protein [Volvox carteri f. nagariensis]
 gb|EFJ46345.1| iron-sulfur cluster assembly protein [Volvox carteri f. nagariensis]
Length=535

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/480 (75%), Positives = 418/480 (87%), Gaps = 0/480 (0%)
 Frame = -3

Query  1804  SNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYER  1625
             S+E   +QK L R YK+GF   I+S T PKGL+E+ +R IS++K EP+WMLEFRLK+Y +
Sbjct  56    SDEKRDIQKILDRPYKYGFKTIIESDTFPKGLNEDVVRAISAKKGEPEWMLEFRLKAYRK  115

Query  1624  FMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNR  1445
             ++ M+EPKWSDN YPEI++QD+ YYSEPK K  L SL+E DPEL+K FEKLG+PLNE+ R
Sbjct  116   WLTMEEPKWSDNAYPEIDYQDVSYYSEPKVKEKLKSLEEVDPELLKTFEKLGIPLNEQKR  175

Query  1444  LANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYG  1265
             LANVAVDAV DSVSIATT ++ L+K GVIFCSISEA++EYPDLV+KY+G VVP  DN++ 
Sbjct  176   LANVAVDAVFDSVSIATTFKEDLKKHGVIFCSISEALKEYPDLVKKYMGSVVPVGDNYFA  235

Query  1264  ALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTA  1085
             ALNSAVFSDGSFV+VPK  +CPM++STYFRINA ETGQFERTLIVA++ S+V YLEGCTA
Sbjct  236   ALNSAVFSDGSFVFVPKGVKCPMELSTYFRINASETGQFERTLIVAEEGSYVSYLEGCTA  295

Query  1084  PSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKIS  905
             P+YD+NQLHAAVVELYC + AEIKYSTVQNWYAGD  G+GGI+NFVTKRG+CAG  SKIS
Sbjct  296   PAYDSNQLHAAVVELYCEKDAEIKYSTVQNWYAGDANGKGGIYNFVTKRGMCAGPNSKIS  355

Query  904   WTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISK  725
             WTQVETGS+ITWKYPSVVL GD SVGEFYSVALTNN QQADTGTKMIH G+NTRSRI+SK
Sbjct  356   WTQVETGSSITWKYPSVVLAGDNSVGEFYSVALTNNCQQADTGTKMIHVGRNTRSRIVSK  415

Query  724   GISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEA  545
             GISAG SRNCYRGLVQVM SA  ARN SQCDSMLIG+ A ANTYPYIQ + PSA +EHEA
Sbjct  416   GISAGTSRNCYRGLVQVMPSAKGARNFSQCDSMLIGDRAGANTYPYIQVREPSAVVEHEA  475

Query  544   TTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             +TSKIGEDQLFYFQQRGID EKA+ A+ISGFCR+VFNELP EF AEVN+LMSLKLEG+VG
Sbjct  476   STSKIGEDQLFYFQQRGIDPEKAVGAIISGFCREVFNELPLEFAAEVNELMSLKLEGTVG  535



>ref|XP_004153240.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like, partial 
[Cucumis sativus]
Length=482

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/479 (78%), Positives = 414/479 (86%), Gaps = 9/479 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNFKVRAEA----KVTIDAPGK  1823
             LL  GIS F   P  E  K        P+ +NL+    + F+VRA+     K     P  
Sbjct  4     LLANGISRFPHNPTWELHKDAIPKLHSPRIANLKISKSKPFRVRADVGYDPKTANSGPIS  63

Query  1822  Q--PSPSTSNEDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDW  1658
             Q   SPS++  D+ +Q  L+ RDY  K+GF  +IDSF++PKGLS+ETIRLISS K EPDW
Sbjct  64    QGKSSPSSTTTDEKIQDILRNRDYDRKFGFTVDIDSFSIPKGLSKETIRLISSLKEEPDW  123

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             MLEFRL ++E+F+ MKEP WSDNRYP I+FQD+CYYS PKKKPTLNSLDEADPEL+ YF+
Sbjct  124   MLEFRLNAFEKFLKMKEPTWSDNRYPPIDFQDVCYYSAPKKKPTLNSLDEADPELLMYFD  183

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             +LGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAI+EYPDLVRKYLG
Sbjct  184   RLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIKEYPDLVRKYLG  243

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
             RVVPSEDNFY ALNSAVFSDGSF Y+PK+T+CPMQISTYFRINA+ETGQFERTLIVADD 
Sbjct  244   RVVPSEDNFYAALNSAVFSDGSFCYIPKDTKCPMQISTYFRINALETGQFERTLIVADDR  303

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             SFVEYLEGCTAPSYD NQLHAAVVELYC EGA+IKYSTVQNWYAGDEEG+GG++NFVTKR
Sbjct  304   SFVEYLEGCTAPSYDRNQLHAAVVELYCAEGAQIKYSTVQNWYAGDEEGKGGVYNFVTKR  363

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             GLCAG RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQQADTGTKMIHK
Sbjct  364   GLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGTKMIHK  423

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQ  581
             GKNTRSRIISKGISAG+SRNCYRGLVQV S ADNA+NSSQCDSMLIG+NAAANTYPYIQ
Sbjct  424   GKNTRSRIISKGISAGNSRNCYRGLVQVQSKADNAKNSSQCDSMLIGDNAAANTYPYIQ  482



>ref|XP_003564527.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic [Brachypodium 
distachyon]
Length=536

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/495 (73%), Positives = 413/495 (83%), Gaps = 1/495 (0%)
 Frame = -3

Query  1846  VTIDAPGKQPSPSTSN-EDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKN  1670
             V +    ++PSPS +  E + LQ  LKR+YK+GF  + +SF++PKGLSE T+R IS  K 
Sbjct  42    VAVQTGPQKPSPSPAEAESEALQNLLKREYKYGFVSDFESFSIPKGLSEATVRRISELKA  101

Query  1669  EPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELI  1490
             EP WML+FRL +Y RF+ M EP WSDN Y  ++ Q +C+YS PK KP LNSLDE DPEL+
Sbjct  102   EPAWMLDFRLAAYRRFLTMVEPTWSDNEYSPVDLQSLCFYSAPKTKPKLNSLDEVDPELL  161

Query  1489  KYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVR  1310
             K F++LG+PL E+ RL+NVAVDAV+DS SIATTHR+ L   GVIFCSISEAIREYPDL+R
Sbjct  162   KTFDRLGIPLGEQKRLSNVAVDAVIDSTSIATTHREALMAKGVIFCSISEAIREYPDLIR  221

Query  1309  KYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIV  1130
             +Y+G +VP  DN+Y ALNSAVFSDGSF YVPK+T CPM+ISTYFRIN  ETGQFERTLIV
Sbjct  222   RYIGSIVPPGDNYYAALNSAVFSDGSFCYVPKDTVCPMEISTYFRINDKETGQFERTLIV  281

Query  1129  ADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNF  950
             AD  S V YLEGCTAP+YD+NQLHAAVVEL C EGAEIKYSTVQNWYAGDEEG+GGI+NF
Sbjct  282   ADARSTVSYLEGCTAPAYDSNQLHAAVVELVCEEGAEIKYSTVQNWYAGDEEGKGGIYNF  341

Query  949   VTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTK  770
             VTKRG C G  SKISWTQVETGSAITWKYPSV L GD++VGEFYSVALT +YQQADTGTK
Sbjct  342   VTKRGRCKGRGSKISWTQVETGSAITWKYPSVELVGDDTVGEFYSVALTKDYQQADTGTK  401

Query  769   MIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYP  590
             MIHKGKN+RSRIISKGISAG SRNCYRGLVQ+ S A+NA NSSQCDS+LIG+NAAANTYP
Sbjct  402   MIHKGKNSRSRIISKGISAGKSRNCYRGLVQMNSGAENAYNSSQCDSLLIGDNAAANTYP  461

Query  589   YIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGA  410
              IQ    S R+EHEA+TSKIGEDQLFYFQQRGID+EKA+AAMI GFCR VF  LP EF  
Sbjct  462   TIQVGCTSGRVEHEASTSKIGEDQLFYFQQRGIDHEKAVAAMIGGFCRAVFEHLPYEFAQ  521

Query  409   EVNQLMSLKLEGSVG  365
             EV+ LM+LKLEGSVG
Sbjct  522   EVDALMNLKLEGSVG  536



>ref|XP_011037665.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic isoform X2 [Populus 
euphratica]
Length=503

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/479 (78%), Positives = 412/479 (86%), Gaps = 9/479 (2%)
 Frame = -3

Query  1990  LLTKGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNFKVRA----EAKVTIDAPGK  1823
             LL+  I  FS +P+ +  K  K      KP   +      FK+RA    E+K     PG 
Sbjct  4     LLSNTIPHFSPKPIKDSSKLNKPFFFQIKPIFFKPSKLNLFKIRADVGFESKTVKSVPGN  63

Query  1822  QPSPSTSN--EDDPLQKFLK-RDY--KWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDW  1658
               +  TS+   DD +++ L+ RDY  K+GFN +IDSF +PKGLS+ETIRLISS K EPDW
Sbjct  64    SAATGTSSTSSDDKIREILRNRDYNEKFGFNMDIDSFAIPKGLSKETIRLISSLKEEPDW  123

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             ML+FRL ++ERF+ +KEPKWSDN YP I+FQDICYYS PKKKPT+NSL+EADPELIKYF+
Sbjct  124   MLDFRLNAFERFLKLKEPKWSDNEYPIIDFQDICYYSAPKKKPTVNSLEEADPELIKYFD  183

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             +LG+PL ERNRLANVAVDAVLDSVSIATTHRKTLEK+GVIFCSISEAI++YPDLVRKYLG
Sbjct  184   RLGIPLTERNRLANVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIQKYPDLVRKYLG  243

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
             RVVPSEDN+Y ALNSAVFSDGSF YVPK+T+CPMQISTYFRINAMETGQFERTLIVADD 
Sbjct  244   RVVPSEDNYYAALNSAVFSDGSFCYVPKDTKCPMQISTYFRINAMETGQFERTLIVADDR  303

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             SFVEYLEGCTAPSYD NQLHAAVVELYC EGAEIKYSTVQNWYAGDE+G+GGI+NFVTKR
Sbjct  304   SFVEYLEGCTAPSYDRNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEQGKGGIYNFVTKR  363

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             GLCAG RSKISWTQVETGSAITWKYPSVVLEGD++VGEFYSVALTNNYQQADTGTKMIHK
Sbjct  364   GLCAGDRSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGTKMIHK  423

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQ  581
             GKNTRSRIISKGIS GHSRNCYRGLVQV S ADNARNSSQCDSMLIG+ AAANTYPYIQ
Sbjct  424   GKNTRSRIISKGISVGHSRNCYRGLVQVQSKADNARNSSQCDSMLIGDTAAANTYPYIQ  482



>dbj|BAJ90146.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85435.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=536

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/495 (72%), Positives = 414/495 (84%), Gaps = 1/495 (0%)
 Frame = -3

Query  1846  VTIDAPGKQPSPS-TSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKN  1670
             V +    ++PSPS  ++E + LQ  LKR+YK+GF  + +SF++PKGLSE T+R IS  K 
Sbjct  42    VAVQTGPQKPSPSPAADEAEALQNLLKREYKYGFVSDFESFSIPKGLSEATVRRISELKA  101

Query  1669  EPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELI  1490
             EP WML+FRL +Y RF+ M EP WSDN Y  ++ Q +C+YS PK KP LNSLDE DPEL+
Sbjct  102   EPAWMLDFRLAAYRRFLTMAEPTWSDNVYSPVDLQSLCFYSAPKTKPKLNSLDEVDPELL  161

Query  1489  KYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVR  1310
             K F++LG+PL E+ RL+NVAVDAV+DS SIATTHR+ L   GVIFCSISEAIREYPDL++
Sbjct  162   KTFDRLGIPLGEQKRLSNVAVDAVIDSTSIATTHREALMAKGVIFCSISEAIREYPDLIK  221

Query  1309  KYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIV  1130
             +Y+G +VP  DN+Y ALNSAVFSDGSF YVPK+T CPM+ISTYFRIN  ETGQFERTLIV
Sbjct  222   RYIGSIVPPGDNYYAALNSAVFSDGSFCYVPKDTVCPMEISTYFRINDKETGQFERTLIV  281

Query  1129  ADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNF  950
             AD+ S V YLEGCTAP+YD+NQLHAAVVEL C EGAEIKYSTVQNWYAGDE+G+GGI+NF
Sbjct  282   ADERSTVSYLEGCTAPAYDSNQLHAAVVELVCEEGAEIKYSTVQNWYAGDEKGKGGIYNF  341

Query  949   VTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTK  770
             VTKRG C G  SKISWTQVETGSAITWKYPSV L GD++VGEFYSVALT +YQQADTGTK
Sbjct  342   VTKRGRCKGRGSKISWTQVETGSAITWKYPSVELVGDDTVGEFYSVALTKDYQQADTGTK  401

Query  769   MIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYP  590
             MIHKGKN+RSRIISKGISAG SRNCYRGLVQ+ S A+NA NSSQCDS+LIG+ AAANTYP
Sbjct  402   MIHKGKNSRSRIISKGISAGKSRNCYRGLVQMNSGAENAYNSSQCDSLLIGDKAAANTYP  461

Query  589   YIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGA  410
              IQ    S R+EHEA+TSKIGEDQLFYFQQRGID+EKA+AAMI GFCR VF  LP EF  
Sbjct  462   TIQVGCTSGRVEHEASTSKIGEDQLFYFQQRGIDHEKAVAAMIGGFCRAVFEHLPYEFAQ  521

Query  409   EVNQLMSLKLEGSVG  365
             EV+ LM+LKLEGSVG
Sbjct  522   EVDALMNLKLEGSVG  536



>dbj|BAJ88923.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=536

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/495 (72%), Positives = 414/495 (84%), Gaps = 1/495 (0%)
 Frame = -3

Query  1846  VTIDAPGKQPSPS-TSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKN  1670
             V +    ++PSPS  ++E + LQ  LKR+YK+GF  + +SF++PKGLSE T+R IS  K 
Sbjct  42    VAVQTGPQKPSPSPAADEAEALQNLLKREYKYGFVSDFESFSIPKGLSEATVRRISELKA  101

Query  1669  EPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELI  1490
             EP WML+FRL +Y RF+ M EP WSDN Y  ++ Q +C+Y+ PK KP LNSLDE DPEL+
Sbjct  102   EPAWMLDFRLAAYRRFLTMAEPTWSDNVYSPVDLQSLCFYAAPKTKPKLNSLDEVDPELL  161

Query  1489  KYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVR  1310
             K F++LG+PL E+ RL+NVAVDAV+DS SIATTHR+ L   GVIFCSISEAIREYPDL++
Sbjct  162   KTFDRLGIPLGEQKRLSNVAVDAVIDSTSIATTHREALMAKGVIFCSISEAIREYPDLIK  221

Query  1309  KYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIV  1130
             +Y+G +VP  DN+Y ALNSAVFSDGSF YVPK+T CPM+ISTYFRIN  ETGQFERTLIV
Sbjct  222   RYIGSIVPPGDNYYAALNSAVFSDGSFCYVPKDTVCPMEISTYFRINDKETGQFERTLIV  281

Query  1129  ADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNF  950
             AD+ S V YLEGCTAP+YD+NQLHAAVVEL C EGAEIKYSTVQNWYAGDE+G+GGI+NF
Sbjct  282   ADERSTVSYLEGCTAPAYDSNQLHAAVVELVCEEGAEIKYSTVQNWYAGDEKGKGGIYNF  341

Query  949   VTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTK  770
             VTKRG C G  SKISWTQVETGSAITWKYPSV L GD++VGEFYSVALT +YQQADTGTK
Sbjct  342   VTKRGRCKGRGSKISWTQVETGSAITWKYPSVELVGDDTVGEFYSVALTKDYQQADTGTK  401

Query  769   MIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYP  590
             MIHKGKN+RSRIISKGISAG SRNCYRGLVQ+ S A+NA NSSQCDS+LIG+ AAANTYP
Sbjct  402   MIHKGKNSRSRIISKGISAGKSRNCYRGLVQMNSGAENAYNSSQCDSLLIGDKAAANTYP  461

Query  589   YIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGA  410
              IQ    S R+EHEA+TSKIGEDQLFYFQQRGID+EKA+AAMI GFCR VF  LP EF  
Sbjct  462   TIQVGCTSGRVEHEASTSKIGEDQLFYFQQRGIDHEKAVAAMIGGFCRAVFEHLPYEFAQ  521

Query  409   EVNQLMSLKLEGSVG  365
             EV+ LM+LKLEGSVG
Sbjct  522   EVDALMNLKLEGSVG  536



>ref|XP_002458708.1| hypothetical protein SORBIDRAFT_03g038740 [Sorghum bicolor]
 gb|EES03828.1| hypothetical protein SORBIDRAFT_03g038740 [Sorghum bicolor]
Length=542

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/474 (76%), Positives = 402/474 (85%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             LQK LKR+YK+GF  + +SF++PKGLSE T+R IS  K EP WML+FRL +Y RF+ M E
Sbjct  69    LQKLLKREYKYGFVSDFESFSIPKGLSEATVRRISELKAEPAWMLDFRLAAYRRFLTMVE  128

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P WSDN Y  ++ Q ICYYS PK KP LNSLDE DPEL+K F++LG+PL E+ RL NVAV
Sbjct  129   PTWSDNEYAPVDLQSICYYSAPKTKPKLNSLDEVDPELLKTFDRLGIPLTEQKRLTNVAV  188

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV+DS SIATTHR+ L   GVIFCSISEAIREYPDLVR+YLG VVP  DN+Y ALNSAV
Sbjct  189   DAVIDSTSIATTHREALMAKGVIFCSISEAIREYPDLVRRYLGSVVPPGDNYYAALNSAV  248

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSF YVPK+T CPM+ISTYFRIN  ETGQFERTLIVAD+ S V YLEGCTAP+YD+N
Sbjct  249   FSDGSFCYVPKDTVCPMEISTYFRINDKETGQFERTLIVADERSTVSYLEGCTAPAYDSN  308

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL C EGAEIKYSTVQNWY+GDEEG+GGI+NFVTKRG C G  SKISWTQVET
Sbjct  309   QLHAAVVELVCEEGAEIKYSTVQNWYSGDEEGKGGIYNFVTKRGRCKGRGSKISWTQVET  368

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPSV L GD+SVGEFYSVALT + QQADTGTKMIHKGKN+RSRIISKGISAG 
Sbjct  369   GSAITWKYPSVELVGDDSVGEFYSVALTKDCQQADTGTKMIHKGKNSRSRIISKGISAGK  428

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             SRNCYRGLV + SSA+NA NSSQCDS+LIG+NAAANTYP IQ    S R+EHEA+TSKIG
Sbjct  429   SRNCYRGLVLMNSSAENAYNSSQCDSLLIGDNAAANTYPTIQVGCTSGRVEHEASTSKIG  488

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYFQQRG+D+EKA+AAMI GFCR VF  LP EF  EV+ LM+LKLEGSVG
Sbjct  489   EDQLFYFQQRGVDHEKAVAAMIGGFCRSVFEHLPYEFAQEVDALMNLKLEGSVG  542



>ref|NP_001044693.1| Os01g0830000 [Oryza sativa Japonica Group]
 dbj|BAB68118.1| ABC transporter subunit-like [Oryza sativa Japonica Group]
 dbj|BAB89586.1| ABC transporter subunit-like [Oryza sativa Japonica Group]
 dbj|BAF06607.1| Os01g0830000 [Oryza sativa Japonica Group]
 gb|EAY76364.1| hypothetical protein OsI_04296 [Oryza sativa Indica Group]
 gb|EAZ14026.1| hypothetical protein OsJ_03952 [Oryza sativa Japonica Group]
 dbj|BAH00317.1| unnamed protein product [Oryza sativa Japonica Group]
Length=544

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/479 (75%), Positives = 406/479 (85%), Gaps = 0/479 (0%)
 Frame = -3

Query  1801  NEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERF  1622
              E + LQ  LKR+YK+GF  + +SF++PKGLSE T+R IS  K EP WML+FRL +Y RF
Sbjct  66    TESETLQNLLKREYKYGFVSDFESFSIPKGLSEATVRRISELKAEPAWMLDFRLAAYRRF  125

Query  1621  MNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRL  1442
             + M +P WSDN Y  ++ Q ICYYS PK KP LNSLDE DPEL+  F++LG+PL+E+ RL
Sbjct  126   LTMVQPTWSDNVYEPVDLQSICYYSAPKTKPKLNSLDEVDPELLNTFDRLGIPLSEQKRL  185

Query  1441  ANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGA  1262
             ANVAVDAV+DS SIATTHR+ L K GVIFCSISEAIREYPDLV++YLG VVP  DN+Y A
Sbjct  186   ANVAVDAVIDSTSIATTHREELMKKGVIFCSISEAIREYPDLVKRYLGSVVPPADNYYAA  245

Query  1261  LNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAP  1082
             LNSAVFSDGSF YVPK+T CPM+ISTYFRIN  ETGQFERTLIVAD+ S V YLEGCTAP
Sbjct  246   LNSAVFSDGSFCYVPKDTVCPMEISTYFRINDKETGQFERTLIVADERSTVSYLEGCTAP  305

Query  1081  SYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISW  902
             +YD+NQLHAAVVEL C E AEIKYSTVQNWY+GDEEG+GGI+NFVTKRG C G  SKISW
Sbjct  306   AYDSNQLHAAVVELVCEEQAEIKYSTVQNWYSGDEEGKGGIYNFVTKRGRCKGRGSKISW  365

Query  901   TQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKG  722
             TQVETGSAITWKYPSV L GD++VGEFYSVALT +YQQADTGTKMIHKGKN+RSRIISKG
Sbjct  366   TQVETGSAITWKYPSVELLGDDTVGEFYSVALTKDYQQADTGTKMIHKGKNSRSRIISKG  425

Query  721   ISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEAT  542
             ISAG SRNCYRGLVQ+ S A+NA NSSQCDS+LIG+NAAANTYP IQ    S+R+EHEA+
Sbjct  426   ISAGKSRNCYRGLVQINSGAENAYNSSQCDSLLIGDNAAANTYPTIQVGCISSRVEHEAS  485

Query  541   TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             TSKIGEDQLFYFQQRGID+EKA+AAMI GFCR VF  LP EF  E++ LM+LKLEGSVG
Sbjct  486   TSKIGEDQLFYFQQRGIDHEKAVAAMIGGFCRAVFENLPYEFAHEMDALMNLKLEGSVG  544



>ref|NP_001143087.1| uncharacterized protein LOC100275561 [Zea mays]
 gb|ACG28862.1| hypothetical protein [Zea mays]
 gb|AFW84700.1| hypothetical protein ZEAMMB73_160665 [Zea mays]
Length=540

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/474 (75%), Positives = 402/474 (85%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             LQK LKR+YK+GF  + +SF++PKGLSE T+R IS  K EP WML+FRL +Y RF+ M E
Sbjct  67    LQKLLKREYKYGFVSDFESFSIPKGLSEATVRRISELKAEPAWMLDFRLAAYRRFLTMVE  126

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P WSDN Y  ++ Q ICYYS PK KP LNSLDE DPEL+K F++LG+PL E+ RL+NVAV
Sbjct  127   PTWSDNEYAPVDLQSICYYSAPKTKPKLNSLDEVDPELLKTFDRLGIPLTEQKRLSNVAV  186

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV+DS SIATTHR+ L   GVIFCSISEAIREYPDL+R+YLG VVP  DN+Y ALNSAV
Sbjct  187   DAVIDSTSIATTHREALMAKGVIFCSISEAIREYPDLIRRYLGSVVPPGDNYYAALNSAV  246

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSF +VPK+T CPM+ISTYFRIN  ETGQFERTLIVAD+ S V YLEGCTAP+YD+N
Sbjct  247   FSDGSFCFVPKDTVCPMEISTYFRINDKETGQFERTLIVADERSTVSYLEGCTAPAYDSN  306

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL C EGAEIKYSTVQNWY+GDEEG+GGI+NFVTKRG C G  SKISWTQVET
Sbjct  307   QLHAAVVELVCEEGAEIKYSTVQNWYSGDEEGKGGIYNFVTKRGRCKGHGSKISWTQVET  366

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPSV L GD+SVGEFYSVALT + QQADTGTKMIHKGKN+RSRIISKGISAG 
Sbjct  367   GSAITWKYPSVELIGDDSVGEFYSVALTKDCQQADTGTKMIHKGKNSRSRIISKGISAGK  426

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             SRNCYRGLV +  SA+NA NSSQCDS+LIG+NAAANTYP IQ    S R+EHEA+TSKIG
Sbjct  427   SRNCYRGLVLMNPSAENAYNSSQCDSLLIGDNAAANTYPTIQVGCTSGRVEHEASTSKIG  486

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYFQQRG+D+EKA+AAMI GFCR VF  LP EF  EV+ LM+LKLEGSVG
Sbjct  487   EDQLFYFQQRGVDHEKAVAAMIGGFCRSVFEHLPYEFAQEVDALMNLKLEGSVG  540



>ref|XP_004970442.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Setaria 
italica]
Length=542

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/474 (75%), Positives = 402/474 (85%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             LQK LKR+YK+GF  + +SF++PKGLSE T+R IS  K EP WML+FRL +Y RF+ M E
Sbjct  69    LQKLLKREYKYGFVSDFESFSIPKGLSEATVRRISELKAEPAWMLDFRLAAYRRFLTMVE  128

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P WSDN Y  ++ Q +CYYS PK KP LNSLDE DPEL+K F++LG+PL E+ RL NVAV
Sbjct  129   PTWSDNEYAPVDLQSLCYYSAPKTKPKLNSLDEVDPELLKTFDRLGIPLTEQKRLTNVAV  188

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV+DS SIATTHR+ L   GVIFCSISEAIREYPDLV++YLG +VP  DN+Y ALNSAV
Sbjct  189   DAVIDSTSIATTHREALMAKGVIFCSISEAIREYPDLVKRYLGSIVPPGDNYYAALNSAV  248

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSF YVPK+T CPM+ISTYFRIN  ETGQFERTLIVAD+ S V YLEGCTAP+YD+N
Sbjct  249   FSDGSFCYVPKDTVCPMEISTYFRINDKETGQFERTLIVADERSTVSYLEGCTAPAYDSN  308

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL C EGAEIKYSTVQNWY+GDEEG+GGI+NFVTKRG C G  SKISWTQVET
Sbjct  309   QLHAAVVELVCEEGAEIKYSTVQNWYSGDEEGKGGIYNFVTKRGRCKGRGSKISWTQVET  368

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPSV L GD++VGEFYSVALT + QQADTGTKMIHKGKN+RSRIISKGISAG 
Sbjct  369   GSAITWKYPSVELVGDDTVGEFYSVALTKDCQQADTGTKMIHKGKNSRSRIISKGISAGK  428

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             SRNCYRGLVQ+ + A+NA NSSQCDS+LIG+NAAANTYP IQ    S R+EHEA+TSKIG
Sbjct  429   SRNCYRGLVQMNAGAENAYNSSQCDSLLIGDNAAANTYPTIQVGCTSGRVEHEASTSKIG  488

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYFQQRG+D+EKA+AAMI GFCR VF  LP EF  EV+ LM+LKLEGSVG
Sbjct  489   EDQLFYFQQRGVDHEKAVAAMIGGFCRAVFEHLPYEFAQEVDALMNLKLEGSVG  542



>gb|KFM28399.1| hypothetical protein F751_5312 [Auxenochlorella protothecoides]
Length=534

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/539 (67%), Positives = 427/539 (79%), Gaps = 11/539 (2%)
 Frame = -3

Query  1981  KGISLFSVQPVCEPPKSLKASQVLPKPSNLRTQNPRNFKVRAEAKVTIDAPGKQPSPSTS  1802
             +G SL +   +C P +  +A     +PS      P+  +VRA A   +    ++P+   S
Sbjct  7     QGASLLT-SSLC-PARPFRAGSRPARPSR-----PQCARVRATATDFV----REPATEMS  55

Query  1801  NEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERF  1622
              E   LQ+ L + YK+GF   I+S   PKGL E+ +R IS +K EP+W+LEFRLK++ R+
Sbjct  56    EEKRDLQRMLSKPYKYGFKTFIESDVFPKGLDEDVVRAISLKKEEPEWLLEFRLKAWRRW  115

Query  1621  MNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRL  1442
             + M+EP WSDN YP I++Q   YYS P++K    SL+E DPEL+  F+KLG+PL E+ RL
Sbjct  116   LAMEEPTWSDNDYPAIDYQAYSYYSAPRQKEKKGSLEEVDPELLATFDKLGIPLAEQKRL  175

Query  1441  ANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGA  1262
             ANVAVDAV DSVSIATT R+ L K+GVIFCSISEA+REYPDL+RK+LG VVP+ DN++ A
Sbjct  176   ANVAVDAVFDSVSIATTFREELGKAGVIFCSISEAVREYPDLIRKHLGSVVPTSDNYFAA  235

Query  1261  LNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAP  1082
             LNSAVFSDGSFVY+P+  RCPM++STYFRINA ETGQFERTLIVA++ S V YLEGCTAP
Sbjct  236   LNSAVFSDGSFVYIPRGVRCPMELSTYFRINAAETGQFERTLIVAEEGSHVSYLEGCTAP  295

Query  1081  SYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISW  902
             +YDTNQLHAAVVEL     AEIKYSTVQNWYAGD  GRGGI+NFVTKRG+CAG+RSKISW
Sbjct  296   AYDTNQLHAAVVELSAAADAEIKYSTVQNWYAGDAAGRGGIYNFVTKRGVCAGARSKISW  355

Query  901   TQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKG  722
             TQVETGSAITWKYPSVVL G +SVGEFYSVALTNN QQADTGTKMIH G  TRSRI+SKG
Sbjct  356   TQVETGSAITWKYPSVVLAGADSVGEFYSVALTNNRQQADTGTKMIHVGPRTRSRIVSKG  415

Query  721   ISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEAT  542
             ISAG SRN YRGLV +   AD ARN SQCDSMLIG+ A ANTYPYIQ +NP+AR+EHEA+
Sbjct  416   ISAGQSRNVYRGLVSIGPGADGARNHSQCDSMLIGDEAGANTYPYIQVRNPTARVEHEAS  475

Query  541   TSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             TSKIGEDQLFYFQQRG+  E+A+  +ISGFCR+VFNELP EF AEVNQLMSLKLEGSVG
Sbjct  476   TSKIGEDQLFYFQQRGVAVEEAVGMIISGFCREVFNELPLEFAAEVNQLMSLKLEGSVG  534



>ref|XP_007513604.1| cysteine desulfurase activator complex subunit SufB [Bathycoccus 
prasinos]
 emb|CCO16129.1| cysteine desulfurase activator complex subunit SufB [Bathycoccus 
prasinos]
Length=568

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/478 (71%), Positives = 401/478 (84%), Gaps = 0/478 (0%)
 Frame = -3

Query  1798  EDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFM  1619
             E + +Q  L + YKWGF  +I++ T+PKGLSE+T+RLISS+KNEP+WMLEFRLK+Y +++
Sbjct  91    EGEKIQDMLNKPYKWGFTTDIETLTIPKGLSEDTVRLISSKKNEPEWMLEFRLKAYRKWL  150

Query  1618  NMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLA  1439
              M+EP WSDN+YPEI++Q + YYS PK      SLDE DPEL+K F+KLG+PLNE+ R+ 
Sbjct  151   TMEEPDWSDNKYPEIDYQAVSYYSAPKVLEKKESLDEVDPELLKTFDKLGIPLNEQKRMT  210

Query  1438  NVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGAL  1259
             NVAVDAV DSVS+ATT R  L K+GVIFCSISEAI+EYP+L++KYLG VVP  DN++ AL
Sbjct  211   NVAVDAVFDSVSVATTFRADLLKAGVIFCSISEAIKEYPELIKKYLGSVVPVGDNYFSAL  270

Query  1258  NSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPS  1079
             N+AVFSDGSF Y+PK    PM++STYFRINA  +GQFERTLIVA+D S+V YLEGCTAP+
Sbjct  271   NAAVFSDGSFCYIPKGVISPMELSTYFRINAESSGQFERTLIVAEDDSYVSYLEGCTAPA  330

Query  1078  YDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWT  899
             YD NQLHAAVVE+Y  + AE+KYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWT
Sbjct  331   YDENQLHAAVVEIYAGKNAEVKYSTVQNWYAGDENGKGGIYNFVTKRGLCKGDNSKISWT  390

Query  898   QVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGI  719
             QVETGS+ITWKYPSVVL GD S GEFYSVALTNN QQADTG+KMIH GKNTRSRI+SKGI
Sbjct  391   QVETGSSITWKYPSVVLAGDNSKGEFYSVALTNNKQQADTGSKMIHVGKNTRSRIVSKGI  450

Query  718   SAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATT  539
             SAG S+N YRGLV V  +A  +RN SQCDSMLIG++A ANTYPYIQ K+PS+R+EHEA+T
Sbjct  451   SAGKSKNVYRGLVSVGPNATGSRNYSQCDSMLIGDDAGANTYPYIQVKDPSSRVEHEAST  510

Query  538   SKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             SKIGEDQLFYFQQRGID E A+  +ISGFC +VF ELP EF AEV  LMSLKLE +VG
Sbjct  511   SKIGEDQLFYFQQRGIDLESAVGVIISGFCSEVFQELPLEFAAEVEALMSLKLENAVG  568



>emb|CEG01320.1| SUF system FeS cluster assembly, SufBD [Ostreococcus tauri]
Length=554

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/488 (70%), Positives = 407/488 (83%), Gaps = 2/488 (0%)
 Frame = -3

Query  1822  QPSPSTSNED--DPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLE  1649
             Q SP ++ E+  D +Q+ L + YKWGF+  I++ T+P GLSE+ +R+IS++KNEPDWML+
Sbjct  67    QISPVSAKEEEVDRIQEMLNKPYKWGFSTTIETETIPAGLSEDVVRMISAKKNEPDWMLD  126

Query  1648  FRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLG  1469
             FRLK++ +++ M+EP WSDN YP+I++Q + YYS PK      SLDE DPEL+  F+KLG
Sbjct  127   FRLKAFRKWLTMEEPDWSDNSYPQIDYQGVSYYSAPKSMEKKKSLDEVDPELLATFDKLG  186

Query  1468  VPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVV  1289
             +PLNE+ RL NVAVDAV DSVSI TT ++ L K+GVIFCSISEA+ +YP+LV+K+LG VV
Sbjct  187   IPLNEQKRLTNVAVDAVFDSVSIGTTFKEDLLKAGVIFCSISEAVHDYPELVKKHLGSVV  246

Query  1288  PSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFV  1109
             P  DN++ ALNSAVFSDGSFVY+PK    PM++STYFRINA   GQFERTLIVA+D S+V
Sbjct  247   PVADNYFTALNSAVFSDGSFVYIPKGVVSPMELSTYFRINAESAGQFERTLIVAEDDSYV  306

Query  1108  EYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLC  929
              YLEGCTAP+YD NQLHAAVVE+   + AE+KYSTVQNWYAGDE G+GGI+NFVTKRGLC
Sbjct  307   SYLEGCTAPAYDDNQLHAAVVEISAGKNAEVKYSTVQNWYAGDENGKGGIYNFVTKRGLC  366

Query  928   AGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKN  749
              G  SKISWTQVETGS+ITWKYPSVVL GD S+GEF+SVALTNN QQADTGTKMIH GKN
Sbjct  367   KGDNSKISWTQVETGSSITWKYPSVVLAGDNSIGEFFSVALTNNAQQADTGTKMIHIGKN  426

Query  748   TRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNP  569
             TRSRI+SKGISAG S+N YRGLVQV  +A  ARN SQCDSMLIG+ A ANTYPYIQ K P
Sbjct  427   TRSRIVSKGISAGKSKNVYRGLVQVGPNAVGARNYSQCDSMLIGDKAGANTYPYIQVKEP  486

Query  568   SARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMS  389
             SAR+EHEA+TSKIGEDQLFYFQQRGID E+A+  +ISGFC +VFNELP EF AEVNQLMS
Sbjct  487   SARVEHEASTSKIGEDQLFYFQQRGIDPEEAVGVIISGFCSEVFNELPLEFAAEVNQLMS  546

Query  388   LKLEGSVG  365
             LKLEGSVG
Sbjct  547   LKLEGSVG  554



>ref|XP_001419047.1| ABC(membrane) family transporter (Fe-S assembly/SufBCD system) 
[Ostreococcus lucimarinus CCE9901]
 gb|ABO97340.1| ABC(membrane) family transporter (Fe-S assembly/SufBCD system) 
[Ostreococcus lucimarinus CCE9901]
Length=471

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/471 (72%), Positives = 398/471 (85%), Gaps = 0/471 (0%)
 Frame = -3

Query  1777  FLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKW  1598
              L + YKWGF+ ++D+ T+P GL+EE +R+IS++K EP+WML+FRLK++ +++ M+EP W
Sbjct  1     MLNKPYKWGFSTDVDTETIPAGLNEEVVRMISAKKEEPEWMLDFRLKAFRKWLTMEEPDW  60

Query  1597  SDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAVDAV  1418
             SDNRYP+I++Q   YYS PK      SLDE DPEL+  F+KLG+PLNE+ RL NVAVDAV
Sbjct  61    SDNRYPQIDYQASSYYSAPKSMEKKKSLDEVDPELLATFDKLGIPLNEQKRLTNVAVDAV  120

Query  1417  LDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFSD  1238
              DSVSI TT ++ L K+GVIFCSISEA+ EYP+LV++YLG VVP  DN++ ALNSAVFSD
Sbjct  121   FDSVSIGTTFKEDLLKAGVIFCSISEAVHEYPELVKQYLGSVVPVADNYFTALNSAVFSD  180

Query  1237  GSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQLH  1058
             GSFVY+PK    PM++STYFRINA  +GQFERTLIVA+D S+V YLEGCTAP+YD NQLH
Sbjct  181   GSFVYIPKGVVSPMELSTYFRINAESSGQFERTLIVAEDDSYVSYLEGCTAPAYDENQLH  240

Query  1057  AAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVETGSA  878
             AAVVE+   + AE+KYSTVQNWYAGDE+G+GGI+NFVTKRGLC G  SKISWTQVETGS+
Sbjct  241   AAVVEISAGKNAEVKYSTVQNWYAGDEDGKGGIYNFVTKRGLCKGDNSKISWTQVETGSS  300

Query  877   ITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGHSRN  698
             ITWKYPSVVL GD S+GEFYSVALTNN QQADTGTKMIH GKNTRSRI+SKGISAG S+N
Sbjct  301   ITWKYPSVVLAGDNSIGEFYSVALTNNAQQADTGTKMIHIGKNTRSRIVSKGISAGKSKN  360

Query  697   CYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIGEDQ  518
              YRGLVQV  +A  ARN SQCDSMLIG+ A ANTYPYIQ K PS+R+EHEA+TSKIGEDQ
Sbjct  361   VYRGLVQVGPNASGARNYSQCDSMLIGDKAGANTYPYIQVKEPSSRVEHEASTSKIGEDQ  420

Query  517   LFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             LFYFQQRGI  E+A+  +ISGFCR+VFNELP EF AEVNQLMSLKLEGSVG
Sbjct  421   LFYFQQRGISPEEAVGVIISGFCREVFNELPLEFAAEVNQLMSLKLEGSVG  471



>ref|WP_011056341.1| cysteine desulfurase activator complex subunit SufB [Thermosynechococcus 
elongatus]
 ref|NP_681280.1| cysteine desulfurase [Thermosynechococcus elongatus BP-1]
 dbj|BAC08042.1| ABC transporter subunit [Thermosynechococcus elongatus BP-1]
Length=478

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/474 (72%), Positives = 402/474 (85%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +Q  + + YK+GF   I++ T+PKGL+E+ IRLIS++KNEP++MLEFRL++Y +++ M E
Sbjct  5     VQSLVNQPYKYGFVTPIETETIPKGLNEDIIRLISAKKNEPEFMLEFRLRAYRQWLKMSE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P+W    YP IN+QDI YYS PK+K  L SLDE DP L++ FEKLG+PL+E+ RL NVAV
Sbjct  65    PQWPRVSYPPINYQDIVYYSAPKQKEKLKSLDEVDPVLLETFEKLGIPLSEQKRLTNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT R+ L K G+IFCSISEA+++YP+LV+KYLG VVP  DNFY ALNSAV
Sbjct  125   DAIFDSVSVATTFREELAKQGIIFCSISEALQDYPELVQKYLGSVVPIGDNFYAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVYVPKNTRCPM++STYFRIN  E+GQFERTLI+AD  S+V YLEGCTAP +DTN
Sbjct  185   FSDGSFVYVPKNTRCPMELSTYFRINNGESGQFERTLIIADAGSYVSYLEGCTAPMFDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCLGRNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTN+YQQADTGTKMIH GKNTRSRI+SKGISAGH
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNHYQQADTGTKMIHIGKNTRSRIVSKGISAGH  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   A  ARN SQCDSMLIG+ AAANT+PYIQ +NP+A++EHEA+TSKIG
Sbjct  365   SQNSYRGLVKIGPKATGARNYSQCDSMLIGDTAAANTFPYIQVQNPTAQVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A++ MISGFCRDVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFAQRGISAEDAVSMMISGFCRDVFNQLPMEFAVEADRLLSLKLEGSVG  478



>ref|XP_003057567.1| ATP-binding cassette superfamily [Micromonas pusilla CCMP1545]
 gb|EEH57518.1| ATP-binding cassette superfamily [Micromonas pusilla CCMP1545]
Length=561

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/478 (71%), Positives = 404/478 (85%), Gaps = 0/478 (0%)
 Frame = -3

Query  1798  EDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFM  1619
             E D +Q+ L + YK GF  +I++ T+PKGLSE+T+R+IS++KNEP+WMLEFRLK++ +++
Sbjct  84    EVDKIQQMLSKPYKPGFKTDIETDTIPKGLSEDTVRIISAKKNEPEWMLEFRLKAFRKWL  143

Query  1618  NMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLA  1439
              M+EP WSDNRYP+I++Q + YYS PK      SLDE DPEL+K F+KLG+PL+E+ R+ 
Sbjct  144   TMEEPDWSDNRYPDIDYQAVSYYSAPKVMEKKKSLDEVDPELLKTFDKLGIPLSEQKRMT  203

Query  1438  NVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGAL  1259
             NVAVDAV DSVSIATT R+ L K GVIFCSISEAIREYP+L++++LG VVP  DN++ AL
Sbjct  204   NVAVDAVFDSVSIATTFREDLAKVGVIFCSISEAIREYPELIKQHLGSVVPVGDNYFSAL  263

Query  1258  NSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPS  1079
             N+AVFSDGSF Y+PK  + PM++STYFRINA  +GQFERTLIVA++ S+V YLEGCTAP+
Sbjct  264   NAAVFSDGSFCYIPKGVKSPMELSTYFRINAESSGQFERTLIVAEEGSYVSYLEGCTAPA  323

Query  1078  YDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWT  899
             YD NQLHAAVVE+   + AE+KYSTVQNWYAG+E+G GGI+NFVTKRGLC G  SKISWT
Sbjct  324   YDENQLHAAVVEISAAKDAEVKYSTVQNWYAGNEDGVGGIYNFVTKRGLCKGDNSKISWT  383

Query  898   QVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGI  719
             QVETGS+ITWKYPSVVL GD SVGEF+SVALTNN QQADTGTKMIH GKNTRSRI+SKGI
Sbjct  384   QVETGSSITWKYPSVVLAGDNSVGEFFSVALTNNKQQADTGTKMIHVGKNTRSRIVSKGI  443

Query  718   SAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATT  539
             SAG SRNCYRGLVQV  SA  ARN SQCDSMLIG+ A ANTYPYI  + PSAR+EHEA+T
Sbjct  444   SAGKSRNCYRGLVQVSPSAVGARNYSQCDSMLIGDKAGANTYPYISVREPSARVEHEAST  503

Query  538   SKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             SKIGEDQLFYFQQRGID E A+  +ISGFC +VFNELP EF AEVN LMSLKLEGSVG
Sbjct  504   SKIGEDQLFYFQQRGIDPETAVGIIISGFCNEVFNELPLEFAAEVNALMSLKLEGSVG  561



>ref|WP_024125377.1| iron-sulfur cluster assembly protein SufB [Thermosynechococcus 
sp. NK55a]
 ref|YP_008900505.1| iron-sulfur cluster assembly protein SufB [Thermosynechococcus 
sp. NK55a]
 gb|AHB88992.1| iron-sulfur cluster assembly protein SufB [Thermosynechococcus 
sp. NK55a]
Length=478

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/474 (72%), Positives = 402/474 (85%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +Q  + + YK+GF   I++ T+PKGL+E+ IRLIS++KNEP++MLEFRL++Y +++ M E
Sbjct  5     VQSLVNQPYKYGFVTPIETETIPKGLNEDIIRLISAKKNEPEFMLEFRLRAYRQWLKMSE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P+W    YP IN+QDI YYS PK+K  L SLDE DP L++ FEKLG+PL+E+ RL NVAV
Sbjct  65    PRWPRVSYPPINYQDIVYYSAPKQKEKLKSLDEVDPVLLETFEKLGIPLSEQKRLTNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT R+ L K G+IFCSISEA++EYP+LV+KYLG VVP  DNFY ALNSAV
Sbjct  125   DAIFDSVSVATTFREELAKQGIIFCSISEALQEYPELVQKYLGSVVPIGDNFYAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PKNTRCPM++STYFRIN  E+GQFERTLI+AD  S+V YLEGCTAP +DTN
Sbjct  185   FSDGSFVYIPKNTRCPMELSTYFRINNGESGQFERTLIIADAGSYVSYLEGCTAPMFDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCLGRNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTN+YQQADTGTKMIH GKNTRSRI+SKGISAGH
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNHYQQADTGTKMIHIGKNTRSRIVSKGISAGH  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   A  ARN SQCDS+LIG+ AAANT+PYIQ +NP+A++EHEA+TSKIG
Sbjct  365   SQNSYRGLVKIGPKATGARNYSQCDSLLIGDTAAANTFPYIQVQNPTAQVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A++ MISGFCRDVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFAQRGISAEDAVSMMISGFCRDVFNQLPMEFAVEADRLLSLKLEGSVG  478



>ref|XP_005647845.1| ABC family transporter (Fe-S assembly/SufBCD system) [Coccomyxa 
subellipsoidea C-169]
 gb|EIE23301.1| ABC family transporter (Fe-S assembly/SufBCD system) [Coccomyxa 
subellipsoidea C-169]
Length=477

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/471 (73%), Positives = 393/471 (83%), Gaps = 3/471 (1%)
 Frame = -3

Query  1768  RDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKWSDN  1589
             R+Y  GF   I+S T  KGL E  +R IS++K EP+WML+FRLK+Y +++ M EP WSDN
Sbjct  7     REYTPGFTTLIESETFAKGLDETVVRAISAKKREPEWMLDFRLKAYRKWLTMAEPAWSDN  66

Query  1588  RYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLA---NVAVDAV  1418
             RYP+INFQD+ YYS PK+K    SLDE DP+L++ F KLG+P+NE+ RLA   +VA D V
Sbjct  67    RYPQINFQDLSYYSAPKQKSEKKSLDEVDPKLLETFSKLGIPINEQKRLAGVKDVAYDYV  126

Query  1417  LDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFSD  1238
              DS SIATT +  L + G+IFCSISEAIREYPDL+RK+LG VVP  DN+Y ALNSAVFSD
Sbjct  127   FDSESIATTFKAELAQQGIIFCSISEAIREYPDLIRKHLGSVVPVGDNYYAALNSAVFSD  186

Query  1237  GSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQLH  1058
             GSFVY+PK  +  M++STYFRINA ETGQFERTLI+A+D S V YLEGCTAPSYD+NQLH
Sbjct  187   GSFVYIPKGVKSAMELSTYFRINAKETGQFERTLIIAEDDSEVSYLEGCTAPSYDSNQLH  246

Query  1057  AAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVETGSA  878
             AAVVEL     AEIKYSTVQNWY+G+EEG GGI+NFVTKRGLC G+ SKISWTQVETGSA
Sbjct  247   AAVVELSAGANAEIKYSTVQNWYSGNEEGVGGIYNFVTKRGLCHGANSKISWTQVETGSA  306

Query  877   ITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGHSRN  698
             ITWKYPSVVL+GD SVGEFYSVALTNN+QQADTG+KMIH G+NTRSRIISKGISAG SRN
Sbjct  307   ITWKYPSVVLKGDNSVGEFYSVALTNNHQQADTGSKMIHVGRNTRSRIISKGISAGQSRN  366

Query  697   CYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIGEDQ  518
             CYRGLVQV  +A  ARN SQCDSMLIG+ A ANTYPYIQ +N SAR+EHEA+TSKIGEDQ
Sbjct  367   CYRGLVQVQPTAVGARNFSQCDSMLIGDTAGANTYPYIQVRNESARVEHEASTSKIGEDQ  426

Query  517   LFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             LFYFQQRGID E+A+  +ISGFC DVFN+LPDEF  EVN LMSLKLEGSVG
Sbjct  427   LFYFQQRGIDPEQAVGTIISGFCADVFNKLPDEFAQEVNALMSLKLEGSVG  477



>ref|XP_005852172.1| hypothetical protein CHLNCDRAFT_29265 [Chlorella variabilis]
 gb|EFN60070.1| hypothetical protein CHLNCDRAFT_29265 [Chlorella variabilis]
Length=480

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/480 (72%), Positives = 394/480 (82%), Gaps = 9/480 (2%)
 Frame = -3

Query  1777  FLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKW  1598
              L + YK+GF   I++   PKGLSE+ +R IS++K EP+WML+FRLK+Y +++ M+EP W
Sbjct  1     MLAKPYKYGFKTIIETEQFPKGLSEDVVRAISAKKEEPEWMLDFRLKAYRKWLTMEEPNW  60

Query  1597  SDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAVDAV  1418
             SDNRYP I++QD+ YYS PK      SLDE DPEL+  F+KLG+PLNE+ RLANVAVDAV
Sbjct  61    SDNRYPRIDYQDLSYYSAPKVVDKKTSLDEVDPELLATFDKLGIPLNEQKRLANVAVDAV  120

Query  1417  LDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFSD  1238
              DSVSIATT ++ L K+GVIFCSISEA++EYPDLVRKYLG VVP  DN++ ALN+AVFSD
Sbjct  121   FDSVSIATTFKEELGKAGVIFCSISEAVKEYPDLVRKYLGSVVPVADNYFAALNAAVFSD  180

Query  1237  GSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQLH  1058
             GSFVY+PK  R PM++STYFRINA ETGQFERTLIVA++ ++V YLEGCTAP+YD NQLH
Sbjct  181   GSFVYIPKGVRSPMELSTYFRINASETGQFERTLIVAEEGAYVSYLEGCTAPAYDENQLH  240

Query  1057  AAVVELYCHEGAEIKYSTVQNW--YAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVETG  884
             AAVVEL   + AEIKYSTVQNW  YAGD EGRGGI+NFVTKRG+C G RSKISWTQVETG
Sbjct  241   AAVVELSAAKDAEIKYSTVQNWWGYAGDAEGRGGIYNFVTKRGICLGERSKISWTQVETG  300

Query  883   SAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGHS  704
             SAITWKYPSVVL+GD SVGEFYSVALTNN QQADTGTKMIH GK TRSRI+SKGISAGHS
Sbjct  301   SAITWKYPSVVLKGDHSVGEFYSVALTNNRQQADTGTKMIHVGKGTRSRIVSKGISAGHS  360

Query  703   RNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYI-------QTKNPSARIEHEA  545
              N YRGLVQV  +A  ARN SQCDSMLIG+ A ANTYPYI             AR+EHEA
Sbjct  361   VNAYRGLVQVQPTAAGARNYSQCDSMLIGDQAGANTYPYIQAGGGAAAGSGQGARVEHEA  420

Query  544   TTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             +TSKIGEDQLFYF QRGID E A+  +ISGFCRDVFNELP EF AEVN LMSLKLEGSVG
Sbjct  421   STSKIGEDQLFYFLQRGIDAEDAVGMIISGFCRDVFNELPLEFAAEVNALMSLKLEGSVG  480



>ref|WP_015154063.1| iron-regulated ABC transporter membrane component SufB [Chroococcidiopsis 
thermalis]
 ref|YP_007091384.1| iron-regulated ABC transporter membrane component SufB [Chroococcidiopsis 
thermalis PCC 7203]
 gb|AFY87515.1| Iron-regulated ABC transporter membrane component SufB [Chroococcidiopsis 
thermalis PCC 7203]
Length=479

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/475 (71%), Positives = 404/475 (85%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++  +P+GLSE+ IRLIS++K EP++MLEFRL++Y +++ M E
Sbjct  5     VKTIVNQPYKYGFITDIEADIIPRGLSEDVIRLISAKKEEPEFMLEFRLRAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKP-TLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W   +YP IN+QDI YYS PKKKP  LNSL+E DP L++ FEKLG+P++E+ RL+NVA
Sbjct  65    PTWHSVQYPPINYQDIIYYSAPKKKPKQLNSLEEVDPALLETFEKLGIPISEQKRLSNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L K GVIFCSISEA+REYP+LV+KYLG VVP+ DN++ ALNSA
Sbjct  125   VDAIFDSVSVATTFKEKLAKEGVIFCSISEALREYPELVQKYLGSVVPTADNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PKNT+CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YDT
Sbjct  185   VFSDGSFVYIPKNTKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDT  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGDE+G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDEKGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S N YRGLV+V   A  ARN SQCDSMLIG+NA ANT+PYIQ +N +A+IEHEA+TSKI
Sbjct  365   NSSNSYRGLVKVNPKAQGARNYSQCDSMLIGDNARANTFPYIQVQNNTAKIEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFAQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADRLLSLKLEGSVG  479



>ref|WP_039714289.1| cysteine desulfurase [Scytonema millei]
 gb|KIF22019.1| cysteine desulfurase [Scytonema millei VB511283]
Length=479

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/475 (71%), Positives = 404/475 (85%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++  +P+GLSE+ IRLIS++K EP++MLEFRL++Y +++ M E
Sbjct  5     VKTIVNQPYKYGFITDIEADIIPRGLSEDVIRLISAKKEEPEFMLEFRLRAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKP-TLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W   +YP IN+QDI YYS PKKKP  LNSL+E DP L++ FEKLG+P++E+ RL+NVA
Sbjct  65    PTWHSVQYPPINYQDIIYYSAPKKKPKQLNSLEEVDPALLETFEKLGIPISEQKRLSNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L K GVIFCSISEA+REYP+LV+KYLG VVP+ DN++ ALNSA
Sbjct  125   VDAIFDSVSVATTFKEKLAKEGVIFCSISEALREYPELVQKYLGSVVPTADNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PKNT+CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YDT
Sbjct  185   VFSDGSFVYIPKNTKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDT  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGDE+G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDEKGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S N YRGLV+V   A  ARN SQCDSMLIG+NA ANT+PYIQ +N +A+IEHEA+TSKI
Sbjct  365   NSSNSYRGLVKVNPKAQGARNYSQCDSMLIGDNARANTFPYIQVQNNTAKIEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFSQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADRLLSLKLEGSVG  479



>ref|WP_015190665.1| Iron-regulated ABC transporter membrane component SufB [Gloeocapsa 
sp. PCC 7428]
 ref|YP_007129958.1| Iron-regulated ABC transporter membrane component SufB [Gloeocapsa 
sp. PCC 7428]
 gb|AFZ32798.1| Iron-regulated ABC transporter membrane component SufB [Gloeocapsa 
sp. PCC 7428]
Length=478

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/474 (70%), Positives = 403/474 (85%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+E+ IRLIS++K EP++MLEFRLK++ ++  M E
Sbjct  5     VKTLVNQPYKYGFVTDIEADTIPRGLNEDVIRLISAKKEEPEFMLEFRLKAFRQWQKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W + +YP I++QDI YYS PKKKP LNS++E DP L++ FEKLG+PL+E+ RL+NVAV
Sbjct  65    PTWPNVKYPPIDYQDIIYYSAPKKKPKLNSIEEVDPALLETFEKLGIPLSEQKRLSNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT ++ L K GVIFCSISEA+REYP+LV+KYLG VVP  DN++ ALNSAV
Sbjct  125   DAIFDSVSVATTFKEKLAKEGVIFCSISEALREYPELVQKYLGSVVPVADNYFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVYVPKNT+CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YDTN
Sbjct  185   FSDGSFVYVPKNTKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVALDNAEIKYSTVQNWYAGDESGKGGIYNFVTKRGLCQGVNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKM+H GKNTRS I+SKGISAG 
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMVHVGKNTRSTIVSKGISAGR  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV+V  +A  ARN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKIG
Sbjct  365   SSNSYRGLVKVSPNAKGARNYSQCDSMLIGDNAHANTFPYIQVQNNTAKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             E+QLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   EEQLFYFAQRGISAEDAVSMMISGFCKDVFNQLPMEFAVEADRLLSLKLEGSVG  478



>ref|WP_027843139.1| cysteine desulfurase [Mastigocoleus testarum]
Length=479

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/475 (70%), Positives = 401/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  ++++ T+P+GLSE+ +RLIS++KNEPD+MLE+RLK+Y ++  M E
Sbjct  5     VKTLVNQPYKYGFVTDVEADTIPRGLSEDVVRLISAKKNEPDFMLEYRLKAYRQWQKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             PKWS  +YPEI++QDI YYS PK KK  LNSLDE DP +++ FEKLG+PL+E+ RLANVA
Sbjct  65    PKWSGLKYPEIDYQDIIYYSAPKQKKEKLNSLDEVDPAVLETFEKLGIPLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L + GV+FCSISEA++EYP+LV+KYLG VVP  DN++ ALN+A
Sbjct  125   VDAIFDSVSVATTFKEKLAEDGVVFCSISEALQEYPELVKKYLGSVVPIADNYFAALNAA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKM+H GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMVHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S N YRGLV+V   A+ ARN SQCDSMLIG+NA ANTYPYIQ +N S +IEHEA+TSKI
Sbjct  365   RSSNSYRGLVKVNPKAEGARNYSQCDSMLIGDNAHANTYPYIQVQNNSGKIEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A+  MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFAQRGISAEDAVTMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_009632056.1| FeS assembly protein SufB [Synechocystis sp. PCC 7509]
Length=478

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/474 (70%), Positives = 402/474 (85%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +Q  + + YK+GF  +I+S T+P+GLSE+ +RLIS++K EP++MLEFRLK+Y +++ M E
Sbjct  5     VQTLVNQPYKYGFITDIESDTIPRGLSEDVVRLISAKKEEPEFMLEFRLKAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W + +YP I++Q+I YYS PK+K  LNSLDE DP L++ FEKLG+ L+E+ RL+NVAV
Sbjct  65    PTWPNVKYPTIDYQNIIYYSAPKQKAKLNSLDEVDPTLLETFEKLGISLSEQKRLSNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT +  L K GVIFCSISEA++E+P+LV+KYLG VVP+ DN++ ALN AV
Sbjct  125   DAIFDSVSVATTFKDKLAKDGVIFCSISEALKEHPELVKKYLGSVVPAADNYFAALNGAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PKNT+CPM++STYFRIN+ +TGQFERTLIV ++ S V YLEGCTAP YDTN
Sbjct  185   FSDGSFVYIPKNTKCPMELSTYFRINSGDTGQFERTLIVVEEGSSVSYLEGCTAPMYDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCQGVNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTN+ QQADTGTKMIH GKNTRS IISKGISAG+
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNHKQQADTGTKMIHVGKNTRSTIISKGISAGN  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV++   A+ ARN SQCDSMLIG+NA+ANT+PYIQ +NP+A++EHEA+TSKIG
Sbjct  365   SSNSYRGLVKINPKAEGARNYSQCDSMLIGDNASANTFPYIQVQNPAAKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFSQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADRLLSLKLEGSVG  478



>ref|XP_003080587.1| ABC transporter subunit (ISS) [Ostreococcus tauri]
Length=960

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/488 (70%), Positives = 407/488 (83%), Gaps = 2/488 (0%)
 Frame = -3

Query  1822  QPSPSTSNED--DPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLE  1649
             Q SP ++ E+  D +Q+ L + YKWGF+  I++ T+P GLSE+ +R+IS++KNEPDWML+
Sbjct  473   QISPVSAKEEEVDRIQEMLNKPYKWGFSTTIETETIPAGLSEDVVRMISAKKNEPDWMLD  532

Query  1648  FRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLG  1469
             FRLK++ +++ M+EP WSDN YP+I++Q + YYS PK      SLDE DPEL+  F+KLG
Sbjct  533   FRLKAFRKWLTMEEPDWSDNSYPQIDYQGVSYYSAPKSMEKKKSLDEVDPELLATFDKLG  592

Query  1468  VPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVV  1289
             +PLNE+ RL NVAVDAV DSVSI TT ++ L K+GVIFCSISEA+ +YP+LV+K+LG VV
Sbjct  593   IPLNEQKRLTNVAVDAVFDSVSIGTTFKEDLLKAGVIFCSISEAVHDYPELVKKHLGSVV  652

Query  1288  PSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFV  1109
             P  DN++ ALNSAVFSDGSFVY+PK    PM++STYFRINA   GQFERTLIVA+D S+V
Sbjct  653   PVADNYFTALNSAVFSDGSFVYIPKGVVSPMELSTYFRINAESAGQFERTLIVAEDDSYV  712

Query  1108  EYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLC  929
              YLEGCTAP+YD NQLHAAVVE+   + AE+KYSTVQNWYAGDE G+GGI+NFVTKRGLC
Sbjct  713   SYLEGCTAPAYDDNQLHAAVVEISAGKNAEVKYSTVQNWYAGDENGKGGIYNFVTKRGLC  772

Query  928   AGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKN  749
              G  SKISWTQVETGS+ITWKYPSVVL GD S+GEF+SVALTNN QQADTGTKMIH GKN
Sbjct  773   KGDNSKISWTQVETGSSITWKYPSVVLAGDNSIGEFFSVALTNNAQQADTGTKMIHIGKN  832

Query  748   TRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNP  569
             TRSRI+SKGISAG S+N YRGLVQV  +A  ARN SQCDSMLIG+ A ANTYPYIQ K P
Sbjct  833   TRSRIVSKGISAGKSKNVYRGLVQVGPNAVGARNYSQCDSMLIGDKAGANTYPYIQVKEP  892

Query  568   SARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMS  389
             SAR+EHEA+TSKIGEDQLFYFQQRGID E+A+  +ISGFC +VFNELP EF AEVNQLMS
Sbjct  893   SARVEHEASTSKIGEDQLFYFQQRGIDPEEAVGVIISGFCSEVFNELPLEFAAEVNQLMS  952

Query  388   LKLEGSVG  365
             LKLEGSVG
Sbjct  953   LKLEGSVG  960



>ref|WP_026098480.1| cysteine desulfurase [Oscillatoria sp. PCC 10802]
Length=479

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/475 (70%), Positives = 400/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  EI++ T+P+GLSE+ IRLISS+KNEP++MLEFRL++Y +++ M E
Sbjct  5     VKTLVNQPYKYGFVTEIEADTIPRGLSEDIIRLISSKKNEPEFMLEFRLRAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W+   YP+IN+QDI YYS PK KK  LNSL+E DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  65    PAWAHVNYPKINYQDIIYYSAPKQKKQKLNSLEEVDPALLETFEKLGIPLSEQKRLSNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L K GVIFCSISEA++E+PDLV+KYLG VVP  DN++ ALNSA
Sbjct  125   VDAIFDSVSVATTFKEKLAKQGVIFCSISEALQEHPDLVQKYLGSVVPVSDNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM +STYFRIN  +TGQFERTLIVA+  S V YLEGCTAP YDT
Sbjct  185   VFSDGSFVYIPKGVKCPMDLSTYFRINTGDTGQFERTLIVAESGSSVTYLEGCTAPMYDT  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDETGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNNYQQADTGTKM+H GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNYQQADTGTKMVHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             HS+N YRGLV++   A  ARN SQCDSMLIG++A ANT+PYIQ +N + ++EHEA+TSKI
Sbjct  365   HSQNSYRGLVKIGPKAAGARNYSQCDSMLIGDSAQANTFPYIQVQNNTGKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYFQQRGI  E A++ +ISGFC+DVFN+LP EF  E ++L+SLKLEG+VG
Sbjct  425   GEDQLFYFQQRGISAEDAVSMIISGFCKDVFNKLPMEFAVEADRLLSLKLEGTVG  479



>ref|WP_039741125.1| cysteine desulfurase [Hassallia byssoidea]
 gb|KIF36408.1| cysteine desulfurase [Hassallia byssoidea VB512170]
Length=479

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/475 (70%), Positives = 402/475 (85%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF   I++ T+P+GL+E+ IRLISS+KNEP++MLEFRL++Y +++ M E
Sbjct  5     VKTLVNQPYKYGFVTNIEADTIPRGLNEDVIRLISSKKNEPEFMLEFRLRAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W   +YP IN+QDI YYS PK+ K  LNSLDE DP L++ FEKLG+PL+E+ RL NVA
Sbjct  65    PTWHSVQYPPINYQDIIYYSAPKQAKKKLNSLDEVDPTLLETFEKLGIPLSEQKRLGNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L K GVIFCSISEA++EYP+LV+KYLG VVP+ DN++ ALN+A
Sbjct  125   VDAIFDSVSVATTFKEKLLKDGVIFCSISEALQEYPELVQKYLGSVVPAADNYFAALNAA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGDE+G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDEKGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S N YRGLV++   A+ ARN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  365   NSSNSYRGLVKINPKAEGARNYSQCDSMLIGDNAHANTFPYIQVQNNTAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFAQRGISSEDAVSMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_029632972.1| cysteine desulfurase [[Scytonema hofmanni] UTEX B 1581]
Length=479

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/475 (69%), Positives = 401/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF   I++ T+P+GLSE+ +RLISS+KNEP++MLEFRL++Y  ++ M E
Sbjct  5     VKTLVNQPYKYGFVTNIEADTIPRGLSEDVVRLISSKKNEPEFMLEFRLRAYRHWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W   +YP IN+QDI YYS PK+ K  LNSLDE DP L++ FEKLG+PL+E+ RL NVA
Sbjct  65    PTWHSVKYPPINYQDIIYYSAPKQAKKKLNSLDELDPTLLETFEKLGIPLSEQKRLGNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L K GVIFCSISEA++EYP+L++KYLG VVP+ DN++ ALN+A
Sbjct  125   VDAIFDSVSVATTFKEKLLKDGVIFCSISEALQEYPELIQKYLGSVVPAGDNYFAALNAA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YDT
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDT  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGDE+G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDEKGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTN+ QQADTG+KMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNHMQQADTGSKMIHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S N YRGLV++   A+ ARN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  365   NSSNSYRGLVKINPKAEGARNYSQCDSMLIGDNAHANTFPYIQVQNKAAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFAQRGISSEDAVSMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_017713634.1| cysteine desulfurase activator complex subunit SufB [Prochlorothrix 
hollandica]
Length=479

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/475 (70%), Positives = 397/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +Q  + + YK+GF  +I++  +PKGLSE+ +RLIS++K EPD+MLEFRLK+Y +++ M E
Sbjct  5     VQTLVNQPYKYGFVTDIETDKIPKGLSEDVVRLISAKKGEPDFMLEFRLKAYRQWLKMAE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPT-LNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W+   YP I++QDI YYS PK+KP  LNSLDE DP L++ FEKLG+PL+E+ RL NVA
Sbjct  65    PDWAAVGYPTIDYQDIIYYSAPKQKPKKLNSLDEVDPALLETFEKLGIPLSEQKRLGNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDAV DSVSIATT R  L + GVIFCSISEA+ EYPDL+++YLG VVP  DN++ ALNSA
Sbjct  125   VDAVFDSVSIATTFRAQLAEHGVIFCSISEAVAEYPDLIKRYLGSVVPVADNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK   CPM++STYFRIN+ ++GQFERTLIVA++ S V YLEGCTAP +DT
Sbjct  185   VFSDGSFVYIPKGVACPMELSTYFRINSGDSGQFERTLIVAEEGSQVSYLEGCTAPMFDT  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNADIKYSTVQNWYAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS +L GD SVGEFYSVALTN+ QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCILVGDNSVGEFYSVALTNHCQQADTGTKMIHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              SRN YRGLV+V  +A  ARN SQCDSML+G+ A ANT+PYIQ +NPS+++EHEA+TSKI
Sbjct  365   RSRNSYRGLVKVGPNAQGARNYSQCDSMLVGDRAQANTFPYIQVQNPSSKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYFQQRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFQQRGISAEDAISMMISGFCKDVFNQLPMEFAVEADRLLSLKLEGSVG  479



>ref|WP_012628835.1| cysteine desulfurase activator complex subunit SufB [Cyanothece 
sp. PCC 7425]
 ref|YP_002484135.1| cysteine desulfurase [Cyanothece sp. PCC 7425]
 gb|ACL45774.1| FeS assembly protein SufB [Cyanothece sp. PCC 7425]
Length=479

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/475 (70%), Positives = 399/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+P+GL+E+ IRLIS++KNEP +ML+FRLK+Y +++ M E
Sbjct  5     VKSLVNQPYKYGFVTDIESETIPRGLNEDVIRLISAKKNEPQFMLDFRLKAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W + +YP IN+QDI YYS PK+ K  LNSL+E DP L++ FEKLG+PL+E+ RL NVA
Sbjct  65    PDWPNVKYPPINYQDIVYYSAPKQPKKKLNSLEEVDPVLLETFEKLGIPLSEQKRLGNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT R+ L K GVIFCSISEA++EYP+LV KY+G VVP  DN+Y ALNSA
Sbjct  125   VDAIFDSVSVATTFREKLAKEGVIFCSISEALQEYPELVEKYIGSVVPVGDNYYAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PKNT CPM++STYFRIN  E+GQFERTLIVA++ S+V YLEGCTAP +DT
Sbjct  185   VFSDGSFVYIPKNTHCPMELSTYFRINNGESGQFERTLIVAEEGSYVSYLEGCTAPMFDT  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCQGKNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLIGDNSVGEFYSVALTNNCQQADTGTKMIHIGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S N YRGLV++   A+ ARN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  365   RSNNSYRGLVKMGPKAEGARNYSQCDSMLIGDNAGANTFPYIQVQNNTAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFAQRGISAEDAISMMISGFCKDVFNQLPMEFAVEADRLLSLKLEGSVG  479



>ref|WP_017655181.1| cysteine desulfurase activator complex subunit SufB [Microchaete 
sp. PCC 7126]
Length=479

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/475 (70%), Positives = 399/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+E+ IRLIS++KNEP++MLEFRLK+Y ++  M E
Sbjct  5     VKTLVNQPYKYGFVTDIEADTIPRGLNEDVIRLISTKKNEPEFMLEFRLKAYRQWQKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W   +YP I++QDI YYS PK KK  LNSLDE DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  65    PTWPSVKYPPIDYQDIIYYSAPKQKKAKLNSLDEVDPTLLETFEKLGIPLSEQKRLSNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L K GVIFCSISEA++EYP+LV+KYLG VVP  DN++ ALN+A
Sbjct  125   VDAIFDSVSVATTFKEKLLKDGVIFCSISEALQEYPELVKKYLGSVVPVADNYFAALNAA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHIGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S N YRGLV+V  +A  ARN SQCDSMLIG+NA ANT+PYIQ +N SA++EHEA+TSKI
Sbjct  365   KSSNSYRGLVKVNPNAKGARNYSQCDSMLIGDNAHANTFPYIQVQNNSAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFAQRGISPEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_019502103.1| cysteine desulfurase activator complex subunit SufB [Pseudanabaena 
sp. PCC 6802]
Length=479

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/475 (69%), Positives = 399/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +Q  + + YK+GF  +I+S T+PKGL+E+ IR IS++KNEP +MLEFRLK+Y +++ M E
Sbjct  5     VQALVNQPYKYGFVTQIESETIPKGLNEDVIRTISAKKNEPAFMLEFRLKAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P+W+   YP+IN+QDI YYS PK+ K  L S+D+ DPEL+  FEKLG+PL+E+ RL+NVA
Sbjct  65    PEWAHVSYPKINYQDITYYSAPKQAKQKLESIDDVDPELLATFEKLGIPLSEQKRLSNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDAV DSVSIATT +K L K GVIFCSISEA+ EYP+L+ KYLG VVP  DN++ ALNSA
Sbjct  125   VDAVFDSVSIATTFKKDLAKVGVIFCSISEAVHEYPELIEKYLGSVVPIADNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSF Y+PK  RCPM +STYFRIN  ++GQFERTLI+A++ S+V YLEGCTAP +DT
Sbjct  185   VFSDGSFCYIPKGVRCPMDLSTYFRINNGDSGQFERTLIIAEEGSYVSYLEGCTAPMFDT  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGD++G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDKDGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKM+H GKNTRS+I+SKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNKQQADTGTKMVHIGKNTRSKIVSKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLV+V  +A  ARN SQCDSMLIG+N+ ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  365   NSQNSYRGLVKVGPNATGARNYSQCDSMLIGSNSQANTFPYIQVQNNTAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GE+QLFYFQQRGI  E A++ MISGFCRDVFN LP EF  E ++L++LKLEGSVG
Sbjct  425   GEEQLFYFQQRGISVEDAISMMISGFCRDVFNALPMEFAVEADKLLALKLEGSVG  479



>ref|WP_009767622.1| Iron-regulated ABC transporter membrane component SufB [Oscillatoriales 
cyanobacterium JSC-12]
 gb|EKQ68508.1| Iron-regulated ABC transporter membrane component SufB [Oscillatoriales 
cyanobacterium JSC-12]
Length=478

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/474 (69%), Positives = 397/474 (84%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +Q  + + YK+GF  +I++ T+P+GL+E+ +RLIS +K EP++ML+FRL++Y +++ M E
Sbjct  5     VQNLVNQPYKYGFVTQIEADTIPRGLNEDIVRLISEKKGEPEFMLDFRLRAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W    YP I++QDI YYS PK      SL+E DPEL++ FEKLG+PL+E+ RLANVAV
Sbjct  65    PTWQRATYPAIDYQDIIYYSAPKVSEKKKSLNEVDPELLETFEKLGIPLSEQKRLANVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT ++ L K GVIFCS+SEA++E+P+LVRKYLG VVP  DN++ ALNSAV
Sbjct  125   DAIFDSVSVATTFKEKLAKDGVIFCSMSEALKEHPELVRKYLGSVVPIADNYFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK  RCPM++STYFRIN  E+GQFERTLIVA++ S+V YLEGCTAP YDTN
Sbjct  185   FSDGSFVYIPKGVRCPMELSTYFRINNGESGQFERTLIVAEEGSYVSYLEGCTAPMYDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGD++GRGGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVALDDAEIKYSTVQNWYAGDKDGRGGIYNFVTKRGLCQGKNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTN+YQQADTGTKM+H GKNTRS I+SKGISAG 
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNHYQQADTGTKMVHIGKNTRSTIVSKGISAGQ  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ +N S+++EHEA+TSKIG
Sbjct  365   SKNSYRGLVKIGPKATGARNYSQCDSMLIGDNAQANTFPYIQVQNNSSKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYFQQRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFQQRGISAEDAVSMMISGFCKDVFNQLPMEFAVEADRLLSLKLEGSVG  478



>ref|WP_026093781.1| cysteine desulfurase [Calothrix sp. PCC 7103]
Length=479

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/475 (69%), Positives = 396/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GLSE+ +RLIS +KNEP++MLEFRL++Y +++ M E
Sbjct  5     VKTLVNQPYKYGFVTDIEADTIPRGLSEDIVRLISEKKNEPEFMLEFRLRAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P WS   YP IN+QDI YYS PK+ K  LNSLDE DP L++ FEKLG+PL E+ RLANVA
Sbjct  65    PDWSGLNYPPINYQDIIYYSAPKQAKKKLNSLDEVDPTLLETFEKLGIPLTEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT +  L K GVIFCSISEA+ E+P+LV+KYLG VVP  DN++ ALN+A
Sbjct  125   VDAIFDSVSVATTFKDKLAKDGVIFCSISEALHEHPELVKKYLGSVVPPADNYFAALNAA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDDAEIKYSTVQNWYAGDVNGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKM+H GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMVHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S N YRGLV+V  +A  ARN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  365   KSSNSYRGLVKVNPTAKGARNYSQCDSMLIGDNAHANTFPYIQVQNHTAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFTQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_015165175.1| iron-regulated ABC transporter membrane component SufB [Pseudanabaena 
sp. PCC 7367]
 ref|YP_007102637.1| iron-regulated ABC transporter membrane component SufB [Pseudanabaena 
sp. PCC 7367]
 gb|AFY70209.1| Iron-regulated ABC transporter membrane component SufB [Pseudanabaena 
sp. PCC 7367]
Length=478

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/474 (69%), Positives = 396/474 (84%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +QK + + YK+GF  +++S  +P+GLSE+ IR IS++KNEP++MLEFRLK+Y +++ M E
Sbjct  5     VQKLVNQPYKYGFVTKVESDIIPRGLSEDVIRTISAKKNEPEFMLEFRLKAYRKWLTMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W + +YP+IN+QDI YYS PK +    SLDE DP +++ FEKLG+PL+E+ RL+NVAV
Sbjct  65    PSWPNVKYPKINYQDIIYYSAPKAQAKKQSLDEVDPAMLETFEKLGIPLSEQKRLSNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVSIATT +K L K GV+FCSISEA+ EYP+L+ KYLG VVP  DNF+ ALNSAV
Sbjct  125   DAVFDSVSIATTFKKDLAKVGVVFCSISEAMHEYPELIEKYLGSVVPIGDNFFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSF Y+PK  +CPM +STYFRIN  ++GQFERTLIVA++ S V YLEGCTAP +DTN
Sbjct  185   FSDGSFCYIPKGVKCPMDLSTYFRINNGDSGQFERTLIVAEEGSSVSYLEGCTAPMFDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAG+E+G+GGI+NFVTKRGLCAG  SKISWTQVET
Sbjct  245   QLHAAVVELVALDDAEIKYSTVQNWYAGNEDGKGGIYNFVTKRGLCAGKNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN+QQADTGTKM+H GKNTRS IISKGISAG 
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNHQQADTGTKMVHVGKNTRSTIISKGISAGQ  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV+V S A  ARN SQCDSMLIG+   ANT+PYI+ +N +A++EHEA+TSKIG
Sbjct  365   SKNSYRGLVKVGSKAKGARNYSQCDSMLIGDRTQANTFPYIEVQNNTAKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             E+QLFYFQQRGI  E A++ MISGFC+DVFNELP EF  E ++L++LKLEGSVG
Sbjct  425   EEQLFYFQQRGISMEDAVSMMISGFCKDVFNELPMEFAVEADKLLALKLEGSVG  478



>ref|WP_036003790.1| cysteine desulfurase [Leptolyngbya sp. JSC-1]
Length=478

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/474 (69%), Positives = 397/474 (84%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +   + + YK+GF  +I+S T+P GL+E+ IRLIS++KNEP++MLEFRLK+Y +++ M+E
Sbjct  5     VNTLVNQPYKYGFVTQIESDTIPAGLNEDVIRLISAKKNEPEFMLEFRLKAYRQWLKMEE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P+W++  YP I++Q I YYS PK +    SLDE DP L++ FEKLG+ L+E+ RL+NVAV
Sbjct  65    PRWAEVGYPPIDYQSIIYYSAPKVQEKKKSLDEVDPTLLETFEKLGISLSEQKRLSNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVSIATT ++ L + GVIFCSISEA++E+P+LV+KYLG VVP  DN++ ALNSAV
Sbjct  125   DAIFDSVSIATTFKEKLAEHGVIFCSISEALQEHPELVQKYLGSVVPVADNYFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK  +CPM++STYFRIN  E+GQFERTLIVA++ S+V YLEGCTAP YDTN
Sbjct  185   FSDGSFVYIPKGVKCPMELSTYFRINNGESGQFERTLIVAEEGSYVSYLEGCTAPMYDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGD EG+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVALDNAEIKYSTVQNWYAGDAEGKGGIYNFVTKRGLCQGVNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKM+H GKNTRS I+SKGISAGH
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNRQQADTGTKMVHIGKNTRSTIVSKGISAGH  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV++   A+ ARN SQCDSMLIG+NA ANT+PYIQ +N SA++EHEA+TSKIG
Sbjct  365   SENSYRGLVKIGPKAEGARNYSQCDSMLIGDNAGANTFPYIQVQNNSAKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A+A MISGFCRDVFN+LP EF  E ++L++LKLEGSVG
Sbjct  425   EDQLFYFSQRGISMEDAIAMMISGFCRDVFNQLPMEFAVEADKLLALKLEGSVG  478



>ref|WP_009458254.1| MULTISPECIES: cysteine desulfurase activator complex subunit 
SufB [Fischerella]
 gb|EHC11037.1| FeS assembly protein SufB [Fischerella sp. JSC-11]
Length=478

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/474 (69%), Positives = 397/474 (84%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF   I++ T+P+GL+E+ IR+IS++KNEP++MLEFRL++Y ++  M E
Sbjct  5     VKTLVNQPYKYGFVTNIEADTIPRGLNEDIIRMISAKKNEPEFMLEFRLRAYRQWQKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P WS  +YP I++Q+I YYS PK++    SL+E DP L++ FEKLG+PL+E+ RLANVAV
Sbjct  65    PTWSSVKYPPIDYQNIIYYSAPKQQAKKKSLEEVDPTLLETFEKLGIPLSEQKRLANVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT ++ L K GVIFCSISEA++E+P+LV+KYLG VVP  DN++ ALNSAV
Sbjct  125   DAIFDSVSVATTFKEKLAKEGVIFCSISEALQEHPELVKKYLGSVVPIADNYFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK  +CPM++STYFRIN  ETGQFERTLIVA++ S+V YLEGCTAP YD+N
Sbjct  185   FSDGSFVYIPKGVKCPMELSTYFRINNGETGQFERTLIVAEEDSYVSYLEGCTAPMYDSN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE+GRGGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELIALDNAEIKYSTVQNWYAGDEKGRGGIYNFVTKRGLCQGVNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG+
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHIGKNTRSTIISKGISAGN  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV++   A+ ARN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKIG
Sbjct  365   SSNSYRGLVKINQKAEKARNYSQCDSMLIGDNAHANTFPYIQVQNNTAKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A+  MISGFC+DVFN LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFAQRGISTEDALKMMISGFCKDVFNNLPMEFAVEADKLLSLKLEGSVG  478



>ref|WP_006277481.1| cysteine desulfurase activator complex subunit SufB [Cylindrospermopsis 
raciborskii]
 gb|EFA69695.1| FeS assembly protein SufB [Cylindrospermopsis raciborskii CS-505]
Length=479

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/475 (69%), Positives = 399/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+EE IRLIS++K EP++MLEFRL++Y +++ M E
Sbjct  5     VKTIVNQPYKYGFVTDIETDTIPRGLNEEVIRLISAKKQEPEFMLEFRLRAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W+   YP IN+QDI YYS PK KK  LNSL+E DP L++ FEKLG+ L+E+ RLANVA
Sbjct  65    PIWAHVNYPPINYQDIVYYSAPKQKKAKLNSLEEVDPTLLETFEKLGISLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L + GVIFCSISEA+RE+P+LV+KYLG VVP  DN++ ALNSA
Sbjct  125   VDAIFDSVSVATTFKEKLAEDGVIFCSISEALREHPELVKKYLGSVVPIADNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA++SS+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEESSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD S+GEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSIGEFYSVALTNNRQQADTGTKMIHIGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S N YRGLV++  SA  ARN SQCDSMLIG+NA ANT+PYIQ +N + ++EHEA+TSKI
Sbjct  365   KSSNSYRGLVKINPSAKGARNYSQCDSMLIGDNAQANTFPYIQVQNNTGKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLF+F QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFFFAQRGISAEDAVSMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_011244666.1| cysteine desulfurase activator complex subunit SufB [Synechococcus 
elongatus]
 ref|YP_173066.1| cysteine desulfurase activator complex subunit SufB [Synechococcus 
elongatus PCC 6301]
 ref|YP_400752.1| cysteine desulfurase [Synechococcus elongatus PCC 7942]
 dbj|BAD80546.1| ABC transporter subunit [Synechococcus elongatus PCC 6301]
 gb|ABB57765.1| Iron-regulated ABC transporter membrane component SufB [Synechococcus 
elongatus PCC 7942]
 gb|AJD57747.1| cysteine desulfurase [Synechococcus sp. UTEX 2973]
Length=479

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/475 (69%), Positives = 396/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +Q  + + YK+GF  +I++  + KGLSEE +RLIS++K EP+WMLEFRLK+Y R++ M+E
Sbjct  5     VQALVNQPYKYGFVTDIETEKIAKGLSEEVVRLISAKKEEPEWMLEFRLKAYRRWLTMEE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKP-TLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W+   YP I++Q+I YY+ PK+K     SLDE DP L++ FEKLG+PL+E+ RLANVA
Sbjct  65    PDWAAVGYPAIDYQNIVYYAAPKQKAEKKQSLDEVDPTLLETFEKLGIPLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDAV DSVSIATT R+ L + GVIFCSISEA+REYP++V++YLG VVP  DN++ ALNSA
Sbjct  125   VDAVFDSVSIATTFREKLAEEGVIFCSISEAVREYPEMVKQYLGSVVPIGDNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK  RCPM++STYFRIN+ +TGQFERTLIVA++ S V YLEGCTAP +DT
Sbjct  185   VFSDGSFVFIPKGVRCPMELSTYFRINSGDTGQFERTLIVAEEGSHVSYLEGCTAPMFDT  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDDAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCKGRNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKM+H GKNTRS I+SKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNCQQADTGTKMVHIGKNTRSTIVSKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S+N YRGLV+V   A  ARN SQCDSMLIG+ AAANT+PYIQ +N  A++EHEA+TSKI
Sbjct  365   RSQNSYRGLVKVGPQATGARNYSQCDSMLIGDRAAANTFPYIQVQNAGAQVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYFQQRGI  E A++ +ISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFQQRGISLEDAVSMLISGFCKDVFNQLPMEFAVEADRLLSLKLEGSVG  479



>emb|CDM82944.1| unnamed protein product [Triticum aestivum]
Length=431

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/431 (76%), Positives = 371/431 (86%), Gaps = 0/431 (0%)
 Frame = -3

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             ML+FRL +Y RF+ M EP WSDN Y  ++ Q +C+YS PK KP LNSLDE DPEL+K F+
Sbjct  1     MLDFRLAAYRRFLTMAEPTWSDNVYSPVDLQSLCFYSAPKTKPKLNSLDEVDPELLKTFD  60

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             +LG+PL E+ RL+NVAVDAV+DS SIATTHR+ L   GVIFCSISEAIREYPDL+++Y+G
Sbjct  61    RLGIPLGEQKRLSNVAVDAVIDSTSIATTHREALMAKGVIFCSISEAIREYPDLIKRYIG  120

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
              +VP  DN+Y ALNSAVFSDGSF YVPK+T CPM+ISTYFRIN  ETGQFERTLIVAD+ 
Sbjct  121   SIVPPGDNYYAALNSAVFSDGSFCYVPKDTVCPMEISTYFRINDKETGQFERTLIVADER  180

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             S V YLEGCTAP+YD+NQLHAAVVEL C EGAEIKYSTVQNWYAGDEEG+GGI+NFVTKR
Sbjct  181   STVSYLEGCTAPAYDSNQLHAAVVELVCEEGAEIKYSTVQNWYAGDEEGKGGIYNFVTKR  240

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             G C G  SKISWTQVETGSAITWKYPSV L GD++VGEFYSVALT +YQQADTGTKMIHK
Sbjct  241   GRCKGRGSKISWTQVETGSAITWKYPSVELVGDDTVGEFYSVALTKDYQQADTGTKMIHK  300

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQT  578
             GKN+RSRIISKGISAG SRNCYRGLVQ+ S A+NA NSSQCDS+LIG+NAAANTYP IQ 
Sbjct  301   GKNSRSRIISKGISAGKSRNCYRGLVQMNSGAENAYNSSQCDSLLIGDNAAANTYPTIQV  360

Query  577   KNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  398
                S R+EHEA+TSKIGEDQLFYFQQRGID+EKA+AAMI GFCR VF  LP EF  EV+ 
Sbjct  361   GCTSGRVEHEASTSKIGEDQLFYFQQRGIDHEKAVAAMIGGFCRAVFEHLPYEFAQEVDA  420

Query  397   LMSLKLEGSVG  365
             LM+LKLEGSVG
Sbjct  421   LMNLKLEGSVG  431



>ref|WP_013190242.1| cysteine desulfurase activator complex subunit SufB [Trichormus 
azollae]
 ref|YP_003720347.1| FeS assembly protein SufB ['Nostoc azollae' 0708]
 gb|ADI63224.1| FeS assembly protein SufB ['Nostoc azollae' 0708]
Length=479

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/475 (69%), Positives = 398/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+E+ IRLIS++KNEP++MLE+RL++Y +++ M E
Sbjct  5     VKTLVNQPYKYGFVTDIEADTIPRGLNEDVIRLISAKKNEPEFMLEYRLRAYHQWLKMIE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP IN+QDI YYS PK KK  LNSLDE DP L++ FEKLG+PLNE+ RL+NVA
Sbjct  65    PSWPHVTYPPINYQDIIYYSAPKQKKAKLNSLDEVDPTLLETFEKLGIPLNEQKRLSNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L K GVIFCSISEA++E+P+L++KYLG VVP  DN++ ALN+A
Sbjct  125   VDAIFDSVSVATTFKENLAKDGVIFCSISEALQEHPELIKKYLGSVVPIADNYFAALNAA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLI+A++ S+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIIAEEGSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHIGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S N YRGLV++  +A  ARN SQCDSMLIG+NA ANT+PYIQ +N + ++EHEA+TSKI
Sbjct  365   KSSNSYRGLVKINPTAKGARNYSQCDSMLIGDNAQANTFPYIQVQNNNGKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLF+F QRGI  E A++ MISGFC+DVFN+LP EF  E N+L+SLKLEGSVG
Sbjct  425   GEDQLFFFAQRGISSEDAISMMISGFCKDVFNQLPMEFAVEANKLLSLKLEGSVG  479



>ref|WP_015125085.1| iron-regulated ABC transporter membrane component SufB [Synechococcus 
sp. PCC 6312]
 ref|YP_007062085.1| iron-regulated ABC transporter membrane component SufB [Synechococcus 
sp. PCC 6312]
 gb|AFY61542.1| Iron-regulated ABC transporter membrane component SufB [Synechococcus 
sp. PCC 6312]
Length=478

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/474 (70%), Positives = 391/474 (82%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +Q  + + YK+GF  EI+S T+P+GL E+ IRLIS++KNEP++ML FRLK+Y +++ M E
Sbjct  5     VQSLVNQPYKYGFVTEIESETIPRGLDEDVIRLISTKKNEPEFMLAFRLKAYRQWLQMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W    YP IN+QDI YYS PK+   LNSL+E DP L++ FEKLG+PL+E+ RL+NVAV
Sbjct  65    PTWPHVHYPPINYQDIIYYSAPKQAAKLNSLEEVDPVLLETFEKLGIPLSEQKRLSNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVS+ATT RK L K GVIFCSISEA+ +YP+LV KYLG VVP  DNF+ ALNSAV
Sbjct  125   DAVFDSVSVATTFRKDLAKHGVIFCSISEAVHDYPELVEKYLGSVVPVGDNFFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK+T+CPM +STYFRIN  ++GQFERTLI+A+  + V YLEGCTAP +DTN
Sbjct  185   FSDGSFVYIPKDTKCPMDLSTYFRINNGDSGQFERTLIIAESGASVTYLEGCTAPMFDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVALDNAEIKYSTVQNWYAGDVNGKGGIYNFVTKRGLCQGKNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG 
Sbjct  305   GSAITWKYPSCVLIGDHSVGEFYSVALTNNCQQADTGTKMIHVGKNTRSTIISKGISAGR  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   A  ARN SQCDSMLIG+ A ANT+PYIQ +N +A++EHEA+TSKIG
Sbjct  365   SQNSYRGLVKMGPKAIGARNYSQCDSMLIGDQAGANTFPYIQVQNHTAQVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A++ MISGFCRDVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFAQRGISAEDAVSMMISGFCRDVFNQLPMEFAVEADRLLSLKLEGSVG  478



>ref|WP_026721840.1| cysteine desulfurase [Fischerella sp. PCC 9431]
Length=478

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/474 (69%), Positives = 396/474 (84%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF   I++ T+P+GLSE+ IR+IS++KNEP++MLEFRL++Y +++ M E
Sbjct  5     VKTLVNQPYKYGFITNIEADTIPRGLSEDVIRMISAKKNEPEFMLEFRLRAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W   +YP I++Q+I YYS PK++    SL+E DP L++ FEKLG+PL+E+ RLANVAV
Sbjct  65    PTWPSVKYPPIDYQNIIYYSAPKQQSKKKSLEEVDPTLLETFEKLGIPLSEQKRLANVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT ++ L K GVIFCSISEA++E+PDLV+KYLG VVP  DN++ ALNSAV
Sbjct  125   DAIFDSVSVATTFKEKLAKEGVIFCSISEALQEHPDLVKKYLGSVVPIADNYFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK  +CPM++STYFRIN  +TGQFERTLIVA+D S+V YLEGCTAP YD+N
Sbjct  185   FSDGSFVYIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEDDSYVSYLEGCTAPMYDSN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE+G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVALDNAEIKYSTVQNWYAGDEKGKGGIYNFVTKRGLCQGVNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG+
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHIGKNTRSTIISKGISAGN  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKIG
Sbjct  365   SSNSYRGLVKINPKAQGARNYSQCDSMLIGDNAHANTFPYIQVQNNTAKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A+  MISGFC+DVFN LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFAQRGISAEDAVKMMISGFCKDVFNNLPMEFAVEADKLLSLKLEGSVG  478



>ref|WP_036535504.1| cysteine desulfurase [Neosynechococcus sphagnicola]
 gb|KGF71869.1| cysteine desulfurase [Neosynechococcus sphagnicola sy1]
Length=478

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/474 (69%), Positives = 394/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+  T+P+GL+E+ IRLIS++K+EP +MLEFRLK+Y  ++ M E
Sbjct  5     VKTLVNQPYKYGFVTDIEVDTIPRGLNEDVIRLISAKKSEPAFMLEFRLKAYRHWLKMVE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W    YP I++QDI YYS PK++    SLDE DP L++ FEKLG+ L+E+ RL NVAV
Sbjct  65    PTWPHVSYPPIDYQDIVYYSAPKQQEKKKSLDEVDPTLLETFEKLGISLSEQKRLTNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT ++ L + GVIFCSISEA++EYPDL+++YLGRVVP  DN+Y ALNSAV
Sbjct  125   DAIFDSVSVATTFKEKLAEQGVIFCSISEAVKEYPDLIQQYLGRVVPVGDNYYAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK+TRCPM++STYFRIN+ +TGQFERTLI+A+  S V YLEGCTAP YDTN
Sbjct  185   FSDGSFVYIPKDTRCPMELSTYFRINSGDTGQFERTLIIAEAGSQVSYLEGCTAPMYDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLCAG  SKISWTQVET
Sbjct  245   QLHAAVVELVALDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRGLCAGVNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTN+YQQADTGTKMIH GKNTRS IISKGISAGH
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNHYQQADTGTKMIHVGKNTRSTIISKGISAGH  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ +N   R+EHEA+TSKIG
Sbjct  365   SKNSYRGLVKIAPQAIGARNYSQCDSMLIGDNAEANTFPYIQVQNHRGRVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A++ +ISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFSQRGISAEDAVSMIISGFCKDVFNQLPMEFAVEADRLLSLKLEGSVG  478



>ref|WP_017322263.1| cysteine desulfurase activator complex subunit SufB [cyanobacterium 
PCC 7702]
Length=478

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/474 (69%), Positives = 392/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF   I+  T+P+GL+E+ IRLIS++KNEP++MLEFRL++Y ++  M E
Sbjct  5     VKTLVNQPYKYGFVTNIEVETIPRGLNEDIIRLISAKKNEPEFMLEFRLRAYRQWQKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P WS  +YP IN+Q+I YYS PK+K    SL+E DP+L++ FEKLG+PL+E+ RLANVAV
Sbjct  65    PNWSSVKYPAINYQNIIYYSAPKQKAKKQSLEEVDPKLLETFEKLGIPLSEQKRLANVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVSIATT ++ L K GVIFCSISEA++E+P+LV+KYLG VVP  DN++ ALNSAV
Sbjct  125   DAIFDSVSIATTFKEKLAKEGVIFCSISEALQEHPELVKKYLGSVVPIADNYFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVYVPK  +CPM++STYFRIN  ETGQFERTLI+AD  S+V YLEGCTAP YD+N
Sbjct  185   FSDGSFVYVPKGVKCPMELSTYFRINNGETGQFERTLIIADQDSYVSYLEGCTAPMYDSN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELIALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCQGVNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG 
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHIGKNTRSTIISKGISAGK  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV++   A+ ARN S CDSMLIG+NA ANT+PYIQ +N +AR+EHEA+TSKIG
Sbjct  365   SSNSYRGLVKIGPKAEKARNYSVCDSMLIGDNARANTFPYIQVQNHTARVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFY Q RGI  E A+  MISGFC+DVFN LP EF  E ++L+SLKLEG+VG
Sbjct  425   EDQLFYLQARGISAEDAVKLMISGFCKDVFNHLPMEFAVEADKLLSLKLEGTVG  478



>ref|WP_026731385.1| cysteine desulfurase [Fischerella sp. PCC 9605]
Length=478

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/474 (69%), Positives = 395/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+E+ IR IS++KNEP++MLEFRL++Y ++  M E
Sbjct  5     VKTLVNQPYKYGFVTKIEADTIPRGLNEDVIRTISAKKNEPEFMLEFRLRAYRQWQKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W   +YP I++Q+I YYS PK++    SL+E DP L++ FEKLG+PL+E+ RLANVAV
Sbjct  65    PTWPSVKYPPIDYQNIIYYSAPKQQAKKKSLEEVDPTLLETFEKLGIPLSEQKRLANVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT ++ L K GVIFCSISEAI+EYP+LV+KYLG VVP+ DN++ ALNSAV
Sbjct  125   DAIFDSVSVATTFKEKLAKEGVIFCSISEAIQEYPELVKKYLGSVVPTADNYFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLI+AD+ S+V YLEGCTAP YD+N
Sbjct  185   FSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIIADEDSYVSYLEGCTAPMYDSN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVALDNAEIKYSTVQNWYAGDESGKGGIYNFVTKRGLCQGVNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG 
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHIGKNTRSTIISKGISAGK  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKIG
Sbjct  365   SSNSYRGLVKINPKAKGARNYSQCDSMLIGDNAHANTFPYIQVQNNTAKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A+  MISGFC+DVFN LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFAQRGISSEDAVKMMISGFCKDVFNNLPMEFAVEADKLLSLKLEGSVG  478



>ref|WP_015122735.1| iron-regulated ABC transporter membrane component SufB [Rivularia 
sp. PCC 7116]
 ref|YP_007059733.1| iron-regulated ABC transporter membrane component SufB [Rivularia 
sp. PCC 7116]
 gb|AFY59186.1| Iron-regulated ABC transporter membrane component SufB [Rivularia 
sp. PCC 7116]
Length=478

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/474 (69%), Positives = 394/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+E+ IRLIS++KNEP++MLEFRLK+Y ++  M E
Sbjct  5     VKTLVNQPYKYGFVTDIETDTIPRGLNEDVIRLISAKKNEPEFMLEFRLKAYRQWQKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W+   YP I++Q+I YYS PK+     SLDE DP L++ FEKLG+PL+E+ RLANVAV
Sbjct  65    PDWASVGYPAIDYQNIIYYSAPKQSAKKKSLDEVDPTLLETFEKLGIPLSEQKRLANVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT ++ L + GVIFCSISEA++EYP+LV+KYLG VVP  DN++ ALN+AV
Sbjct  125   DAIFDSVSVATTFKEKLAEEGVIFCSISEALQEYPELVQKYLGSVVPVADNYFAALNAAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFV++PK  +CPM++STYFRIN  +TGQFERTLIVA++ S+V YLEGCTAP YD+N
Sbjct  185   FSDGSFVFIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEEDSYVSYLEGCTAPMYDSN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVTLDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCKGKNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKM+H GKNTRS IISKGISAG 
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMVHVGKNTRSTIISKGISAGK  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV+V   AD ARN SQCDSMLIG+NA ANT+PYIQ +N   ++EHEA+TSKIG
Sbjct  365   SSNSYRGLVKVNPKADGARNYSQCDSMLIGDNAHANTFPYIQVQNNKGKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A+A MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFSQRGISTEDAIAMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  478



>ref|XP_010688022.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=522

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/474 (69%), Positives = 396/474 (84%), Gaps = 6/474 (1%)
 Frame = -3

Query  1768  RDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKWSDN  1589
             ++Y++GF   +DSFT+ KG+SE+ IRLIS  K+EP+WML+FRL SY +F+NM +P WSDN
Sbjct  49    KEYEYGFKHNLDSFTIGKGISEDKIRLISKLKDEPNWMLDFRLNSYHKFLNMVQPIWSDN  108

Query  1588  RYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLA-NVAVDAVLD  1412
             +YP I+FQDICYYS PKKKP L++LDE D ++I++ +KL +PL ++ RL  NVA+D V D
Sbjct  109   QYPPIDFQDICYYSSPKKKPNLDNLDEVDSDMIQFLDKLNLPLTQKKRLGTNVAIDFVYD  168

Query  1411  SVSIATTH-----RKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             S S  T +     R +L  +GVIFCS+S A+REYPDL+++YLG+VVP  DN+Y ALNSAV
Sbjct  169   SESFGTAYTDSKSRTSLTDAGVIFCSMSRAVREYPDLIKEYLGKVVPDSDNYYAALNSAV  228

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSF Y+PK  +C + +STYFRINA ETGQFERTLIVAD+ S VEYLEGCTA ++ + 
Sbjct  229   FSDGSFCYIPKGVKCEIPLSTYFRINASETGQFERTLIVADEGSVVEYLEGCTAVAHHSK  288

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVELY   GA+IKYSTVQNW+ GD +GRGGI+NFVTKRGLCAG  SKISWTQVET
Sbjct  289   QLHAAVVELYAASGAQIKYSTVQNWFPGDAQGRGGIYNFVTKRGLCAGRGSKISWTQVET  348

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPSVVLEGDES+GEFYSVA+T N+QQADTG+KMIHKGKNTRSRIISKGISAG 
Sbjct  349   GSAITWKYPSVVLEGDESIGEFYSVAVTTNHQQADTGSKMIHKGKNTRSRIISKGISAGT  408

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             SRN YRGLV++MS A NARNSSQCDSML+G+ A+ANTYPYI+ KNPS R+EHEA+TS+IG
Sbjct  409   SRNVYRGLVKIMSGATNARNSSQCDSMLVGDLASANTYPYIEAKNPSVRVEHEASTSRIG  468

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
              DQ+FYFQQRGID E+A++ MI+ F +DV   LP EF AE NQL++LKLE SVG
Sbjct  469   ADQIFYFQQRGIDQEQAISVMINQFTKDVVPRLPKEFSAEANQLLTLKLERSVG  522



>ref|WP_017316116.1| cysteine desulfurase activator complex subunit SufB [Mastigocladopsis 
repens]
Length=479

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/475 (69%), Positives = 397/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF   I++ TLP+GL+E+TIRLIS++KNEP++ML+FRL+++ ++  M E
Sbjct  5     VKTLVNQPYKYGFITNIEADTLPRGLNEDTIRLISAKKNEPEFMLDFRLRAFRQWQKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W   +YP I++QDI YYS PK+ K  LNSLDE DP L++ FEKLG+PL+E+ RLANVA
Sbjct  65    PTWPSVKYPSIDYQDIIYYSAPKQTKQKLNSLDEVDPTLLETFEKLGIPLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSI TT ++ L K GVIFCSISEA++EYP+LV+KYLG VVP  DN++ ALN+A
Sbjct  125   VDAIFDSVSIGTTFKEKLLKDGVIFCSISEALQEYPELVQKYLGSVVPPADNYFAALNAA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN  +TGQFERTLIVA++ S+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  365   NSSNSYRGLVKINPKAQGARNYSQCDSMLIGDNAHANTFPYIQVQNHTAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFAQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_026102049.1| cysteine desulfurase [Geminocystis herdmanii]
Length=479

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/475 (69%), Positives = 398/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+PKGLSE+ +RLIS +KNEP++MLEFRLK+Y +++ M E
Sbjct  5     VKTLVNQPYKYGFITDIESDTIPKGLSEDVVRLISLKKNEPEFMLEFRLKAYRQWLTMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P+W+   YP IN+QDI YYS PK+ K  L+SLDE DP L++ FEKLG+PL+E+ RL NVA
Sbjct  65    PEWAHVGYPSINYQDIIYYSAPKQQKKKLDSLDEVDPTLLEAFEKLGIPLSEQKRLGNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT +  L K GVIFCSISEA++E+PDL++KYLG VVPS DN++ ALN A
Sbjct  125   VDAIFDSVSIATTFKDKLAKDGVIFCSISEALQEHPDLIQKYLGSVVPSADNYFAALNGA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK  +CPM++STYFRIN  +TGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  185   VFSDGSFVFIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEEGASVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGDE+G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNADIKYSTVQNWYAGDEKGKGGIYNFVTKRGLCKGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKM+H GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNMQQADTGTKMVHIGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLV++ + A  ARN SQCDSMLIG+NA ANT+PYIQ  N  A++EHEA+TSKI
Sbjct  365   NSKNSYRGLVKMGNKATGARNYSQCDSMLIGDNAEANTFPYIQVDNSRAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV NELP EF AE ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFAQRGISEEDAVSMLVSGFCKDVLNELPMEFAAEADKLLSLKLEGSVG  479



>gb|AIU44588.1| putative ABC transporter [Cyanophora paradoxa]
Length=486

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/483 (67%), Positives = 406/483 (84%), Gaps = 1/483 (0%)
 Frame = -3

Query  1810  STSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSY  1631
             + S ++  L+  + + YK+GF  +I+  T+ KGL+E+T+RLIS++KNEP++MLEFRL+++
Sbjct  4     TQSPKNSGLENLVNQPYKYGFTTDIEIETISKGLTEDTVRLISAKKNEPEFMLEFRLQAF  63

Query  1630  ERFMNMK-EPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNE  1454
              +++ MK EP+W+   YP+IN+QD+ YYS PK+K  L SLDE DP L++ FEKLG+PL E
Sbjct  64    RKWLEMKNEPEWAHLNYPKINYQDMVYYSAPKQKKKLQSLDEVDPTLLETFEKLGIPLTE  123

Query  1453  RNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDN  1274
             + RLANVAVDA+ DSVS+ATT ++ L K GVIFC ISEAI++YPDL++KYLG VV + DN
Sbjct  124   QKRLANVAVDAIFDSVSVATTFKEELAKEGVIFCPISEAIQKYPDLIKKYLGSVVSTSDN  183

Query  1273  FYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEG  1094
             ++  LN+AVFSDGSF Y+PKN RCP+++STYFRIN  E+GQFERTLIVAD+ S+V YLEG
Sbjct  184   YFSCLNAAVFSDGSFCYIPKNVRCPLELSTYFRINNGESGQFERTLIVADEGSYVSYLEG  243

Query  1093  CTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRS  914
             CTAP +DTNQLHAAVVEL   + AEIKYSTVQNWYAGD+ G+GGI+NFVTKRGLCAG  S
Sbjct  244   CTAPQFDTNQLHAAVVELVALKDAEIKYSTVQNWYAGDDNGKGGIYNFVTKRGLCAGENS  303

Query  913   KISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRI  734
             KISWTQVETGSAITWKYPS VL GD S+GEFYSVALTN YQQADTGTKMIH GKNTRSRI
Sbjct  304   KISWTQVETGSAITWKYPSCVLLGDNSIGEFYSVALTNRYQQADTGTKMIHIGKNTRSRI  363

Query  733   ISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIE  554
             ISKGISAGHS+N YRGLV++   A  ARN SQCDS+LIG+N+ ANT+P++Q KNP+A++E
Sbjct  364   ISKGISAGHSQNSYRGLVKISPKALGARNYSQCDSLLIGDNSQANTFPHLQIKNPTAKVE  423

Query  553   HEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEG  374
             HEA+TSKIGE+Q+FYF QRGI+ E+A++ +ISGFCR+VFN LP EF  E ++L+ LKLEG
Sbjct  424   HEASTSKIGEEQIFYFLQRGINAEEAISLIISGFCREVFNNLPMEFALEADKLLGLKLEG  483

Query  373   SVG  365
             SVG
Sbjct  484   SVG  486



>ref|WP_015140225.1| FeS assembly protein SufB [Nostoc sp. PCC 7524]
 ref|YP_007077403.1| FeS assembly protein SufB [Nostoc sp. PCC 7524]
 gb|AFY49806.1| FeS assembly protein SufB [Nostoc sp. PCC 7524]
Length=479

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/475 (69%), Positives = 399/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+E+ IRLIS++KNEP++MLEFRL++Y +++ M E
Sbjct  5     VKTLVNQPYKYGFVTDIETDTIPRGLNEDVIRLISAKKNEPEFMLEFRLRAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++QDI YYS PK KK  LNSL+E DP L++ FEKLG+PL+E+ RLANVA
Sbjct  65    PTWPSVTYPPIDYQDIIYYSAPKQKKEKLNSLEEVDPTLLETFEKLGIPLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L K GVIFCSISEA++E+P+L++KYLG VVP  DN++ ALN+A
Sbjct  125   VDAIFDSVSVATTFKEKLAKDGVIFCSISEALQEHPELIKKYLGSVVPIADNYFAALNAA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHIGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S N YRGLV++   A+ ARN SQCDSMLIG+NA ANT+PYIQ +N + ++EHEA+TSKI
Sbjct  365   NSSNSYRGLVKINPKAEGARNYSQCDSMLIGDNAHANTFPYIQVQNNTGKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFAQRGISAEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_006101632.1| cysteine desulfurase activator complex subunit SufB [Coleofasciculus 
chthonoplastes]
 gb|EDX74812.1| FeS assembly protein SufB [Coleofasciculus chthonoplastes PCC 
7420]
Length=479

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/475 (69%), Positives = 402/475 (85%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++K + + YK+GF  +I++ T+P+GLSE+ +RLIS++KNEP++MLEFRLK+Y +++ M+E
Sbjct  5     VKKLVNQPYKYGFVTDIEADTIPRGLSEDVVRLISAKKNEPEFMLEFRLKAYRQWLKMEE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKP-TLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP IN+QDI YYS PKKK   LNSL+E DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  65    PTWPHVNYPPINYQDIIYYSAPKKKTEKLNSLEEVDPALLETFEKLGIPLSEQKRLSNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT +  L ++GVIFCSISEA++E+P+LV+KYLG VVP  DN++ ALNSA
Sbjct  125   VDAIFDSVSVATTFKDKLAEAGVIFCSISEALQEHPELVQKYLGSVVPVGDNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK  +CPM++STYFRIN  +TGQFERTLIVA++ S V YLEGCTAP YDT
Sbjct  185   VFSDGSFVFIPKGVKCPMELSTYFRINTGDTGQFERTLIVAEEGSSVSYLEGCTAPMYDT  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNW+AGDE+G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVTLDNAEIKYSTVQNWFAGDEKGKGGIYNFVTKRGLCKGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKM+H GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMVHIGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLV+V   A  +RN SQCDSMLIG+ A ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  365   NSKNSYRGLVKVSPKAKRSRNYSQCDSMLIGDTAEANTFPYIQVENNTAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DVFNELP EF AE ++L+SLKLEG+VG
Sbjct  425   GEDQLFYFTQRGISEEDAVSMIVSGFCQDVFNELPMEFAAEADKLLSLKLEGAVG  479



>ref|WP_008316689.1| FeS assembly protein SufB [Leptolyngbya sp. PCC 6406]
Length=479

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/475 (69%), Positives = 395/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +Q  + + YK+GF  +I++ T+P+GLSE+T+RLIS++KNEP++ML FRLK+Y +++ M E
Sbjct  5     VQTLVSQPYKYGFVTDIEADTIPRGLSEDTVRLISAKKNEPEFMLNFRLKAYRKWLTMAE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W + +YP IN+QDI YYS PK+ K  L SLD+ADP L++ FEKLG+PL+E+ RLANVA
Sbjct  65    PTWPNVQYPRINYQDIIYYSAPKRDKKKLASLDDADPALLETFEKLGLPLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSI TT ++ L + GVIFCSISEA+ E+P+LV KYLG VVP  DN++ ALNSA
Sbjct  125   VDAIFDSVSIGTTFKEKLAEEGVIFCSISEALAEHPELVEKYLGSVVPVGDNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK+T+CPM +STYFRIN  ++GQFERTLIVA+  S V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKDTQCPMDLSTYFRINTSDSGQFERTLIVAEAGSSVTYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A IKYSTVQNW+AGDE G+GGI+NFVTKRGLCAG  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNANIKYSTVQNWFAGDENGKGGIYNFVTKRGLCAGKNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTN+YQQADTGTKMIH GKNTRS I+SKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNHYQQADTGTKMIHVGKNTRSTIVSKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             HS N YRGLV++   A  ARN SQCDSMLIG+   ANTYPYIQ + P+AR+EHEA+TSKI
Sbjct  365   HSTNSYRGLVKIGPKATGARNYSQCDSMLIGDTGNANTYPYIQVQTPTARVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ +ISGFCR VFNELP EF AE ++LM+LKLE SVG
Sbjct  425   GEDQLFYFAQRGISPEDAVSMIISGFCRQVFNELPLEFAAEADKLMALKLENSVG  479



>ref|WP_015202046.1| FeS assembly protein SufB [Crinalium epipsammum]
 ref|YP_007141434.1| FeS assembly protein SufB [Crinalium epipsammum PCC 9333]
 gb|AFZ11924.1| FeS assembly protein SufB [Crinalium epipsammum PCC 9333]
Length=478

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/474 (68%), Positives = 396/474 (84%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  +   YK+GF  +I++  +P+GL+E+ +R+IS++K EP++MLEFRL++Y +++ M E
Sbjct  5     VKTLVNEPYKYGFVTDIETDQIPRGLNEDIVRMISAKKEEPEFMLEFRLRAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W    YP IN+QDI YYS PK+K  LNSL+E DP L++ FEKLG+ L+E+ RL+NVAV
Sbjct  65    PTWQHVTYPPINYQDIIYYSAPKQKKKLNSLEEVDPILLETFEKLGISLSEQKRLSNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVS+ATT ++ L K GVIFCSISEA+ E+P+LV+KYLG VVP  DN++ ALNSAV
Sbjct  125   DAVFDSVSVATTFKEKLAKDGVIFCSISEALTEHPELVQKYLGSVVPVADNYFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PKNT+CPM +STYFRIN  ++GQFERTLI+A++ + V YLEGCTAP +DTN
Sbjct  185   FSDGSFVYIPKNTKCPMDLSTYFRINTGDSGQFERTLIIAEEGASVTYLEGCTAPMFDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVALDNAEIKYSTVQNWYAGDETGKGGIYNFVTKRGLCQGVNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNNYQQADTGTKMIH GKNTRS IISKGIS+GH
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNYQQADTGTKMIHVGKNTRSTIISKGISSGH  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKIG
Sbjct  365   SKNSYRGLVKMNPKAQGARNYSQCDSMLIGDNAQANTFPYIQVQNSTAKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLF+F QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFFFAQRGISQEDAISMMISGFCKDVFNQLPMEFAVEADRLLSLKLEGSVG  478



>ref|WP_006634911.1| cysteine desulfurase activator complex subunit SufB [Microcoleus 
vaginatus]
 gb|EGK85127.1| FeS assembly protein SufB [Microcoleus vaginatus FGP-2]
Length=480

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/475 (69%), Positives = 398/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+P+GLSE+ +RLIS++KNEP++ML+FRLK+Y +++ M E
Sbjct  6     VKTLVNQPYKYGFVTDIESDTIPRGLSEDVVRLISAKKNEPEFMLQFRLKAYRKWLTMSE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPT-LNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q I YYS PK+KP  LNSLDE DP L++ FEKLG+PL+E+ RL NVA
Sbjct  66    PTWPHVNYPAIDYQQIIYYSAPKQKPKKLNSLDEVDPTLLETFEKLGIPLSEQKRLGNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDAV DSVSIATT R+ L K GVIFCSISEA+++YP+L+ KYLG VVP  DNF+ ALNSA
Sbjct  126   VDAVFDSVSIATTFREKLAKDGVIFCSISEAVKDYPELIEKYLGSVVPVGDNFFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN  ++GQFERTLIVA+++S V YLEGCTAP +DT
Sbjct  186   VFSDGSFVYIPKGVKCPMELSTYFRINNGDSGQFERTLIVAEENSSVSYLEGCTAPMFDT  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVTMDNADIKYSTVQNWYAGDANGKGGIYNFVTKRGLCQGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNKQQADTGTKMIHVGKNTRSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S N YRGLV++  +A  +RN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  366   NSSNSYRGLVKMGPNAKGSRNYSQCDSMLIGDNAQANTFPYIQVQNHTAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GE+QLF+F QRGI  E A++ MISGFC+DVFN+LP EF AE ++L+SLKLEGSVG
Sbjct  426   GEEQLFFFAQRGISAENAISMMISGFCKDVFNQLPMEFAAEADKLLSLKLEGSVG  480



>ref|WP_038081908.1| cysteine desulfurase [Tolypothrix bouteillei]
 gb|KIE07947.1| cysteine desulfurase [Tolypothrix bouteillei VB521301]
Length=479

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/475 (69%), Positives = 399/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+E+ +RLIS++KNEP++ML+FRLK++ ++  M E
Sbjct  5     VKTLVNQPYKYGFVTDIEADTIPRGLNEDIVRLISAKKNEPEFMLDFRLKAFRQWQKMVE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W   +YP I++Q+I YYS PK KK  LNSL+E DP L++ FEKLG+PL+E+ RLANVA
Sbjct  65    PAWPSVKYPAIDYQNIIYYSAPKQKKQKLNSLEEVDPTLLETFEKLGIPLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L K GVIFCSISEA++E+P+LV+KYLG VVP  DN++ ALNSA
Sbjct  125   VDAIFDSVSVATTFKEKLAKDGVIFCSISEALQEHPELVQKYLGSVVPVADNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN  ETGQFERTLIVA++ S+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINNGETGQFERTLIVAEEGSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S N YRGLV++   A+ ARN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  365   NSSNSYRGLVKINPKAEGARNYSQCDSMLIGDNAHANTFPYIQVQNNAAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ M+SGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFAQRGISTEDAISMMVSGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_011317308.1| cysteine desulfurase activator complex subunit SufB [Anabaena 
variabilis]
 ref|YP_320945.1| cysteine desulfurase activator complex subunit SufB [Anabaena 
variabilis ATCC 29413]
 gb|ABA20050.1| Iron-regulated ABC transporter membrane component SufB [Anabaena 
variabilis ATCC 29413]
Length=479

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/475 (68%), Positives = 398/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GLSE+ +RLIS++KNEP++MLE+RLK++ ++  M E
Sbjct  5     VKTLVNQPYKYGFVTDIEADTIPRGLSEDVVRLISAKKNEPEFMLEYRLKAFRQWQKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W   +YP I++Q+I YYS PK KK  LNSLDE DP LI+ FEKLG+PL+E+ RLANVA
Sbjct  65    PTWPSVKYPPIDYQNIIYYSAPKQKKAKLNSLDEVDPTLIETFEKLGIPLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L K GVIFCSISEA++E+P+L++KYLG VVP  DN++ ALN+A
Sbjct  125   VDAIFDSVSVATTFKEKLAKDGVIFCSISEALQEHPELIKKYLGSVVPIADNYFAALNAA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELIALDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S N YRGLV++  +A  ARN SQCDSMLIG+NA ANT+PYIQ +N + ++EHEA+TSKI
Sbjct  365   QSSNSYRGLVKINPTATGARNYSQCDSMLIGDNAHANTFPYIQVQNNTGKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLF+F QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFFFAQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_009343208.1| cysteine desulfurase activator complex subunit SufB [Raphidiopsis 
brookii]
 gb|EFA72707.1| FeS assembly protein SufB [Raphidiopsis brookii D9]
Length=479

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/475 (69%), Positives = 398/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+EE IRLIS++K EP++MLEFRL++Y +++ M E
Sbjct  5     VKTLVNQPYKYGFVTDIETDTIPRGLNEEVIRLISAKKQEPEFMLEFRLRAYRQWLKMME  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W+   Y  IN+QDI YYS PK KK  LNSL+E DP L++ FEKLG+ L+E+ RLANVA
Sbjct  65    PIWAHVNYTPINYQDIVYYSAPKQKKAKLNSLEEVDPTLLETFEKLGISLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L + GVIFCSISEA+RE+P+LV+KYLG VVP  DN++ ALNSA
Sbjct  125   VDAIFDSVSVATTFKEKLAEDGVIFCSISEALREHPELVKKYLGSVVPIGDNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA++SS+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEESSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD S+GEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSIGEFYSVALTNNRQQADTGTKMIHIGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S N YRGLV++  SA  ARN SQCDSMLIG+NA ANT+PYIQ +N + ++EHEA+TSKI
Sbjct  365   KSSNSYRGLVKINPSAKGARNYSQCDSMLIGDNAQANTFPYIQVQNNTGKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLF+F QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFFFAQRGISAEDAVSMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_027401841.1| cysteine desulfurase [Aphanizomenon flos-aquae]
Length=479

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/472 (69%), Positives = 396/472 (84%), Gaps = 1/472 (0%)
 Frame = -3

Query  1777  FLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKW  1598
              + + YK+GF  +I++ T+P+GLSE+ +RLIS++KNEP++MLE+RL++Y +++ M EP W
Sbjct  8     LVNQPYKYGFVTDIEADTIPRGLSEDVVRLISAKKNEPEFMLEYRLRAYHQWLKMTEPTW  67

Query  1597  SDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAVDA  1421
             S  +YP IN+QDI YYS PK KK  LNSLDE DP L++ F KLG+PLNE+ RL+NVAVDA
Sbjct  68    SHVQYPPINYQDIIYYSAPKQKKAKLNSLDEVDPTLLETFAKLGIPLNEQKRLSNVAVDA  127

Query  1420  VLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFS  1241
             + DSVS+ATT+++ L K GVIFCS SEA++E+P+L++KYLG VVP  DN++ ALN+AVFS
Sbjct  128   IFDSVSVATTYKEKLAKDGVIFCSFSEALQEHPELIKKYLGSVVPIADNYFAALNAAVFS  187

Query  1240  DGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQL  1061
             DGSFVY+PK  +CPM++STYFRIN  +TGQFERTLIVA++ S+V YLEGCTAP YD+NQL
Sbjct  188   DGSFVYIPKGLKCPMELSTYFRINTGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDSNQL  247

Query  1060  HAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVETGS  881
             HAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVETGS
Sbjct  248   HAAVVELVALDNAEIKYSTVQNWYAGDVNGKGGIYNFVTKRGLCQGVNSKISWTQVETGS  307

Query  880   AITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGHSR  701
             AITWKYPS VL GD SVGEFYSVALTNN QQADTG+KMIH GKNTRS IISKGISAG S 
Sbjct  308   AITWKYPSCVLIGDNSVGEFYSVALTNNMQQADTGSKMIHVGKNTRSTIISKGISAGKSS  367

Query  700   NCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIGED  521
             N YRGLV++  +A  ARN SQCDSMLIG+NA ANT+PYIQ +N + ++EHEA+TSKIGED
Sbjct  368   NSYRGLVKINPTAKGARNYSQCDSMLIGDNAQANTFPYIQVQNNTGKVEHEASTSKIGED  427

Query  520   QLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             QLF+F QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  428   QLFFFAQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_015176922.1| Iron-regulated ABC transporter membrane component SufB [Oscillatoria 
nigro-viridis]
 ref|YP_007116068.1| Iron-regulated ABC transporter membrane component SufB [Oscillatoria 
nigro-viridis PCC 7112]
 gb|AFZ07652.1| Iron-regulated ABC transporter membrane component SufB [Oscillatoria 
nigro-viridis PCC 7112]
Length=480

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/475 (69%), Positives = 398/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+P+GLSE+ +RLIS++KNEP++ML+FRLK+Y +++ M E
Sbjct  6     VKTLVNQPYKYGFVTDIESDTIPRGLSEDVVRLISAKKNEPEFMLQFRLKAYRKWLTMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPT-LNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q I YYS PK+KP  LNSLDE DP L++ FEKLG+PL+E+ RL NVA
Sbjct  66    PTWPHVNYPAIDYQQIIYYSAPKQKPKKLNSLDEVDPTLLETFEKLGIPLSEQKRLGNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDAV DSVSIATT R+ L K GVIFCSISEA+++YP+L+ KYLG VVP  DNF+ ALNSA
Sbjct  126   VDAVFDSVSIATTFREKLAKDGVIFCSISEAVKDYPELIEKYLGSVVPVGDNFFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN  ++GQFERTLIVA+++S V YLEGCTAP +DT
Sbjct  186   VFSDGSFVYIPKGVKCPMELSTYFRINNGDSGQFERTLIVAEENSSVSYLEGCTAPMFDT  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVTMDNADIKYSTVQNWYAGDANGKGGIYNFVTKRGLCQGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNKQQADTGTKMIHIGKNTRSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S N YRGLV++  +A  +RN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  366   NSSNSYRGLVKMGPNAKGSRNYSQCDSMLIGDNAQANTFPYIQVQNHTAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GE+QLF+F QRGI  E A++ MISGFC+DVFN+LP EF AE ++L+SLKLEGSVG
Sbjct  426   GEEQLFFFAQRGISAENAISMMISGFCKDVFNQLPMEFAAEADKLLSLKLEGSVG  480



>ref|WP_015151527.1| iron-regulated ABC transporter membrane component SufB [Oscillatoria 
acuminata]
 ref|YP_007088836.1| iron-regulated ABC transporter membrane component SufB [Oscillatoria 
acuminata PCC 6304]
 gb|AFY84916.1| Iron-regulated ABC transporter membrane component SufB [Oscillatoria 
acuminata PCC 6304]
Length=479

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/473 (69%), Positives = 395/473 (84%), Gaps = 0/473 (0%)
 Frame = -3

Query  1783  QKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEP  1604
             +  + + YK+GF  +++S TLP G++E+ +RLIS++K EP++MLEFRL+++ ++  M +P
Sbjct  7     KTLVNQPYKYGFITDVESDTLPPGINEDVVRLISAKKEEPEFMLEFRLRAFRQWQKMADP  66

Query  1603  KWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAVD  1424
              W+   YP+IN+QDI YYS PKKK  LNS+DE DP +++ FEKLG+PL+E+ RL+NVAVD
Sbjct  67    TWAHVNYPKINYQDIIYYSAPKKKQKLNSMDEVDPAILETFEKLGIPLSEQKRLSNVAVD  126

Query  1423  AVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAVF  1244
             AV DSVSIATT R  L + GVIFCSISEA+++YP+LV++YLG VVP  DN++ ALNSAVF
Sbjct  127   AVFDSVSIATTFRAKLAEEGVIFCSISEAVKDYPELVKQYLGSVVPVADNYFAALNSAVF  186

Query  1243  SDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQ  1064
             SDGSFVY+PK  +CPM++STYFRIN  E+GQFERTLI+A++ S V YLEGCTAP +DTNQ
Sbjct  187   SDGSFVYIPKGVKCPMELSTYFRINNGESGQFERTLIIAEEGSHVSYLEGCTAPMFDTNQ  246

Query  1063  LHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVETG  884
             LHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVETG
Sbjct  247   LHAAVVELVTLDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCKGKNSKISWTQVETG  306

Query  883   SAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGHS  704
             SAITWKYPS +L GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG+S
Sbjct  307   SAITWKYPSCMLVGDNSVGEFYSVALTNNKQQADTGTKMIHIGKNTRSTIISKGISAGNS  366

Query  703   RNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIGE  524
              N YRGLV+V   A  ARN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKIGE
Sbjct  367   SNSYRGLVKVAPKAKGARNYSQCDSMLIGDNAQANTFPYIQVENDTAKVEHEASTSKIGE  426

Query  523   DQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             DQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  427   DQLFYFAQRGISPEDAISMMISGFCKDVFNQLPMEFAVEADRLLSLKLEGSVG  479



>ref|WP_011433021.1| cysteine desulfurase activator complex subunit SufB [Synechococcus 
sp. JA-2-3B'a(2-13)]
 ref|YP_477636.1| cysteine desulfurase activator complex subunit SufB [Synechococcus 
sp. JA-2-3B'a(2-13)]
 gb|ABD02373.1| FeS assembly protein SufB [Synechococcus sp. JA-2-3B'a(2-13)]
Length=478

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/474 (69%), Positives = 397/474 (84%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I S ++ KGL+EE IR I ++K EPD+MLEFRL++Y +++ M E
Sbjct  5     VRALVNQPYKYGFVTDIPSESIGKGLNEEVIRQIWAKKGEPDFMLEFRLRAYRQWLKMSE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W +  YP I++Q+I YYS PK +P   SLDE DP L++ FEKLG+PL+E+ RLANVAV
Sbjct  65    PTWPNVSYPPIDYQNIVYYSAPKVQPKKKSLDEVDPVLLETFEKLGIPLSEQKRLANVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT R+ L K GVIFCS+SEA+REYP+LVRKYLG VVP  DN+Y ALNSAV
Sbjct  125   DAIFDSVSVATTFREKLAKEGVIFCSMSEALREYPELVRKYLGSVVPIADNYYAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVYVPK  RCPM++STYFRIN  E+GQFERTLI+AD+ S+V YLEGCTAP +DTN
Sbjct  185   FSDGSFVYVPKGVRCPMELSTYFRINNGESGQFERTLIIADEGSYVSYLEGCTAPMFDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G+ SKISWTQVET
Sbjct  245   QLHAAVVELIVLDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCQGANSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL G+ SVGEFYSVALTNNYQQADTGTKMIH G+NTRS+IISKGISAGH
Sbjct  305   GSAITWKYPSCVLVGENSVGEFYSVALTNNYQQADTGTKMIHVGRNTRSKIISKGISAGH  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   A+ ARN SQCDSMLIG+  +ANT+PYI+ +N +A++EHEA+TSKIG
Sbjct  365   SKNSYRGLVKIGPKAEGARNFSQCDSMLIGDQCSANTFPYIEVQNNTAKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             E+QLFYFQ RGI  E A++ +ISGFCR+VFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   EEQLFYFQSRGISAEDAVSMIISGFCREVFNQLPMEFAVEADRLLSLKLEGSVG  478



>ref|WP_016951202.1| cysteine desulfurase activator complex subunit SufB [Anabaena 
sp. PCC 7108]
Length=479

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/472 (69%), Positives = 395/472 (84%), Gaps = 1/472 (0%)
 Frame = -3

Query  1777  FLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKW  1598
              + + YK+GF  +I++ T+P+GLSE+ +RLIS++KNEP++MLE+RL++Y +++ M EP W
Sbjct  8     LVNQPYKYGFVTDIEADTIPRGLSEDVVRLISAKKNEPEFMLEYRLRAYHQWLKMTEPTW  67

Query  1597  SDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAVDA  1421
             S   YP IN+QDI YYS PK KK  LNSLDE DP L++ F KLG+PLNE+ RL NVAVDA
Sbjct  68    SHVEYPPINYQDIIYYSAPKQKKAKLNSLDEVDPTLLETFAKLGIPLNEQKRLTNVAVDA  127

Query  1420  VLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFS  1241
             + DSVS+ATT+++ L K GVIFCS SEA++E+P+L++KYLG VVP  DN++ ALN+AVFS
Sbjct  128   IFDSVSVATTYKEKLAKDGVIFCSFSEALQEHPELIKKYLGSVVPIADNYFAALNAAVFS  187

Query  1240  DGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQL  1061
             DGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YD+NQL
Sbjct  188   DGSFVYIPKGLKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDSNQL  247

Query  1060  HAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVETGS  881
             HAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVETGS
Sbjct  248   HAAVVELVALDNAEIKYSTVQNWYAGDVNGKGGIYNFVTKRGLCQGVNSKISWTQVETGS  307

Query  880   AITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGHSR  701
             AITWKYPS VL GD SVGEFYSVALTNN QQADTG+KMIH GKNTRS IISKGISAG S 
Sbjct  308   AITWKYPSCVLIGDNSVGEFYSVALTNNMQQADTGSKMIHVGKNTRSTIISKGISAGKSS  367

Query  700   NCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIGED  521
             N YRGLV++  +A  ARN SQCDSMLIG+NA ANT+PYIQ +N + ++EHEA+TSKIGED
Sbjct  368   NSYRGLVKINPTAKGARNYSQCDSMLIGDNAQANTFPYIQVQNNTGKVEHEASTSKIGED  427

Query  520   QLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             QLF+F QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  428   QLFFFAQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_015080912.1| FeS assembly protein SufB [Anabaena sp. 90]
 ref|YP_006997579.1| FeS assembly protein SufB [Anabaena sp. 90]
 gb|AFW95766.1| FeS assembly protein SufB [Anabaena sp. 90]
Length=479

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/472 (69%), Positives = 395/472 (84%), Gaps = 1/472 (0%)
 Frame = -3

Query  1777  FLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKW  1598
              + + YK+GF  +I++ T+P+GLSE+ +RLIS++KNEP++MLE+RL++Y +++ M EP W
Sbjct  8     LVNQPYKYGFVTDIEADTIPRGLSEDVVRLISAKKNEPEFMLEYRLRAYHQWLKMTEPTW  67

Query  1597  SDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAVDA  1421
             S  +YP IN+QDI YYS PK KK  LNSLDE DP L++ F KLG+PLNE+ RL+NVAVDA
Sbjct  68    SHVQYPPINYQDIIYYSAPKQKKAKLNSLDEVDPTLLETFAKLGIPLNEQKRLSNVAVDA  127

Query  1420  VLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFS  1241
             + DSVS+ATT+++ L K GVIFCS SEA++E+P+L++KYLG VVP  DN++ ALN+AVFS
Sbjct  128   IFDSVSVATTYKEKLAKDGVIFCSFSEALQEHPELIKKYLGSVVPIADNYFAALNAAVFS  187

Query  1240  DGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQL  1061
             DGSFVY+PK  +CPM++STYFRIN  +TGQFERTLIVA+  S+V YLEGCTAP YD+NQL
Sbjct  188   DGSFVYIPKGLKCPMELSTYFRINTGDTGQFERTLIVAEAGSYVSYLEGCTAPMYDSNQL  247

Query  1060  HAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVETGS  881
             HAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVETGS
Sbjct  248   HAAVVELVALDNAEIKYSTVQNWYAGDVNGKGGIYNFVTKRGLCQGVNSKISWTQVETGS  307

Query  880   AITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGHSR  701
             AITWKYPS VL GD SVGEFYSVALTNN QQADTG+KMIH GKNTRS IISKGISAG S 
Sbjct  308   AITWKYPSCVLIGDNSVGEFYSVALTNNMQQADTGSKMIHVGKNTRSTIISKGISAGKSS  367

Query  700   NCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIGED  521
             N YRGLV++  +A  ARN SQCDSMLIG+NA ANT+PYIQ +N + ++EHEA+TSKIGED
Sbjct  368   NSYRGLVKINPTAKGARNYSQCDSMLIGDNAQANTFPYIQVQNNTGKVEHEASTSKIGED  427

Query  520   QLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             QLF+F QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  428   QLFFFAQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_016863450.1| cysteine desulfurase activator complex subunit SufB [Fischerella 
muscicola]
Length=478

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/474 (69%), Positives = 394/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF   I++ T+P+GL+E+ IR+IS++KNEP++MLEFRL++Y ++  M E
Sbjct  5     VKTLVNQPYKYGFVTNIEADTIPRGLNEDIIRMISAKKNEPEFMLEFRLRAYRQWQKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W   +YP IN+Q+I YYS PK++    SL+E DP L++ FEKLG+PL+E+ RLANVAV
Sbjct  65    PTWPSVKYPAINYQNIIYYSAPKQQAKKKSLEEVDPTLLETFEKLGIPLSEQKRLANVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT ++ L K GVIFCSISEA++E+P+LV+KYLG VVP  DN++ ALNSAV
Sbjct  125   DAIFDSVSVATTFKEKLAKEGVIFCSISEALQEHPELVKKYLGSVVPIADNYFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK  +CPM++STYFRIN  +TGQFERTLIVA+D S+V YLEGCTAP YD+N
Sbjct  185   FSDGSFVYIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEDDSYVSYLEGCTAPMYDSN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE+G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVALDNAEIKYSTVQNWYAGDEKGKGGIYNFVTKRGLCQGVNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG+
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHIGKNTRSTIISKGISAGN  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ +N + ++EHEA+TSKIG
Sbjct  365   SSNSYRGLVKINPKAQGARNYSQCDSMLIGDNAHANTFPYIQVQNNTGKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A+  MISGFC+DVFN LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFAQRGISAEDAVTMMISGFCKDVFNNLPMEFAVEADKLLSLKLEGSVG  478



>ref|WP_015112308.1| iron-regulated ABC transporter membrane component SufB [Nostoc 
sp. PCC 7107]
 ref|YP_007049232.1| iron-regulated ABC transporter membrane component SufB [Nostoc 
sp. PCC 7107]
 gb|AFY42082.1| Iron-regulated ABC transporter membrane component SufB [Nostoc 
sp. PCC 7107]
Length=479

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/475 (68%), Positives = 399/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GLSE+ +RLIS++KNEP++ML+FRL++Y ++  M E
Sbjct  5     VKSLVNQPYKYGFITDIEADTIPRGLSEDVVRLISAKKNEPEFMLDFRLRAYRQWQKMVE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W   +YP IN+QDI YYS PK KK  LNSLDE DP L++ FEKLG+ L+E+ RLANVA
Sbjct  65    PTWPSVKYPPINYQDIIYYSAPKQKKAKLNSLDEVDPTLLETFEKLGISLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L + GVIFCSISEA++E+P+L++KYLG VVP  DN++ ALN+A
Sbjct  125   VDAIFDSVSVATTFKEKLAEDGVIFCSISEALQEHPELIKKYLGSVVPIADNYFAALNAA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDVNGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S N YRGLV++   A+ ARN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  365   NSSNSYRGLVKINPKAEGARNYSQCDSMLIGDNAHANTFPYIQVQNKAAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLF+F QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFFFAQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>gb|ACF84872.1| unknown [Zea mays]
Length=431

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/431 (77%), Positives = 369/431 (86%), Gaps = 0/431 (0%)
 Frame = -3

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             ML+FRL +Y RF+ M EP WSDN Y  ++ Q ICYYS PK KP LNSLDE DPEL+K F+
Sbjct  1     MLDFRLAAYRRFLTMVEPTWSDNEYAPVDLQSICYYSAPKTKPKLNSLDEVDPELLKTFD  60

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             +LG+PL E+ RL+NVAVDAV+DS SIATTHR+ L   GVIFCSISEAIREYPDL+R+YLG
Sbjct  61    RLGIPLTEQKRLSNVAVDAVIDSTSIATTHREALMAKGVIFCSISEAIREYPDLIRRYLG  120

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
              VVP  DN+Y ALNSAVFSDGSF +VPK+T CPM+ISTYFRIN  ETGQFERTLIVAD+ 
Sbjct  121   SVVPPGDNYYAALNSAVFSDGSFCFVPKDTVCPMEISTYFRINDKETGQFERTLIVADER  180

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             S V YLEGCTAP+YD+NQLHAAVVEL C EGAEIKYSTVQNWY+GDEEG+GGI+NFVTKR
Sbjct  181   STVSYLEGCTAPAYDSNQLHAAVVELVCEEGAEIKYSTVQNWYSGDEEGKGGIYNFVTKR  240

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             G C G  SKISWTQVETGSAITWKYPSV L GD+SVGEFYSVALT + QQADTGTKMIHK
Sbjct  241   GRCKGHGSKISWTQVETGSAITWKYPSVELIGDDSVGEFYSVALTKDCQQADTGTKMIHK  300

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQT  578
             GKN+RSRIISKGISAG SRNCYRGLV +  SA+NA NSSQCDS+LIG+NAAANTYP IQ 
Sbjct  301   GKNSRSRIISKGISAGKSRNCYRGLVLMNPSAENAYNSSQCDSLLIGDNAAANTYPTIQV  360

Query  577   KNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  398
                S R+EHEA+TSKIGEDQLFYFQQRG+D+EKA+AAMI GFCR VF  LP EF  EV+ 
Sbjct  361   GCTSGRVEHEASTSKIGEDQLFYFQQRGVDHEKAVAAMIGGFCRSVFEHLPYEFAQEVDA  420

Query  397   LMSLKLEGSVG  365
             LM+LKLEGSVG
Sbjct  421   LMNLKLEGSVG  431



>ref|WP_014855025.1| cysteine desulfurase activator complex subunit SufB [Melioribacter 
roseus]
 ref|YP_006526601.1| Fe-S cluster assembly protein SufB [Melioribacter roseus P3M-2]
 gb|AFN73588.1| Fe-S cluster assembly protein SufB [Melioribacter roseus P3M-2]
Length=495

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/474 (68%), Positives = 390/474 (82%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++     +YKWGF  EI+S   PKGL+E+ IR+IS +K EP+WM E+RLK+Y  ++ M+E
Sbjct  22    IEDLTNEEYKWGFVSEIESEVAPKGLNEDVIRMISEKKGEPEWMTEWRLKAYRYWLKMEE  81

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             PKW++ +Y  ++FQDI YY+ PKKKP LNSLDE DPELIK FEKLG+PL E+  LA VAV
Sbjct  82    PKWANVKYEPVDFQDISYYAAPKKKPQLNSLDEVDPELIKTFEKLGIPLEEQKALAGVAV  141

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVS+ATT ++TL++ G+IFCSISEAIRE+PDLV+KYLG VVP  DNFY ALNSAV
Sbjct  142   DAVFDSVSVATTFKETLKEKGIIFCSISEAIREHPDLVKKYLGSVVPYTDNFYAALNSAV  201

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK  RCPM++STYFRINA ETGQFERTLI+AD+ S+V YLEGCTAP  D N
Sbjct  202   FSDGSFVYIPKGVRCPMELSTYFRINAQETGQFERTLIIADEDSYVSYLEGCTAPIRDDN  261

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWY GD++G+GGI+NFVTKRG C G  SKISWTQVET
Sbjct  262   QLHAAVVELVALDNAEIKYSTVQNWYPGDKQGKGGIYNFVTKRGACRGVNSKISWTQVET  321

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYP  +L+GD S+GEFYSVA+TNN+QQADTGTKMIH GKNTRS IISKGISAG 
Sbjct  322   GSAITWKYPGCILQGDNSIGEFYSVAVTNNFQQADTGTKMIHLGKNTRSTIISKGISAGR  381

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV+V   A NARN +QCDSML+G+   A+T+PYI+ +N +AR+EHEATTSK+G
Sbjct  382   SNNSYRGLVKVGKKATNARNFTQCDSMLMGDRCGAHTFPYIEVENDTARVEHEATTSKVG  441

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQ+FY  QRGI  E A+  +++GFC++VFNELP EF  E  +L+++ LEGSVG
Sbjct  442   EDQIFYLNQRGIPTEDAINMIVNGFCKEVFNELPMEFAVEAQKLLAISLEGSVG  495



>ref|WP_015130440.1| iron-regulated ABC transporter membrane component SufB [Calothrix 
sp. PCC 7507]
 ref|YP_007067472.1| iron-regulated ABC transporter membrane component SufB [Calothrix 
sp. PCC 7507]
 gb|AFY34638.1| Iron-regulated ABC transporter membrane component SufB [Calothrix 
sp. PCC 7507]
Length=479

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/475 (69%), Positives = 398/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+E+ IRLIS++KNEP++MLEFRL++Y ++  M E
Sbjct  5     VKTLVNQPYKYGFVTDIEADTIPRGLNEDVIRLISAKKNEPEFMLEFRLRAYRQWQKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W   +YP I++Q+I YYS PK KK  LNSLDE DP L++ FEKLG+ L+E+ RL+NVA
Sbjct  65    PTWPSVKYPAIDYQNIIYYSAPKQKKAKLNSLDEVDPTLLETFEKLGISLSEQKRLSNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L K GVIFCSISEA++EYP+L++KYLG VVP  DN++ ALN+A
Sbjct  125   VDAIFDSVSVATTFKEKLLKDGVIFCSISEALQEYPELIKKYLGSVVPIADNYFAALNAA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVAFDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTN+ QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNHMQQADTGTKMIHIGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S N YRGLV+V  +A  ARN SQCDSMLIG+NA ANT+PYIQ +N SA++EHEA+TSKI
Sbjct  365   KSSNSYRGLVKVNPTAKGARNYSQCDSMLIGDNAHANTFPYIQVQNNSAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFAQRGISPEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_028082495.1| cysteine desulfurase [Dolichospermum circinale]
Length=479

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/472 (69%), Positives = 395/472 (84%), Gaps = 1/472 (0%)
 Frame = -3

Query  1777  FLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKW  1598
              + + YK+GF  +I++ T+P+GLSE+ +RLIS++KNEP++MLE+RL++Y +++ M EP W
Sbjct  8     LVNQPYKYGFVTDIEADTIPRGLSEDVVRLISAKKNEPEFMLEYRLRAYHQWLKMTEPTW  67

Query  1597  SDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAVDA  1421
                +YP IN+QDI YYS PK KK  LNSLDE DP L++ FEKLG+ L+E+ RLANVAVDA
Sbjct  68    PHVKYPPINYQDIIYYSAPKQKKAKLNSLDEVDPTLLETFEKLGISLSEQKRLANVAVDA  127

Query  1420  VLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFS  1241
             + DSVS+ATT ++ L + GVIFCSISEA++E+P+L++KYLG VVP  DN++ ALN+AVFS
Sbjct  128   IFDSVSVATTFKEKLAEDGVIFCSISEALQEHPELIKKYLGSVVPIADNYFAALNAAVFS  187

Query  1240  DGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQL  1061
             DGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA+  S+V YLEGCTAP YD+NQL
Sbjct  188   DGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEADSYVSYLEGCTAPMYDSNQL  247

Query  1060  HAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVETGS  881
             HAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVETGS
Sbjct  248   HAAVVELVALDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRGLCQGVNSKISWTQVETGS  307

Query  880   AITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGHSR  701
             AITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG S 
Sbjct  308   AITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHIGKNTRSTIISKGISAGKSS  367

Query  700   NCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIGED  521
             N YRGLV++  +A  ARN SQCDSMLIG+NA ANT+PYIQ +N S ++EHEA+TSKIGED
Sbjct  368   NSYRGLVKINPTAKGARNYSQCDSMLIGDNAQANTFPYIQVQNNSGKVEHEASTSKIGED  427

Query  520   QLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             QLF+F QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  428   QLFFFAQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_015200448.1| iron-regulated ABC transporter membrane component SufB [Calothrix 
parietina]
 ref|YP_007139808.1| iron-regulated ABC transporter membrane component SufB [Calothrix 
sp. PCC 6303]
 gb|AFZ03836.1| Iron-regulated ABC transporter membrane component SufB [Calothrix 
sp. PCC 6303]
Length=479

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/475 (69%), Positives = 399/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +   + + YK+GF  +I+S T+P+GLSE+ +RLISS+KNEPD+MLEFRL++Y +++ M E
Sbjct  5     VNTLVNQPYKYGFVTDIESDTIPRGLSEDIVRLISSKKNEPDFMLEFRLRAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P WS   YP I++Q+I YYS PK+ K  L+SLDE DP L++ FEKLG+ L+E+ RLANVA
Sbjct  65    PDWSGLNYPPIDYQNIIYYSAPKQAKKKLDSLDEVDPTLLETFEKLGISLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L K GVIFCS SEA++E+P+L++KYLG VVP  DN++ ALN+A
Sbjct  125   VDAIFDSVSVATTFKEKLAKDGVIFCSFSEALQEHPELIKKYLGSVVPIADNYFAALNAA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN  +TGQFERTLIVA++ S+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVAMDDAEIKYSTVQNWYAGDVNGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S N YRGLV+V  +A  ARN SQCDSMLIG++AAANT+PYIQ +N +A++EHEA+TSKI
Sbjct  365   NSSNSYRGLVKVNPTAKGARNYSQCDSMLIGDSAAANTFPYIQVQNQTAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLF+F+QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFFFRQRGISAEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_010996648.1| cysteine desulfurase activator complex subunit SufB [Nostoc sp. 
PCC 7120]
 ref|NP_486532.1| cysteine desulfurase activator complex subunit SufB [Nostoc sp. 
PCC 7120]
 dbj|BAB74191.1| alr2492 [Nostoc sp. PCC 7120]
Length=479

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/475 (68%), Positives = 397/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL E+ +RLIS++KNEP++MLEFRL+++ ++  M E
Sbjct  5     VKTLVNQPYKYGFVTDIEADTIPRGLDEDVVRLISTKKNEPEFMLEFRLRAFRQWQKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W   +YP I++Q+I YYS PK KK  LNSLDE DP LI+ FEKLG+PL+E+ RLANVA
Sbjct  65    PTWPSVKYPPIDYQNIIYYSAPKQKKAKLNSLDEVDPTLIETFEKLGIPLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L K GVIFCSISEA++E+P+L++KYLG VVP  DN++ ALN+A
Sbjct  125   VDAIFDSVSVATTFKEKLAKDGVIFCSISEALQEHPELIKKYLGSVVPIADNYFAALNAA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHIGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S N YRGLV++  +A  ARN SQCDSMLIG+NA ANT+PYIQ +N + ++EHEA+TSKI
Sbjct  365   QSSNSYRGLVKINPTAKGARNYSQCDSMLIGDNAHANTFPYIQVQNNTGKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLF+F QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFFFAQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_006194430.1| cysteine desulfurase activator complex subunit SufB [Nodularia 
spumigena]
 gb|EAW47210.1| hypothetical protein N9414_05135 [Nodularia spumigena CCY9414]
Length=479

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/474 (69%), Positives = 398/474 (84%), Gaps = 1/474 (0%)
 Frame = -3

Query  1783  QKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEP  1604
             +  + + YK+GF  +I++ T+P+GL+E+ +RLIS++KNEP +ML+FRL+ Y +++ M EP
Sbjct  6     KTLVNQPYKYGFITDIEADTIPRGLNEDVVRLISAKKNEPQFMLDFRLRCYRQWLKMTEP  65

Query  1603  KWSDNRYPEINFQDICYYSEPKKKPT-LNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
              W   +YP I++Q+I YYS PKKK   LNSLDE DP L++ FEKLG+ L+E+ RLANVAV
Sbjct  66    TWPSVKYPAIDYQNIIYYSAPKKKKAKLNSLDEVDPTLLETFEKLGISLSEQKRLANVAV  125

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT +  L + GVIFCSISEA++E+P+LVRKYLG VVP+ DN++ ALN AV
Sbjct  126   DAIFDSVSVATTFKDKLAEDGVIFCSISEALQEHPELVRKYLGSVVPAADNYFAALNGAV  185

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YDTN
Sbjct  186   FSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDTN  245

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE+G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  246   QLHAAVVELVALDNAEIKYSTVQNWYAGDEKGKGGIYNFVTKRGLCQGVNSKISWTQVET  305

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG+
Sbjct  306   GSAITWKYPSCVLLGDNSVGEFYSVALTNNMQQADTGTKMIHVGKNTRSTIISKGISAGN  365

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV+V  +A  ARN SQCDSMLIG+NA ANT+PYIQ +N ++++EHEA+TSKIG
Sbjct  366   SSNSYRGLVKVNPTAKGARNYSQCDSMLIGDNAHANTFPYIQVQNNASKVEHEASTSKIG  425

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+S+KLEGSVG
Sbjct  426   EDQLFYFAQRGISPEDAISMMISGFCKDVFNQLPMEFAVEADKLLSMKLEGSVG  479



>ref|WP_016876439.1| cysteine desulfurase activator complex subunit SufB [Chlorogloeopsis 
fritschii]
Length=478

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/474 (69%), Positives = 392/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF   I++ T+P+GL+E+ IR+IS++KNEP++MLEFRL++Y ++  M E
Sbjct  5     VKTLVNQPYKYGFVTNIEADTIPRGLNEDIIRMISAKKNEPEFMLEFRLRAYRQWQKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W   +YP I++Q+I YYS PK+K    SL+E DP L++ FEKLG+PL+E+ RLANVAV
Sbjct  65    PTWPSVKYPPIDYQNIIYYSAPKQKAKKQSLEEVDPTLLETFEKLGIPLSEQKRLANVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT ++ L K GVIFCSISEA++EYP+LV+KYLG VVP  DN++ ALNSAV
Sbjct  125   DAIFDSVSVATTFKEKLAKEGVIFCSISEALQEYPELVKKYLGSVVPVADNYFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK  +CPM++STYFRIN  ETGQFERTLIVA++ S+V YLEGCTAP YD+N
Sbjct  185   FSDGSFVYIPKGVKCPMELSTYFRINNGETGQFERTLIVAEEDSYVSYLEGCTAPMYDSN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVALDNAEIKYSTVQNWYAGDESGKGGIYNFVTKRGLCQGVNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKM+H GKNTRS IISKGISAG 
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMVHIGKNTRSTIISKGISAGK  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ +N + ++EHEA+TSKIG
Sbjct  365   SSNSYRGLVKIGPKAQKARNYSQCDSMLIGDNAHANTFPYIQVQNNTGKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A+  MISGFC+DVFN LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFAQRGISAEDAVKLMISGFCKDVFNHLPMEFAVEADKLLSLKLEGSVG  478



>ref|WP_011431003.1| cysteine desulfurase activator complex subunit SufB [Synechococcus 
sp. JA-3-3Ab]
 ref|YP_475593.1| cysteine desulfurase activator complex subunit SufB [Synechococcus 
sp. JA-3-3Ab]
 gb|ABD00330.1| FeS assembly protein SufB [Synechococcus sp. JA-3-3Ab]
Length=478

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/474 (69%), Positives = 397/474 (84%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I S ++ KGL+E+ IR I ++K EPD+MLEFRL++Y +++ M E
Sbjct  5     VRTLISQPYKYGFVTDIPSESIGKGLNEDIIRQIWAKKGEPDFMLEFRLRAYRQWLKMSE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W +  YP I++Q+I YYS PK +P   SLDE DP L++ FEKLG+PL+E+ RLANVAV
Sbjct  65    PTWPNVSYPPIDYQNIVYYSAPKVQPKKKSLDEVDPVLLETFEKLGIPLSEQKRLANVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT R+ L K G+IFCS+SEA+REYP+LVRKYLG VVP  DN+Y ALNSAV
Sbjct  125   DAIFDSVSVATTFREKLAKEGIIFCSMSEALREYPELVRKYLGSVVPIADNYYAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVYVPK  RCPM++STYFRIN  E+GQFERTLI+AD+ S+V YLEGCTAP +DTN
Sbjct  185   FSDGSFVYVPKGVRCPMELSTYFRINNGESGQFERTLIIADEGSYVSYLEGCTAPMFDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G+ SKISWTQVET
Sbjct  245   QLHAAVVELIALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCQGANSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL G+ SVGEFYSVALTNNYQQADTGTKMIH G+NTRS+IISKGISAGH
Sbjct  305   GSAITWKYPSCVLVGENSVGEFYSVALTNNYQQADTGTKMIHVGRNTRSKIISKGISAGH  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   A+ ARN SQCDSMLIG+  +ANT+PYI+ +N +A++EHEA+TSKIG
Sbjct  365   SKNSYRGLVKIGPKAEGARNFSQCDSMLIGDQCSANTFPYIEVQNNTAKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             E+QLFYFQ RGI  E A++ +ISGFCR+VFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   EEQLFYFQSRGIGMEDAVSMIISGFCREVFNQLPMEFAVEADRLLSLKLEGSVG  478



>ref|WP_015169618.1| FeS assembly protein SufB [Synechococcus sp. PCC 7502]
 ref|YP_007107102.1| FeS assembly protein SufB [Synechococcus sp. PCC 7502]
 gb|AFY74967.1| FeS assembly protein SufB [Synechococcus sp. PCC 7502]
Length=478

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/474 (68%), Positives = 398/474 (84%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +Q  + + YK+GF   I+S T+P+GLSEE +R+IS++KNEP++MLEFRL++Y +++ M E
Sbjct  5     VQALVNQPYKYGFVTPIESDTIPRGLSEEVVRMISAKKNEPEFMLEFRLRAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             PKW++  +P+IN+QDI YYS PK+     SLDE DPEL+  FEKLG+P++E+ RL+NVAV
Sbjct  65    PKWANVDFPKINYQDIVYYSAPKQSKKKLSLDEVDPELLDTFEKLGIPISEQKRLSNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVSIATT RK L K GVIFCSISEA+ +YP+LV+KY+G VVP  DN+Y ALNSAV
Sbjct  125   DAIFDSVSIATTFRKDLAKVGVIFCSISEALHDYPELVKKYMGSVVPIADNYYAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             F+DGSF Y+PK  RCPM +STYFRIN  ++GQFERTLIVA++ S+V YLEGCTAP++DTN
Sbjct  185   FTDGSFCYIPKGVRCPMDLSTYFRINNGDSGQFERTLIVAEEGSYVSYLEGCTAPAFDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGD+EG+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVAMDNAEIKYSTVQNWYAGDKEGKGGIYNFVTKRGLCQGVNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GS+ITWKYPS VL GD SVGEFYSVALTNN QQADTGTKM+H GKNTRS+IISKGISAG 
Sbjct  305   GSSITWKYPSCVLVGDNSVGEFYSVALTNNKQQADTGTKMVHIGKNTRSKIISKGISAGK  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV+V   A  ARN SQCDSMLIG+++ ANT+PYI+ +N +A++EHEA+TSKIG
Sbjct  365   SQNSYRGLVKVSPKAVGARNYSQCDSMLIGSDSQANTFPYIEVQNSTAKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             E+QLFYF QRGI  E A++ +ISGFC+DVFN LP EF  E ++L++LKLEGSVG
Sbjct  425   EEQLFYFAQRGIAPEDAVSMIISGFCKDVFNALPMEFAVEADKLLALKLEGSVG  478



>ref|WP_015223946.1| iron-regulated ABC transporter membrane component SufB [Cyanobacterium 
stanieri]
 ref|YP_007166281.1| iron-regulated ABC transporter membrane component SufB [Cyanobacterium 
stanieri PCC 7202]
 gb|AFZ48632.1| Iron-regulated ABC transporter membrane component SufB [Cyanobacterium 
stanieri PCC 7202]
Length=480

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/476 (68%), Positives = 402/476 (84%), Gaps = 2/476 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S ++PKGLSE+ +RLIS++KNEP++MLEFRLK+Y +++ M E
Sbjct  5     VKTLVNQPYKYGFITDIESDSIPKGLSEDVVRLISAKKNEPEFMLEFRLKAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKK--KPTLNSLDEADPELIKYFEKLGVPLNERNRLANV  1433
             P+W+   YP+IN+QDI YYS PKK  K  L SLD+ DP L++ FEKLG+PL+E+ RL+NV
Sbjct  65    PQWAHVGYPKINYQDIIYYSAPKKQGKEKLKSLDDVDPTLLETFEKLGIPLSEQKRLSNV  124

Query  1432  AVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNS  1253
             AVDA+ DSVSI TT ++ L + GVIFCSISEA++E+PDLV+KYLG VVP  DNF+ ALNS
Sbjct  125   AVDAIFDSVSIGTTFKEKLAEEGVIFCSISEALQEHPDLVQKYLGTVVPVADNFFSALNS  184

Query  1252  AVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYD  1073
             AVFSDGSFV++PK  +CPM++STYFRIN+ +TGQFERTLIVA++ + V YLEGCTAP YD
Sbjct  185   AVFSDGSFVFIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGASVSYLEGCTAPMYD  244

Query  1072  TNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQV  893
             +NQLHAAVVEL   + A+IKYSTVQNW+AGDE+G+GGI+NFVTKRGLC G  SKISWTQV
Sbjct  245   SNQLHAAVVELVALDNADIKYSTVQNWFAGDEKGKGGIYNFVTKRGLCKGVNSKISWTQV  304

Query  892   ETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISA  713
             ETGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKM+H GKNTRS IISKGISA
Sbjct  305   ETGSAITWKYPSCVLVGDNSVGEFYSIALTNNMQQADTGTKMVHIGKNTRSTIISKGISA  364

Query  712   GHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSK  533
             G+S+N YRGLV++ + A  ARN SQCDSMLIG+NA ANT+PYIQ  N +A++EHEA+TSK
Sbjct  365   GNSKNSYRGLVKMGNKATGARNYSQCDSMLIGDNAEANTFPYIQVDNNTAKLEHEASTSK  424

Query  532   IGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             IGEDQLFYF QRGI  E A++ ++SGFC+DV NELP EF AE ++L+SLKLEG+VG
Sbjct  425   IGEDQLFYFAQRGISEEDAISMLVSGFCKDVLNELPMEFAAEADKLLSLKLEGTVG  480



>ref|WP_015211234.1| Iron-regulated ABC transporter membrane component SufB [Cylindrospermum 
stagnale]
 ref|YP_007150681.1| Iron-regulated ABC transporter membrane component SufB [Cylindrospermum 
stagnale PCC 7417]
 gb|AFZ28001.1| Iron-regulated ABC transporter membrane component SufB [Cylindrospermum 
stagnale PCC 7417]
Length=479

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/475 (68%), Positives = 397/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +   + + YK+GF  +I++ T+P+GL+E+ IR+IS++KNEP++MLEFRL++Y +++ M E
Sbjct  5     VNTLVNQPYKYGFVTDIEADTIPRGLNEDVIRVISAKKNEPEFMLEFRLRAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W   +YP I++Q+I YYS PK KK  LNSL+E DP L++ FEKLG+P+ E+ RLANVA
Sbjct  65    PTWPSVKYPAIDYQNIVYYSAPKQKKQKLNSLEEVDPTLLETFEKLGIPITEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT +  L K GVIFCSISEA++E+P+L++KYLG VVP  DN++ ALN+A
Sbjct  125   VDAIFDSVSIATTFKDKLAKDGVIFCSISEALQEHPELIKKYLGSVVPIADNYFAALNAA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDVNGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKM+H GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMVHIGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S N YRGLV+V  +A  ARN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  365   KSSNSYRGLVKVNPTAKGARNYSQCDSMLIGDNAHANTFPYIQVQNHTAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFAQRGISPEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_028089116.1| cysteine desulfurase [Dolichospermum circinale]
Length=479

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/472 (69%), Positives = 395/472 (84%), Gaps = 1/472 (0%)
 Frame = -3

Query  1777  FLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKW  1598
              + + YK+GF  +I++ T+P+GLSE+ +RLIS++KNEP++MLE+RL++Y +++ M EP W
Sbjct  8     LVNQPYKYGFVTDIEADTIPRGLSEDVVRLISAKKNEPEFMLEYRLRAYHQWLKMTEPTW  67

Query  1597  SDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAVDA  1421
                +YP IN+QDI YYS PK KK  LNSLDE DP L++ FEKLG+ L+E+ RLANVAVDA
Sbjct  68    PHVKYPPINYQDIIYYSAPKQKKAKLNSLDEVDPTLLETFEKLGISLSEQKRLANVAVDA  127

Query  1420  VLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFS  1241
             + DSVS+ATT ++ L + GVIFCSISEA++E+P+L++KYLG VVP  DN++ ALN+AVFS
Sbjct  128   IFDSVSVATTFKEKLAEDGVIFCSISEALQEHPELIKKYLGSVVPIADNYFAALNAAVFS  187

Query  1240  DGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQL  1061
             DGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA+  S+V YLEGCTAP YD+NQL
Sbjct  188   DGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEADSYVSYLEGCTAPMYDSNQL  247

Query  1060  HAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVETGS  881
             HAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVETGS
Sbjct  248   HAAVVELVALDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRGLCQGVNSKISWTQVETGS  307

Query  880   AITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGHSR  701
             AITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG S 
Sbjct  308   AITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHVGKNTRSTIISKGISAGKSS  367

Query  700   NCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIGED  521
             N YRGLV++  +A  ARN SQCDSMLIG+NA ANT+PYIQ +N + ++EHEA+TSKIGED
Sbjct  368   NSYRGLVKINPTAKGARNYSQCDSMLIGDNAQANTFPYIQVQNNTGKVEHEASTSKIGED  427

Query  520   QLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             QLF+F QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  428   QLFFFAQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_012307425.1| MULTISPECIES: cysteine desulfurase activator complex subunit 
SufB [Synechococcus]
 ref|YP_001735058.1| cysteine desulfurase activator complex subunit SufB [Synechococcus 
sp. PCC 7002]
 gb|AAQ82447.1| SufB [Synechococcus sp. PCC 7002]
 gb|ACA99802.1| FeS assembly protein SufB [Synechococcus sp. PCC 7002]
Length=479

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/475 (68%), Positives = 401/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++  +P+GLSE+ +RLIS++KNEPD+MLEFRLK+Y +++ M E
Sbjct  5     VKTLVNQPYKYGFVTDIETEKIPRGLSEDVVRLISAKKNEPDFMLEFRLKAYHQWLKMAE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPT-LNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P+W+  +YP I++QDI YY+ PKK+   + SLDE DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  65    PEWAHVKYPPIDYQDIVYYAAPKKETKKIESLDEIDPALLETFEKLGIPLSEQKRLSNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDAV DSVSIATT +K L K GVIFCSISEA++EYPDLV+KYLG VVP+ DN++ ALNSA
Sbjct  125   VDAVFDSVSIATTFKKDLAKHGVIFCSISEALQEYPDLVKKYLGTVVPTSDNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK  +CPM++STYFRIN  ETGQFERTLI+A++ + V YLEGCTAP +DT
Sbjct  185   VFSDGSFVFIPKGVKCPMELSTYFRINDGETGQFERTLIIAEEGASVSYLEGCTAPMFDT  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNW+AGDEEG+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNADIKYSTVQNWFAGDEEGKGGIYNFVTKRGLCKGINSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN+QQADTGTKMIH GKN+RS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLLGDNSVGEFYSIALTNNHQQADTGTKMIHIGKNSRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S+N YRGLV++   AD ARN SQCDSMLIG+ A ANT+PYIQ  N +A++EHEA+T+KI
Sbjct  365   KSKNSYRGLVKMHPKADGARNYSQCDSMLIGDTAEANTFPYIQVDNQNAKVEHEASTAKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GE+QLFYF QRGI  E A++ ++SGFC+DV +ELP EF AE ++L+SLKLEG+VG
Sbjct  425   GEEQLFYFAQRGIAEEDAISMLVSGFCKDVLSELPMEFAAEADKLLSLKLEGTVG  479



>gb|KDD76926.1| UPF0051 hypothetical protein [Helicosporidium sp. ATCC 50920]
Length=469

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/470 (70%), Positives = 387/470 (82%), Gaps = 1/470 (0%)
 Frame = -3

Query  1774  LKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKWS  1595
             + + YK+GF  EI+S   PKGLSE+ +R IS++K EP+WML+FRLK+Y R++ M+EP WS
Sbjct  1     MSKPYKYGFQTEIESDVFPKGLSEDVVRAISAKKEEPEWMLDFRLKAYRRWLTMEEPCWS  60

Query  1594  DNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAVDAVL  1415
             D R+P I++Q   YYS PK  P   SLDE DP L+  F+KLG+PL E+ RLANVAVDAV 
Sbjct  61    DVRFPPIDYQSFTYYSAPKHIPKKASLDEVDPALLATFDKLGIPLVEQKRLANVAVDAVF  120

Query  1414  DSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFSDG  1235
             DSVSIATT R+ L K+GV+FCSISEA+R+ PDLVR++LG VVP  DN++ ALNSAVFSDG
Sbjct  121   DSVSIATTFREELAKAGVLFCSISEAVRDCPDLVRRHLGSVVPPGDNYFAALNSAVFSDG  180

Query  1234  SFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQLHA  1055
             SFVYVP    CPM++STYFRIN   +GQFERTLIV ++ + V YLEGCTAP++DTNQLHA
Sbjct  181   SFVYVPSGVSCPMELSTYFRINTANSGQFERTLIVVEEGASVSYLEGCTAPAFDTNQLHA  240

Query  1054  AVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVETGSAI  875
             AVVEL     A IKYSTVQNWYAGDE+GRGGI+NFVTKRGL AG R+KISWTQVETGSAI
Sbjct  241   AVVELSAGADATIKYSTVQNWYAGDEQGRGGIYNFVTKRGL-AGDRAKISWTQVETGSAI  299

Query  874   TWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGHSRNC  695
             TWKYPSVVL+G+ SVGEFYSVALTN  QQADTGTKM+H G+N+RSRI+SKGI AG S N 
Sbjct  300   TWKYPSVVLKGEASVGEFYSVALTNGQQQADTGTKMVHLGRNSRSRIVSKGICAGASTNA  359

Query  694   YRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIGEDQL  515
             YRGLV V  +A +AR+ SQCDSMLIG+ A ANTYPYI  +N SA +EHEA+TSKIGEDQL
Sbjct  360   YRGLVSVAPAAGSARSHSQCDSMLIGDRAHANTYPYIAVRNASATVEHEASTSKIGEDQL  419

Query  514   FYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             FYFQQRG+D E+A+A +ISGFC DVF ELP EF AEVNQLMSLKLEGSVG
Sbjct  420   FYFQQRGVDAEQAVAMIISGFCSDVFKELPLEFAAEVNQLMSLKLEGSVG  469



>ref|WP_012593789.1| cysteine desulfurase activator complex subunit SufB [Cyanothece 
sp. PCC 8801]
 ref|YP_002370668.1| cysteine desulfurase [Cyanothece sp. PCC 8801]
 gb|ACK64512.1| FeS assembly protein SufB [Cyanothece sp. PCC 8801]
Length=480

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/475 (68%), Positives = 397/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+E+ IRLIS++KNEPD+ML FRL++Y+++  M E
Sbjct  6     VKTLVNQPYKYGFVTDIETDTIPRGLNEDIIRLISAKKNEPDFMLAFRLRAYQQWQKMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q+I YYS PK KK  L SLDE DP L++ FEKLG+PL+E+ RL NVA
Sbjct  66    PTWPHVTYPPIDYQNIIYYSAPKQKKEKLGSLDEVDPTLLETFEKLGIPLSEQKRLGNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L +SGVIFCSISEA++E+P+LV+KYLG VVP  DNF+ ALNSA
Sbjct  126   VDAIFDSVSIATTFKEKLAESGVIFCSISEALQEHPELVKKYLGTVVPVADNFFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK  +CPM++STYFRIN+ +TGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  186   VFSDGSFVFIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGASVSYLEGCTAPMYDS  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAA+VEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAIVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGKNTRSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S+N YRGLV++   AD ARN SQCDSMLIG+NA ANT+PYIQ  N +A++EHEA+TSKI
Sbjct  366   GSKNSYRGLVKIGPKADGARNYSQCDSMLIGDNAQANTFPYIQVDNNTAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV NELP EF AE ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGISEEDAVSMLVSGFCKDVLNELPMEFAAEADKLLSLKLEGTVG  480



>ref|WP_015213829.1| Iron-regulated ABC transporter membrane component SufB [Anabaena 
cylindrica]
 ref|YP_007156090.1| Iron-regulated ABC transporter membrane component SufB [Anabaena 
cylindrica PCC 7122]
 gb|AFZ57180.1| Iron-regulated ABC transporter membrane component SufB [Anabaena 
cylindrica PCC 7122]
Length=479

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/475 (68%), Positives = 397/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+E+ IRLIS++KNEP++MLEFRL++Y +++ M E
Sbjct  5     VKTLVNQPYKYGFVTDIEADTIPRGLNEDVIRLISAKKNEPEFMLEFRLRAYHQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP IN+QDI YYS PK KK  LNSLDE DP L++ FEKLG+ L+E+ RL+NVA
Sbjct  65    PTWPSVNYPPINYQDIIYYSAPKQKKAKLNSLDEVDPTLLETFEKLGISLSEQKRLSNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L + GVIFCS SEA++E+P+L++KYLG VVP  DN++ ALN+A
Sbjct  125   VDAIFDSVSVATTFKEKLAEDGVIFCSFSEALQEHPELIKKYLGSVVPIADNYFAALNAA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTN+ QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNHMQQADTGTKMIHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S N YRGLV++  +A  ARN SQCDSMLIG+NA ANT+PYIQ +N + ++EHEA+TSKI
Sbjct  365   KSSNSYRGLVKINPTAKGARNYSQCDSMLIGDNAHANTFPYIQVQNNTGKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLF+F QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFFFAQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_017309174.1| cysteine desulfurase activator complex subunit SufB [Fischerella 
sp. PCC 9339]
Length=478

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/474 (68%), Positives = 394/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF   I++ T+P+GL+E+ +R+IS++KNEP++MLEFRL++Y ++  M E
Sbjct  5     VKTLVNQPYKYGFITNIEADTIPRGLNEDIVRMISAKKNEPEFMLEFRLRAYRQWQKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W   +YP I++Q+I YYS PK++    SL+E DP L++ FEKLG+PL+E+ RLANVAV
Sbjct  65    PTWPSVKYPPIDYQNIIYYSAPKQQAKKKSLEEVDPTLLETFEKLGIPLSEQKRLANVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT ++ L K GVIFCSISEA++E+P+LV+KYLG VVP  DN++ ALNSAV
Sbjct  125   DAIFDSVSVATTFKEKLAKEGVIFCSISEALQEHPELVKKYLGSVVPIADNYFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK  +CPM++STYFRIN  +TGQFERTLIVA+D S+V YLEGCTAP YD+N
Sbjct  185   FSDGSFVYIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEDDSYVSYLEGCTAPMYDSN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE+G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVALDNAEIKYSTVQNWYAGDEKGKGGIYNFVTKRGLCQGVNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG+
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHIGKNTRSTIISKGISAGN  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ +N + ++EHEA+TSKIG
Sbjct  365   SSNSYRGLVKINPKAQGARNYSQCDSMLIGDNAHANTFPYIQVQNNTGKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A+  MISGFC+DVFN LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFAQRGISAEDAVTMMISGFCKDVFNNLPMEFAVEADKLLSLKLEGSVG  478



>ref|WP_016868020.1| cysteine desulfurase activator complex subunit SufB [Fischerella 
muscicola]
Length=478

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/474 (68%), Positives = 394/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF   I++ T+P+GL+E+ IR+IS++KNEP++MLEFRL++Y ++  M E
Sbjct  5     VKTLVNQPYKYGFVTNIEADTIPRGLNEDIIRMISAKKNEPEFMLEFRLRAYRQWQKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W   +YP I++Q+I YYS PK++    SL+E DP L++ FEKLG+PL+E+ RLANVAV
Sbjct  65    PTWPSVKYPPIDYQNIIYYSAPKQQAKKKSLEELDPTLLETFEKLGIPLSEQKRLANVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT ++ L K GVIFCSISEA++E+P+LV+KYLG VVP  DN++ ALNSAV
Sbjct  125   DAIFDSVSVATTFKEKLAKEGVIFCSISEALQEHPELVKKYLGSVVPIADNYFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK  +CPM++STYFRIN  +TGQFERTLIVA++ S+V YLEGCTAP YD+N
Sbjct  185   FSDGSFVYIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEEDSYVSYLEGCTAPMYDSN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE+GRGGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVALDNAEIKYSTVQNWYAGDEKGRGGIYNFVTKRGLCQGVNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG+
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHIGKNTRSTIISKGISAGN  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ +N + ++EHEA+TSKIG
Sbjct  365   SSNSYRGLVKINPKAQGARNYSQCDSMLIGDNAHANTFPYIQVQNNTGKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A+  MISGFC+DVFN LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFAQRGISTEDALKMMISGFCKDVFNNLPMEFAVEADKLLSLKLEGSVG  478



>ref|WP_007307555.1| cysteine desulfurase activator complex subunit SufB [Crocosphaera 
watsonii]
 gb|EAM48668.1| FeS assembly protein SufB [Crocosphaera watsonii WH 8501]
 gb|EHJ10451.1| Iron-sulfur cluster assembly protein SufB [Crocosphaera watsonii 
WH 0003]
 emb|CCQ61728.1| Iron-sulfur cluster assembly protein SufB [Crocosphaera watsonii 
WH 0401]
 emb|CCQ50232.1| Iron-sulfur cluster assembly protein SufB [Crocosphaera watsonii 
WH 8502]
 emb|CCQ55993.1| Iron-sulfur cluster assembly protein SufB [Crocosphaera watsonii 
WH 0005]
Length=480

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/475 (68%), Positives = 399/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GLSE+ IRLIS++KNEP++MLEFRLK+Y++++ M E
Sbjct  6     VKNLVNQPYKYGFVTDIETETIPRGLSEDVIRLISAKKNEPEFMLEFRLKAYKQWLKMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP+I++Q+I YYS PK KK  L SLD+ DP LI+ FEKLG+PL+E+ RL+NVA
Sbjct  66    PTWPHVHYPKIDYQNIIYYSAPKQKKEKLKSLDDVDPTLIETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L + GVIFCSISEA+ E+P+LVRKYLG VVP  DNF+ ALNSA
Sbjct  126   VDAIFDSVSVATTFKEKLAEDGVIFCSISEALEEHPELVRKYLGSVVPVADNFFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSF+++PK  +CPM++STYFRIN  +TGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  186   VFSDGSFIFIPKGVKCPMELSTYFRINTGDTGQFERTLIVAEEGASVSYLEGCTAPMYDS  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGDE+G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVALDNADIKYSTVQNWYAGDEKGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  306   TGSAITWKYPSCVLAGDNSVGEFYSIALTNNMQQADTGTKMIHLGKNTRSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLVQ+   A  ARN SQCDSMLIG+NA ANT+PYIQ  N +A++EHEA+TSKI
Sbjct  366   NSKNSYRGLVQMGPRAKGARNYSQCDSMLIGDNAEANTFPYIQVDNNTAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV +ELP EF +E ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGISEEDAVSMLVSGFCKDVLSELPMEFASEADKLLSLKLEGTVG  480



>ref|WP_015220402.1| iron-regulated ABC transporter membrane component SufB [Cyanobacterium 
aponinum]
 ref|YP_007162723.1| iron-regulated ABC transporter membrane component SufB [Cyanobacterium 
aponinum PCC 10605]
 gb|AFZ54679.1| Iron-regulated ABC transporter membrane component SufB [Cyanobacterium 
aponinum PCC 10605]
Length=479

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/475 (68%), Positives = 398/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+ KGL+E+ IRLIS++KNEP++MLEFRLK+Y +++ M E
Sbjct  5     VKNLVNQPYKYGFITDIESDTIAKGLNEDVIRLISAKKNEPEFMLEFRLKAYRQWLQMNE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             PKW+   YP I++Q+I YY  PK+ K  LNSLDE DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  65    PKWAHVGYPAIDYQNIIYYCAPKQQKKKLNSLDEVDPTLLETFEKLGIPLSEQKRLSNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L + GVIFCSISEA+ E+P+LV+KYLG VVP+ DN++ ALNSA
Sbjct  125   VDAIFDSVSIATTFKEKLAEVGVIFCSISEALHEHPELVQKYLGTVVPTADNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK  +CPM++STYFRIN  ETGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  185   VFSDGSFVFIPKGVKCPMELSTYFRINNGETGQFERTLIVAEEGASVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNW+AGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWFAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKM+H GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNMQQADTGTKMVHIGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S+N YRGLV++ + A  ARN SQCDSMLIG+NA ANT+PYIQ  N +A++EHEA+TSKI
Sbjct  365   KSKNSYRGLVKMGNKATGARNYSQCDSMLIGDNAEANTFPYIQVDNNTAKLEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV NELP EF AE ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFAQRGISEEDAISMLVSGFCKDVLNELPMEFAAEADKLLSLKLEGSVG  479



>ref|WP_012796795.1| cysteine desulfurase activator complex subunit SufB [Cyanothece 
sp. PCC 8802]
 ref|YP_003136220.1| cysteine desulfurase activator complex subunit SufB [Cyanothece 
sp. PCC 8802]
 gb|ACU99384.1| FeS assembly protein SufB [Cyanothece sp. PCC 8802]
Length=480

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/475 (68%), Positives = 397/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+E+ IRLIS++KNEPD+ML FRL++Y+++  M E
Sbjct  6     VKTLVNQPYKYGFVTDIETDTIPRGLNEDIIRLISAKKNEPDFMLAFRLRAYQQWQKMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q++ YYS PK KK  L SLDE DP L++ FEKLG+PL+E+ RL NVA
Sbjct  66    PTWPHVTYPPIDYQNMIYYSAPKQKKEKLGSLDEVDPTLLETFEKLGIPLSEQKRLGNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L +SGVIFCSISEA++E+P+LV+KYLG VVP  DNF+ ALNSA
Sbjct  126   VDAIFDSVSIATTFKEKLAESGVIFCSISEALQEHPELVKKYLGTVVPVADNFFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK  +CPM++STYFRIN+ +TGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  186   VFSDGSFVFIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGASVSYLEGCTAPMYDS  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAA+VEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAIVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGKNTRSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S+N YRGLV++   AD ARN SQCDSMLIG+NA ANT+PYIQ  N +A++EHEA+TSKI
Sbjct  366   GSKNSYRGLVKIGPKADGARNYSQCDSMLIGDNAQANTFPYIQVDNNTAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV NELP EF AE ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGISEEDAVSMLVSGFCKDVLNELPMEFAAEADKLLSLKLEGTVG  480



>ref|WP_012411125.1| cysteine desulfurase activator complex subunit SufB [Nostoc punctiforme]
 ref|YP_001868112.1| cysteine desulfurase activator complex subunit SufB [Nostoc punctiforme 
PCC 73102]
 gb|ACC83169.1| FeS assembly protein SufB [Nostoc punctiforme PCC 73102]
Length=479

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/475 (68%), Positives = 397/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL E+ IRLISS+KNEP +ML+FRL++Y ++  M E
Sbjct  5     VKTLVNQPYKYGFVTDIEADTIPRGLDEDVIRLISSKKNEPQFMLDFRLRAYRQWQKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W + +YP IN+QDI YYS PK KK  LNSLDE DP L++ FEKLG+ L+E+ RLANVA
Sbjct  65    PTWPNVKYPPINYQDIIYYSAPKRKKEKLNSLDEVDPTLLETFEKLGISLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L + GVIFCS SEA++E+P+L++KYLG VVP  DN++ ALN+A
Sbjct  125   VDAIFDSVSVATTFKEKLAEDGVIFCSFSEALQEHPELIKKYLGSVVPIADNYFAALNAA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLIVA++ S+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTN+ QQADTG+KMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNHQQQADTGSKMIHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S N YRGLV+V  +A+ ARN SQCDSMLIG+NA ANT+PYIQ +N  A++EHEA+TSKI
Sbjct  365   NSSNSYRGLVKVNPTANGARNYSQCDSMLIGDNAHANTFPYIQVQNNGAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFYFAQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|NP_043219.1| putative ABC transporter [Cyanophora paradoxa]
 sp|P48260.1|YCF24_CYAPA RecName: Full=UPF0051 protein ycf24 [Cyanophora paradoxa]
 gb|AAA81250.1| ABC transporter subunit [Cyanophora paradoxa]
Length=486

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/483 (67%), Positives = 400/483 (83%), Gaps = 1/483 (0%)
 Frame = -3

Query  1810  STSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSY  1631
             + S ++  L+  + + YK+G     +  T+ KGL+EETIRLIS +KNEP +MLEFRL++Y
Sbjct  4     TQSPKNSGLENLVNQPYKYGLPLIFEIETISKGLTEETIRLISEKKNEPQFMLEFRLQAY  63

Query  1630  ERFMNM-KEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNE  1454
              +++ M  EP+W+   YP+IN+QD+ YYS PK+K  L SLDE DP L++ FEKLG+PL E
Sbjct  64    RKWLEMSNEPEWAHLNYPKINYQDMVYYSAPKQKKKLQSLDEVDPTLLETFEKLGIPLTE  123

Query  1453  RNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDN  1274
             + RLANVAVDA+ DSVS+ATT ++ L K GVIFC ISEA+++YPDL++KYLG VV + DN
Sbjct  124   QKRLANVAVDAIFDSVSVATTFKEELAKEGVIFCPISEAVQKYPDLIKKYLGSVVSTSDN  183

Query  1273  FYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEG  1094
             ++  LN+AVFSDGSF Y+PKN RCP+++STYFRIN  E+GQFERTLIVAD+ S+V YLEG
Sbjct  184   YFSCLNAAVFSDGSFCYIPKNVRCPLELSTYFRINNGESGQFERTLIVADEGSYVSYLEG  243

Query  1093  CTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRS  914
             CTAP +DTNQLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLCAG  S
Sbjct  244   CTAPQFDTNQLHAAVVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCAGKNS  303

Query  913   KISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRI  734
             KISWTQVETGSAITWKYPS VL GD S+GEFYSVALTN YQQADTGTKMIH GKNTRSRI
Sbjct  304   KISWTQVETGSAITWKYPSCVLLGDNSIGEFYSVALTNRYQQADTGTKMIHIGKNTRSRI  363

Query  733   ISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIE  554
             ISKGISAGHS+N YRGLV++   A  ARN SQCDS+LIG+N+ ANT+P++Q KNP+A++E
Sbjct  364   ISKGISAGHSQNSYRGLVKIGPKAVGARNYSQCDSLLIGDNSQANTFPHLQIKNPTAKVE  423

Query  553   HEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEG  374
             HEA+TSKIGE+Q+FYF QRGI+ E+A++ +ISGFCR+VFN LP EF  E ++L+ LKLEG
Sbjct  424   HEASTSKIGEEQIFYFLQRGINAEEAISLIISGFCREVFNNLPMEFALEADKLLGLKLEG  483

Query  373   SVG  365
             SVG
Sbjct  484   SVG  486



>ref|WP_028836742.1| cysteine desulfurase [Proteobacteria bacterium JGI 0000113-L05]
Length=481

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/474 (69%), Positives = 404/474 (85%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             L+K + + YK+GF  EI++ T+  GLSEET+RLISS+KNEP +ML+FRLK+++++  MKE
Sbjct  8     LEKLVNQPYKYGFATEIETDTIKIGLSEETVRLISSKKNEPSFMLDFRLKAFKKWQKMKE  67

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P+W+   Y   N+Q+I YYS PKKK  L+SLDE DPELI+ FEKLG+ LNE+ R++NVAV
Sbjct  68    PEWAYLNYVPTNYQNIRYYSAPKKKKKLDSLDEVDPELIEAFEKLGISLNEQKRISNVAV  127

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVSI TT +  L K+GVIFCSISEAI+ YP+L++ YLGRVVP  DNF+ ALNSAV
Sbjct  128   DAVFDSVSIGTTFKDELAKAGVIFCSISEAIQLYPNLIKTYLGRVVPVGDNFFAALNSAV  187

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             F+DGSF Y+PKN +CP+++STYFRIN  E+GQFERTLI+A+++S+V YLEGCTAP YD+N
Sbjct  188   FTDGSFCYIPKNVKCPLELSTYFRINDEESGQFERTLIIAEENSYVSYLEGCTAPKYDSN  247

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAA+VEL   E AEIKYSTVQNWYAG+E+G+GGI+NFVTKRGLCAG  SKISWTQVET
Sbjct  248   QLHAAIVELISLESAEIKYSTVQNWYAGNEDGKGGIYNFVTKRGLCAGKDSKISWTQVET  307

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS +L G+ S GEFYSVALTNNYQQADTGTKM+H GKNTRSRI+SKGISAG 
Sbjct  308   GSAITWKYPSCILTGENSTGEFYSVALTNNYQQADTGTKMLHIGKNTRSRIVSKGISAGS  367

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             SRN YRGLV++  +A  ARN SQCDS+L+GNN++ANT+PYIQ +N +A+IEHEA+TSKIG
Sbjct  368   SRNSYRGLVKIGPNAFGARNYSQCDSLLLGNNSSANTFPYIQVQNSTAKIEHEASTSKIG  427

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             E+Q+FYF QRGID E A++ +ISGFCR+VF+ELP EF  E ++L++LKLEG+VG
Sbjct  428   EEQIFYFLQRGIDLESAVSLIISGFCREVFSELPMEFALEADRLLNLKLEGTVG  481



>ref|WP_010480924.1| cysteine desulfurase activator complex subunit SufB [Acaryochloris 
sp. CCMEE 5410]
Length=478

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/474 (69%), Positives = 392/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+  T+PKGLSE+ IRLIS++K EP +MLEFRLK+Y +++ MKE
Sbjct  5     VENLVNQPYKYGFVTDIEVETIPKGLSEDVIRLISAKKEEPAFMLEFRLKAYRQWLKMKE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W    YP I++QDI YYS PK++    SLD+ DP L++ F+KLG+PL+E+ RL+NVAV
Sbjct  65    PTWPHVNYPAIDYQDITYYSAPKEQEKKKSLDDVDPALLETFDKLGIPLSEQKRLSNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVS+ATT R+ L K GVIFCSISEA++++PDLV KYLG VVP  DNF+ ALNSAV
Sbjct  125   DAVFDSVSVATTFREQLAKEGVIFCSISEALKDFPDLVEKYLGSVVPINDNFFSALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK  +CPM++STYFRIN    GQFERTLI+A++ S V YLEGCTAP +DTN
Sbjct  185   FSDGSFVYIPKGVKCPMELSTYFRINTEGAGQFERTLIIAEEGSQVSYLEGCTAPMFDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + A+IKYSTVQNWYAGDE G+GGI+NFVTKRGLCAG  SKISWTQVET
Sbjct  245   QLHAAVVELVALDDADIKYSTVQNWYAGDENGKGGIYNFVTKRGLCAGKNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG 
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNKQQADTGTKMIHVGKNTRSTIISKGISAGR  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   AD +RN SQCDSMLIG++A ANT+PYIQ +N + ++EHEA+TSKIG
Sbjct  365   SQNSYRGLVRMGPKADGSRNYSQCDSMLIGSDAEANTFPYIQVQNNNTKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFAQRGISVEDAVSMMISGFCQDVFNQLPMEFAVEADRLLSLKLEGSVG  478



>ref|WP_024546352.1| cysteine desulfurase [Synechococcus sp. NKBG15041c]
Length=479

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/475 (68%), Positives = 398/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++  +P+GLSE+ +RLIS++KNEP++MLEFRLK+Y++++ M E
Sbjct  5     VKTLVNQPYKYGFVTDIETEKIPRGLSEDVVRLISAKKNEPEFMLEFRLKAYQQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W+   YP I++QDI YYS PKK K  + SLDE DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  65    PTWAHVNYPAIDYQDIVYYSAPKKDKQKIESLDEIDPALLETFEKLGIPLSEQKRLSNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDAV DSVSIATT +K L K GVIFCSISEA+ E+P+LV+KYLG VVP+ DN++ ALNSA
Sbjct  125   VDAVFDSVSIATTFKKDLAKHGVIFCSISEAVHEHPELVKKYLGTVVPTSDNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK  +CPM++STYFRIN  +TGQFERTLI+A++S+ V YLEGCTAP +DT
Sbjct  185   VFSDGSFVFIPKGVKCPMELSTYFRINDGDTGQFERTLIIAEESASVSYLEGCTAPMFDT  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNW+AGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNADIKYSTVQNWFAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLLGDNSVGEFYSIALTNNLQQADTGTKMIHIGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S+N YRGLV++   AD ARN SQCDSMLIG+ A ANT+PYIQ  N +A++EHEA+T+KI
Sbjct  365   KSKNSYRGLVKMHPKADGARNYSQCDSMLIGDTAEANTFPYIQVDNQNAKVEHEASTAKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GE+QLFYF QRGI  E A++ ++SGFC+DV +ELP EF AE ++L+SLKLEG+VG
Sbjct  425   GEEQLFYFAQRGISEEDAISMLVSGFCKDVLSELPMEFAAEADKLLSLKLEGTVG  479



>ref|XP_006644946.1| PREDICTED: UPF0051 protein ABCI8, chloroplastic-like [Oryza brachyantha]
Length=431

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/431 (77%), Positives = 368/431 (85%), Gaps = 0/431 (0%)
 Frame = -3

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             ML+FRL +Y RF+ M +P WSDN Y  ++ Q ICYYS PK KP LNSLDE DPEL+  F+
Sbjct  1     MLDFRLAAYRRFLTMVQPTWSDNVYEPVDLQSICYYSAPKTKPKLNSLDEVDPELLNTFD  60

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             +LG+PL+E+ RLANVAVDAV+DS SIATTHR+ L K GVIFCSISEAIREYPDLV++YLG
Sbjct  61    RLGIPLSEQKRLANVAVDAVIDSTSIATTHREELMKKGVIFCSISEAIREYPDLVKRYLG  120

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
              VVP  DN+Y ALNSAVFSDGSF YVPK+T CPM+ISTYFRIN  ETGQFERTLIVAD  
Sbjct  121   SVVPPGDNYYAALNSAVFSDGSFCYVPKDTVCPMEISTYFRINDKETGQFERTLIVADAR  180

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             S V YLEGCTAP+YD+NQLHAAVVEL C E AEIKYSTVQNWY+GDEEG GGI+NFVTKR
Sbjct  181   STVSYLEGCTAPAYDSNQLHAAVVELVCEEQAEIKYSTVQNWYSGDEEGNGGIYNFVTKR  240

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             G C G  SKISWTQVETGSAITWKYPSV L GD++VGEFYSVALT + QQADTGTKMIHK
Sbjct  241   GRCKGRASKISWTQVETGSAITWKYPSVELLGDDTVGEFYSVALTKDCQQADTGTKMIHK  300

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQT  578
             GKN+RSRIISKGISAG SRNCYRGLVQ+ S A+NA NSSQCDS+LIG+NAAANTYP IQ 
Sbjct  301   GKNSRSRIISKGISAGKSRNCYRGLVQINSGAENAYNSSQCDSLLIGDNAAANTYPTIQV  360

Query  577   KNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  398
                S R+EHEA+TSKIGEDQLFYFQQRGID+EKA+AAMI GFCR VF  LP EF  E++ 
Sbjct  361   GCLSGRVEHEASTSKIGEDQLFYFQQRGIDHEKAVAAMIGGFCRAVFENLPYEFAHEMDA  420

Query  397   LMSLKLEGSVG  365
             LM+LKLEGSVG
Sbjct  421   LMNLKLEGSVG  431



>ref|WP_015192676.1| Iron-regulated ABC transporter membrane component SufB [Stanieria 
cyanosphaera]
 ref|YP_007131970.1| Iron-regulated ABC transporter membrane component SufB [Stanieria 
cyanosphaera PCC 7437]
 gb|AFZ35004.1| Iron-regulated ABC transporter membrane component SufB [Stanieria 
cyanosphaera PCC 7437]
Length=479

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/475 (68%), Positives = 398/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  EI++ T+P+GL+E+ IRLIS++KNEP++ML+FRLK+Y +++ M E
Sbjct  5     VKNLVNQPYKYGFITEIEADTIPRGLNEDIIRLISAKKNEPEFMLQFRLKAYHQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W+   YP I++Q+I YYS PK KK  LNSLDE DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  65    PTWAHVGYPPIDYQNIIYYSAPKQKKAKLNSLDEVDPALLETFEKLGLPLSEQKRLSNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L + GVIFCSISEA++E+PDLV+KYLG VVP  DN++ ALNSA
Sbjct  125   VDAIFDSVSIATTFKEKLAEEGVIFCSISEALQEHPDLVQKYLGSVVPVADNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK  +CPM++STYFRIN  ETGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  185   VFSDGSFVFIPKGVKCPMELSTYFRINNGETGQFERTLIVAEEGASVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNW+AGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDDAEIKYSTVQNWFAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTN+ QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSIALTNHKQQADTGTKMIHIGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S+  YRGLV++   AD ARN SQCDSMLIG+NA ANT+PYIQ  N SAR+EHEA+T+KI
Sbjct  365   ESKGSYRGLVKIGPKADGARNYSQCDSMLIGDNAEANTFPYIQVDNNSARVEHEASTAKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GE+QLFYF QRGI  E A++ ++SGFC+DV NELP EF AE ++L+SLKLEG+VG
Sbjct  425   GEEQLFYFAQRGISEEDAVSMLVSGFCKDVLNELPMEFAAEADKLLSLKLEGTVG  479



>ref|WP_017286400.1| cysteine desulfurase activator complex subunit SufB [Leptolyngbya 
boryana]
Length=478

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/474 (68%), Positives = 393/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +Q  + + YK+GF   I+S T+P+GLSE+ +RLIS++K EP+WML+FRL++Y +++ M E
Sbjct  5     VQTLVNQPYKYGFVTNIESDTIPRGLSEDVVRLISAKKEEPEWMLDFRLRAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W+   YP I++Q+I YYS PK      SLDE DPEL++ FEKLG+PL+E+ RL+NVAV
Sbjct  65    PDWAAVGYPAIDYQNIIYYSAPKVSEKKKSLDEVDPELLETFEKLGIPLSEQKRLSNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT ++ L K GVIFCSISEA+RE+P+LV+KYLG VVP  DN++ ALNSAV
Sbjct  125   DAIFDSVSVATTFKEKLAKDGVIFCSISEAVREHPELVKKYLGSVVPVGDNYFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFV++PK  +CPM++STYFRIN  ++GQFERTLIVA++S+ V YLEGCTAP YD+N
Sbjct  185   FSDGSFVFIPKGVKCPMELSTYFRINNGDSGQFERTLIVAEESAQVSYLEGCTAPMYDSN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + A+IKYSTVQNWYAGD +G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVALDDADIKYSTVQNWYAGDADGKGGIYNFVTKRGLCQGKNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN+QQADTGTKMIH GKNTRS IISKGISAG 
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNHQQADTGTKMIHIGKNTRSTIISKGISAGQ  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   A  ARN SQCDSMLIG+ A ANT+PYIQ +N   ++EHEA+TSKIG
Sbjct  365   SKNSYRGLVKISPKATGARNYSQCDSMLIGDRAQANTFPYIQVQNNQGKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFAQRGISPEDAISMMISGFCQDVFNQLPMEFAVEADKLLSLKLEGSVG  478



>ref|WP_015172281.1| iron-regulated ABC transporter membrane component SufB [Geitlerinema 
sp. PCC 7407]
 ref|YP_007109767.1| iron-regulated ABC transporter membrane component SufB [Geitlerinema 
sp. PCC 7407]
 gb|AFY66715.1| Iron-regulated ABC transporter membrane component SufB [Geitlerinema 
sp. PCC 7407]
Length=478

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/474 (68%), Positives = 398/474 (84%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             L+  + + YK+GF  +I++ ++ +GL+E+ IRLIS++KNEP++MLEFRLK+Y +++ M+E
Sbjct  5     LKNVVNQPYKYGFVTDIETDSIARGLNEDVIRLISAKKNEPEFMLEFRLKAYRQWLKMEE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W    YP IN+QDI YYS PK+K  L SLDE DP+L++ FEKLG+PL+E+ RL+NVAV
Sbjct  65    PTWPHVSYPPINYQDIVYYSAPKQKEKLGSLDEVDPKLLETFEKLGIPLSEQKRLSNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT ++ L + GVIFCSISEA+ ++P+LV+KYLG VVP  DN++ ALNSAV
Sbjct  125   DAIFDSVSVATTFKEKLAEEGVIFCSISEALHQHPELVKKYLGTVVPVADNYFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             F+DGSFV++PK  +CPM +STYFRIN  ++GQFERTLIVA++ + V YLEGCTAP +DTN
Sbjct  185   FTDGSFVFIPKGVKCPMDLSTYFRINNGDSGQFERTLIVAEEGASVTYLEGCTAPMFDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEI+YSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVALDNAEIRYSTVQNWYAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKM+H GKNTRS IISKGISAG 
Sbjct  305   GSAITWKYPSCVLAGDNSVGEFYSVALTNNCQQADTGTKMVHIGKNTRSTIISKGISAGR  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV+V  SA+ ARN SQCDSMLIG++A ANT+PYIQ +N + R+EHEA+TSKIG
Sbjct  365   SKNSYRGLVKVNPSAEGARNYSQCDSMLIGDSAEANTFPYIQVQNNTGRVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYFQQRGI  E A++ +ISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFQQRGISTEDAVSMIISGFCKDVFNKLPMEFAVEADRLLSLKLEGSVG  478



>ref|WP_035154703.1| cysteine desulfurase [Calothrix sp. 336/3]
 gb|KFB84485.1| cysteine desulfurase [Calothrix sp. 336/3]
Length=478

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/474 (68%), Positives = 393/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GLSE+ +R IS++KNEP++MLEFRL++Y +++ M E
Sbjct  5     VKTLVNQPYKYGFVTDIEADTIPRGLSEDVVRTISAKKNEPEFMLEFRLRAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W+   YP I++Q+I YYS PK+     SLDE DP L++ FEKLG+PL+E+ RLANVAV
Sbjct  65    PDWAAIGYPPIDYQNIIYYSAPKQTAKKKSLDEVDPTLLETFEKLGIPLSEQKRLANVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT ++ L K GVIFCSISEA++E+P+L++KYLG VVP  DN++ ALN+AV
Sbjct  125   DAIFDSVSVATTFKEKLAKEGVIFCSISEALQEHPELIKKYLGSVVPIADNYFAALNAAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK  +CPM++STYFRIN  +TGQFERTLIVA+  S+V YLEGCTAP YD+N
Sbjct  185   FSDGSFVYIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEADSYVSYLEGCTAPMYDSN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVALDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRGLCQGVNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNT+S IISKGISAG 
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHVGKNTKSTIISKGISAGK  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKIG
Sbjct  365   SSNSYRGLVKINPKAKGARNYSQCDSMLIGDNAHANTFPYIQVQNNTAKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFTQRGISAEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  478



>ref|WP_017746897.1| cysteine desulfurase activator complex subunit SufB [Scytonema 
hofmanni]
Length=479

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/475 (68%), Positives = 396/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+E+ +R+IS++KNEP++ML FRLK++ ++  M E
Sbjct  5     VKTLVNQPYKYGFVTDIEADTIPRGLNEDIVRIISAKKNEPEFMLNFRLKAFRQWQKMVE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W   +YP I++Q+I YYS PK KK  LNSLDE DP L++ FEKLG+ L+E+ RLANVA
Sbjct  65    PTWPSVKYPAIDYQNIIYYSAPKQKKQKLNSLDEVDPTLLETFEKLGISLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L + GVIFCSISEA++E+P+LV+KYLG VVP  DN++ ALNSA
Sbjct  125   VDAIFDSVSVATTFKEKLAQDGVIFCSISEALQEHPELVQKYLGSVVPGADNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN  ETGQFERTLIVA++ S+V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINNGETGQFERTLIVAEEGSYVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRGLCQGINSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S N YRGLV++   A+ ARN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  365   NSSNSYRGLVKINPKAEGARNYSQCDSMLIGDNAHANTFPYIQVQNNAAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ M+SGFC+DVFN+LP EF  E ++L+SLKLE SVG
Sbjct  425   GEDQLFYFAQRGISTEDAISMMVSGFCKDVFNQLPMEFAVEADKLLSLKLENSVG  479



>emb|CDM64966.1| Iron-regulated ABC transporter membrane component SufB [Pyrinomonas 
methylaliphatogenes]
Length=479

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/475 (68%), Positives = 390/475 (82%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++    R+YK+GF  EI+    P+GL+EE IRL+S RK EPDWMLEFRLK+Y  ++ M+E
Sbjct  5     IELLANREYKYGFVTEIEYEDFPRGLNEEIIRLLSERKGEPDWMLEFRLKAYRHWVTMRE  64

Query  1606  PK-WSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P+ W +  YPEI+FQ I YYS PK++P   SLDE DPEL++ FEKLG+PL+E+  LA VA
Sbjct  65    PRHWPNITYPEIDFQSIVYYSAPKQRPKKKSLDEVDPELLRTFEKLGIPLHEQKLLAGVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDAV DSVS+ATT+++ L+K G+IFCS+SEAIREYPDLVRKYLG VVP  DNFY ALNSA
Sbjct  125   VDAVFDSVSVATTYKEKLKKMGIIFCSMSEAIREYPDLVRKYLGSVVPPNDNFYAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSF Y+PK  RCPM++STYFRIN  E+GQFERTLIVA++ ++V YLEGCTAP YD 
Sbjct  185   VFSDGSFCYIPKGVRCPMELSTYFRINNAESGQFERTLIVAEEGAYVSYLEGCTAPMYDR  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGDEEGRGGI+NFVTKRG C G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDDAEIKYSTVQNWYAGDEEGRGGIYNFVTKRGKCLGRNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPSV+L GD S+GEFYSVALTN+ QQADTGTKMIH G+NTRS I+SKGI+AG
Sbjct  305   TGSAITWKYPSVILMGDNSIGEFYSVALTNHRQQADTGTKMIHIGRNTRSTIVSKGIAAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S N YRGLV+++  A+NARN +QCDSMLIG+  +ANT+PYI+  N S+R EHEATTS+I
Sbjct  365   KSSNSYRGLVKILPKAENARNFTQCDSMLIGSECSANTFPYIEVMNNSSRAEHEATTSRI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
              E+QLFY QQRG+  E A++ +I+GFC++VF ELP EF  E  +L+ +KLEGSVG
Sbjct  425   SEEQLFYLQQRGLSQEDAVSLIINGFCKEVFRELPMEFAVEAQRLLGIKLEGSVG  479



>ref|WP_006515514.1| Iron-regulated ABC transporter membrane component SufB [Leptolyngbya 
sp. PCC 7375]
 gb|EKV01109.1| Iron-regulated ABC transporter membrane component SufB [Leptolyngbya 
sp. PCC 7375]
Length=479

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/466 (70%), Positives = 392/466 (84%), Gaps = 0/466 (0%)
 Frame = -3

Query  1762  YKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKWSDNRY  1583
             YK+GF  +++S  +P+GLSE+ IRLIS +KNEPD+MLEFRLK+Y +++ M EP W +  Y
Sbjct  14    YKYGFVTDVESDVIPRGLSEDIIRLISEKKNEPDFMLEFRLKAYRQWLKMTEPTWPNVNY  73

Query  1582  PEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAVDAVLDSVS  1403
               I++QDI YYS PK+   L SLDE DPE++  FEKLG+PL+E+ RL NVAVDAV DSVS
Sbjct  74    KPIDYQDIIYYSAPKQSEKLKSLDEVDPEILATFEKLGLPLSEQKRLTNVAVDAVFDSVS  133

Query  1402  IATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFSDGSFVY  1223
             IATT ++ L + G+IFCSISEA++EYPDLV+KYLG VVPS DN++ ALNSAVFSDGSFVY
Sbjct  134   IATTFKEELAEHGIIFCSISEAVQEYPDLVKKYLGSVVPSADNYFTALNSAVFSDGSFVY  193

Query  1222  VPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQLHAAVVE  1043
             +P+NT+CPM +STYFRIN  ++GQFERTL++AD  S V YLEGCTAP YD+NQLHAAVVE
Sbjct  194   IPENTQCPMDLSTYFRINNGDSGQFERTLVIADKGSSVTYLEGCTAPMYDSNQLHAAVVE  253

Query  1042  LYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVETGSAITWKY  863
             L   + A+I YSTVQNW+AGD++G+GGI+NFVTKRGLC+G  SKISWTQVETGSAITWKY
Sbjct  254   LVTLDDAKIDYSTVQNWFAGDKDGKGGIYNFVTKRGLCSGKNSKISWTQVETGSAITWKY  313

Query  862   PSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGHSRNCYRGL  683
             PS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG+S+N YRGL
Sbjct  314   PSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHVGKNTRSTIISKGISAGNSKNSYRGL  373

Query  682   VQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIGEDQLFYFQ  503
             V+V   A+NARN SQCDSML+G+ + ANTYPYIQ +N + ++EHEA+TSKIGEDQLFYF 
Sbjct  374   VKVGPKAENARNYSQCDSMLLGDTSNANTYPYIQVQNNTGQVEHEASTSKIGEDQLFYFA  433

Query  502   QRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             QRGI  E A++ +ISGFCRDVFN+LP EF AE ++L++LKLE SVG
Sbjct  434   QRGISPEDAVSMIISGFCRDVFNKLPMEFAAEADKLLALKLENSVG  479



>ref|WP_007353113.1| MULTISPECIES: cysteine desulfurase activator complex subunit 
SufB [Kamptonema]
 emb|CBN53886.1| cysteine desulfurase activator complex subunit SufB [ [[Oscillatoria] 
sp. PCC 6506]
Length=479

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/475 (68%), Positives = 395/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +Q  + + YK+GF  EI+S T+P+GLSE+ +RLISS+KNEP +MLEFRLK+Y +++ M E
Sbjct  5     VQTLVNQPYKYGFVTEIESDTIPRGLSEDVVRLISSKKNEPAFMLEFRLKAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPT-LNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP IN+Q+I YYS P++KP  LNSL+E DP L++ FEKLG+ L+E+ RL+NVA
Sbjct  65    PTWPHVSYPPINYQEIIYYSAPRQKPKKLNSLEEVDPVLLETFEKLGISLSEQKRLSNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDAV DSVS+ATT R+ L K GVIFCSISEA+++YP+L+ KYLG VVP  DN++ ALNSA
Sbjct  125   VDAVFDSVSVATTFREKLAKDGVIFCSISEAVKDYPELIEKYLGSVVPVGDNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN  ++GQFERTLI+A+  S V YLEGCTAP +DT
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINNGDSGQFERTLIIAEAGSSVSYLEGCTAPMFDT  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNADIKYSTVQNWYAGDENGKGGIYNFVTKRGLCQGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTN+ QQADTGTKM+H GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNHKQQADTGTKMVHIGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S N YRGLV++  ++  +RN SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  365   KSSNSYRGLVKMGPNSKGSRNYSQCDSMLIGDNAQANTFPYIQVQNHTAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLF+F QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   GEDQLFFFAQRGISPEDAISMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG  479



>ref|WP_015157720.1| FeS assembly protein SufB [Chamaesiphon minutus]
 ref|YP_007095052.1| FeS assembly protein SufB [Chamaesiphon minutus PCC 6605]
 gb|AFY91525.1| FeS assembly protein SufB [Chamaesiphon minutus PCC 6605]
Length=479

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/475 (68%), Positives = 392/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +Q  + + YK+GF  +I S  +P+GL+E+ +RLISS+K+EP+++L FRL++Y +++ M E
Sbjct  5     VQNLVNQPYKYGFVTDIQSDKIPRGLNEDIVRLISSKKDEPEFLLNFRLRAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPT-LNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++QDI YYS PK+    L+SLDE DP L++ FEKLG+ LNE+ RL+NVA
Sbjct  65    PTWPHVDYPAIDYQDIIYYSAPKQAAKKLDSLDEVDPVLLETFEKLGISLNEQKRLSNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDAV DSVS+ATT +  L K GV+FCSISEA++EYP+L+ KYLG VVP  DNF+ ALNSA
Sbjct  125   VDAVFDSVSVATTFKAQLAKEGVVFCSISEAVKEYPELIEKYLGSVVPIADNFFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK T+CPM +STYFRIN  ++GQFERTLI+AD+ + V YLEGCTAP++DT
Sbjct  185   VFSDGSFVYIPKGTKCPMDLSTYFRINTGDSGQFERTLIIADEGASVTYLEGCTAPAFDT  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVVLDNAEIKYSTVQNWYAGDETGKGGIYNFVTKRGLCKGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNLQQADTGTKMIHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S+N YRGLV++  +A  ARN SQCDSMLIG+ A ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  365   KSKNSYRGLVKMNPTAKGARNYSQCDSMLIGDRAQANTFPYIQVQNQTAKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLF+F QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEG+VG
Sbjct  425   GEDQLFFFAQRGISQEDAISMMISGFCKDVFNQLPMEFAVEADRLLSLKLEGTVG  479



>ref|WP_013408499.1| cysteine desulfurase activator complex subunit SufB [Leadbetterella 
byssophila]
 ref|YP_003997803.1| iron-regulated ABC transporter membrane component sufb [Leadbetterella 
byssophila DSM 17132]
 gb|ADQ17450.1| Iron-regulated ABC transporter membrane component SufB [Leadbetterella 
byssophila DSM 17132]
Length=481

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/480 (66%), Positives = 394/480 (82%), Gaps = 0/480 (0%)
 Frame = -3

Query  1804  SNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYER  1625
             S + D L++    +YK+GF  +I++   P GLSE+ +R IS++KNEP+WMLE+RLK+Y  
Sbjct  2     SKDTDILEEITSSEYKYGFYTDIEADEAPPGLSEDIVRFISAKKNEPEWMLEWRLKAYRE  61

Query  1624  FMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNR  1445
             +  M EP W++  Y + +FQ I YYS PK++  LNSLDE DPEL K FEKLG+ L+E+ R
Sbjct  62    WEKMTEPNWANVTYEKPDFQAIKYYSAPKQQKKLNSLDEVDPELRKTFEKLGISLSEQKR  121

Query  1444  LANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYG  1265
             ++ VAVDAV+DSVS+ATT R  L + G+IFCSISEAI+EYPDLV+KYLG VVP +DNFY 
Sbjct  122   ISGVAVDAVIDSVSVATTFRAELAEKGIIFCSISEAIKEYPDLVKKYLGSVVPVKDNFYS  181

Query  1264  ALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTA  1085
             ALNSAVFSDGSF Y+PK  RCPM++STYFRINA  TGQFERTLI+AD+ ++V YLEGCTA
Sbjct  182   ALNSAVFSDGSFCYIPKGVRCPMELSTYFRINAAGTGQFERTLIIADEGAYVSYLEGCTA  241

Query  1084  PSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKIS  905
             P  D NQLHAAVVE++ HE AE+KYSTVQNWY GD+EG+GG+FNFVTKRGLC G RSKIS
Sbjct  242   PMRDENQLHAAVVEIFAHENAEVKYSTVQNWYPGDKEGKGGVFNFVTKRGLCFGDRSKIS  301

Query  904   WTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISK  725
             WTQVETGSA+TWKYPSV+L+GD S+GEFYSVA+TNN+QQADTGTKMIH GKNTRSRI+SK
Sbjct  302   WTQVETGSAVTWKYPSVILKGDNSIGEFYSVAVTNNFQQADTGTKMIHIGKNTRSRIVSK  361

Query  724   GISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEA  545
             GISAG S+N YRGLV++   ADNARN SQCDSML+G+   A+T+PYI+  NP+A +EHEA
Sbjct  362   GISAGRSQNSYRGLVEISKRADNARNFSQCDSMLLGDRCGAHTFPYIECNNPTANVEHEA  421

Query  544   TTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             TTSKIGEDQLFY  QRGID E A+A +I+G+ ++V N+LP EF  E  +L+++ LEGSVG
Sbjct  422   TTSKIGEDQLFYCNQRGIDTETAVALIINGYAKEVLNQLPMEFAVEAQKLLAVSLEGSVG  481



>ref|WP_012161807.1| cysteine desulfurase activator complex subunit SufB [Acaryochloris 
marina]
 ref|YP_001515575.1| cysteine desulfurase activator complex subunit SufB [Acaryochloris 
marina MBIC11017]
 gb|ABW26261.1| FeS assembly protein SufB [Acaryochloris marina MBIC11017]
Length=478

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/474 (68%), Positives = 391/474 (82%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+  T+PKGLSE+ IRLIS++K EP +MLEFRLK+Y +++ MKE
Sbjct  5     VENLVNQPYKYGFVTDIEVETIPKGLSEDVIRLISAKKEEPAFMLEFRLKAYRQWLKMKE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W    YP I++QDI YYS PK++    SLD+ DP L++ F+KLG+PL+E+ RL+NVAV
Sbjct  65    PTWPHVDYPAIDYQDITYYSAPKEQEKKKSLDDVDPALLETFDKLGIPLSEQKRLSNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVS+ATT ++ L K GVIFCSISEA++++P+LV KYLG VVP  DNF+ ALNSAV
Sbjct  125   DAVFDSVSVATTFKEQLAKEGVIFCSISEALKDFPELVEKYLGSVVPINDNFFSALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK  +CPM++STYFRIN    GQFERTLI+A++ S V YLEGCTAP +DTN
Sbjct  185   FSDGSFVYIPKGVKCPMELSTYFRINTEGAGQFERTLIIAEEGSQVSYLEGCTAPMFDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + A+IKYSTVQNWYAGDE G+GGI+NFVTKRGLCAG  SKISWTQVET
Sbjct  245   QLHAAVVELVALDDADIKYSTVQNWYAGDENGKGGIYNFVTKRGLCAGKNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG 
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNKQQADTGTKMIHVGKNTRSTIISKGISAGR  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   AD +RN SQCDSMLIG++A ANT+PYIQ +N   ++EHEA+TSKIG
Sbjct  365   SQNSYRGLVRMGPKADGSRNYSQCDSMLIGSDAEANTFPYIQVQNNQTKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A++ MISGFC+DVFN+LP EF  E ++L+SLKLEGSVG
Sbjct  425   EDQLFYFAQRGISVEDAVSMMISGFCQDVFNQLPMEFAVEADRLLSLKLEGSVG  478



>ref|WP_009627514.1| Iron-regulated ABC transporter membrane component SufB [Pseudanabaena 
biceps]
 gb|ELS32360.1| Iron-regulated ABC transporter membrane component SufB [Pseudanabaena 
biceps PCC 7429]
Length=507

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/500 (65%), Positives = 406/500 (81%), Gaps = 2/500 (0%)
 Frame = -3

Query  1864  VRAEAKVTIDAPGKQPSPSTSNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLI  1685
             +RA  +V I A     S ++++    +Q  + + YK+GF   I+S T+P+GLSE+ +R+I
Sbjct  10    IRALNRVLIRAL--NLSGASTDMTATVQALVNQPYKYGFVTSIESDTIPRGLSEDVVRMI  67

Query  1684  SSRKNEPDWMLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEA  1505
             S++KNEP++MLEFRLK+Y +++ M+EP W+   YP I++QDI YYS PK+     SLDE 
Sbjct  68    SAKKNEPEYMLEFRLKAYRQWLKMQEPTWAHVDYPAIDYQDIVYYSAPKQSKKKASLDEV  127

Query  1504  DPELIKYFEKLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREY  1325
             DPEL+  FEKLG+ L+E+ RLANVAVDA+ DSVS+ATT +K L K GVIFCSISEA+ EY
Sbjct  128   DPELLDTFEKLGISLSEQKRLANVAVDAIFDSVSVATTFKKDLAKVGVIFCSISEAMHEY  187

Query  1324  PDLVRKYLGRVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFE  1145
             P+L++KYLG VVP  DN++ ALN+AVFSDGSFVY+PK  +CPM +STYFRIN  ++GQFE
Sbjct  188   PELIKKYLGSVVPIADNYFSALNAAVFSDGSFVYIPKGVKCPMDLSTYFRINNGDSGQFE  247

Query  1144  RTLIVADDSSFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRG  965
             RTLIVA++ S+V YLEGCTAP +DTNQLHAAVVEL   + AEIKYSTVQNWYAGD+ G+G
Sbjct  248   RTLIVAEEGSYVSYLEGCTAPMFDTNQLHAAVVELVALDDAEIKYSTVQNWYAGDKNGKG  307

Query  964   GIFNFVTKRGLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQA  785
             GI+NFVTKRGLC G  SKISWTQVETGSAITWKYPS VL G+ SVGEFYSVALTNN QQA
Sbjct  308   GIYNFVTKRGLCQGKNSKISWTQVETGSAITWKYPSCVLVGENSVGEFYSVALTNNKQQA  367

Query  784   DTGTKMIHKGKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAA  605
             DTG+KM+H GKNTRS+I+SKGISAG S+N YRGLV++   A+ ARN SQCDSMLIG+ + 
Sbjct  368   DTGSKMVHIGKNTRSKIVSKGISAGGSQNSYRGLVKISPKAEGARNYSQCDSMLIGDCSQ  427

Query  604   ANTYPYIQTKNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELP  425
             ANT+PYIQ +N +AR+EHEA+TSKIGE+QLFYFQQRGI  E A++ +ISGFC++VFN LP
Sbjct  428   ANTFPYIQVQNNTARVEHEASTSKIGEEQLFYFQQRGIAVEDAVSMIISGFCKEVFNALP  487

Query  424   DEFGAEVNQLMSLKLEGSVG  365
              EF  E ++L++LKLE SVG
Sbjct  488   MEFAVEADKLLALKLENSVG  507



>ref|WP_017297931.1| cysteine desulfurase activator complex subunit SufB [Nodosilinea 
nodulosa]
Length=479

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/475 (67%), Positives = 397/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +Q  + + YK+GF  +I++  +P+GLSE+ +R+IS++KNEP +MLEFRLK+Y +++ MKE
Sbjct  5     VQSLVSQPYKYGFTTDIEADAIPRGLSEDVVRMISAKKNEPAFMLEFRLKAYRKWLTMKE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPT-LNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W +  YP I++Q+I YYS PK +P  L SLDE DP +++ FEKLG+PL+E+ RLANVA
Sbjct  65    PIWPNVSYPPIDYQNIVYYSAPKTQPKKLGSLDEVDPTMLETFEKLGIPLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT+++ L +SGVIFCSISEA++E+P+LV KYLG VVP  DN++ ALNSA
Sbjct  125   VDAIFDSVSIATTYKEKLAESGVIFCSISEALQEHPELVEKYLGTVVPIGDNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK+T+CPM +STYFRIN  ++GQFERTLIVA+  S V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKDTQCPMDLSTYFRINNGDSGQFERTLIVAESGSSVTYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAA+VEL   + A I YSTVQNW+AGDE G+GGI+NFVTKRGLCAG  SKISWTQVE
Sbjct  245   NQLHAAIVELVALDNATINYSTVQNWFAGDENGKGGIYNFVTKRGLCAGKNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN+QQADTGTKM+H GKNTRS IISKGISA 
Sbjct  305   TGSAITWKYPSCVLVGDSSVGEFYSVALTNNHQQADTGTKMVHVGKNTRSTIISKGISAA  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S+N YRGLV++   A  ARN SQCDSMLIG+ ++ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  365   KSKNSYRGLVKIGPKATGARNYSQCDSMLIGDTSSANTFPYIQVQNSTAQVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ +ISGFCRDVFN+LP EF AE ++L++LKLE +VG
Sbjct  425   GEDQLFYFAQRGISPEDAVSMIISGFCRDVFNKLPMEFAAEADKLLALKLENTVG  479



>ref|WP_015956672.1| cysteine desulfurase activator complex subunit SufB [Cyanothece 
sp. PCC 7424]
 ref|YP_002379957.1| cysteine desulfurase activator complex subunit SufB [Cyanothece 
sp. PCC 7424]
 gb|ACK73089.1| FeS assembly protein SufB [Cyanothece sp. PCC 7424]
Length=480

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/475 (68%), Positives = 397/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+P+GL+E+ IRLIS++KNEP++ML+FRLK+Y ++  M E
Sbjct  6     VKTLVNQPYKYGFITDIESETVPRGLNEDIIRLISAKKNEPEFMLDFRLKAYRQWQKMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q+I YYS PK KK  L+SLDE DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  66    PTWPHVSYPPIDYQNIIYYSAPKTKKVKLDSLDEVDPALLETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L + GVIFCSISEA++E+PDLV+KYLG VVP  DN++ ALNSA
Sbjct  126   VDAIFDSVSIATTFKEKLAEEGVIFCSISEALQEHPDLVQKYLGSVVPVNDNYFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK  +CPM++STYFRIN  ETGQFERTLI+A++ ++V YLEGCTAP YDT
Sbjct  186   VFSDGSFVFIPKGVKCPMELSTYFRINNGETGQFERTLIIAEEGAYVSYLEGCTAPMYDT  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNW+AGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVTLDNAEIKYSTVQNWFAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGKNTRSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ  N +A++EHEA+TSKI
Sbjct  366   NSKNSYRGLVKMSPGAKGARNYSQCDSMLIGDNAEANTFPYIQVDNNTAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRG+  E A++ ++SGFC+DV + LP EF AE ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGVSEEDAISMLVSGFCKDVLSALPMEFAAEADKLLSLKLEGTVG  480



>ref|WP_023074234.1| iron-regulated abc transporter membrane component [Leptolyngbya 
sp. Heron Island J]
 gb|ESA34956.1| iron-regulated abc transporter membrane component [Leptolyngbya 
sp. Heron Island J]
Length=478

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/474 (68%), Positives = 395/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +Q  + + YK+GF  +++S  +P+GLSE+ IRLIS +KNEP++MLEFRLK+Y +++ M E
Sbjct  5     VQAVVSQPYKYGFVTDVESDVIPRGLSEDIIRLISQKKNEPEFMLEFRLKAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W +  Y  IN+QDI YYS PK+   L SLDE DPE++  FEKLG+PL+E+ RL NVAV
Sbjct  65    PNWPNVNYEPINYQDIIYYSAPKQSEKLKSLDEVDPEILATFEKLGLPLSEQKRLTNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVSIATT ++ L + G+IFCSISEA++++P+L++KYLG VVPS DN++ ALNSAV
Sbjct  125   DAVFDSVSIATTFKEELAEHGIIFCSISEAVQDHPELIKKYLGSVVPSADNYFTALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+P+NT+CPM +STYFRIN  ++GQFERTL++AD  S V YLEGCTAP YD+N
Sbjct  185   FSDGSFVYIPENTQCPMDLSTYFRINNGDSGQFERTLVIADKGSSVTYLEGCTAPMYDSN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + A+I YSTVQNW+AGD+ G+GGI+NFVTKRGLCAG  SKISWTQVET
Sbjct  245   QLHAAVVELVTLDDAKINYSTVQNWFAGDKNGKGGIYNFVTKRGLCAGKNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKM+H GKNTRS IISKGISAG+
Sbjct  305   GSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMVHVGKNTRSTIISKGISAGN  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV+V   A+NARN SQCDSMLIG+ + ANTYPYIQ +N + ++EHEA+TSKIG
Sbjct  365   SKNSYRGLVKVGPKAENARNYSQCDSMLIGDTSNANTYPYIQVQNNTGQVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A++ +ISGFCRDVFN+LP EF AE ++L++LKLE +VG
Sbjct  425   EDQLFYFAQRGISPEDAVSMIISGFCRDVFNKLPMEFAAEADKLLALKLENAVG  478



>ref|WP_015184215.1| iron-regulated ABC transporter membrane component SufB [Microcoleus 
sp. PCC 7113]
 ref|YP_007123485.1| iron-regulated ABC transporter membrane component SufB [Microcoleus 
sp. PCC 7113]
 gb|AFZ20079.1| Iron-regulated ABC transporter membrane component SufB [Microcoleus 
sp. PCC 7113]
Length=479

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/475 (68%), Positives = 397/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++K + + YK+GF  +I++ T+P+GL+E+ IRLIS +KNEP++MLEFRLK+Y +++ M E
Sbjct  5     VKKLVNQPYKYGFVTDIEADTIPRGLNEDVIRLISGKKNEPEFMLEFRLKAYRQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP IN+QDI YYS PK+ K  L+SL++ DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  65    PTWPHVTYPPINYQDIIYYSAPKQAKKKLDSLEDVDPALLETFEKLGIPLSEQKRLSNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSI TT ++ L K GVIFCSISEA++E+P+LV+KYLG VVP  DN++ ALN+A
Sbjct  125   VDAIFDSVSIGTTFKEKLAKEGVIFCSISEALQEHPELVKKYLGSVVPVADNYFAALNAA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV+VPK  +CPM++STYFRIN+ +TGQFERTLIVA++ S V YLEGCTAP YD+
Sbjct  185   VFSDGSFVFVPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGSSVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNADIKYSTVQNWYAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKM+H GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNKQQADTGTKMVHIGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRG V++   A  ARN SQCDSMLIG+ A ANT+PYIQ +N +A++EHEA+T+KI
Sbjct  365   NSKNSYRGQVKIGPKAQGARNYSQCDSMLIGSTAEANTFPYIQVENNTAKVEHEASTAKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ M+SGFC+DVFN LP EF AE ++L+SLKLEG+VG
Sbjct  425   GEDQLFYFAQRGISEEDAISMMVSGFCKDVFNNLPMEFAAEADKLLSLKLEGAVG  479



>ref|WP_023471975.1| FeS cluster assembly protein SufB [Betaproteobacteria bacterium 
MOLA814]
 gb|ESS15074.1| FeS cluster assembly protein SufB [Betaproteobacteria bacterium 
MOLA814]
Length=478

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/476 (66%), Positives = 390/476 (82%), Gaps = 0/476 (0%)
 Frame = -3

Query  1792  DPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNM  1613
             + +Q  + + YK GF  +I+S   PKGL+E TIR+IS++KNEP+W+LEFRLKSY  ++NM
Sbjct  3     EAIQNIVNQPYKHGFVSDIESDVSPKGLNENTIRMISAKKNEPEWLLEFRLKSYAAWLNM  62

Query  1612  KEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANV  1433
              EP W++  YP+IN Q+I YY+ PK+KP LNS+D+ DPEL++ FEKLGVPL+ER  LA V
Sbjct  63    TEPTWANVHYPKINLQEISYYASPKQKPKLNSMDDVDPELLRTFEKLGVPLHERMALAGV  122

Query  1432  AVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNS  1253
             AVD + DSVS+ATT++  L + G+IFCS+SEA+ E+P+LV+KYLG V+PS DNFY ALNS
Sbjct  123   AVDVIFDSVSVATTYKHKLAEVGIIFCSMSEAVLEHPELVQKYLGTVIPSGDNFYAALNS  182

Query  1252  AVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYD  1073
             AVF+DGSF ++PK  +CPM +STYFRIN  ETGQFERTLI+A++ + V YLEGCTAP++ 
Sbjct  183   AVFTDGSFCFIPKGVKCPMDLSTYFRINTEETGQFERTLIIAEEGASVSYLEGCTAPAFS  242

Query  1072  TNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQV  893
             +NQLHAAVVEL   + A+IKYSTVQNWYAGDE G GG+FNFVTKRGL  G  S+ISWTQV
Sbjct  243   SNQLHAAVVELVALDNADIKYSTVQNWYAGDENGVGGVFNFVTKRGLAKGVNSRISWTQV  302

Query  892   ETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISA  713
             ETGSAITWKYPSVVL GD SVGEFYSVA+TN+ QQADTGTKMIH GKNTRS I+SKGISA
Sbjct  303   ETGSAITWKYPSVVLRGDNSVGEFYSVAVTNHLQQADTGTKMIHIGKNTRSTIVSKGISA  362

Query  712   GHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSK  533
             G S N YRGLV++  +A NARN SQCDSMLIG+ + ANT+PYIQ +N +A++EHEA+TSK
Sbjct  363   GRSSNSYRGLVRMTPTAANARNYSQCDSMLIGDQSGANTFPYIQVRNNTAQVEHEASTSK  422

Query  532   IGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             IGEDQLFYF QRG+  E A++ +I+GFC+DVF +LP EF  E   L+S KLEGSVG
Sbjct  423   IGEDQLFYFAQRGVSAEAAVSMIINGFCKDVFQQLPMEFAVEATNLLSFKLEGSVG  478



>ref|WP_038650668.1| cysteine desulfurase [Prochlorococcus sp. MIT 0801]
 gb|AIQ96245.1| Iron-sulfur cluster assembly protein SufB [Prochlorococcus sp. 
MIT 0801]
Length=480

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/478 (65%), Positives = 404/478 (85%), Gaps = 0/478 (0%)
 Frame = -3

Query  1798  EDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFM  1619
             + + +++ + + YK+GF  EI++  +PKGL+E+ IRLIS++KNEPD++L+FRL++YE+++
Sbjct  3     QTNTVEEIVAQPYKYGFTTEIETEKIPKGLNEDVIRLISAKKNEPDFLLKFRLRAYEQWL  62

Query  1618  NMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLA  1439
              MKEP WS   Y ++++QD+ YY+ PK+     SLDE DP+L++ FEKLG+PL+E+ RL+
Sbjct  63    KMKEPDWSGLTYSKVDYQDLVYYAAPKQDIKKKSLDEVDPKLLETFEKLGIPLSEQKRLS  122

Query  1438  NVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGAL  1259
             NVAVDAV DSVSIATT+++ L + GVIFCSISEAI E+PDL++KY+G VVP+ DNF+ AL
Sbjct  123   NVAVDAVFDSVSIATTYKEKLAEHGVIFCSISEAIIEHPDLIKKYMGTVVPTNDNFFAAL  182

Query  1258  NSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPS  1079
             NSAVFSDGSFVYVPK   CPM++S+YFRIN+ +TGQFERTLI+A++S+ V YLEGCTAP 
Sbjct  183   NSAVFSDGSFVYVPKGVECPMELSSYFRINSGDTGQFERTLIIAEESASVSYLEGCTAPM  242

Query  1078  YDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWT  899
             +DTN LHAAVVEL   + A IKYSTVQNWYAG+E+G GGI+NFVTKRG C G RSKISW+
Sbjct  243   FDTNTLHAAVVELVTLDDASIKYSTVQNWYAGNEKGVGGIYNFVTKRGECRGKRSKISWS  302

Query  898   QVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGI  719
             QVETGSA+TWKYPS VL+GD S+GEFYS+ALTNN+Q+ADTGTKMIH GKNT+S+I+SKGI
Sbjct  303   QVETGSAVTWKYPSCVLQGDSSIGEFYSIALTNNFQKADTGTKMIHIGKNTKSKIVSKGI  362

Query  718   SAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATT  539
             SAG S+N YRGLV +  +A+ ARN SQCDSMLIG+ A+ANTYPYIQ+K P + IEHEA+T
Sbjct  363   SAGQSKNSYRGLVSISPNAEGARNYSQCDSMLIGDKASANTYPYIQSKQPQSNIEHEAST  422

Query  538   SKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
              +I EDQLFY Q RGID+E++++ +ISGFC DVFNELP EF +E ++L++LKLEGSVG
Sbjct  423   CRISEDQLFYLQSRGIDFEESVSMLISGFCSDVFNELPMEFASEADKLLALKLEGSVG  480



>ref|WP_036483053.1| cysteine desulfurase [Myxosarcina sp. GI1]
Length=480

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/476 (67%), Positives = 397/476 (83%), Gaps = 2/476 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GLSEE IRLIS++KNEP++MLEFRLK+Y ++  M E
Sbjct  5     VKTLVNQPYKYGFVTDIEADTIPRGLSEEVIRLISAKKNEPEFMLEFRLKAYRQWQKMSE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPT--LNSLDEADPELIKYFEKLGVPLNERNRLANV  1433
             PKWS  +YP I++Q+I YYS PKKK    L SL+E DP L+  FEKLG+PL+E+ RL+NV
Sbjct  65    PKWSQAKYPAIDYQNIIYYSAPKKKKQEKLGSLEEVDPALLDTFEKLGIPLSEQKRLSNV  124

Query  1432  AVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNS  1253
             AVDA+ DSVS+ATT ++ L + GVIFCSISEA++E+P+LV+KYLG VVP  DN++ ALNS
Sbjct  125   AVDAIFDSVSVATTFKEKLAEEGVIFCSISEALQEHPELVQKYLGSVVPVGDNYFAALNS  184

Query  1252  AVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYD  1073
             AVFSDGSFV++PK   CPM++STYFRIN  +TGQFERTLIVA++ + V YLEGCTAP +D
Sbjct  185   AVFSDGSFVFIPKGVTCPMELSTYFRINTGDTGQFERTLIVAEEGASVSYLEGCTAPMFD  244

Query  1072  TNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQV  893
             TNQLHAAVVEL   + A+IKYSTVQNW+AGDE+G+GGI+NFVTKRGLC G  SKISWTQV
Sbjct  245   TNQLHAAVVELVALDNADIKYSTVQNWFAGDEQGKGGIYNFVTKRGLCKGVNSKISWTQV  304

Query  892   ETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISA  713
             ETGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH GKNTRS II+KGISA
Sbjct  305   ETGSAITWKYPSCVLVGDNSVGEFYSIALTNNQQQADTGTKMIHIGKNTRSTIIAKGISA  364

Query  712   GHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSK  533
             G+S++ YRGLV++ + A  ARN SQCDSMLIG+NA ANT+PYIQ  N +A++EHEA+T+K
Sbjct  365   GNSQSSYRGLVKIGAKAAGARNYSQCDSMLIGDNAEANTFPYIQVDNNTAKLEHEASTAK  424

Query  532   IGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             IGE+QLFY  QRGI  E A+  M+SGFC+DV NELP EF AE ++L+SLKLEG+VG
Sbjct  425   IGEEQLFYLAQRGISEEDAVTMMVSGFCKDVLNELPMEFAAEADKLLSLKLEGTVG  480



>ref|WP_039726650.1| cysteine desulfurase [Lyngbya confervoides]
 gb|KIF14832.1| cysteine desulfurase [Aphanocapsa montana BDHKU210001]
 gb|KIF39756.1| cysteine desulfurase [Lyngbya confervoides BDU141951]
Length=478

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/475 (69%), Positives = 396/475 (83%), Gaps = 2/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  +   YK+GF  +I++ T+P+GLSE+T+RLIS++K EP +MLEFRLK+Y +++ M E
Sbjct  5     VRSLVSEPYKYGFKTDIEADTIPRGLSEDTVRLISAKKEEPKFMLEFRLKAYRKWLQMAE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W++  YP IN+QDI YYS PK+ K  L SLDEADP L++ FEKLG+PL+E+ RLANVA
Sbjct  65    PDWANVGYPPINYQDIIYYSAPKQEKKKLKSLDEADPALLETFEKLGLPLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDAV DSVSI TT+++ L + GVIFCSISEA+ E+P+LV KYLG VVP  DN++ ALNSA
Sbjct  125   VDAVFDSVSIGTTYKEKLAEDGVIFCSISEAVEEFPELVEKYLGSVVPVGDNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK T+CPM +STYFRIN  ++GQFERTLIVA++ S V YLEGCTAP YDT
Sbjct  185   VFSDGSFVYIPKGTKCPMDLSTYFRINNGDSGQFERTLIVAEEGSSVTYLEGCTAPMYDT  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNW+AGDE+GRGGI+NFVTKRGLC    +KISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWFAGDEQGRGGIYNFVTKRGLCH-KNAKISWTQVE  303

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKM+H GKNTRS I+SKGISAG
Sbjct  304   TGSAITWKYPSCVLLGDNSVGEFYSVALTNNMQQADTGTKMVHIGKNTRSTIVSKGISAG  363

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S+N YRGLV++   A+ ARN SQCDSMLIG+ + ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  364   KSKNSYRGLVKIGPKAEGARNYSQCDSMLIGDTSNANTFPYIQVQNNTAQVEHEASTSKI  423

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ +ISGFCR+VFNELP EF AE ++LM+LKLE +VG
Sbjct  424   GEDQLFYFAQRGISPEDAVSMIISGFCREVFNELPMEFAAEADKLMALKLENTVG  478



>ref|WP_009545929.1| cysteine desulfurase activator complex subunit SufB [Cyanothece 
sp. ATCC 51472]
Length=480

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/475 (67%), Positives = 398/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+E+ IRLIS++KNEPD+MLEFRLK+Y++++ M E
Sbjct  6     VKNLVNQPYKYGFVTDIEADTIPRGLNEDVIRLISAKKNEPDFMLEFRLKAYQQWLKMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP+I++Q+I YYS PK KK  L +LDE DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  66    PTWPHVNYPKIDYQNIIYYSAPKQKKEKLKNLDEVDPALLETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ TT+++ L + GVIFCSISEA+ E+P+LV+KYLG VVP  DNF+ ALN+A
Sbjct  126   VDAIFDSVSVGTTYKEKLAEDGVIFCSISEALEEHPELVKKYLGSVVPVGDNFFAALNAA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK  +CPM++STYFRIN  +TGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  186   VFSDGSFVFIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEEGASVSYLEGCTAPMYDS  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVALDNADIKYSTVQNWYAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGKNTRSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLVQ+   A  ARN SQCDSMLIG+NA ANT+PYIQ  N +A++EHEA+TSKI
Sbjct  366   NSKNSYRGLVQMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVDNNTAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV +ELP EF +E ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGISEEDAISMLVSGFCQDVLSELPMEFASEADKLLSLKLEGTVG  480



>ref|WP_026788521.1| MULTISPECIES: cysteine desulfurase [Planktothrix]
 gb|KEI68100.1| SufB [Planktothrix agardhii NIVA-CYA 126/8]
Length=478

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/474 (68%), Positives = 390/474 (82%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+P+GLSE+ +RLIS++KNEP++ML FRL++Y++++ M E
Sbjct  5     VKTLVNQPYKYGFVTDIESDTIPRGLSEDVVRLISAKKNEPEFMLNFRLRAYKQWLKMAE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W    YP I++Q I YYS PK +    SLDE DP L++ FEKLG+PLNE+ RL+NVAV
Sbjct  65    PTWPHVNYPAIDYQSIIYYSAPKVEQKKTSLDEVDPTLLETFEKLGIPLNEQKRLSNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVSIATT ++ L + GVIFCSISEA++E+P+L+ KYLG VVP  DNF+ ALNSAV
Sbjct  125   DAVFDSVSIATTFKEKLAEDGVIFCSISEAVKEHPELIEKYLGSVVPVADNFFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK  +CPM +STYFRIN  ++GQFERTLIVA+  S V YLEGCTAP +DTN
Sbjct  185   FSDGSFVYIPKGVQCPMDLSTYFRINNGDSGQFERTLIVAEAGSSVTYLEGCTAPMFDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDEEG+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELVTLDNAEIKYSTVQNWYAGDEEGKGGIYNFVTKRGLCKGVNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS +L GD SVGEFYSVALTNN QQADTGTKMIH GKNTRS IISKGISAG 
Sbjct  305   GSAITWKYPSCLLVGDNSVGEFYSVALTNNKQQADTGTKMIHIGKNTRSTIISKGISAGK  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV++   A  ARN SQCDSMLIG+ A ANT+PYIQ +N SA++EHEA+TSKIG
Sbjct  365   SSNSYRGLVKMGPKAAGARNYSQCDSMLIGDRAQANTFPYIQVENNSAKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A++ MISGFC+DVF++LP EF  E ++L+SLKLEG+VG
Sbjct  425   EDQLFYFSQRGISAEDAISMMISGFCKDVFSKLPMEFAVEADKLLSLKLEGTVG  478



>ref|WP_008187504.1| cysteine desulfurase activator complex subunit SufB [Moorea producens]
 gb|EGJ31051.1| Iron-regulated ABC transporter membrane component SufB [Moorea 
producens 3L]
Length=479

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/475 (68%), Positives = 394/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+E+ IRLIS++KNEP++MLEFRLK+Y ++  M E
Sbjct  5     VKTLVNQPYKYGFVTDIEADTIPRGLNEDIIRLISAKKNEPEFMLEFRLKAYRQWQKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q I YYS PK+ K  LNSLDE DP L++ F+KLG+ L+E+ RLANVA
Sbjct  65    PTWPHVTYPPIDYQKIIYYSAPKQTKEKLNSLDEVDPALLETFDKLGISLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L +SGVIFCSISEA++E+P+LVRKYLG VVP  DN++ ALNSA
Sbjct  125   VDAIFDSVSIATTFKEKLAESGVIFCSISEALQEHPELVRKYLGSVVPVADNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN  +TGQFERTLIVA++ S V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEEGSNVSYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNW+AGD+ G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNAEIKYSTVQNWFAGDKNGKGGIYNFVTKRGLCKGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD S+GEFYSVALTNN QQADTGTKM+H GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSIGEFYSVALTNNLQQADTGTKMVHIGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S+N YRGLV++   A  ARN SQCDSMLIG+ A ANT+PYIQ +N   ++EHEA+TSKI
Sbjct  365   KSKNSYRGLVKIGPKAKGARNYSQCDSMLIGDTAEANTFPYIQVQNNMGKVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLF+F QRGI  E A++ M+SGFC+DVFNELP EF AE ++L+SLKLEG+VG
Sbjct  425   GEDQLFFFAQRGISEEDAISMMVSGFCKDVFNELPMEFAAEADKLLSLKLEGTVG  479



>ref|WP_012361428.1| cysteine desulfurase activator complex subunit SufB [Cyanothece 
sp. ATCC 51142]
 ref|YP_001802102.1| cysteine desulfurase activator complex subunit SufB [Cyanothece 
sp. ATCC 51142]
 gb|ACB50036.1| iron-sulfur assembly protein [Cyanothece sp. ATCC 51142]
Length=494

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/475 (67%), Positives = 398/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+E+ IRLIS++KNEPD+MLEFRLK+Y++++ M E
Sbjct  20    VKNLVNQPYKYGFVTDIEADTIPRGLNEDVIRLISAKKNEPDFMLEFRLKAYQQWLKMTE  79

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP+I++Q+I YYS PK KK  L +LDE DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  80    PTWPHVNYPKIDYQNIIYYSAPKQKKEKLKNLDEVDPALLETFEKLGIPLSEQKRLSNVA  139

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ TT+++ L + GVIFCSISEA+ E+P+LV+KYLG VVP  DNF+ ALN+A
Sbjct  140   VDAIFDSVSVGTTYKEKLAEDGVIFCSISEALEEHPELVKKYLGSVVPVGDNFFAALNAA  199

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK  +CPM++STYFRIN  +TGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  200   VFSDGSFVFIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEEGASVSYLEGCTAPMYDS  259

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  260   NQLHAAVVELVALDNADIKYSTVQNWYAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  319

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  320   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGKNTRSTIISKGISAG  379

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLVQ+   A  ARN SQCDSMLIG+NA ANT+PYIQ  N +A++EHEA+TSKI
Sbjct  380   NSKNSYRGLVQMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVDNNTAKVEHEASTSKI  439

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV +ELP EF +E ++L+SLKLEG+VG
Sbjct  440   GEDQLFYFAQRGISEEDAISMLVSGFCQDVLSELPMEFASEADKLLSLKLEGTVG  494



>gb|ETZ23616.1| cysteine desulfurase activator complex subunit SufB [Pedobacter 
sp. V48]
Length=481

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/476 (67%), Positives = 390/476 (82%), Gaps = 0/476 (0%)
 Frame = -3

Query  1792  DPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNM  1613
             D L++ +  +YK+GF  +ID+  + KGLSE TIRLIS++KNEP+WML++RLK+Y  ++ +
Sbjct  6     DTLEQAVLTEYKYGFVTDIDTDVIAKGLSENTIRLISNKKNEPEWMLDWRLKAYNHWLKL  65

Query  1612  KEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANV  1433
             +EPKWS+ +YP IN+QDI YY+ PK K  LNSLDEADPEL+  FEKLG+ LNE+ RL  V
Sbjct  66    EEPKWSNVKYPIINYQDIIYYAAPKPKKQLNSLDEADPELLATFEKLGISLNEQKRLTGV  125

Query  1432  AVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNS  1253
             AVD V+DSVSIAT+ ++ L + GVIFCSISEAI+ +P+LV+KYLG VVP  DN++ ALNS
Sbjct  126   AVDVVMDSVSIATSFKEQLSEIGVIFCSISEAIQLHPELVKKYLGSVVPMTDNYFAALNS  185

Query  1252  AVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYD  1073
             AVF+DGSF Y+PK  RCPM++STYFRIN    GQFERTLIVA+D S+V YLEGCTAP  D
Sbjct  186   AVFTDGSFCYIPKGVRCPMELSTYFRINTENAGQFERTLIVAEDESYVSYLEGCTAPMRD  245

Query  1072  TNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQV  893
              NQLHAAVVEL  H  AEIKYSTVQNWY GD+ G GGI+NFVTKRG+C G  SKISWTQV
Sbjct  246   ENQLHAAVVELVAHAKAEIKYSTVQNWYPGDKNGLGGIYNFVTKRGMCKGDHSKISWTQV  305

Query  892   ETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISA  713
             ETGSAITWKYPSV+L+GD S+GEFYSVA TNN+QQADTGTKMIH GKNTRSRI+SKGISA
Sbjct  306   ETGSAITWKYPSVILKGDHSIGEFYSVAFTNNHQQADTGTKMIHLGKNTRSRIVSKGISA  365

Query  712   GHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSK  533
             GHS+N YRGLV+    A NARN SQCDS+L+G+   A+T+PYI+ KN +A +EHEATTSK
Sbjct  366   GHSQNSYRGLVRASKQATNARNYSQCDSLLLGDKCGAHTFPYIEVKNKTAIVEHEATTSK  425

Query  532   IGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             IGEDQLFY +QRGID E A+A +++GF ++V N+LP EF  E  +L+++ +EGSVG
Sbjct  426   IGEDQLFYCKQRGIDAETAVALIVNGFAKEVMNQLPMEFAVEAQKLLAISMEGSVG  481



>gb|AIE73525.1| Iron-sulfur cluster assembly protein SufB [Synechocystis sp. 
PCC 6714]
Length=480

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/475 (67%), Positives = 394/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++  +P+GLSE+ +RLIS++KNEP++ML+FRL++Y  ++ M E
Sbjct  6     VKNLVNQPYKYGFVTDIEADAIPRGLSEDVVRLISAKKNEPEFMLDFRLRAYRHWLTMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP IN+QDI YYS PK+ K  L SLDE DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  66    PNWPAVHYPPINYQDIIYYSAPKQSKKKLESLDEVDPALLETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSI TT ++ L + GVIFCSISEA++E+P+LV+KYLG VVP+ DNF+ ALNSA
Sbjct  126   VDAIFDSVSIGTTFKEKLAEDGVIFCSISEALQEHPELVQKYLGSVVPTADNFFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK  +CPM++STYFRIN  +TGQFERTLI+A++ + V YLEGCTAP YD+
Sbjct  186   VFSDGSFVFIPKGVKCPMELSTYFRINNGDTGQFERTLIIAEEGASVSYLEGCTAPMYDS  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVALDNADIKYSTVQNWYAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGKNTRSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S N YRGLV++   A  ARN SQCDSMLIG+ AAANT+PYIQ  N +A++EHEA+TSKI
Sbjct  366   NSANSYRGLVKMGPKAQGARNYSQCDSMLIGDRAAANTFPYIQVDNNTAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV NELP EF AE ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGISEEDAVSMLVSGFCKDVLNELPMEFAAEADKLLSLKLEGTVG  480



>ref|WP_010873770.1| cysteine desulfurase activator complex subunit SufB [Synechocystis 
sp. PCC 6803]
 ref|NP_442472.1| cysteine desulfurase [Synechocystis sp. PCC 6803]
 ref|YP_005384341.1| Fe-S assembly protein SufB [Synechocystis sp. PCC 6803 substr. 
GT-I]
 ref|YP_005387510.1| Fe-S assembly protein SufB [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 ref|YP_005410217.1| Fe-S assembly protein SufB [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 ref|YP_005652533.1| Fe-S assembly protein SufB [Synechocystis sp. PCC 6803]
 ref|YP_007452348.1| ABC transporter subunit [Synechocystis sp. PCC 6803]
 sp|Q55790.1|Y074_SYNY3 RecName: Full=UPF0051 protein slr0074 [Synechocystis sp. PCC 
6803 substr. Kazusa]
 dbj|BAA10542.1| ABC transporter subunit [Synechocystis sp. PCC 6803]
 dbj|BAK51328.1| Fe-S assembly protein SufB [Synechocystis sp. PCC 6803]
 dbj|BAL30326.1| Fe-S assembly protein SufB [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL33495.1| Fe-S assembly protein SufB [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL36664.1| Fe-S assembly protein SufB [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM53862.1| cysteine desulfurase [Bacillus subtilis BEST7613]
 gb|AGF52834.1| ABC transporter subunit [Synechocystis sp. PCC 6803]
Length=480

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/475 (68%), Positives = 393/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF   I++  +P+GLSE+ +RLIS++KNEP++ML+FRL++Y  ++ M E
Sbjct  6     VKNLVNQPYKYGFVTNIEADAIPRGLSEDVVRLISAKKNEPEFMLDFRLRAYRHWLTMAE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++QDI YYS PK+ K  L SLDE DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  66    PTWPAVHYPPIDYQDIIYYSAPKQSKKKLESLDEVDPALLETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSI TT ++ L + GVIFCSISEA++E+PDLV+KYLG VVP+ DNF+ ALNSA
Sbjct  126   VDAIFDSVSIGTTFKEKLAEDGVIFCSISEALQEHPDLVQKYLGSVVPTADNFFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK  +CPM++STYFRIN  +TGQFERTLI+A++ + V YLEGCTAP YDT
Sbjct  186   VFSDGSFVFIPKGVKCPMELSTYFRINNGDTGQFERTLIIAEEGASVSYLEGCTAPMYDT  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVALDNADIKYSTVQNWYAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGKNTRSIIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S N YRGLV++   A  ARN SQCDSMLIG+ AAANT+PYIQ  N +A++EHEA+TSKI
Sbjct  366   NSANSYRGLVKMGPKAQGARNYSQCDSMLIGDRAAANTFPYIQVDNNTAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV NELP EF AE ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGISEEDAVSMLVSGFCKDVLNELPMEFAAEADKLLSLKLEGTVG  480



>ref|WP_008278529.1| cysteine desulfurase activator complex subunit SufB [Cyanothece 
sp. CCY0110]
 gb|EAZ88385.1| component of SufBCD complex [Cyanothece sp. CCY0110]
Length=480

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/475 (67%), Positives = 398/475 (84%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+E+ IRLIS++KNEP++MLEFRLK+Y++++ M E
Sbjct  6     VKNLVNQPYKYGFVTDIEADTIPRGLNEDVIRLISAKKNEPEFMLEFRLKAYQQWLKMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP+I++Q+I YYS PK KK  L +LDE DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  66    PTWPHVNYPKIDYQNIIYYSAPKQKKEKLKNLDEVDPALLETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ TT+++ L + GVIFCSISEA+ E+P+LV+KYLG VVP  DNF+ ALN+A
Sbjct  126   VDAIFDSVSVGTTYKEKLAEDGVIFCSISEALEEHPELVKKYLGSVVPVGDNFFAALNAA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK  +CPM++STYFRIN  +TGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  186   VFSDGSFVFIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEEGASVSYLEGCTAPMYDS  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVALDNADIKYSTVQNWYAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGKNTRSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLVQ+   A  ARN SQCDSMLIG+NA ANT+PYIQ  N +A++EHEA+TSKI
Sbjct  366   NSKNSYRGLVQMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVDNNTAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV +ELP EF +E ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGISEEDAISMLVSGFCQDVLSELPMEFASEADKLLSLKLEGTVG  480



>ref|WP_025040285.1| cysteine desulfurase [Nitrosospira briensis]
Length=478

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/474 (66%), Positives = 389/474 (82%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             LQK + + YK GF  EI+S   PKGL+E+ IRLISS+K EP+W+LEFRLK+YE+++ M+E
Sbjct  5     LQKLVNQPYKHGFVTEIESDIAPKGLNEDIIRLISSKKEEPEWLLEFRLKAYEQWLKMEE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P+W + +YP+I+FQ I YY+ PK+K  LNS+DE DPEL++ FEKLGVP++ER  LA VAV
Sbjct  65    PRWPNVKYPKIDFQSISYYAAPKQKKKLNSMDEVDPELLRTFEKLGVPMHERAALAGVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             D + DSVS+ATT+++ L + G+IFCSISEA+ E+PDLVR+YLG VVP  DN+Y ALNSAV
Sbjct  125   DVIFDSVSVATTYKQKLAEVGIIFCSISEAVHEHPDLVRQYLGTVVPVGDNYYAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             F+DG+F ++PK  +CPM ++TYFRIN  E+GQFERTLI+  + S V YLEGCTAP +DTN
Sbjct  185   FTDGTFCFIPKGVKCPMDLATYFRINTEESGQFERTLIIGAEGSSVSYLEGCTAPKFDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + A+IKYSTVQNWYAGDE G GGI+NFVTKRGL  G  S+ISWTQVET
Sbjct  245   QLHAAVVELVAMDNADIKYSTVQNWYAGDENGMGGIYNFVTKRGLAKGVNSRISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS +L+G+ SVGEFYSVA+TNNYQQADTGTKM+H GKNTRS I+SKGISAGH
Sbjct  305   GSAITWKYPSCILQGENSVGEFYSVAVTNNYQQADTGTKMVHIGKNTRSTIVSKGISAGH  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV++  +A  ARN SQCDSMLIG+   A+T+PYIQ +N  A++EHEA+TSKIG
Sbjct  365   SNNSYRGLVRIAPTATGARNYSQCDSMLIGDKCGAHTFPYIQVRNQEAKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E+A++ +I+GFC+DVF +LP EF  E  +L+  KLEGSVG
Sbjct  425   EDQLFYFAQRGIGSEEAVSMIINGFCKDVFQQLPMEFAVEATKLLGFKLEGSVG  478



>ref|WP_008236070.1| Iron-sulfur cluster assembly protein SufB [Richelia intracellularis]
 emb|CCH68427.1| Iron-sulfur cluster assembly protein SufB [Richelia intracellularis 
HH01]
Length=478

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/474 (67%), Positives = 393/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GL+E+ I+LIS++KNEP++ML+FRLK+Y ++  M E
Sbjct  5     VKTLVSQPYKYGFVTDIEADTIPRGLNEDIIKLISAKKNEPEFMLDFRLKAYSKWKKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W+D  YP I++Q+I YYS PK+     SLDE DP L++ FEKLG+PL+E+ RL+NVAV
Sbjct  65    PDWADINYPPIDYQNIIYYSAPKQAEKKKSLDEVDPTLLETFEKLGIPLSEQKRLSNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DS+SIATT +  L K GVIFCSISEAI+EYP+LV+KYLG VVP  DN++ ALNSAV
Sbjct  125   DAIFDSISIATTFKDKLAKDGVIFCSISEAIKEYPELVKKYLGSVVPIADNYFSALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK  +CPM++STYFRIN+ +TGQFERTLI+AD+ S+V YLEGCTAP YDTN
Sbjct  185   FSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIIADEGSYVSYLEGCTAPMYDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAVVELITLDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCQGMNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVG FYSVALTNN QQADTGTKM+H G NTRS IISKGISAG 
Sbjct  305   GSAITWKYPSCVLVGDNSVGNFYSVALTNNMQQADTGTKMVHVGNNTRSTIISKGISAGK  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV++  +A+   N SQCDSMLIG+NA ANT+PYIQ +N +A++EHEA+ S++G
Sbjct  365   SSNSYRGLVKINPNAERTINYSQCDSMLIGDNAHANTFPYIQVQNQTAKVEHEASISRMG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             E+Q+FYF QRGI  E A++ M+SGFC+DVFN+LP EF  E ++L+SLKLEGS+G
Sbjct  425   EEQIFYFAQRGICMEDAVSIMVSGFCKDVFNQLPMEFAVEADRLLSLKLEGSIG  478



>ref|WP_017303873.1| cysteine desulfurase activator complex subunit SufB [Spirulina 
subsalsa]
Length=480

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/475 (68%), Positives = 396/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GLSEE +RLIS++KNEP++MLEFRL++Y +++ M E
Sbjct  6     VKTLVNQPYKYGFITDIETDTIPRGLSEEVVRLISAKKNEPEFMLEFRLRAYRQWLKMSE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPKKK-PTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W+   YP I++Q+I YYS PK K   L SLDE DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  66    PTWAHVGYPPIDYQNIIYYSAPKTKGEKLKSLDEVDPALLETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L ++GVIFCSISEAI E+P+LV+KYLG VVP  DN++ ALNSA
Sbjct  126   VDAIFDSVSIATTFKEKLAEAGVIFCSISEAIHEHPELVKKYLGSVVPVGDNYFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK   CPM++STYFRIN  +TGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  186   VFSDGSFVYIPKGVTCPMELSTYFRINNGDTGQFERTLIVAEEGASVSYLEGCTAPMYDS  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAA+VEL   + A IKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAIVELVALDNASIKYSTVQNWYAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKM+H GKNTRS IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMVHIGKNTRSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLV++   A  ARN SQCDSMLIG+ A ANT+PYIQ ++ SA++EHEA+TSKI
Sbjct  366   NSQNSYRGLVKMGPKAVGARNYSQCDSMLIGDCAEANTFPYIQVEHNSAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ +ISGFC+DVFN+LP EF AE ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGISAEDAISMLISGFCKDVFNQLPMEFAAEADKLLSLKLEGTVG  480



>ref|WP_029526761.1| cysteine desulfurase [Polaromonas glacialis]
Length=478

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/474 (66%), Positives = 390/474 (82%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             LQ  + + YK GF   I+S   PKGLSE+TIR+IS++KNEP W+L+FRLK+Y+ ++ M E
Sbjct  5     LQNLVNQPYKHGFVTNIESDVAPKGLSEQTIRMISAKKNEPAWLLDFRLKAYQAWLLMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W +  YP+I+FQ I YY+ PK+KP L+S+DE DPEL++ FEKLGVPL+ER  LA VAV
Sbjct  65    PAWPNVHYPKIDFQAISYYAAPKQKPKLSSMDEVDPELLRTFEKLGVPLHERMALAGVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             D + DSVS+ATT++  L ++G+IFCS+SEA+ E+P+LV+KYLG VVP+ DN+Y ALNSAV
Sbjct  125   DVIFDSVSVATTYKARLAEAGIIFCSMSEAVLEHPELVKKYLGTVVPTGDNYYAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             F+DGSF ++P+  +CPM +STYFRIN  E+GQFERTLIVA++ + V YLEGCTAP++ +N
Sbjct  185   FTDGSFCFIPRGVKCPMDLSTYFRINTEESGQFERTLIVAEEGASVSYLEGCTAPAFSSN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + A+IKYSTVQNWYAGDE G GGI+NFVTKRGL  G  S+ISWTQVET
Sbjct  245   QLHAAVVELVALDNADIKYSTVQNWYAGDENGVGGIYNFVTKRGLAKGVNSRISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPSV+L GD SVGEFYSVA+TN++QQADTGTKMIH GKNTRS I+SKGISAG 
Sbjct  305   GSAITWKYPSVILRGDNSVGEFYSVAVTNHHQQADTGTKMIHLGKNTRSTIVSKGISAGQ  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV+VM +A  ARN SQCDSMLIG+ + A+T+PYIQ +NP+A++EHEA+TSKIG
Sbjct  365   SNNSYRGLVKVMPTATGARNYSQCDSMLIGDKSGAHTFPYIQVRNPTAQVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A++ +I+GFC+DVF +LP EF  E  QL+  KLEG+VG
Sbjct  425   EDQLFYFAQRGISAEAAVSMIINGFCKDVFQQLPMEFAVEATQLLGFKLEGAVG  478



>ref|WP_017326755.1| cysteine desulfurase activator complex subunit SufB [Synechococcus 
sp. PCC 7336]
Length=479

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/472 (68%), Positives = 390/472 (83%), Gaps = 1/472 (0%)
 Frame = -3

Query  1777  FLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKW  1598
              + + YK+GF   I+S T+PKGLSE+ +RLIS++KNEPD++LEFRL++Y +++ + EP W
Sbjct  8     LVNQPYKYGFVSNIESETIPKGLSEDVVRLISAKKNEPDFLLEFRLRAYRQWLTLAEPHW  67

Query  1597  SDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAVDA  1421
             ++  YP ++FQ+I YYS PK+    + SLD+ DPEL+  FEKLG+PL+E+ RL NVAVDA
Sbjct  68    ANLNYPALDFQNIIYYSAPKQGSKKVESLDDLDPELLATFEKLGIPLSEQKRLGNVAVDA  127

Query  1420  VLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFS  1241
             V DSVSIATT ++ L K G+IFCSISEA+ +YP+LVRKYLG VVP  DNF+ ALNSAVFS
Sbjct  128   VFDSVSIATTFKQDLAKHGIIFCSISEAVHDYPELVRKYLGSVVPVGDNFFAALNSAVFS  187

Query  1240  DGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQL  1061
             DGSFVY+PK  +CPM +STYFRIN  E+GQFERTLIVA++ S V YLEGCTAP +DTNQL
Sbjct  188   DGSFVYIPKGVKCPMDLSTYFRINNGESGQFERTLIVAEEGSSVTYLEGCTAPMFDTNQL  247

Query  1060  HAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVETGS  881
             HAAVVEL   + AEIKYSTVQNWYAGDE G+GGI+NFVTKRGLC G  SKISWTQVETGS
Sbjct  248   HAAVVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVETGS  307

Query  880   AITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGHSR  701
             AITWKYPS VL GD S GEFYSVALTNN Q+ADTGTKMIH GKNT S IISKGISAG S 
Sbjct  308   AITWKYPSCVLAGDNSAGEFYSVALTNNCQEADTGTKMIHIGKNTSSTIISKGISAGRSN  367

Query  700   NCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIGED  521
             N YRG V+V   AD ARN +QCDSMLIG+   A+T+PYIQ++NP+A++EHEA+TSKIGED
Sbjct  368   NSYRGQVKVGPKADGARNYTQCDSMLIGDRCEASTFPYIQSQNPTAKVEHEASTSKIGED  427

Query  520   QLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             QLFYF QRGI  E A++ +I+GFC+DVFN+LP EF +E ++L+SLKLEGSVG
Sbjct  428   QLFYFLQRGISMEDAVSMIINGFCKDVFNQLPMEFASEADKLLSLKLEGSVG  479



>ref|WP_015145949.1| FeS assembly protein SufB [Pleurocapsa minor]
 ref|YP_007083211.1| FeS assembly protein SufB [Pleurocapsa sp. PCC 7327]
 gb|AFY79654.1| FeS assembly protein SufB [Pleurocapsa sp. PCC 7327]
Length=480

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/475 (68%), Positives = 393/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF   I+S T+P+GL+E+ IRLIS++KNEP++MLEFRLK+Y ++  M E
Sbjct  6     VKNIVNQPYKYGFVTNIESDTIPRGLNEDIIRLISAKKNEPEFMLEFRLKAYRQWQKMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P WS   YP I++Q+I YYS PK  K  L SL+E DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  66    PTWSHVSYPPIDYQNIIYYSAPKHNKEKLKSLEEVDPTLLETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L + GVIFCSISEA++E+P LV KY+G VVP  DN++ ALNSA
Sbjct  126   VDAIFDSVSIATTFKEKLAEHGVIFCSISEALQEHPKLVEKYIGSVVPVGDNYFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN  ETGQFERTLI+AD+ + V YLEGCTAP YD+
Sbjct  186   VFSDGSFVYIPKGVQCPMELSTYFRINNGETGQFERTLIIADEGACVSYLEGCTAPMYDS  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + AEIKYSTVQNW+AGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELIALDNAEIKYSTVQNWFAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  306   TGSAITWKYPSCVLIGDNSVGEFYSIALTNNKQQADTGTKMIHIGKNTRSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ  N SA++EHEA+TSKI
Sbjct  366   NSKNSYRGLVKMGPKATGARNYSQCDSMLIGDNAEANTFPYIQVDNNSAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV N+LP EF AE ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGISEEDAVSMLVSGFCKDVLNKLPMEFAAEADKLLSLKLEGTVG  480



>ref|WP_011294068.1| cysteine desulfurase activator complex subunit SufB [Prochlorococcus 
marinus]
 ref|YP_292627.1| cysteine desulfurase activator complex subunit SufB [Prochlorococcus 
marinus str. NATL2A]
 gb|AAZ58924.1| Iron-regulated ABC transporter membrane component SufB [Prochlorococcus 
marinus str. NATL2A]
Length=480

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/478 (65%), Positives = 401/478 (84%), Gaps = 0/478 (0%)
 Frame = -3

Query  1798  EDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFM  1619
             + + +++ + + YK+GF  EI++  +PKGL+E+ IRLIS++KNEP+++L+FRL++YE+++
Sbjct  3     QSNTVEEIVSQPYKYGFITEIETEKIPKGLNEDVIRLISAKKNEPEFLLKFRLRAYEQWL  62

Query  1618  NMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLA  1439
              MKEP WS   Y ++++QD+ YYS PK+     SLDE DP+L++ FEKLG+PL+E+ RL+
Sbjct  63    KMKEPDWSGLTYSKVDYQDLVYYSAPKQDIKKKSLDEVDPKLLETFEKLGIPLSEQKRLS  122

Query  1438  NVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGAL  1259
             NVAVDAV DSVSIATT+++ L + GVIFCSISEAI EYPDL+ KY+G VVP  DNF+ AL
Sbjct  123   NVAVDAVFDSVSIATTYKEKLAEHGVIFCSISEAISEYPDLIEKYMGTVVPINDNFFAAL  182

Query  1258  NSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPS  1079
             NSAVFSDGSFVY+PK   CPM++S+YFRIN+ +TGQFERTLI+A++SS V YLEGCTAP 
Sbjct  183   NSAVFSDGSFVYIPKGVECPMELSSYFRINSGDTGQFERTLIIAEESSSVSYLEGCTAPM  242

Query  1078  YDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWT  899
             +DTN LHAAVVEL   + A IKYSTVQNWYAG+EEG GGI+NFVTKRG C G +SKISW+
Sbjct  243   FDTNTLHAAVVELVALDNASIKYSTVQNWYAGNEEGVGGIYNFVTKRGECRGKKSKISWS  302

Query  898   QVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGI  719
             QVETGSAITWKYPS VL+GD S+GEFYS+ALTNN Q+ADTGTKMIH GKNT+S+I+SKGI
Sbjct  303   QVETGSAITWKYPSCVLQGDNSIGEFYSIALTNNCQKADTGTKMIHIGKNTKSKIVSKGI  362

Query  718   SAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATT  539
             SAG S+N YRGLV +  +A+ ARN SQCDSMLIG+ A+ANTYPYIQ+K P + IEHEA+T
Sbjct  363   SAGKSKNSYRGLVSISPNAEGARNYSQCDSMLIGDKASANTYPYIQSKQPQSNIEHEAST  422

Query  538   SKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
              +I EDQLFY Q RGID+E++++ ++SGFC DVFNELP EF +E ++L++LKLEGSVG
Sbjct  423   CRISEDQLFYLQSRGIDFEESVSMLVSGFCSDVFNELPMEFASEADKLLALKLEGSVG  480



>ref|WP_011822933.1| cysteine desulfurase activator complex subunit SufB [Prochlorococcus 
marinus]
 ref|YP_001013966.1| cysteine desulfurase activator complex subunit SufB [Prochlorococcus 
marinus str. NATL1A]
 gb|ABM74701.1| ABC transporter, membrane component [Prochlorococcus marinus 
str. NATL1A]
Length=480

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/478 (65%), Positives = 401/478 (84%), Gaps = 0/478 (0%)
 Frame = -3

Query  1798  EDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFM  1619
             + + +++ + + YK+GF  EI++  +PKGL+E+ IRLISS+KNEP+++L+FRL++YE+++
Sbjct  3     QSNTVEEIVSQPYKYGFITEIETEKIPKGLNEDVIRLISSKKNEPEFLLKFRLRAYEQWL  62

Query  1618  NMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLA  1439
              MKEP WS   Y ++++QD+ YY+ PK+     SLDE DP+L++ FEKLG+PL+E+ RL+
Sbjct  63    KMKEPDWSGLTYSKVDYQDLVYYAAPKQDIKKKSLDEVDPKLLETFEKLGIPLSEQKRLS  122

Query  1438  NVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGAL  1259
             NVAVDAV DSVSIATT+++ L + GVIFCSISEAI EYPDL+ KY+G VVP  DNF+ AL
Sbjct  123   NVAVDAVFDSVSIATTYKEKLAEHGVIFCSISEAISEYPDLIEKYMGTVVPLNDNFFAAL  182

Query  1258  NSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPS  1079
             NSAVFSDGSFVY+PK   CPM++S+YFRIN+ +TGQFERTLI+A++SS V YLEGCTAP 
Sbjct  183   NSAVFSDGSFVYIPKGVECPMELSSYFRINSGDTGQFERTLIIAEESSSVSYLEGCTAPM  242

Query  1078  YDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWT  899
             +DTN LHAAVVEL   + A IKYSTVQNWYAG+EEG GGI+NFVTKRG C G +SKISW+
Sbjct  243   FDTNTLHAAVVELVALDNASIKYSTVQNWYAGNEEGVGGIYNFVTKRGECRGKKSKISWS  302

Query  898   QVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGI  719
             QVETGSAITWKYPS VL+GD S+GEFYS+ALTNN Q+ADTGTKMIH GKNT+S+I+SKGI
Sbjct  303   QVETGSAITWKYPSCVLQGDNSIGEFYSIALTNNCQKADTGTKMIHIGKNTKSKIVSKGI  362

Query  718   SAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATT  539
             SAG S+N YRGLV +  +A+ ARN SQCDSMLIG+ A+ANTYPYIQ+K P + IEHEA+T
Sbjct  363   SAGKSKNSYRGLVSISPNAEGARNYSQCDSMLIGDKASANTYPYIQSKQPQSNIEHEAST  422

Query  538   SKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
              +I EDQLFY Q RGID+E++++ ++SGFC DVFNELP EF +E ++L++LKLEGSVG
Sbjct  423   CRISEDQLFYLQSRGIDFEESVSMLVSGFCSDVFNELPMEFASEADKLLALKLEGSVG  480



>ref|WP_019508529.1| cysteine desulfurase activator complex subunit SufB [Pleurocapsa 
sp. PCC 7319]
Length=479

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/475 (67%), Positives = 394/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ T+P+GLSE+ IRLIS++KNEP++MLEFRLK+Y +++ M E
Sbjct  5     VKTLVNQPYKYGFVTDIETDTIPRGLSEDVIRLISAKKNEPEFMLEFRLKAYRQWLKMSE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKK-PTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++QDI YYS PKKK   L SLD+ DP L++ F+KLG+PL+E+ RL NVA
Sbjct  65    PDWPHVEYPAIDYQDIVYYSAPKKKQEKLGSLDDVDPALLETFDKLGIPLSEQKRLGNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSI TT ++ L + GVIFCSISEA++EYP+LV+KYLG VVP  DNF+ ALNSA
Sbjct  125   VDAIFDSVSIGTTFKEKLAEDGVIFCSISEALQEYPELVQKYLGSVVPVADNFFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++P+   CPM++STYFRIN  +TGQFERTLIVA++ + V YLEGCTAP +DT
Sbjct  185   VFSDGSFVFIPRGVTCPMELSTYFRINDGDTGQFERTLIVAEEGASVSYLEGCTAPMFDT  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNW+AGDE+G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNADIKYSTVQNWFAGDEDGKGGIYNFVTKRGLCKGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S+  YRGLV++ + A  ARN SQCDSMLIG+NA ANT+PYIQ  N +A++EHEA+T+KI
Sbjct  365   DSKGSYRGLVKIGNKAAGARNYSQCDSMLIGDNAEANTFPYIQVDNNTAKLEHEASTAKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GE+QLFYF QRGI  E A++ ++SGFC+DV NELP EF AE ++L+SLKLEG+VG
Sbjct  425   GEEQLFYFAQRGISEEDAVSMLVSGFCKDVLNELPMEFAAEADKLLSLKLEGTVG  479



>ref|WP_006511582.1| FeS assembly protein SufB [Xenococcus sp. PCC 7305]
 gb|ELS01367.1| FeS assembly protein SufB [Xenococcus sp. PCC 7305]
Length=479

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/475 (67%), Positives = 394/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++  +P+GLSE+ IRLISS+KNEP++MLEFRLK+Y +++ M E
Sbjct  5     VKNLVNQPYKYGFVTDIETDAIPRGLSEDIIRLISSKKNEPEFMLEFRLKAYSQWLKMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W+   YP I++QDI YYS PK KK  L SLD+ DP L++ FEKLG+PL+E+ RL NVA
Sbjct  65    PDWAHVGYPAIDYQDIVYYSAPKQKKEQLGSLDQVDPTLLETFEKLGIPLSEQKRLGNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L + GVIFCSISEA++EYP++++KYLG VVP  DNF+ ALNSA
Sbjct  125   VDAIFDSVSVATTFKEKLAEDGVIFCSISEALQEYPEIIQKYLGTVVPVADNFFTALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN  +TGQFERTLI+A++ + V YLEGCTAP +DT
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINDGDTGQFERTLIIAEEGASVSYLEGCTAPMFDT  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNW+AGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNADIKYSTVQNWFAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYP  VL GD SVGEFYS+ALTNN QQADTGTKMIH GKNTRS IISKG+SAG
Sbjct  305   TGSAITWKYPGCVLVGDNSVGEFYSIALTNNLQQADTGTKMIHIGKNTRSTIISKGVSAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+  YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ  N +A++EHEA+T+KI
Sbjct  365   NSKGSYRGLVKMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVDNNTAKVEHEASTAKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GE+QLFYF QRGI  E A++ ++SGFC+DV NELP EF AE ++L+SLKLEG+VG
Sbjct  425   GEEQLFYFAQRGISEEDAVSMLVSGFCKDVLNELPMEFAAEADKLLSLKLEGTVG  479



>ref|WP_015132392.1| iron-regulated ABC transporter membrane component SufB [Leptolyngbya 
sp. PCC 7376]
 ref|YP_007069439.1| iron-regulated ABC transporter membrane component SufB [Leptolyngbya 
sp. PCC 7376]
 gb|AFY36605.1| Iron-regulated ABC transporter membrane component SufB [Leptolyngbya 
sp. PCC 7376]
Length=479

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/475 (68%), Positives = 394/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++  +P+GLSE+ IRLIS++K EP++MLEFRLK+Y ++ NM E
Sbjct  5     VKTLVNQPYKYGFVTDIETEKIPRGLSEDVIRLISAKKKEPEFMLEFRLKAYRQWKNMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKK-PTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             PKW+   YP I++QDI YYS PKK      SLDE DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  65    PKWAHVNYPPIDYQDIVYYSAPKKDIKKAESLDEIDPALLETFEKLGIPLDEQKRLSNVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDAV DSVSIATT +K L K GVIFCSISEA+ E+P+LV+KYLG VVP+ DN++ ALNSA
Sbjct  125   VDAVFDSVSIATTFKKDLAKYGVIFCSISEALEEHPELVKKYLGTVVPTADNYFTALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK  +CPM++STYFRIN  ++GQFERTLI+A++ + V YLEGCTAP +DT
Sbjct  185   VFSDGSFVYIPKGVKCPMELSTYFRINDGDSGQFERTLIIAEEGASVSYLEGCTAPMFDT  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNW+AGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  245   NQLHAAVVELVALDNADIKYSTVQNWFAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  305   TGSAITWKYPSCVLLGDNSVGEFYSIALTNNLQQADTGTKMIHVGKNTRSTIISKGISAG  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S+N YRGLV++   AD ARN SQCDSMLIG+ A ANT+PYIQ  N +A++EHEA+T+KI
Sbjct  365   KSKNSYRGLVKMNPKADGARNYSQCDSMLIGDRAEANTFPYIQVDNKNAKVEHEASTAKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GE+QLFYF QRGI  E A++ ++SGFC+DV +ELP EF AE ++L+SLKLEG+VG
Sbjct  425   GEEQLFYFAQRGISEEDAISMLVSGFCKDVLSELPMEFAAEADKLLSLKLEGTVG  479



>ref|WP_011584370.1| cysteine desulfurase activator complex subunit SufB [Cytophaga 
hutchinsonii]
 ref|YP_677595.1| cysteine desulfurase activator complex subunit SufB [Cytophaga 
hutchinsonii ATCC 33406]
 gb|ABG58255.1| Iron-regulated ABC transporter membrane component SufB [Cytophaga 
hutchinsonii ATCC 33406]
Length=481

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/480 (65%), Positives = 396/480 (83%), Gaps = 0/480 (0%)
 Frame = -3

Query  1804  SNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYER  1625
             S+ +  L++    +YKWGF  +ID+ +LPKGL+E+T+R IS++KNEP+W+LE+RL ++ +
Sbjct  2     SDSNKILEEITSSEYKWGFVTDIDNDSLPKGLNEDTVRYISAKKNEPEWLLEWRLDAFRK  61

Query  1624  FMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNR  1445
             ++ M+EP W + +YP+I+FQDI YYS PK K TLNSLDE DPEL   FEKLG+ L+E+ R
Sbjct  62    WLKMEEPTWPNVKYPKIDFQDIIYYSAPKPKVTLNSLDEIDPELRATFEKLGISLDEQKR  121

Query  1444  LANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYG  1265
             +  VAVDAV+DSVSI TT +  L + G+IFCS+SEA++E+P+LVRKYLG VVP  DN+Y 
Sbjct  122   MTGVAVDAVIDSVSITTTFKGKLSELGIIFCSMSEAVQEHPELVRKYLGSVVPVTDNYYA  181

Query  1264  ALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTA  1085
             ALNSAVFSDGSF Y+PK  R PM++STYFRINA  TGQFERTL++AD+ ++V YLEGCTA
Sbjct  182   ALNSAVFSDGSFCYIPKGVRSPMELSTYFRINAANTGQFERTLLIADEGAYVSYLEGCTA  241

Query  1084  PSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKIS  905
             P  D NQLHAAVVEL   E AEIKYSTVQNWY GD+ G+GGI+NFVTKRG+CAG  +KIS
Sbjct  242   PVRDENQLHAAVVELVAMEKAEIKYSTVQNWYPGDKNGKGGIYNFVTKRGICAGDYAKIS  301

Query  904   WTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISK  725
             WTQVETGSA+TWKYPS +L+GD S+GEFYSVA+TNNYQQADTGTKMIH GKNT+SRI+SK
Sbjct  302   WTQVETGSAVTWKYPSCILKGDHSIGEFYSVAVTNNYQQADTGTKMIHIGKNTKSRIVSK  361

Query  724   GISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEA  545
             GISAGHS N YRGLV+VM  A+ ARN SQCDS+L+G+   A+T+PYI+ +N ++ +EHEA
Sbjct  362   GISAGHSHNSYRGLVKVMKRAEGARNYSQCDSLLMGDQCGAHTFPYIEVENNTSTVEHEA  421

Query  544   TTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             TTSKIGEDQ+FY  QRGID EKA+A +++G+C++V N+LP EF  E  +L+++ LEGSVG
Sbjct  422   TTSKIGEDQIFYCNQRGIDTEKAVALIVNGYCKEVLNQLPMEFAVEAQKLLAISLEGSVG  481



>ref|WP_013323186.1| cysteine desulfurase activator complex subunit SufB [Cyanothece 
sp. PCC 7822]
 ref|YP_003888368.1| FeS assembly protein SufB [Cyanothece sp. PCC 7822]
 gb|ADN15093.1| FeS assembly protein SufB [Cyanothece sp. PCC 7822]
Length=480

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/475 (68%), Positives = 394/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+P+GL+E+ IRLIS++KNEP++MLEFRLK+Y ++  M E
Sbjct  6     VKTLVNQPYKYGFVTDIESETVPRGLNEDIIRLISAKKNEPEFMLEFRLKAYRQWQKMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q+I YYS PK KK  L SL+E DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  66    PTWPHVDYPPIDYQNIIYYSAPKQKKAKLESLEEVDPALLETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L K GVIFCSISEA++E+P+LV+KYLG VVP  DN++ ALNSA
Sbjct  126   VDAIFDSVSIATTFKEKLAKEGVIFCSISEALQEHPELVQKYLGSVVPVNDNYFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK  +CPM++STYFRIN  +TGQFERTLIVA++ + V YLEGCTAP YDT
Sbjct  186   VFSDGSFVFIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEEGASVSYLEGCTAPMYDT  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNW+AGD  G+GGIFNFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVALDNADIKYSTVQNWFAGDANGKGGIFNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH GKNTRS IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHVGKNTRSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ  N +A++EHEA+TSKI
Sbjct  366   NSKNSYRGLVKMGPGAKGARNYSQCDSMLIGDNAEANTFPYIQVDNNTAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV + LP EF AE ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGISEEDAISMLVSGFCKDVLSALPMEFAAEADKLLSLKLEGTVG  480



>ref|WP_035990856.1| cysteine desulfurase [Leptolyngbya sp. KIOST-1]
Length=479

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/475 (67%), Positives = 395/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +Q  + + YK+GF  +I++  +P+GLSE+ +R+IS++KNEP +MLEFRL++Y +++ M E
Sbjct  5     VQSLVSQPYKYGFTTDIEADIIPRGLSEDVVRMISAKKNEPAFMLEFRLRAYRKWLTMPE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKK-PTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W +  YP I++Q+I YYS PK +   L SLDE DP L++ FEKLG+PL+E+ RLANVA
Sbjct  65    PAWPNVTYPPIDYQNIVYYSAPKTQVKKLGSLDEVDPTLLETFEKLGIPLSEQKRLANVA  124

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVS+ATT ++ L +SGVIFCSISEA++E+P+LV KYLG VVP  DN++ ALNSA
Sbjct  125   VDAIFDSVSVATTFKEKLAESGVIFCSISEALQEHPELVEKYLGTVVPIGDNYFAALNSA  184

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK+T+CPM +STYFRIN  ++GQFERTLIVA+  S V YLEGCTAP YD+
Sbjct  185   VFSDGSFVYIPKDTQCPMDLSTYFRINNGDSGQFERTLIVAEAGSSVTYLEGCTAPMYDS  244

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAA+VEL   + A I YSTVQNW+AGDE GRGGI+NFVTKRGLCAG  SKISWTQVE
Sbjct  245   NQLHAAIVELVAMDNATINYSTVQNWFAGDENGRGGIYNFVTKRGLCAGKNSKISWTQVE  304

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYSVALTNN+QQADTGTKM+H GKNT+S I+SKGISA 
Sbjct  305   TGSAITWKYPSCVLVGDNSVGEFYSVALTNNHQQADTGTKMVHVGKNTKSTIVSKGISAA  364

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S+N YRGLV++   A+ ARN SQCDSMLIG+ ++ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  365   KSKNSYRGLVKIGPKAEGARNYSQCDSMLIGDTSSANTFPYIQVQNSTAQVEHEASTSKI  424

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ +ISGFCRDVFN+LP EF AE ++L++LKLE SVG
Sbjct  425   GEDQLFYFAQRGISQEDAVSMIISGFCRDVFNKLPMEFAAEADKLLALKLENSVG  479



>ref|WP_018342941.1| cysteine desulfurase activator complex subunit SufB [Cytophaga 
aurantiaca]
Length=481

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/480 (65%), Positives = 396/480 (83%), Gaps = 0/480 (0%)
 Frame = -3

Query  1804  SNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYER  1625
             S+ +  L++    +YKWGF  +ID+ +LPKGL+E+T+R IS++KNEP+W+LE+RL ++ +
Sbjct  2     SDSNKILEEITSSEYKWGFVTDIDNDSLPKGLNEDTVRYISAKKNEPEWLLEWRLDAFRK  61

Query  1624  FMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNR  1445
             ++ M+EP W +  YP+I+FQDI YYS PK+K TLNSLDE DPEL   FEKLG+ L+E+ R
Sbjct  62    WLKMEEPIWPNVTYPKIDFQDIIYYSAPKQKVTLNSLDEIDPELRATFEKLGISLDEQKR  121

Query  1444  LANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYG  1265
             +  VAVDAV+DSVSI TT +  L + G+IFCS+SEA++E+P+LVRKYLG VVP  DN+Y 
Sbjct  122   MTGVAVDAVIDSVSITTTFKVKLSELGIIFCSMSEAVQEHPELVRKYLGSVVPVTDNYYA  181

Query  1264  ALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTA  1085
             ALNSAVFSDGSF Y+PK  R PM++STYFRINA  TGQFERTL++AD+SS+V YLEGCTA
Sbjct  182   ALNSAVFSDGSFCYIPKGVRSPMELSTYFRINAANTGQFERTLLIADESSYVSYLEGCTA  241

Query  1084  PSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKIS  905
             P  D NQLHAAVVEL   E AEIKYSTVQNWY GD+ G+GGI+NFVTKRG+CAG  +KIS
Sbjct  242   PVRDENQLHAAVVELVAMEKAEIKYSTVQNWYPGDKNGKGGIYNFVTKRGICAGDYAKIS  301

Query  904   WTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISK  725
             WTQVETGSA+TWKYPS +L+GD S+GEFYSVA+TNNYQQADTGTKMIH GKNT+SRI+SK
Sbjct  302   WTQVETGSAVTWKYPSCILKGDHSIGEFYSVAVTNNYQQADTGTKMIHIGKNTKSRIVSK  361

Query  724   GISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEA  545
             GISAGHS N YRGLV+VM  A+ ARN SQCDS+L+G+   A+T+PYI+ +N ++ +EHEA
Sbjct  362   GISAGHSHNSYRGLVKVMKRAEGARNYSQCDSLLMGDQCGAHTFPYIEVENNTSTVEHEA  421

Query  544   TTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             TTSKIGEDQ+FY  QRGI  EKA+A +++G+C++V N+LP EF  E  +L+++ LEGSVG
Sbjct  422   TTSKIGEDQIFYCNQRGIATEKAVALIVNGYCKEVLNQLPMEFAVEAQKLLAISLEGSVG  481



>gb|KFA90312.1| cysteine desulfurase [Cystobacter violaceus Cb vi76]
Length=478

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/474 (67%), Positives = 391/474 (82%), Gaps = 1/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +Q+  KR Y+ GF  +++S  +P GL+E+ IRLISS+K EPD+MLE+RL+++  ++ MKE
Sbjct  6     IQELTKRQYEAGFVTDVESEAIPPGLNEDIIRLISSKKGEPDFMLEWRLRAWRHWLTMKE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P+W    Y  IN+QDI YYS PKKKP L+SLD+ DPE++K +EKLG+PL+E+  + NVAV
Sbjct  66    PRWQKAEYSPINYQDIIYYSAPKKKPKLDSLDQVDPEILKTYEKLGIPLHEQKLMQNVAV  125

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVS+ATT +  L K+GVIFCS SEA+RE+P+LV+KYLG VVP  DNF+ ALNSAV
Sbjct  126   DAVFDSVSVATTFKDKLAKAGVIFCSFSEAVREHPELVKKYLGTVVPHSDNFFAALNSAV  185

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVYVPK  RCPM++STYFRINA  TGQFERTLIVAD+ ++V YLEGCTAP  DTN
Sbjct  186   FSDGSFVYVPKGVRCPMELSTYFRINAENTGQFERTLIVADEGAYVSYLEGCTAPMRDTN  245

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   +GA IKYSTVQNWY GDEEGRGGI+NFVTKRG+ A  RSKISWTQVET
Sbjct  246   QLHAAVVELVALDGATIKYSTVQNWYPGDEEGRGGIYNFVTKRGI-AHHRSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSA+TWKYPSV+L+GD+SVGEFYSVAL N+ QQADTGTKMIH G+N+RS I+SKGISAG 
Sbjct  305   GSAVTWKYPSVILKGDDSVGEFYSVALANHRQQADTGTKMIHLGRNSRSTIVSKGISAGR  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
              +N YRGLV+V+ SA+ ARN +QCDS+L+G+   A+T PYI+ KN SA++EHEA+TSKIG
Sbjct  365   GQNTYRGLVKVLKSAEGARNYTQCDSLLLGSKCGAHTLPYIEVKNSSAQVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFY QQRGI  E A++ +++GFCR VF ELP EF  E  +L+S+ LEGSVG
Sbjct  425   EDQLFYCQQRGISKEDAVSMIVNGFCRQVFKELPMEFAVEAQKLLSVSLEGSVG  478



>gb|AIA21269.1| cysteine desulfurase activator complex subunit SufB [Pyropia 
kanakaensis]
Length=487

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/474 (66%), Positives = 394/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             L   + + YK+GF   ++S   P+G+SE+ +RLIS +KNEP+++L FRLK+Y ++  M  
Sbjct  14    LDYIVNQPYKYGFKTSVESEQFPRGISEDIVRLISRKKNEPEYLLNFRLKAYRKWKKMSN  73

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W++ ++P I+F++I YY+ PK K  LNSLDE DPE++  F KLG+ LNE+ R++NVAV
Sbjct  74    PSWANIKHPNIDFKNIIYYAVPKLKKELNSLDEVDPEILDTFNKLGISLNEQKRISNVAV  133

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVSIATT +K L ++GVIFCSISEAIR+YPDL+ KYLG VVP+ DN++ ALNSAV
Sbjct  134   DAVFDSVSIATTFKKELSEAGVIFCSISEAIRDYPDLINKYLGTVVPAGDNYFAALNSAV  193

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSF Y+P NT CP+++STYFRIN  E+GQFERTLIVAD  S V YLEGCTAP +DTN
Sbjct  194   FSDGSFCYIPPNTVCPLELSTYFRINNEESGQFERTLIVADRGSKVSYLEGCTAPQFDTN  253

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAA+VEL   +GAEIKYSTVQNWYAG++EG+GGI+NFVTKRGLC+G+ SKISWTQVET
Sbjct  254   QLHAAIVELVALDGAEIKYSTVQNWYAGNQEGKGGIYNFVTKRGLCSGNNSKISWTQVET  313

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS +L G  S GEFYSVALTNNYQ+ADTGTKMIH G NT+SRIISKGISAG 
Sbjct  314   GSAITWKYPSCILAGHNSQGEFYSVALTNNYQEADTGTKMIHIGNNTKSRIISKGISAGK  373

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   + N+RN SQCDS+LIG ++ ANT+PYIQ +NP++++EHEA+TSKI 
Sbjct  374   SKNSYRGLVKIGPQSFNSRNYSQCDSLLIGQSSQANTFPYIQVQNPTSKVEHEASTSKIS  433

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQ+FYF QRGI  E+++A MISGFC+DVFNELP EF AE ++L+SLKLEG+VG
Sbjct  434   EDQIFYFLQRGISLEESVALMISGFCKDVFNELPMEFAAEADRLLSLKLEGTVG  487



>ref|WP_009194364.1| FeS cluster assembly protein sufB [Cesiribacter andamanensis]
 gb|EMR03905.1| FeS cluster assembly protein sufB [Cesiribacter andamanensis 
AMV16]
Length=481

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/480 (64%), Positives = 396/480 (83%), Gaps = 0/480 (0%)
 Frame = -3

Query  1804  SNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYER  1625
             + + + L+     +YKWG+  +I++ + PKGL+E+ IR IS++K EP+W+LE+RLK+Y +
Sbjct  2     AKDTEILESITSSEYKWGWETKIENDSAPKGLNEDIIRFISAKKEEPEWLLEWRLKAYHQ  61

Query  1624  FMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNR  1445
             +++MKEPKW + +YPE++FQDI YYS PKKKPT  SLDE DPEL+  F++LG+ L E+ R
Sbjct  62    WLSMKEPKWPNVQYPEVDFQDIIYYSAPKKKPTAKSLDEVDPELLDTFKRLGISLEEQKR  121

Query  1444  LANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYG  1265
             L  VAVDAV+DSVS+ATT +  L + G+IF S SEA++E+P+LVRKYLG VVP  DN+Y 
Sbjct  122   LTGVAVDAVIDSVSVATTFKAKLGELGIIFMSFSEAVKEHPELVRKYLGSVVPVTDNYYA  181

Query  1264  ALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTA  1085
             ALNSAVF+DGSF Y+PK  RCPM++STYFRINA  TGQFERTLIVAD+ S+V YLEGCTA
Sbjct  182   ALNSAVFTDGSFCYIPKGVRCPMELSTYFRINAANTGQFERTLIVADEGSYVSYLEGCTA  241

Query  1084  PSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKIS  905
             P  D NQLHAAVVE+Y  + AE+KYSTVQNWY GD++G+GGI+NFVTKRG+CAG  +KIS
Sbjct  242   PQRDENQLHAAVVEIYAAKKAEVKYSTVQNWYPGDKQGKGGIYNFVTKRGICAGDYAKIS  301

Query  904   WTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISK  725
             WTQVETGSAITWKYPS +L+GD SVGEFYSVA+TNNYQQADTGTKMIH GK+T+SRI+SK
Sbjct  302   WTQVETGSAITWKYPSCILKGDYSVGEFYSVAVTNNYQQADTGTKMIHIGKHTKSRIVSK  361

Query  724   GISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEA  545
             GISAG S+N YRGLVQ+M  A+ ARN SQCDS+L+G+   A+T+PYI+ +NP+A++EHEA
Sbjct  362   GISAGRSQNSYRGLVQIMKRAEGARNFSQCDSLLMGDKCGAHTFPYIEVENPTAKVEHEA  421

Query  544   TTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             TTSKIGEDQ+FY  QRGID E A+A +++G+ ++V  +LP EF  E  +L++L LEGSVG
Sbjct  422   TTSKIGEDQIFYCNQRGIDTEDAVALIVNGYAKEVLKQLPMEFAVEAQKLLALTLEGSVG  481



>ref|WP_022604423.1| FeS assembly protein SufB [Rubidibacter lacunae]
 gb|ERN42681.1| FeS assembly protein SufB [Rubidibacter lacunae KORDI 51-2]
Length=480

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/474 (68%), Positives = 387/474 (82%), Gaps = 1/474 (0%)
 Frame = -3

Query  1783  QKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEP  1604
             +  + R YK+GF  +I+S  LP GL EE +R IS++K EPD++LEFRLK++ ++  M EP
Sbjct  7     RTLVDRPYKYGFVTDIESDRLPPGLDEEVVRAISAKKEEPDFLLEFRLKAFRKWQKMTEP  66

Query  1603  KWSDNRYPEINFQDICYYSEPKKK-PTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             KW    YP I++Q I YYS PK +  TL SLDE DP L++ FEKLG+PL+E+ RL+NVAV
Sbjct  67    KWFHATYPPIDYQAISYYSAPKTQGKTLASLDEVDPALLETFEKLGIPLSEQKRLSNVAV  126

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVSIATT ++ L K GV+FCSI+EA+RE+P+L+ +YLG VVP+ DN++ ALNSAV
Sbjct  127   DAVFDSVSIATTFKEKLAKEGVVFCSIAEAVREHPELIERYLGSVVPAGDNYFAALNSAV  186

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK    PM++STYFRIN+ +TGQFERTLIVADD S+V YLEGCTAP YDTN
Sbjct  187   FSDGSFVYIPKGVTSPMELSTYFRINSGDTGQFERTLIVADDDSYVSYLEGCTAPMYDTN  246

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWYAGD EG+GGI+NFVTKRG C G RSKISWTQVET
Sbjct  247   QLHAAVVELVALDRAEIKYSTVQNWYAGDAEGKGGIYNFVTKRGKCQGVRSKISWTQVET  306

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAIT KYPS VL GD+S GEFYS+ALTNN QQADTGTKM+H GKNT+S IISKGISAGH
Sbjct  307   GSAITLKYPSCVLVGDDSAGEFYSIALTNNLQQADTGTKMVHVGKNTKSTIISKGISAGH  366

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ+    A++EHEATT+KIG
Sbjct  367   STNSYRGLVKMGPKAVGARNYSQCDSMLIGDNAEANTFPYIQSDTDRAKVEHEATTAKIG  426

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A++ ++SGFCRDVFN+LP EF AE ++L+SLKLE SVG
Sbjct  427   EDQLFYFAQRGISEEAAVSMLVSGFCRDVFNQLPMEFAAEADKLLSLKLENSVG  480



>ref|WP_002747962.1| feS assembly protein SufB [Microcystis aeruginosa]
 gb|ELS45618.1| feS assembly protein SufB [Microcystis aeruginosa DIANCHI905]
Length=490

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/487 (67%), Positives = 399/487 (82%), Gaps = 4/487 (1%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+P+GL+EE IRLIS++K EP++ML+FRL++Y ++  M E
Sbjct  6     VKNLVNQPYKYGFITDIESETIPRGLNEEIIRLISAKKKEPEFMLDFRLRAYHQWQKMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q+I YYS PK KK  LNSL+E DP LI+ FEKLG+PL+E+ RL+NVA
Sbjct  66    PSWPHVSYPAIDYQNIIYYSAPKQKKAKLNSLEEVDPTLIETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L + GVIFCSISEA++E+PDLV+KYLG VVP  DN++ ALNSA
Sbjct  126   VDAIFDSVSIATTFKEKLAEQGVIFCSISEALQEHPDLVQKYLGSVVPVGDNYFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK   CPM++STYFRIN  ETGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  186   VFSDGSFVFIPKGVVCPMELSTYFRINNGETGQFERTLIVAEEGASVSYLEGCTAPMYDS  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVALDNADIKYSTVQNWYAGDANGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH G+NT+S IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGRNTKSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ  N SA++EHEA+TSKI
Sbjct  366   NSQNSYRGLVKMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVDNNSAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG*AHRC  350
             GEDQLFYF QRGI  E A++ ++SGFC+DV ++LP EF AE ++L+SLKLEG+VG     
Sbjct  426   GEDQLFYFAQRGISEEDAVSMLVSGFCKDVLSKLPMEFAAEADKLLSLKLEGTVG---AF  482

Query  349   FSVNKKT  329
             FSV K T
Sbjct  483   FSVAKGT  489



>ref|WP_028461197.1| cysteine desulfurase [Nitrosomonas cryotolerans]
Length=478

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/474 (66%), Positives = 389/474 (82%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             LQ  + + YK GF  +I+S   PKGL+E+TIRLIS++K EP+W+L FRL++Y++++ M E
Sbjct  5     LQSLVNQPYKHGFVTKIESDVAPKGLNEDTIRLISAKKKEPEWLLAFRLQAYKKWLTMVE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W +  YP+I+FQ I YYS PK K  L S+DE DPEL++ FEKLGVP++ER  LA VAV
Sbjct  65    PHWQNVNYPKIDFQAISYYSAPKPKKKLASMDEVDPELLRTFEKLGVPMHERAALAGVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             D + DSVS+ATT+++ L + G+IFCSISEA++E+P+LV+KYLG VVP  DN+Y ALNSAV
Sbjct  125   DVIFDSVSVATTYKEKLSEVGIIFCSISEAVQEHPELVKKYLGSVVPVGDNYYAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             F+DGSF ++PK  +CPM +STYFRIN  E+GQFERTLI+A+D + + YLEGCTAP +D+N
Sbjct  185   FTDGSFCFIPKGVKCPMDLSTYFRINTEESGQFERTLIIAEDGASISYLEGCTAPRFDSN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + A+IKYSTVQNWYAGDE G GGI+NFVTKRGL  G  S+ISWTQVET
Sbjct  245   QLHAAVVELIALDNADIKYSTVQNWYAGDEHGIGGIYNFVTKRGLAKGVNSRISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             G+AITWKYPS +L GD SVGEFYSVA+TNNYQQADTGTKMIH GKNTRS I+SKGISAGH
Sbjct  305   GAAITWKYPSCILRGDNSVGEFYSVAVTNNYQQADTGTKMIHLGKNTRSTIVSKGISAGH  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S + YRGLV++  +AD ARN SQCDSMLIG+   A+T+PYIQ +N SA++EHEA+TSKIG
Sbjct  365   SNSSYRGLVKIAPTADGARNYSQCDSMLIGDQCGAHTFPYIQVRNNSAKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGID E+A++ +I+GFC+DVF +LP EF  E  +L+S KLEGSVG
Sbjct  425   EDQLFYFAQRGIDAEEAVSMIINGFCKDVFQQLPMEFAVEATKLLSFKLEGSVG  478



>ref|WP_006456920.1| cysteine desulfurase activator complex subunit SufB [Synechococcus 
sp. PCC 7335]
 gb|EDX87136.1| FeS assembly protein SufB [Synechococcus sp. PCC 7335]
Length=479

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/467 (69%), Positives = 390/467 (84%), Gaps = 1/467 (0%)
 Frame = -3

Query  1762  YKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEPKWSDNRY  1583
             YK+GF  +I+S +LP+GLSE+ +R IS++K EP +ML+FRLK+Y R++ ++EP W + +Y
Sbjct  13    YKYGFVTDIESDSLPRGLSEDVVRAISAKKEEPQFMLDFRLKAYRRWLELEEPTWPNVKY  72

Query  1582  PEINFQDICYYSEPKK-KPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAVDAVLDSV  1406
             P I++ +I YYS PK+ +  L SLDE DP L+  F+KLG+ +NE+ RLANVAVD V DSV
Sbjct  73    PPIDYNEIVYYSAPKQSEKKLGSLDEVDPALLDTFDKLGISINEQKRLANVAVDVVFDSV  132

Query  1405  SIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAVFSDGSFV  1226
             SIATT +K L K GVIFCSISEA++E+P+LV++YLG VVP  DN++ ALNSAVFSDGSFV
Sbjct  133   SIATTFKKDLAKHGVIFCSISEAVKEHPELVKEYLGTVVPVGDNYFTALNSAVFSDGSFV  192

Query  1225  YVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTNQLHAAVV  1046
             Y+PK  +CPM +STYFRIN  ++GQFERTLIVA++SS V YLEGCTAP YD+NQLHAAVV
Sbjct  193   YIPKGVKCPMDLSTYFRINNGDSGQFERTLIVAEESSSVTYLEGCTAPMYDSNQLHAAVV  252

Query  1045  ELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVETGSAITWK  866
             EL   + AEIKYSTVQNW+AGDE G+GGI+NFVTKRGLC G  SKISWTQVETGSAITWK
Sbjct  253   ELVALDSAEIKYSTVQNWFAGDENGKGGIYNFVTKRGLCKGDNSKISWTQVETGSAITWK  312

Query  865   YPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGHSRNCYRG  686
             YPS VL GD SVGEFYSVALTNNYQQADTGTKM+H GKNTRS IISKGISAG S+N YRG
Sbjct  313   YPSCVLAGDNSVGEFYSVALTNNYQQADTGTKMVHVGKNTRSTIISKGISAGKSKNSYRG  372

Query  685   LVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIGEDQLFYF  506
             LV+V   A+ ARN SQCDSML+G+ + ANT+PYIQ +N SA++EHEA+TSKIGEDQLFYF
Sbjct  373   LVKVNPKAEGARNYSQCDSMLLGDASNANTFPYIQVQNSSAQVEHEASTSKIGEDQLFYF  432

Query  505   QQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
              QRGI  E A++ +ISGFCRDVFNELP EF AE ++L+SLKLE SVG
Sbjct  433   AQRGISPEDAVSMIISGFCRDVFNELPMEFAAEADKLLSLKLENSVG  479



>gb|EMS62812.1| UPF0051 protein ABCI8, chloroplastic [Triticum urartu]
 gb|EMT14961.1| UPF0051 protein ABCI8, chloroplastic [Aegilops tauschii]
Length=417

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/417 (77%), Positives = 360/417 (86%), Gaps = 0/417 (0%)
 Frame = -3

Query  1615  MKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLAN  1436
             M EP WSDN Y  ++ Q +C+YS PK KP LNSLDE DPEL+K F++LG+PL E+ RL+N
Sbjct  1     MAEPTWSDNVYSPVDLQSLCFYSAPKTKPKLNSLDEVDPELLKTFDRLGIPLGEQKRLSN  60

Query  1435  VAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALN  1256
             VAVDAV+DS SIATTHR+ L   GVIFCSISEAIREYPDL+++Y+G +VP  DN+Y ALN
Sbjct  61    VAVDAVIDSTSIATTHREALMAKGVIFCSISEAIREYPDLIKRYIGSIVPPGDNYYAALN  120

Query  1255  SAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSY  1076
             SAVFSDGSF YVPK+T CPM+ISTYFRIN  ETGQFERTLIVAD+ S V YLEGCTAP+Y
Sbjct  121   SAVFSDGSFCYVPKDTVCPMEISTYFRINDKETGQFERTLIVADERSTVSYLEGCTAPAY  180

Query  1075  DTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQ  896
             D+NQLHAAVVEL C EGAEIKYSTVQNWYAGDEEG+GGI+NFVTKRG C G  SKISWTQ
Sbjct  181   DSNQLHAAVVELVCEEGAEIKYSTVQNWYAGDEEGKGGIYNFVTKRGRCKGRGSKISWTQ  240

Query  895   VETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGIS  716
             VETGSAITWKYPSV L GD++VGEFYSVALT +YQQADTGTKMIHKGKN+RSRIISKGIS
Sbjct  241   VETGSAITWKYPSVELVGDDTVGEFYSVALTKDYQQADTGTKMIHKGKNSRSRIISKGIS  300

Query  715   AGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTS  536
             AG SRNCYRGLVQ+ S A+NA NSSQCDS+LIG+NAAANTYP IQ    S R+EHEA+TS
Sbjct  301   AGKSRNCYRGLVQMNSGAENAYNSSQCDSLLIGDNAAANTYPTIQVGCTSGRVEHEASTS  360

Query  535   KIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             KIGEDQLFYFQQRGID+EKA+AAMI GFCR VF  LP EF  EV+ LM+LKLEGSVG
Sbjct  361   KIGEDQLFYFQQRGIDHEKAVAAMIGGFCRAVFEHLPYEFAQEVDALMNLKLEGSVG  417



>ref|WP_028979421.1| cysteine desulfurase [Sporocytophaga myxococcoides]
Length=481

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/474 (65%), Positives = 394/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             L++    +YK+GF  +I++ + PKGL+E+ ++ IS++KNEP W+LE+RLK+Y  ++ + E
Sbjct  8     LEEITSSEYKYGFETKIEADSAPKGLNEDIVKFISAKKNEPQWLLEWRLKAYRHWLKLTE  67

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W +  YP+IN+QDI YYS PK K  LNSLDE DPEL   F+KLG+ L+E+ RL+ VAV
Sbjct  68    PNWQNVNYPKINYQDIIYYSAPKPKVKLNSLDEIDPELKATFDKLGISLDEQKRLSGVAV  127

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV+DSVS+ATT++  L + G+IFCS+SEA++E+P+LV+KYLG VVP  DN+Y ALNSAV
Sbjct  128   DAVMDSVSVATTYKGKLAEQGIIFCSLSEAVQEHPELVKKYLGSVVPMTDNYYAALNSAV  187

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFV++PK  RCPM++STYFRINA  TGQFERTLIVA+DSS+V YLEGCTAP  D N
Sbjct  188   FSDGSFVFIPKGVRCPMELSTYFRINAANTGQFERTLIVAEDSSYVSYLEGCTAPMRDEN  247

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWY GD+EG+GGI+NFVTKRG+C+G+ SKISWTQVET
Sbjct  248   QLHAAVVELIAMDNAEIKYSTVQNWYPGDKEGKGGIYNFVTKRGICSGANSKISWTQVET  307

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GS+ITWKYPSV+L+GD S+GEFYSVA+TNN QQADTGTKMIH GKNTRSRI+SKGISAG 
Sbjct  308   GSSITWKYPSVILKGDNSIGEFYSVAVTNNMQQADTGTKMIHIGKNTRSRIVSKGISAGK  367

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV+VM  A+NARN SQCDS+L+G+   A+T+PYI+ KN +A +EHEATTSKIG
Sbjct  368   SQNSYRGLVEVMKRAENARNFSQCDSLLMGDKCGAHTFPYIEVKNNTATVEHEATTSKIG  427

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQ+FY  QRGI  E A+A +++G+C++V N+LP EF  E  +L+++ LEGSVG
Sbjct  428   EDQIFYCNQRGIGTEAAVALIVNGYCKEVLNQLPMEFAVEAQKLLAISLEGSVG  481



>ref|WP_026473878.1| cysteine desulfurase [Alkaliflexus imshenetskii]
Length=482

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/480 (66%), Positives = 390/480 (81%), Gaps = 0/480 (0%)
 Frame = -3

Query  1804  SNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYER  1625
             + +D  L++   R+Y++GF+ +I+   LPKGL+E  IR IS RKNEPD+MLEFRL +Y  
Sbjct  3     TEQDKLLEEVTNREYQYGFHTDIEMDMLPKGLNEGVIREISQRKNEPDFMLEFRLSAYRN  62

Query  1624  FMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNR  1445
             ++ M+ P W+  + PEI+FQ+I YY+ PKKKP LNSLDE DPEL   FEKLG+PL+E+  
Sbjct  63    WLKMESPDWAHLKIPEIDFQEIIYYAAPKKKPQLNSLDEVDPELRATFEKLGIPLDEQKV  122

Query  1444  LANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYG  1265
             LA VAVDA++DSVS+ TT R+TL + G+IFCS+SEA+ EYPDLV+KYLG VVP  DNF+ 
Sbjct  123   LAGVAVDAIIDSVSVKTTFRETLAEKGIIFCSMSEAVLEYPDLVKKYLGSVVPPGDNFFA  182

Query  1264  ALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTA  1085
             ALNSAVFSDGSFV++PK  RCPM++S+YFRINAM TGQFERTLIVA+D S+V YLEGCTA
Sbjct  183   ALNSAVFSDGSFVFIPKGVRCPMELSSYFRINAMNTGQFERTLIVAEDDSYVSYLEGCTA  242

Query  1084  PSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKIS  905
             P  D NQLHAAVVE+   + AE+KYSTVQNWY GD+ G+GGIFNFVTKRG+C G  SKIS
Sbjct  243   PMRDENQLHAAVVEIVTLDRAEVKYSTVQNWYPGDKNGKGGIFNFVTKRGICKGDYSKIS  302

Query  904   WTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISK  725
             WTQVETGSAITWKYPS +L GD +VGEFYSVALTNNYQQADTGTKMIH GKNTRS I+SK
Sbjct  303   WTQVETGSAITWKYPSCILMGDHTVGEFYSVALTNNYQQADTGTKMIHLGKNTRSLIVSK  362

Query  724   GISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEA  545
             GISAG S+N YRGLV+V   ADNARN SQCDS+L+G+   A+T+PY++  N +A++EHEA
Sbjct  363   GISAGKSQNSYRGLVKVSKKADNARNFSQCDSLLLGDKCGAHTFPYLEINNSTAKVEHEA  422

Query  544   TTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             TTSKIGEDQ+FY  QRGID E A+A +++G+ ++V N+LP EF  E  +L+ + LEGSVG
Sbjct  423   TTSKIGEDQIFYCNQRGIDTESAVALIVNGYVKEVINQLPMEFAVEAQKLLQISLEGSVG  482



>ref|WP_002747747.1| cysteine desulfurase activator complex subunit SufB [Microcystis 
aeruginosa]
 emb|CAO86890.1| sufB [Microcystis aeruginosa PCC 7806]
 emb|CCI02946.1| transport protein associated with Fe-S cluster assembly [Microcystis 
aeruginosa PCC 9443]
 gb|ELS45674.1| feS assembly protein SufB [Microcystis aeruginosa DIANCHI905]
Length=480

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/475 (68%), Positives = 394/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+P+GL+EE IRLIS++K EP++ML+FRL++Y ++  M E
Sbjct  6     VKNLVNQPYKYGFITDIESETIPRGLNEEIIRLISAKKKEPEFMLDFRLRAYHQWQKMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q+I YYS PK KK  LNSL+E DP LI+ FEKLG+PL+E+ RL+NVA
Sbjct  66    PSWPHVSYPAIDYQNIIYYSAPKQKKAKLNSLEEVDPTLIETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L + GVIFCSISEA++E+PDLV+KYLG VVP  DN++ ALNSA
Sbjct  126   VDAIFDSVSIATTFKEKLAEQGVIFCSISEALQEHPDLVQKYLGSVVPVGDNYFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK   CPM++STYFRIN  ETGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  186   VFSDGSFVFIPKGVVCPMELSTYFRINNGETGQFERTLIVAEEGASVSYLEGCTAPMYDS  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVALDNADIKYSTVQNWYAGDANGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH G+NT+S IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGRNTKSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ  N SA++EHEA+TSKI
Sbjct  366   NSQNSYRGLVKMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVDNNSAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV ++LP EF AE ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGISEEDAVSMLVSGFCKDVLSKLPMEFAAEADKLLSLKLEGTVG  480



>ref|WP_002758413.1| cysteine desulfurase activator complex subunit SufB [Microcystis 
aeruginosa]
 emb|CCH96315.1| transport protein associated with Fe-S cluster assembly [Microcystis 
aeruginosa PCC 9717]
 dbj|GAL94238.1| iron-sulfur cluster assembly protein SufB [Microcystis aeruginosa 
NIES-44]
Length=480

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/475 (68%), Positives = 394/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+P+GL+EE IRLIS++K EP++ML+FRL++Y ++  M E
Sbjct  6     VKNLVNQPYKYGFITDIESETIPRGLNEEIIRLISAKKKEPEFMLDFRLRAYHQWQKMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q+I YYS PK KK  LNSL+E DP LI+ FEKLG+PL+E+ RL+NVA
Sbjct  66    PSWPHVSYPAIDYQNIIYYSAPKQKKEKLNSLEEVDPTLIETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L + GVIFCSISEA++E+PDLV+KYLG VVP  DN++ ALNSA
Sbjct  126   VDAIFDSVSIATTFKEKLAEQGVIFCSISEALQEHPDLVQKYLGSVVPVGDNYFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK   CPM++STYFRIN  ETGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  186   VFSDGSFVFIPKGVACPMELSTYFRINNGETGQFERTLIVAEEGASVSYLEGCTAPMYDS  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVALDNADIKYSTVQNWYAGDANGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH G+NT+S IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGRNTKSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ  N SA++EHEA+TSKI
Sbjct  366   NSQNSYRGLVKMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVDNNSAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV ++LP EF AE ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGISEEDAVSMLVSGFCKDVLSKLPMEFAAEADKLLSLKLEGTVG  480



>ref|NP_053850.1| putative ABC transporter [Porphyra purpurea]
 sp|P51240.1|YCF24_PORPU RecName: Full=UPF0051 protein ycf24; AltName: Full=ORF487 (chloroplast) 
[Porphyra purpurea]
 gb|AAC08126.1| hypothetical chloroplast ORF 24 (chloroplast) [Porphyra purpurea]
Length=487

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/474 (66%), Positives = 391/474 (82%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             L   + + YK+GF   ++S   P+G+S E ++LIS +KNEP+++L FRLK+YE++  MK 
Sbjct  14    LDYIVNQPYKYGFTTSVESEQFPRGISREVVKLISKKKNEPEYLLNFRLKAYEKWTKMKN  73

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             PKW+  ++P I+F  I YY+ PK K  LNSLDE DPE++  F KLG+ LNE+ RL+NVAV
Sbjct  74    PKWAHLKHPNIDFNSIIYYAVPKLKKELNSLDEVDPEILDTFNKLGISLNEQKRLSNVAV  133

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVSIATT +K L ++GVIFCSISEAIR YPDL++KYLG VVPS DN++ ALNSAV
Sbjct  134   DAVFDSVSIATTFKKELAEAGVIFCSISEAIRNYPDLIQKYLGTVVPSGDNYFAALNSAV  193

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSF Y+P +T CP+++STYFRIN  E+GQFERTLIVAD  S V YLEGCTAP YDTN
Sbjct  194   FSDGSFCYIPPDTVCPLELSTYFRINNEESGQFERTLIVADRGSKVSYLEGCTAPQYDTN  253

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAA+VEL   + AEIKYSTVQNWYAG+++G+GGI+NFVTKRGLC+G  SKISWTQVET
Sbjct  254   QLHAAIVELIALDDAEIKYSTVQNWYAGNKDGKGGIYNFVTKRGLCSGKNSKISWTQVET  313

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYP  +L GD S GEFYSVALTNNYQ+ADTGTKMIH G NT+S+IISKGISAG 
Sbjct  314   GSAITWKYPGCILAGDNSQGEFYSVALTNNYQEADTGTKMIHIGNNTKSKIISKGISAGK  373

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   + N+RN SQCDS+LIG ++ ANT+PYIQ +NP+A++EHEA+TSKI 
Sbjct  374   SKNSYRGLVKIGPQSFNSRNYSQCDSLLIGQSSQANTFPYIQVQNPTAKVEHEASTSKIS  433

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQ+FYF QRGI+ E++++ MISGFC+DVFNELP EF  E ++L+SLKLEG+VG
Sbjct  434   EDQIFYFLQRGINLEESVSLMISGFCKDVFNELPMEFAVEADRLLSLKLEGTVG  487



>ref|WP_011380053.1| cysteine desulfurase activator complex subunit SufB [Nitrosospira 
multiformis]
 ref|YP_411395.1| cysteine desulfurase activator complex subunit SufB [Nitrosospira 
multiformis ATCC 25196]
 gb|ABB74003.1| Iron-regulated ABC transporter membrane component SufB [Nitrosospira 
multiformis ATCC 25196]
Length=478

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/474 (66%), Positives = 390/474 (82%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             LQ  + + YK GF  EI+S   PKGL+E+ IRLIS++KNEP W+L+FRLK+Y++++ M+E
Sbjct  5     LQNLVNQPYKHGFVTEIESDVAPKGLNEDIIRLISTKKNEPAWLLDFRLKAYQQWLKMEE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             PKW + +YP I+FQ I YY+ PK K  L+S+DE DPEL++ FEKLGVP++ER  LA VAV
Sbjct  65    PKWPNVKYPRIDFQAISYYAAPKPKKKLSSMDEVDPELLRTFEKLGVPMHERAALAGVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             D + DSVS+ATT+++ L + G+IFCSISEA+  YP+LV++YLG VVP  DN+Y ALNSAV
Sbjct  125   DVIFDSVSVATTYKQKLAEVGIIFCSISEAVHAYPELVKQYLGTVVPVGDNYYAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             F+DG+F ++PK  +CPM +STYFRIN  E+GQFERTLIVA++ S V YLEGCTAP +DTN
Sbjct  185   FTDGTFCFIPKGVKCPMDLSTYFRINTEESGQFERTLIVAEEGSSVSYLEGCTAPRFDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + A+IKYSTVQNWYAGDE+G GGI+NFVTKRGL  G+ S+ISWTQVET
Sbjct  245   QLHAAVVELIALDNADIKYSTVQNWYAGDEKGVGGIYNFVTKRGLAKGANSRISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS +L+G+ SVGEFYSVA+TNNYQQADTGTKMIH GKNTRS I+SKGISAGH
Sbjct  305   GSAITWKYPSCILQGENSVGEFYSVAVTNNYQQADTGTKMIHIGKNTRSTIVSKGISAGH  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV++  +A  ARN SQCDSMLIG+   A+T+PYIQ +N +A++EHEA+TSKIG
Sbjct  365   SNNSYRGLVRIAPTASGARNYSQCDSMLIGDQCGAHTFPYIQVRNQNAKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E+A++ +I+GFC+DVF +LP EF  E  +L+  KLEGSVG
Sbjct  425   EDQLFYFAQRGIGNEEAVSMIINGFCKDVFQQLPMEFAVEATKLLGFKLEGSVG  478



>ref|WP_002738588.1| feS assembly protein SufB [Microcystis aeruginosa]
 gb|ELP52677.1| feS assembly protein SufB [Microcystis aeruginosa TAIHU98]
Length=480

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/475 (68%), Positives = 394/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+P+GL+EE IRLIS++K EP++ML+FRL++Y ++  M E
Sbjct  6     VKNLVNQPYKYGFITDIESETIPRGLNEEIIRLISAKKKEPEFMLDFRLRAYHQWQKMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q+I YYS PK KK  LNSL+E DP LI+ FEKLG+PL+E+ RL+NVA
Sbjct  66    PSWPHVSYPAIDYQNIIYYSAPKQKKAKLNSLEEVDPTLIETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L + GVIFCSISEA++E+PDLV+KYLG VVP  DN++ ALNSA
Sbjct  126   VDAIFDSVSIATTFKEKLAEQGVIFCSISEALQEHPDLVQKYLGTVVPVGDNYFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK   CPM++STYFRIN  ETGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  186   VFSDGSFVFIPKGVVCPMELSTYFRINNGETGQFERTLIVAEEGASVSYLEGCTAPMYDS  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVALDNADIKYSTVQNWYAGDANGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH G+NT+S IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGRNTKSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ  N SA++EHEA+TSKI
Sbjct  366   NSQNSYRGLVKMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVDNNSAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV ++LP EF AE ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGISEEDAVSMLVSGFCKDVLSKLPMEFAAEADKLLSLKLEGTVG  480



>ref|WP_036904809.1| cysteine desulfurase [Prochlorococcus marinus]
 gb|KGG21781.1| Iron-sulfur cluster assembly protein SufB [Prochlorococcus marinus 
str. PAC1]
Length=480

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/478 (65%), Positives = 401/478 (84%), Gaps = 0/478 (0%)
 Frame = -3

Query  1798  EDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFM  1619
             + + +++ + + YK+GF  EI++  +PKGL+E+ IRLIS++KNEP+++L+FRL++YE+++
Sbjct  3     QSNTVEEIVSQPYKYGFITEIETEKIPKGLNEDVIRLISAKKNEPEFLLKFRLRAYEQWL  62

Query  1618  NMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLA  1439
              MKEP WS   Y ++++QD+ YY+ PK+     SLDE DP+L++ FEKLG+PL+E+ RL+
Sbjct  63    KMKEPDWSGLTYFKVDYQDLVYYAAPKQDIKKKSLDEVDPKLLETFEKLGIPLSEQKRLS  122

Query  1438  NVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGAL  1259
             NVAVDAV DSVSIATT+++ L + GVIFCSISEA+ EYPDL+ KY+G VVP  DNF+ AL
Sbjct  123   NVAVDAVFDSVSIATTYKEKLAEHGVIFCSISEAVSEYPDLIEKYMGTVVPINDNFFAAL  182

Query  1258  NSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPS  1079
             NSAVFSDGSFVY+PK   CPM++S+YFRIN+ +TGQFERTLI+A++SS V YLEGCTAP 
Sbjct  183   NSAVFSDGSFVYIPKGVDCPMELSSYFRINSGDTGQFERTLIIAEESSSVSYLEGCTAPM  242

Query  1078  YDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWT  899
             +DTN LHAAVVEL   + A IKYSTVQNWYAG+EEG GGI+NFVTKRG C G +SKISW+
Sbjct  243   FDTNTLHAAVVELVALDNASIKYSTVQNWYAGNEEGVGGIYNFVTKRGECRGKKSKISWS  302

Query  898   QVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGI  719
             QVETGSAITWKYPS VL+GD S+GEFYS+ALTNN Q+ADTGTKMIH GKNT+S+I+SKGI
Sbjct  303   QVETGSAITWKYPSCVLQGDNSIGEFYSIALTNNCQKADTGTKMIHIGKNTKSKIVSKGI  362

Query  718   SAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATT  539
             SAG S+N YRGLV +  +A+ ARN SQCDSMLIG+ A+ANTYPYIQ+K P + IEHEA+T
Sbjct  363   SAGKSKNSYRGLVSISPNAEGARNYSQCDSMLIGDKASANTYPYIQSKQPQSNIEHEAST  422

Query  538   SKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
              +I EDQLFY Q RGID+E++++ ++SGFC DVFNELP EF +E ++L++LKLEGSVG
Sbjct  423   CRISEDQLFYLQSRGIDFEESVSMLVSGFCSDVFNELPMEFASEADKLLALKLEGSVG  480



>ref|WP_018400764.1| cysteine desulfurase activator complex subunit SufB [filamentous 
cyanobacterium ESFC-1]
Length=480

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/475 (67%), Positives = 392/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+  TLP+GLSE+ IRLIS++K EP++MLEFRL++Y R++ M E
Sbjct  6     VKTLVNQPYKYGFITDIEKDTLPRGLSEDVIRLISAKKKEPEFMLEFRLRAYRRWLEMAE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPKKK-PTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q+I YYS PK+K   LNSLDE DP L++ FEKLG+PL+E+ RL+NVA
Sbjct  66    PAWPHVEYPPIDYQNIVYYSAPKQKDEKLNSLDEVDPTLLETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSI TT ++ L + GVIFCSISEA+ +YP+L+ KYLG VVP  DN++ ALNSA
Sbjct  126   VDAIFDSVSIGTTFKEKLAEDGVIFCSISEAVHDYPELIEKYLGSVVPVGDNYFTALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFVY+PK   CPM++STYFRIN  +TGQFERTLIVA++ + V YLEGCTAP YDT
Sbjct  186   VFSDGSFVYIPKGVTCPMELSTYFRINDGDTGQFERTLIVAEEGASVSYLEGCTAPMYDT  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNW+AGDE G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVALDNADIKYSTVQNWFAGDENGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKM+H G+NT+S IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMVHIGRNTKSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
              S+N YRGLV++   A  ARN SQCDSMLIG+ A ANT+PYIQ +N +A++EHEA+TSKI
Sbjct  366   GSKNSYRGLVKMGPKAKGARNYSQCDSMLIGDTAEANTFPYIQAENNTAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLF+F QRGI  E A++ +ISGFC+DVFN+LP EF AE ++L+SLKLEG+VG
Sbjct  426   GEDQLFFFAQRGISAEDAISMLISGFCKDVFNQLPMEFAAEADKLLSLKLEGTVG  480



>ref|WP_004174036.1| Iron-sulfur cluster assembly protein SufB [Nitrosospira sp. APG3]
 emb|CCU61019.1| Iron-sulfur cluster assembly protein SufB [Nitrosospira sp. APG3]
Length=478

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/474 (66%), Positives = 391/474 (82%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             LQ  + + YK GF  +I+S   PKGLSE+TI+LIS++K EP+W+LEFRLK+Y++++ M+E
Sbjct  5     LQNLVNQPYKHGFVTDIESDVAPKGLSEDTIKLISAKKEEPEWLLEFRLKAYQQWLKMEE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             PKWS+ +YP+I+FQ I YYS PK K  L+S+DE DPEL++ FEKLGVP++ER  LA VAV
Sbjct  65    PKWSNVKYPKIDFQAISYYSAPKPKKKLSSMDEVDPELLRTFEKLGVPMHERAALAGVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             D + DSVS+ATT+++ L + G+IFCSISEA+  +PDLV++YLG VVP  DN+Y ALNSAV
Sbjct  125   DVIFDSVSVATTYKQKLAEVGIIFCSISEAVHMHPDLVKQYLGTVVPVGDNYYAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             F+DG+F ++PK  +CPM +STYFRIN  E+GQFERTLI+A++ + V YLEGCTAP +DTN
Sbjct  185   FTDGTFCFLPKGVKCPMDLSTYFRINTEESGQFERTLIIAEEGASVSYLEGCTAPKFDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + A+IKYSTVQNWYAGDE G GGI+NFVTKRGL  G  S+ISWTQVET
Sbjct  245   QLHAAVVELVALDNADIKYSTVQNWYAGDENGLGGIYNFVTKRGLAKGVNSRISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL G+ SVGEFYSVA+TN+YQQADTGTKM+H GKNTRS I+SKGISAGH
Sbjct  305   GSAITWKYPSCVLLGENSVGEFYSVAVTNHYQQADTGTKMVHLGKNTRSTIVSKGISAGH  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV++  +A  ARN SQCDSMLIG+  +ANT+PYIQ +N +A++EHEA+TSKIG
Sbjct  365   SNNSYRGLVRIAPTAAGARNYSQCDSMLIGDECSANTFPYIQVRNHTAKVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E+A++ +I+GFC+DVF +LP EF  E  +L+  KLEGSVG
Sbjct  425   EDQLFYFAQRGIGNEEAVSMIINGFCKDVFQQLPMEFAVEATKLLGFKLEGSVG  478



>ref|WP_002783201.1| cysteine desulfurase activator complex subunit SufB [Microcystis 
aeruginosa]
 ref|YP_001657323.1| cysteine desulfurase activator complex subunit SufB [Microcystis 
aeruginosa NIES-843]
 dbj|BAG02131.1| Fe-S cluster assembly protein [Microcystis aeruginosa NIES-843]
 emb|CCI12815.1| transport protein associated with Fe-S cluster assembly [Microcystis 
aeruginosa PCC 9806]
 emb|CCI19030.1| transport protein associated with Fe-S cluster assembly [Microcystis 
aeruginosa PCC 9807]
 emb|CCI24205.1| transport protein associated with Fe-S cluster assembly [Microcystis 
aeruginosa PCC 9809]
Length=480

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/475 (68%), Positives = 394/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+P+GL+EE IRLIS++K EP++ML+FRL++Y ++  M E
Sbjct  6     VKNLVNQPYKYGFITDIESETIPRGLNEEIIRLISAKKKEPEFMLDFRLRAYHQWQKMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q+I YYS PK KK  LNSL+E DP LI+ FEKLG+PL+E+ RL+NVA
Sbjct  66    PSWPHVSYPAIDYQNIIYYSAPKQKKEKLNSLEEVDPTLIETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L + GVIFCSISEA++E+PDLV+KYLG VVP  DN++ ALNSA
Sbjct  126   VDAIFDSVSIATTFKEKLAEQGVIFCSISEALQEHPDLVQKYLGSVVPVGDNYFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK   CPM++STYFRIN  ETGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  186   VFSDGSFVFIPKGVVCPMELSTYFRINNGETGQFERTLIVAEEGASVSYLEGCTAPMYDS  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVALDNADIKYSTVQNWYAGDANGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH G+NT+S IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGRNTKSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ  N SA++EHEA+TSKI
Sbjct  366   NSQNSYRGLVKMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVDNNSAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV ++LP EF AE ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGISEEDAVSMLVSGFCKDVLSKLPMEFAAEADKLLSLKLEGTVG  480



>ref|WP_038032565.1| cysteine desulfurase [Thermonema rossianum]
Length=485

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/478 (67%), Positives = 390/478 (82%), Gaps = 1/478 (0%)
 Frame = -3

Query  1795  DDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMN  1616
             DD LQ+ +  DYK+GF   I+  T PKGL+E+ IR IS +KNEPDWMLE+RL ++ ++  
Sbjct  8     DDILQQHINSDYKYGFTTNIEIDTAPKGLNEDIIRFISKKKNEPDWMLEWRLNAFRQWQK  67

Query  1615  MKEPK-WSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLA  1439
             M+EP  W++ +YP IN+Q++ YY+ PK+K    SLDE DPEL + FEKLG+ L E+ RL 
Sbjct  68    MEEPHHWANIQYPPINYQELIYYAAPKQKKRPKSLDEVDPELRRTFEKLGISLEEQKRLT  127

Query  1438  NVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGAL  1259
              VAVDAV+DSVS+ TT R+ L + G+IFC ISEAI+EYPDLVRKYLG VVP  DNF+ AL
Sbjct  128   GVAVDAVMDSVSVITTFREKLAELGIIFCPISEAIQEYPDLVRKYLGSVVPVTDNFFAAL  187

Query  1258  NSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPS  1079
             NSAVFSDGSFVY+PK  RCPM++STYFRINA  TGQFERTLI+A++ ++V YLEGCTAP 
Sbjct  188   NSAVFSDGSFVYIPKGVRCPMELSTYFRINAQNTGQFERTLIIAEEGAYVSYLEGCTAPM  247

Query  1078  YDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWT  899
              D NQLHAAVVEL   + AEIKYSTVQNWY GD++G+GGI+NFVTKRG+CAG  SKISWT
Sbjct  248   RDENQLHAAVVELIALDNAEIKYSTVQNWYPGDKDGKGGIYNFVTKRGICAGKNSKISWT  307

Query  898   QVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGI  719
             QVETGSAITWKYPSV+L+GD SVGEFYSVA+TNNYQQADTGTKMIH GKNTRSRI+SKGI
Sbjct  308   QVETGSAITWKYPSVILKGDNSVGEFYSVAVTNNYQQADTGTKMIHIGKNTRSRIVSKGI  367

Query  718   SAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATT  539
             SAG S+N YRGLVQV   A+NARN SQCDS+LIG+   A+T+PYI+ KN +A +EHEATT
Sbjct  368   SAGKSQNSYRGLVQVHRRAENARNFSQCDSLLIGDKCGAHTFPYIEVKNNTAIVEHEATT  427

Query  538   SKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             SKIGEDQLFY QQRGID E A+A +++G+ ++V  +LP EF  E  +L+++ LEGSVG
Sbjct  428   SKIGEDQLFYCQQRGIDPETAVALIVNGYAKEVLKQLPMEFAVEAQKLLAISLEGSVG  485



>ref|WP_036395285.1| cysteine desulfurase [Microcystis aeruginosa]
Length=480

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/475 (68%), Positives = 394/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+P+GL+EE IRLIS++K EP++ML+FRL++Y ++  M E
Sbjct  6     VKNLVNQPYKYGFITDIESETIPRGLNEEIIRLISAKKKEPEFMLDFRLRAYHQWQKMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q+I YYS PK KK  LNSL+E DP LI+ FEKLG+PL+E+ RL+NVA
Sbjct  66    PSWPHVSYPAIDYQNIIYYSAPKQKKEKLNSLEEVDPTLIETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L + GVIFCSISEA++E+PDLV+KYLG VVP  DN++ ALNSA
Sbjct  126   VDAIFDSVSIATTFKEKLAEQGVIFCSISEALQEHPDLVQKYLGTVVPVGDNYFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK   CPM++STYFRIN  ETGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  186   VFSDGSFVFIPKGVVCPMELSTYFRINNGETGQFERTLIVAEEGASVSYLEGCTAPMYDS  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVALDNADIKYSTVQNWYAGDANGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH G+NT+S IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGRNTKSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ  N SA++EHEA+TSKI
Sbjct  366   NSQNSYRGLVKMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVDNNSAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV ++LP EF AE ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGISEEDAVSMLVSGFCKDVLSKLPMEFAAEADKLLSLKLEGTVG  480



>ref|WP_017662637.1| cysteine desulfurase activator complex subunit SufB [Geitlerinema 
sp. PCC 7105]
Length=480

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/476 (67%), Positives = 390/476 (82%), Gaps = 2/476 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I++ ++P GL+E+ IR IS +KNEP++MLEFRLK+Y +++ M+E
Sbjct  5     VKTLVNQPYKYGFVTDIETESVPPGLNEDVIRAISVKKNEPEFMLEFRLKAYRQWLKMEE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKK--PTLNSLDEADPELIKYFEKLGVPLNERNRLANV  1433
             P W    YP IN+QDI YYS PK K      SLDE DP L+  FEKLG+PL+E+ RLANV
Sbjct  65    PNWQHASYPPINYQDIVYYSAPKVKGDKKKQSLDEVDPALLDTFEKLGIPLSEQKRLANV  124

Query  1432  AVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNS  1253
             AVDA+ DSVS+ATT ++ L ++GVIFCSISEA++E+P+LV+KY+G VVP  DN++ ALNS
Sbjct  125   AVDAIFDSVSVATTFKEKLAEAGVIFCSISEALQEHPELVKKYIGSVVPVGDNYFAALNS  184

Query  1252  AVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYD  1073
             AVF+DGSFV++PK  +CPM +STYFRIN  E GQFERTLIVA++ + V YLEGCTAP +D
Sbjct  185   AVFTDGSFVFIPKGVKCPMDLSTYFRINNGEAGQFERTLIVAEEGASVTYLEGCTAPMFD  244

Query  1072  TNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQV  893
             TNQLHAAVVEL   + AEIKYSTVQNW+AGDEEG+GGI+NFVTKRGLC G  SKISWTQV
Sbjct  245   TNQLHAAVVELVALDDAEIKYSTVQNWFAGDEEGKGGIYNFVTKRGLCKGKNSKISWTQV  304

Query  892   ETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISA  713
             ETGSAITWKYPS VL GD SVGEFYSVALTNN QQADTGTKM+H GKNT+S IISKGISA
Sbjct  305   ETGSAITWKYPSCVLVGDNSVGEFYSVALTNNRQQADTGTKMVHIGKNTKSTIISKGISA  364

Query  712   GHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSK  533
             G S+N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYI   N  AR+EHEA+TSK
Sbjct  365   GKSKNSYRGLVKMGPKASGARNYSQCDSMLIGDNAEANTFPYIDVSNNKARVEHEASTSK  424

Query  532   IGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             IGEDQLFYF QRGI  E A++ +ISGFC+DVFNELP EF AE ++L+SLKLEG+VG
Sbjct  425   IGEDQLFYFAQRGISEEDAVSMIISGFCKDVFNELPMEFAAEADKLLSLKLEGTVG  480



>ref|WP_002632528.1| Iron-sulfur cluster assembly protein SufB [Cystobacter fuscus]
 gb|EPX57769.1| Iron-sulfur cluster assembly protein SufB [Cystobacter fuscus 
DSM 2262]
Length=478

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/474 (67%), Positives = 390/474 (82%), Gaps = 1/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             LQ+  KR Y+ GF   I+S T+P GL+E+ IR+IS++KNEP++MLE+RL++Y  ++ +KE
Sbjct  6     LQELTKRPYEAGFVTAIESETIPPGLNEDIIRIISAKKNEPEFMLEWRLRAYRHWLTLKE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P+W    Y  I++QDI YYS PK+KP L+SLD+ DPEL+K + KLG+PL E+ RL NVAV
Sbjct  66    PRWQKVEYAPIDYQDIIYYSAPKQKPKLDSLDQVDPELLKTYAKLGIPLEEQKRLQNVAV  125

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVS+ATT +  L K+GVIFCS SEA+RE+P+LVRKYLG VVP  DN++ ALNSAV
Sbjct  126   DAVFDSVSVATTFKDKLAKAGVIFCSFSEAVREHPELVRKYLGTVVPHSDNYFAALNSAV  185

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVY+PK  RCPM++STYFRINA  TGQFERTLIVAD+ S V YLEGCTAP  DTN
Sbjct  186   FSDGSFVYIPKGVRCPMELSTYFRINAENTGQFERTLIVADEGSTVSYLEGCTAPQRDTN  245

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   +GA IKYSTVQNWY GDE+GRGGI+NFVTKRG+ A  R+KISWTQVET
Sbjct  246   QLHAAVVELVALDGATIKYSTVQNWYPGDEQGRGGIYNFVTKRGI-AHHRAKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPSV+L+GD+SVGEFYSVAL N+ QQADTGTKMIH G+NT+S I+SKGISAG 
Sbjct  305   GSAITWKYPSVILKGDDSVGEFYSVALANHRQQADTGTKMIHLGRNTKSTIVSKGISAGR  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
              +N YRGLV+V+ SA+ ARN +QCDS+L+G+   A+T PYI+ KN SA++EHEA+TSKIG
Sbjct  365   GQNTYRGLVKVLKSAEGARNYTQCDSLLLGSKCGAHTLPYIEVKNASAQVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFY QQRGI  E A++ +++GFCR VF ELP EF  E  +L+S+ LEGSVG
Sbjct  425   EDQLFYCQQRGISKEDAVSMIVNGFCRQVFKELPMEFAVEAQKLLSVSLEGSVG  478



>ref|YP_009027524.1| cysteine desulfurase activator complex subunit SufB [Pyropia 
perforata]
 gb|AGQ17066.1| cysteine desulfurase activator complex subunit SufB [Pyropia 
perforata]
 gb|AHB35018.1| cysteine desulfurase activator complex subunit SufB (chloroplast) 
[Pyropia perforata]
 gb|AHB35227.1| cysteine desulfurase activator complex subunit SufB (chloroplast) 
[Pyropia perforata]
 gb|AIA19389.1| cysteine desulfurase activator complex subunit SufB [Pyropia 
perforata]
 gb|AIA19598.1| cysteine desulfurase activator complex subunit SufB [Pyropia 
perforata]
 gb|AIA19807.1| cysteine desulfurase activator complex subunit SufB [Pyropia 
perforata]
 gb|AIA20225.1| cysteine desulfurase activator complex subunit SufB [Pyropia 
perforata]
 gb|AIA20434.1| cysteine desulfurase activator complex subunit SufB [Pyropia 
perforata]
 gb|AIA20643.1| cysteine desulfurase activator complex subunit SufB [Pyropia 
perforata]
 gb|AIA20852.1| cysteine desulfurase activator complex subunit SufB [Pyropia 
perforata]
 gb|AIA21061.1| cysteine desulfurase activator complex subunit SufB [Pyropia 
perforata]
Length=487

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/474 (67%), Positives = 390/474 (82%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             L   + + YK+GF   I+S   P+G+ E  +RLIS +KNEP+++L FRLK+Y+++  M  
Sbjct  14    LDYIVNQPYKYGFKTSIESEQFPRGIDESIVRLISKKKNEPEYLLNFRLKAYKKWEKMIN  73

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W+  + P I+F  I YY+ PK K  LNSLDE DPE++  F KLG+ LNE+ R++NVAV
Sbjct  74    PSWAHLKNPNIDFNSIIYYAVPKLKKELNSLDEVDPEILDTFNKLGISLNEQKRISNVAV  133

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVSIATT RK L ++GVIFCSISEAIR+YPDLV KYLG VVP+ DN++ ALNSAV
Sbjct  134   DAVFDSVSIATTFRKELSEAGVIFCSISEAIRDYPDLVNKYLGTVVPAGDNYFAALNSAV  193

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSF Y+P NT CP+++STYFRIN  E+GQFERTLI+AD  S V YLEGCTAP +DTN
Sbjct  194   FSDGSFCYIPPNTVCPLELSTYFRINNEESGQFERTLIIADRGSKVSYLEGCTAPQFDTN  253

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAA+VEL   +GAEIKYSTVQNWYAG++EG+GGI+NFVTKRGLC+G+ SKISWTQVET
Sbjct  254   QLHAAIVELVALDGAEIKYSTVQNWYAGNQEGKGGIYNFVTKRGLCSGNNSKISWTQVET  313

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS +L G  S GEFYSVALTNNYQ+ADTGTKMIH G NT+SRIISKGISAG 
Sbjct  314   GSAITWKYPSCILAGHNSQGEFYSVALTNNYQEADTGTKMIHIGNNTKSRIISKGISAGK  373

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   + N+RN SQCDS+LIG ++ ANT+PYIQ +NP++++EHEA+TSKI 
Sbjct  374   SKNSYRGLVKISPQSFNSRNYSQCDSLLIGQSSQANTFPYIQVQNPTSKVEHEASTSKIS  433

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQ+FYF QRGI+ E+++A MISGFC+DVFNELP EF AE ++L+SLKLEG+VG
Sbjct  434   EDQIFYFLQRGINLEESVALMISGFCKDVFNELPMEFAAEADRLLSLKLEGTVG  487



>ref|WP_016481997.1| Iron-regulated ABC transporter membrane component SufB [Chthonomonas 
calidirosea]
 ref|YP_008088576.1| Iron-regulated ABC transporter membrane component SufB [Chthonomonas 
calidirosea T49]
 emb|CCW34435.1| Iron-regulated ABC transporter membrane component SufB [Chthonomonas 
calidirosea T49]
Length=481

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/474 (66%), Positives = 387/474 (82%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             +++F +++Y +GF  +I+  T+PKGL+EE IR+IS RKNEP W+ E+RL +Y  ++ MKE
Sbjct  8     IEEFARKEYAYGFETQIEIETVPKGLNEEIIRMISERKNEPAWLTEWRLNAYRHWLTMKE  67

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W++ +Y  I++QDI YY+ PKK+P LNSL+EADPELI+ FEKLG+ L E+ RL  VAV
Sbjct  68    PHWANVKYDPIDYQDIIYYAAPKKRPKLNSLEEADPELIRTFEKLGISLEEQKRLVGVAV  127

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVS+ATT +  L + G+IFCSISEA++E+PDLVR+YLG VVP  DNF+ ALNSAV
Sbjct  128   DAVFDSVSVATTFKDKLAELGIIFCSISEAVQEHPDLVREYLGSVVPPTDNFFAALNSAV  187

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDG+F YVPK  RCPM++STYFRINA +TGQFERTLI+AD+ ++V YLEGCTAP  D +
Sbjct  188   FSDGTFCYVPKGVRCPMELSTYFRINARDTGQFERTLIIADEGAYVSYLEGCTAPMRDEH  247

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + A IKYSTVQNWY GD+EGRGGI+NFVTKRG CAG  SKI+WTQVET
Sbjct  248   QLHAAVVELIALKDATIKYSTVQNWYPGDKEGRGGIYNFVTKRGKCAGENSKITWTQVET  307

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS +L GD SVGEFYSVALTN+YQQADTGTKMIH GKNTRS I+SKGISAGH
Sbjct  308   GSAITWKYPSCILLGDNSVGEFYSVALTNHYQQADTGTKMIHIGKNTRSTIVSKGISAGH  367

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
              +N YRGLV+V   AD ARN SQCDS+LIG+   A+T+PYI  +NP+A++EHEATTSKIG
Sbjct  368   GQNTYRGLVRVNPGADGARNYSQCDSLLIGDKCGAHTFPYIDVRNPTAQVEHEATTSKIG  427

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQ+FY  QRGI  E A+  +++GFC++VF ELP EF  E  +L+ + LEGSVG
Sbjct  428   EDQIFYCNQRGISTEDAVNMIVNGFCKEVFRELPMEFAVEAQKLLGVSLEGSVG  481



>ref|WP_009582772.1| Iron-sulfur cluster assembly protein SufB [Fulvivirga imtechensis]
 gb|ELR68971.1| Iron-sulfur cluster assembly protein SufB [Fulvivirga imtechensis 
AK7]
Length=481

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/480 (65%), Positives = 395/480 (82%), Gaps = 0/480 (0%)
 Frame = -3

Query  1804  SNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYER  1625
             S ++  L++F  ++Y+ G+  ++++   PKGLSEE IR IS++K EP+W+LE+RLK+Y  
Sbjct  2     SKDNQILEEFTSKEYEHGWTIDLEADQAPKGLSEEIIRFISAKKEEPEWLLEWRLKAYRS  61

Query  1624  FMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNR  1445
             +  MKEPKW++ ++P+I++QDI YYS PK+K    SLDE DPEL++ F+KLG+ L E+ R
Sbjct  62    WTKMKEPKWANVKFPDIDYQDIIYYSAPKQKVKPKSLDEIDPELLETFKKLGISLEEQKR  121

Query  1444  LANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYG  1265
             L  VAVDAVLDSVS+ATT +  L + G+IFCS SEA+RE+P+LV+KYLG VVP  DN+Y 
Sbjct  122   LTGVAVDAVLDSVSVATTFKDKLAELGIIFCSFSEAVREHPELVKKYLGSVVPISDNYYA  181

Query  1264  ALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTA  1085
             ALNSAVFSDGSF Y+PK  RCPM++STYFRINA  TGQFERTLIVA++ S+V YLEGCTA
Sbjct  182   ALNSAVFSDGSFCYIPKGVRCPMELSTYFRINAANTGQFERTLIVAEEGSYVSYLEGCTA  241

Query  1084  PSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKIS  905
             P  D NQLHAAVVE+Y  + AE+KYSTVQNWY GD+EGRGGI+NFVTKRG+CAG RSKIS
Sbjct  242   PQRDENQLHAAVVEIYAQKDAEVKYSTVQNWYPGDKEGRGGIYNFVTKRGICAGERSKIS  301

Query  904   WTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISK  725
             WTQVETGSAITWKYPS +L+GD S+GEFYSVA+TNN QQADTGTKMIH GKNT+SRI+SK
Sbjct  302   WTQVETGSAITWKYPSCILKGDYSIGEFYSVAVTNNMQQADTGTKMIHIGKNTKSRIVSK  361

Query  724   GISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEA  545
             G+SAG S+N YRG V++M  A+ ARN SQCDS+L+G+   A+T+PYI  +N SA++EHEA
Sbjct  362   GVSAGRSQNSYRGQVKIMKRAEGARNFSQCDSLLMGDKCGAHTFPYIDIENKSAQVEHEA  421

Query  544   TTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             TTSKIGEDQ+FY  QRGID EKA+A +++G+C++V N+LP EF  E  +L++L LEGSVG
Sbjct  422   TTSKIGEDQIFYCTQRGIDEEKAVALIVNGYCKEVLNQLPMEFAVEAQKLLALTLEGSVG  481



>ref|WP_026778678.1| cysteine desulfurase [Polaromonas sp. EUR3 1.2.1]
Length=478

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/474 (66%), Positives = 388/474 (82%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             LQ  + + YK GF  +I+S    KGLSE+TIRLIS++KNEP+W+LEFRLK++  ++ M E
Sbjct  5     LQNLVNQPYKHGFVTDIESDVAAKGLSEDTIRLISAKKNEPEWLLEFRLKAFRHWLTMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W++ ++P+I+FQ I YYS PK K  L+S+DE DPEL++ FEKLGVP++ER  LA VAV
Sbjct  65    PAWANVKHPKIDFQAISYYSAPKPKAKLSSMDEVDPELLRTFEKLGVPMHERAALAGVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             D + DSVS+ TT++  L + G+IF SISEA++ +P+LV+KYLG VVP+ DN+Y ALNSAV
Sbjct  125   DVIFDSVSVTTTYKARLAEVGIIFGSISEAVQNHPELVKKYLGTVVPTADNYYAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             F+DGSF ++PK  +CPM +STYFRIN  +TGQFERTLIVA++ + V YLEGCTAP +DTN
Sbjct  185   FTDGSFCFIPKGVKCPMDLSTYFRINTQDTGQFERTLIVAEEGASVSYLEGCTAPQFDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + A+IKYSTVQNWYAGDE G GGI+NFVTKRG+C G  S+ISWTQVET
Sbjct  245   QLHAAVVELVALDNADIKYSTVQNWYAGDENGVGGIYNFVTKRGMCRGVNSRISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS VL GD SVGEFYSVA+TN++QQADTGTKMIH GKNTRS I+SKGISAG 
Sbjct  305   GSAITWKYPSCVLLGDNSVGEFYSVAVTNHHQQADTGTKMIHIGKNTRSTIVSKGISAGQ  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S N YRGLV+VM  A  ARN SQCDSMLIG + +ANT+PYIQ +NPSA++EHEA+TSKIG
Sbjct  365   SSNSYRGLVKVMPKAAGARNYSQCDSMLIGEHCSANTFPYIQVRNPSAQVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQ+FYF QRGI  E+A++ +I+GFC+DVF +LP EF  E  +L+ LKLEGSVG
Sbjct  425   EDQMFYFAQRGIGAEEAVSMIINGFCKDVFRQLPMEFAVEATKLLGLKLEGSVG  478



>gb|AIA20016.1| cysteine desulfurase activator complex subunit SufB [Pyropia 
perforata]
Length=487

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/474 (67%), Positives = 390/474 (82%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             L   + + YK+GF   I+S   P+G+ E  +RLIS +KNEP+++L FRLK+Y+++  M  
Sbjct  14    LDYIVNQPYKYGFKTSIESEQFPRGIDENIVRLISKKKNEPEYLLNFRLKAYKKWEKMIN  73

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W+  + P I+F  I YY+ PK K  LNSLDE DPE++  F KLG+ LNE+ R++NVAV
Sbjct  74    PSWAHLKNPNIDFNSIIYYAVPKLKKELNSLDEVDPEILDTFNKLGISLNEQKRISNVAV  133

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVSIATT RK L ++GVIFCSISEAIR+YPDLV KYLG VVP+ DN++ ALNSAV
Sbjct  134   DAVFDSVSIATTFRKELSEAGVIFCSISEAIRDYPDLVNKYLGTVVPAGDNYFAALNSAV  193

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSF Y+P NT CP+++STYFRIN  E+GQFERTLI+AD  S V YLEGCTAP +DTN
Sbjct  194   FSDGSFCYIPPNTVCPLELSTYFRINNEESGQFERTLIIADRGSKVSYLEGCTAPQFDTN  253

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAA+VEL   +GAEIKYSTVQNWYAG++EG+GGI+NFVTKRGLC+G+ SKISWTQVET
Sbjct  254   QLHAAIVELVALDGAEIKYSTVQNWYAGNQEGKGGIYNFVTKRGLCSGNNSKISWTQVET  313

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS +L G  S GEFYSVALTNNYQ+ADTGTKMIH G NT+SRIISKGISAG 
Sbjct  314   GSAITWKYPSCILAGHNSQGEFYSVALTNNYQEADTGTKMIHIGNNTKSRIISKGISAGK  373

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   + N+RN SQCDS+LIG ++ ANT+PYIQ +NP++++EHEA+TSKI 
Sbjct  374   SKNSYRGLVKISPQSFNSRNYSQCDSLLIGQSSQANTFPYIQVQNPTSKVEHEASTSKIS  433

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQ+FYF QRGI+ E+++A MISGFC+DVFNELP EF AE ++L+SLKLEG+VG
Sbjct  434   EDQIFYFLQRGINLEESVALMISGFCKDVFNELPMEFAAEADRLLSLKLEGTVG  487



>ref|WP_002804340.1| cysteine desulfurase activator complex subunit SufB [Microcystis 
aeruginosa]
 emb|CCI38412.1| transport protein associated with Fe-S cluster assembly [Microcystis 
aeruginosa PCC 9701]
Length=480

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/475 (67%), Positives = 394/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+P+GL+EE IRLIS++K EP++ML+FRL++Y ++  M E
Sbjct  6     VKNLVNQPYKYGFITDIESETIPRGLNEEIIRLISAKKKEPEFMLDFRLRAYHQWQKMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q+I YYS PK KK  LNSL+E DP LI+ FEKLG+PL+E+ RL+NVA
Sbjct  66    PSWPHVSYPAIDYQNIIYYSAPKQKKEKLNSLEEVDPTLIETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L + GVIFCSISEA++E+P+LV+KYLG VVP  DN++ ALNSA
Sbjct  126   VDAIFDSVSIATTFKEKLAEQGVIFCSISEALQEHPELVQKYLGSVVPVGDNYFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK   CPM++STYFRIN  ETGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  186   VFSDGSFVFIPKGVACPMELSTYFRINNGETGQFERTLIVAEEGASVSYLEGCTAPMYDS  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVALDNADIKYSTVQNWYAGDANGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH G+NT+S IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGRNTKSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ  N SA++EHEA+TSKI
Sbjct  366   NSQNSYRGLVKMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVDNNSAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV ++LP EF AE ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGISEEDAVSMLVSGFCKDVLSKLPMEFAAEADKLLSLKLEGTVG  480



>gb|AFC39909.1| putative ABC transporter [Porphyra umbilicalis]
Length=487

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/474 (66%), Positives = 392/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             L   + + YK+GF   ++S   P+G+S+E ++LIS +KNEP+++L FRLK+Y+++  MK 
Sbjct  14    LDYIVNQPYKYGFTTSVESEQFPRGISQEVVKLISKKKNEPEYLLNFRLKAYDKWTKMKN  73

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W+  ++P I+F +I YY+ PK K  LNSLDE DPE++  F KLG+ LNE+ RL+NVAV
Sbjct  74    PTWAHLKHPTIDFNNIIYYAVPKLKKELNSLDEVDPEILDTFNKLGISLNEQKRLSNVAV  133

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVSIATT +K L ++GVIFCSISEAIR YPDL++KYLG VVPS DN++ ALNSAV
Sbjct  134   DAVFDSVSIATTFKKELAEAGVIFCSISEAIRNYPDLIQKYLGTVVPSGDNYFAALNSAV  193

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSF Y+P NT CP+++STYFRIN  E+GQFERTLIVAD  S V YLEGCTAP YDTN
Sbjct  194   FSDGSFCYIPPNTICPLELSTYFRINNEESGQFERTLIVADRGSKVSYLEGCTAPQYDTN  253

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAA+VEL   + AEIKYSTVQNWYAG+++G+GGI+NFVTKRGLC+G  SKISWTQVET
Sbjct  254   QLHAAIVELIALDDAEIKYSTVQNWYAGNKDGQGGIYNFVTKRGLCSGKNSKISWTQVET  313

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYP  +L GD S GEFYSVALTNNYQ+ADTGTKMIH G NT+S+IISKGISAG 
Sbjct  314   GSAITWKYPGCILAGDNSQGEFYSVALTNNYQEADTGTKMIHIGNNTKSKIISKGISAGK  373

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   + N+RN SQCDS+LIG+++ ANT+PYIQ +NP++++EHEA+TSKI 
Sbjct  374   SKNSYRGLVKIGPQSFNSRNYSQCDSLLIGHSSQANTFPYIQVQNPTSKVEHEASTSKIS  433

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQ+FYF QRGI  E++++ MISGFC+DVFNELP EF  E ++L+SLKLEG+VG
Sbjct  434   EDQIFYFLQRGISLEESVSLMISGFCKDVFNELPMEFAVEADRLLSLKLEGTVG  487



>ref|WP_014216531.1| cysteine desulfurase activator complex subunit SufB [Niastella 
koreensis]
 ref|YP_005006021.1| Iron-regulated ABC transporter membrane component SufB [Niastella 
koreensis GR20-10]
 gb|AEV96617.1| Iron-regulated ABC transporter membrane component SufB [Niastella 
koreensis GR20-10]
Length=481

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/480 (65%), Positives = 399/480 (83%), Gaps = 0/480 (0%)
 Frame = -3

Query  1804  SNEDDPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYER  1625
             +NE   ++K +  DYK+GF  EI++   P GL+E+TIR IS++KNEP+WMLE+RLK+Y  
Sbjct  2     NNELSAIEKTVLTDYKYGFVTEIEADEAPPGLNEDTIRFISAKKNEPEWMLEWRLKAYNH  61

Query  1624  FMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNR  1445
             ++ M+EP W++ +Y  IN+Q+I +YS PK+K  +NSLDE DPEL K FEKLG+ L+E+ R
Sbjct  62    WLKMQEPNWANIKYEPINYQEIKFYSAPKQKKKVNSLDEIDPELRKTFEKLGISLDEQKR  121

Query  1444  LANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYG  1265
             L+ VA+DAV+DS+SI TT ++ L + G+IFCSISEAI+E+P+LV+KY+G VVP  DN++ 
Sbjct  122   LSGVAIDAVIDSISIGTTFKEQLAELGIIFCSISEAIQEHPELVKKYIGSVVPITDNYFS  181

Query  1264  ALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTA  1085
             ALNSAVFSDGSF Y+PK  RCPM++STYFRINA  TGQFERTL++AD+ S+V YLEGCTA
Sbjct  182   ALNSAVFSDGSFCYIPKGVRCPMELSTYFRINAEGTGQFERTLLIADEGSYVSYLEGCTA  241

Query  1084  PSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKIS  905
             P  D NQLHAAVVEL  HE AEIKYSTVQNWY GD++G+GGI+NFVTKRG+CAG+RSKIS
Sbjct  242   PIRDENQLHAAVVELIAHENAEIKYSTVQNWYPGDKDGKGGIYNFVTKRGICAGARSKIS  301

Query  904   WTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISK  725
             WTQVETGS+ITWKYPSV+L+GD SVGEFYSVA+TNN+QQADTGTKM+H GKNTRSRI+SK
Sbjct  302   WTQVETGSSITWKYPSVILKGDYSVGEFYSVAVTNNHQQADTGTKMMHLGKNTRSRIVSK  361

Query  724   GISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEA  545
             GISAG S+N YRGLV V  +A N+RN SQCDS+L+G+   A+T+PYI+ KN +A +EHEA
Sbjct  362   GISAGVSQNSYRGLVHVGKNAANSRNFSQCDSLLLGDKCGAHTFPYIEVKNNTAVVEHEA  421

Query  544   TTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             TTSKIGEDQ+FY  QRGID E A+A +I+GF ++V N+LP EF  E  +L+++ LEGSVG
Sbjct  422   TTSKIGEDQIFYCNQRGIDTETAVALIINGFAKEVMNQLPMEFAVEAQKLLAISLEGSVG  481



>ref|WP_013966069.1| cysteine desulfurase activator complex subunit SufB [Nitrosomonas 
sp. Is79A3]
 ref|YP_004695208.1| FeS assembly protein SufB [Nitrosomonas sp. Is79A3]
 gb|AEJ01809.1| FeS assembly protein SufB [Nitrosomonas sp. Is79A3]
Length=478

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/474 (66%), Positives = 388/474 (82%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             LQ  + + YK GF  EI+S T PKGL+E+ IRLIS++KNEP+W+L FRLK+Y++++ M E
Sbjct  5     LQSLVNQPYKHGFVTEIESDTAPKGLNEDIIRLISTKKNEPEWLLSFRLKAYQKWLTMTE  64

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             PKW +  YP+I+FQ I YYS PK K  L S+DE DPEL++ FEKLGVP++ER  LA VAV
Sbjct  65    PKWQNVHYPKIDFQSISYYSAPKPKQKLASMDEVDPELLRTFEKLGVPMHERAALAGVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             D + DSVS+ATT+++ L + G+IFCSISEA++ +P+L++KYLG VVP  DN++ ALNSAV
Sbjct  125   DVIFDSVSVATTYKEKLAEIGIIFCSISEAVQNHPELIQKYLGSVVPVGDNYFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             F+DGSF ++PK  +CPM +STYFRIN   +GQFERTLI+A++ + V YLEGCTAP +DTN
Sbjct  185   FTDGSFCFIPKGVKCPMDLSTYFRINTEGSGQFERTLIIAEEGASVCYLEGCTAPRFDTN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + A+IKYSTVQNWYAGDE G GGI+NFVTKRGL  G  S+ISWTQVET
Sbjct  245   QLHAAVVELIALDNADIKYSTVQNWYAGDENGVGGIYNFVTKRGLAKGVNSRISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS +L GD SVGEFYSVA+TNNYQQADTGTKMIH GKNTRS I+SKGISAGH
Sbjct  305   GSAITWKYPSCILRGDNSVGEFYSVAVTNNYQQADTGTKMIHLGKNTRSTIVSKGISAGH  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S + YRGLV++  +A+ ARN SQCDSMLIG+ + A+T+PYIQ  N SA +EHEA+TSKIG
Sbjct  365   SNSSYRGLVRIAPTAEGARNYSQCDSMLIGDQSGAHTFPYIQVHNSSAIVEHEASTSKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGID E+A++ +I+GFC+DVF +LP EF  E  +L+S KLEGS+G
Sbjct  425   EDQLFYFSQRGIDAEEAVSMIINGFCKDVFQQLPMEFAVEATKLLSFKLEGSIG  478



>ref|WP_013742323.1| cysteine desulfurase activator complex subunit SufB [Pusillimonas 
sp. T7-7]
 ref|YP_004416411.1| hypothetical protein PT7_1247 [Pusillimonas sp. T7-7]
 gb|AEC19787.1| hypothetical protein PT7_1247 [Pusillimonas sp. T7-7]
Length=495

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/477 (66%), Positives = 390/477 (82%), Gaps = 1/477 (0%)
 Frame = -3

Query  1792  DPLQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNM  1613
             DP++ FL R+Y  GF  EI+S T+PKGLSE+TIRL+S++K EP++MLE+RL +Y  ++ M
Sbjct  19    DPIESFLDREYSAGFVTEIESVTIPKGLSEDTIRLLSAKKGEPEFMLEWRLAAYRHWLTM  78

Query  1612  KEPKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLAN  1436
               P+W+   +P I+FQDI YYS PK KK    SLDE DPEL++ +EKLGVPL+ER RLA 
Sbjct  79    DLPEWAKVSFPAIDFQDISYYSAPKSKKDGPKSLDEVDPELLRTYEKLGVPLHERARLAG  138

Query  1435  VAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALN  1256
             VAVDAV DSVS+ATT RK L + GVIFCS SEA++EYP+LVRKYLG VVP  DNFY ALN
Sbjct  139   VAVDAVFDSVSVATTFRKQLAEVGVIFCSFSEAVKEYPELVRKYLGSVVPPGDNFYAALN  198

Query  1255  SAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSY  1076
             SAVFSDGSFV++PK  RCPM++STYFRINA +TGQFERTLI+A++ + V YLEGCTAP  
Sbjct  199   SAVFSDGSFVFIPKGVRCPMELSTYFRINAQDTGQFERTLIIAEEGASVSYLEGCTAPMR  258

Query  1075  DTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQ  896
             D NQLHAAVVEL   + A+IKYSTVQNWY GD++G+GGI+NFVTKRG C G+RS+ISWTQ
Sbjct  259   DENQLHAAVVELVALDDAKIKYSTVQNWYPGDKDGKGGIYNFVTKRGDCRGARSRISWTQ  318

Query  895   VETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGIS  716
             VETGSAITWKYPSV+L GD+S+GEFYSVAL+N+ QQADTGTKMIH G+NTRS IISKGIS
Sbjct  319   VETGSAITWKYPSVILRGDDSIGEFYSVALSNHRQQADTGTKMIHIGRNTRSTIISKGIS  378

Query  715   AGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTS  536
             AGH  N YRGLV++   A+NARN +QCDS+LIG+  AA+T+P ++ +NPSA +EHEAT S
Sbjct  379   AGHGSNAYRGLVRITPKAENARNYTQCDSLLIGSKCAAHTFPTMEVQNPSASVEHEATAS  438

Query  535   KIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             +IGEDQLFY  QRG+  E A++ +++GFC++VF ELP EF  E   L+ + LEGSVG
Sbjct  439   RIGEDQLFYAMQRGLSAEDAVSMIVNGFCKEVFKELPMEFAVEAQNLLGVSLEGSVG  495



>ref|WP_015226195.1| iron-regulated ABC transporter membrane component SufB [Halothece 
sp. PCC 7418]
 ref|YP_007168534.1| iron-regulated ABC transporter membrane component SufB [Halothece 
sp. PCC 7418]
 gb|AFZ44320.1| Iron-regulated ABC transporter membrane component SufB [Halothece 
sp. PCC 7418]
Length=478

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/474 (67%), Positives = 393/474 (83%), Gaps = 1/474 (0%)
 Frame = -3

Query  1783  QKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEP  1604
             +  L + YK+GF  +I++ TLP+GL+E+ IR+IS++KNEP++ML+FRLK+Y +++ M EP
Sbjct  5     KTLLNQPYKYGFVTDIETETLPRGLNEDIIRMISAKKNEPEFMLDFRLKAYRQWLKMTEP  64

Query  1603  KWSDNRYPEINFQDICYYSEPKKKPTLN-SLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
              W+   Y  I+F DI YYS PKKK     SLDE DP L++ FEKLG+PL+E+ RL NVAV
Sbjct  65    NWAHVGYKPIDFNDIIYYSAPKKKEEKKESLDEVDPALLETFEKLGIPLSEQKRLGNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT ++ L + GVIFCSISEA++EYP+LV+KY+G VVPS DNF+ ALNSAV
Sbjct  125   DAIFDSVSVATTFKEKLAEEGVIFCSISEALQEYPELVKKYIGSVVPSGDNFFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVYVPK  +CPM++STYFRIN  E GQFERTLIVA++ + V YLEGCTAP YD+N
Sbjct  185   FSDGSFVYVPKGVQCPMELSTYFRINTDEAGQFERTLIVAEEGASVSYLEGCTAPMYDSN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAA+VEL   + A+IKYSTVQNW+AGDEEG+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAIVELVALDDADIKYSTVQNWFAGDEEGKGGIYNFVTKRGLCKGKNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSA+TWKYPS VL GD SVGEFYS+ALTNNYQQADTGTKMIH GKNT+S IISKGISAGH
Sbjct  305   GSAVTWKYPSCVLAGDNSVGEFYSIALTNNYQQADTGTKMIHIGKNTKSTIISKGISAGH  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   AD ARN SQCDSML+G+ A ANT+PYIQ  N   ++EHEA+T+KIG
Sbjct  365   SQNSYRGLVKMGPKADGARNYSQCDSMLVGDQAEANTFPYIQVDNNRTKVEHEASTAKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A++ ++SGFC++VFN+LP EF AE ++L++LKLE SVG
Sbjct  425   EDQLFYFAQRGISEEDAVSMIVSGFCKEVFNQLPMEFAAEADKLLALKLENSVG  478



>ref|YP_007947769.1| putative ABC transporter (chloroplast) [Pyropia haitanensis]
 gb|AGG37018.1| putative ABC transporter (chloroplast) [Pyropia haitanensis]
Length=487

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/474 (66%), Positives = 390/474 (82%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             L   + + YK+GF   ++S   P+G+ E  +RLIS +KNEP+++L FRLK+Y+++  M  
Sbjct  14    LDYIVNQPYKYGFKTSVESEQFPRGIDENIVRLISKKKNEPEYLLNFRLKAYKKWKKMSS  73

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W++ + P I+F  I YY+ PK K  LNSLDE DPE++  F KLG+ LNE+ R++NVAV
Sbjct  74    PSWANLKNPNIDFNSIIYYAVPKLKKELNSLDEVDPEILDTFNKLGISLNEQKRISNVAV  133

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVSIATT +K L  +GVIFCSISEAIR+YP+L+ KYLG VVP+ DN++ ALNSAV
Sbjct  134   DAVFDSVSIATTFKKELSAAGVIFCSISEAIRDYPNLIHKYLGTVVPAGDNYFAALNSAV  193

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSF Y+P NT CP+++STYFRIN  E+GQFERTLIVAD  S V YLEGCTAP +DTN
Sbjct  194   FSDGSFCYIPPNTVCPLELSTYFRINNEESGQFERTLIVADRGSKVSYLEGCTAPQFDTN  253

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAA+VEL   +GAEIKYSTVQNWYAG++EG+GGI+NFVTKRGLC+G+ SKISWTQVET
Sbjct  254   QLHAAIVELVALDGAEIKYSTVQNWYAGNQEGKGGIYNFVTKRGLCSGNNSKISWTQVET  313

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS +L G  S GEFYSVALTNNYQ+ADTGTKMIH G NT+SRIISKGISAG 
Sbjct  314   GSAITWKYPSCILAGHSSQGEFYSVALTNNYQEADTGTKMIHIGNNTKSRIISKGISAGK  373

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++ + + N+RN SQCDS+LIG ++ ANT+PYIQ +NP++++EHEA+TSKI 
Sbjct  374   SKNSYRGLVKIGAQSFNSRNYSQCDSLLIGQSSQANTFPYIQVQNPTSKVEHEASTSKIS  433

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQ+FYF QRGI  E+++A MISGFC+DVFNELP EF AE ++L+SLKLEG+VG
Sbjct  434   EDQIFYFLQRGISLEESVALMISGFCKDVFNELPMEFAAEADRLLSLKLEGTVG  487



>gb|EPF24305.1| FeS cluster assembly protein sufB [Microcystis aeruginosa SPC777]
Length=530

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/475 (68%), Positives = 394/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+P+GL+EE IRLIS++K EP++ML+FRL++Y ++  M E
Sbjct  56    VKNLVNQPYKYGFITDIESETIPRGLNEEIIRLISAKKKEPEFMLDFRLRAYHQWQKMTE  115

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q+I YYS PK KK  LNSL+E DP LI+ FEKLG+PL+E+ RL+NVA
Sbjct  116   PSWPHVSYPAIDYQNIIYYSAPKQKKEKLNSLEEVDPTLIETFEKLGIPLSEQKRLSNVA  175

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L + GVIFCSISEA++E+PDLV+KYLG VVP  DN++ ALNSA
Sbjct  176   VDAIFDSVSIATTFKEKLAEQGVIFCSISEALQEHPDLVQKYLGTVVPVGDNYFAALNSA  235

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK   CPM++STYFRIN  ETGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  236   VFSDGSFVFIPKGVVCPMELSTYFRINNGETGQFERTLIVAEEGASVSYLEGCTAPMYDS  295

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  296   NQLHAAVVELVALDNADIKYSTVQNWYAGDANGKGGIYNFVTKRGLCKGVNSKISWTQVE  355

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH G+NT+S IISKGISAG
Sbjct  356   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGRNTKSTIISKGISAG  415

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ  N SA++EHEA+TSKI
Sbjct  416   NSQNSYRGLVKMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVDNNSAKVEHEASTSKI  475

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV ++LP EF AE ++L+SLKLEG+VG
Sbjct  476   GEDQLFYFAQRGISEEDAVSMLVSGFCKDVLSKLPMEFAAEADKLLSLKLEGTVG  530



>ref|WP_008202041.1| cysteine desulfurase activator complex subunit SufB [Microcystis 
sp. T1-4]
 emb|CCI32629.1| transport protein associated with Fe-S cluster assembly [Microcystis 
sp. T1-4]
Length=480

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/475 (67%), Positives = 394/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+P+GL+EE IRLIS++K EP++ML+FRL++Y ++  M E
Sbjct  6     VKNLVNQPYKYGFITDIESETIPRGLNEEIIRLISAKKKEPEFMLDFRLRAYHQWQKMTE  65

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q+I YYS PK KK  LNSL+E DP LI+ FEKLG+PL+E+ RL+NVA
Sbjct  66    PSWPHVSYPAIDYQNIIYYSAPKQKKEKLNSLEEVDPTLIETFEKLGIPLSEQKRLSNVA  125

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L + GVIFCSISEA++E+P+LV+KYLG VVP  DN++ ALNSA
Sbjct  126   VDAIFDSVSIATTFKEKLAEQGVIFCSISEALQEHPELVQKYLGSVVPVGDNYFAALNSA  185

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK   CPM++STYFRIN  ETGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  186   VFSDGSFVFIPKGVVCPMELSTYFRINNGETGQFERTLIVAEEGASVSYLEGCTAPMYDS  245

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  246   NQLHAAVVELVALDNADIKYSTVQNWYAGDANGKGGIYNFVTKRGLCKGVNSKISWTQVE  305

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH G+NT+S IISKGISAG
Sbjct  306   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGRNTKSTIISKGISAG  365

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ  N SA++EHEA+TSKI
Sbjct  366   NSQNSYRGLVKMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVDNNSAKVEHEASTSKI  425

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV ++LP EF AE ++L+SLKLEG+VG
Sbjct  426   GEDQLFYFAQRGISEEDAVSMLVSGFCKDVLSKLPMEFAAEADKLLSLKLEGTVG  480



>dbj|GAL85044.1| cysteine desulfurase activator complex subunit SufB [Sporocytophaga 
myxococcoides]
Length=481

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/474 (65%), Positives = 393/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             L++    +YK+GF  +I++ + PKGL+E+ ++ IS++KNEP W+LE+RLK+Y  ++ + E
Sbjct  8     LEEITSSEYKYGFETKIEADSAPKGLNEDIVKFISAKKNEPQWLLEWRLKAYRHWLTLTE  67

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W +  YP+IN+QDI YYS PK K  LNSLDE DPEL   F+KLG+ L+E+ RL+ VAV
Sbjct  68    PNWQNVNYPKINYQDIIYYSAPKPKVKLNSLDEIDPELKATFDKLGISLDEQKRLSGVAV  127

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV+DSVS+ATT++  L + G+IFCS+SEA++E+P+LV+KYLG VVP  DN++ ALNSAV
Sbjct  128   DAVMDSVSVATTYKGKLAEQGIIFCSLSEAVQEHPELVKKYLGTVVPMTDNYFAALNSAV  187

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFV++PK  RCPM++STYFRINA  TGQFERTLIVA+DSS+V YLEGCTAP  D N
Sbjct  188   FSDGSFVFIPKGVRCPMELSTYFRINAANTGQFERTLIVAEDSSYVSYLEGCTAPMRDEN  247

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAAVVEL   + AEIKYSTVQNWY GD+EG+GGI+NFVTKRG+C+G  SKISWTQVET
Sbjct  248   QLHAAVVELIAMDNAEIKYSTVQNWYPGDKEGKGGIYNFVTKRGICSGVNSKISWTQVET  307

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GS+ITWKYPSV+L+GD S+GEFYSVA+TNN QQADTGTKMIH GKNT+SRI+SKGISAG 
Sbjct  308   GSSITWKYPSVILKGDNSIGEFYSVAVTNNMQQADTGTKMIHIGKNTKSRIVSKGISAGR  367

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV+VM  A+NARN SQCDS+L+G+   A+T+PYI+ KN +A +EHEATTSKIG
Sbjct  368   SQNSYRGLVEVMKRAENARNFSQCDSLLMGDKCGAHTFPYIEVKNNTATVEHEATTSKIG  427

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQ+FY  QRGI  E A+A +++G+C++V N+LP EF  E  +L+++ LEGSVG
Sbjct  428   EDQIFYCNQRGIGTEAAVALIVNGYCKEVLNQLPMEFAVEAQKLLAISLEGSVG  481



>ref|WP_002756125.1| cysteine desulfurase activator complex subunit SufB [Microcystis 
aeruginosa]
 emb|CCH94431.1| transport protein associated with Fe-S cluster assembly [Microcystis 
aeruginosa PCC 9432]
Length=530

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/475 (68%), Positives = 394/475 (83%), Gaps = 1/475 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             ++  + + YK+GF  +I+S T+P+GL+EE IRLIS++K EP++ML+FRL++Y ++  M E
Sbjct  56    VKNLVNQPYKYGFITDIESETIPRGLNEEIIRLISAKKKEPEFMLDFRLRAYHQWQKMTE  115

Query  1606  PKWSDNRYPEINFQDICYYSEPK-KKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVA  1430
             P W    YP I++Q+I YYS PK KK  LNSL+E DP LI+ FEKLG+PL+E+ RL+NVA
Sbjct  116   PSWPHVSYPAIDYQNIIYYSAPKQKKAKLNSLEEVDPTLIETFEKLGIPLSEQKRLSNVA  175

Query  1429  VDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSA  1250
             VDA+ DSVSIATT ++ L + GVIFCSISEA++E+PDLV+KYLG VVP  DN++ ALNSA
Sbjct  176   VDAIFDSVSIATTFKEKLAEQGVIFCSISEALQEHPDLVQKYLGSVVPVGDNYFAALNSA  235

Query  1249  VFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDT  1070
             VFSDGSFV++PK   CPM++STYFRIN  ETGQFERTLIVA++ + V YLEGCTAP YD+
Sbjct  236   VFSDGSFVFIPKGVVCPMELSTYFRINNGETGQFERTLIVAEEGASVSYLEGCTAPMYDS  295

Query  1069  NQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVE  890
             NQLHAAVVEL   + A+IKYSTVQNWYAGD  G+GGI+NFVTKRGLC G  SKISWTQVE
Sbjct  296   NQLHAAVVELVALDNADIKYSTVQNWYAGDANGKGGIYNFVTKRGLCKGVNSKISWTQVE  355

Query  889   TGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAG  710
             TGSAITWKYPS VL GD SVGEFYS+ALTNN QQADTGTKMIH G+NT+S IISKGISAG
Sbjct  356   TGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGRNTKSTIISKGISAG  415

Query  709   HSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKI  530
             +S+N YRGLV++   A  ARN SQCDSMLIG+NA ANT+PYIQ  N SA++EHEA+TSKI
Sbjct  416   NSQNSYRGLVKMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVDNNSAKVEHEASTSKI  475

Query  529   GEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             GEDQLFYF QRGI  E A++ ++SGFC+DV ++LP EF AE ++L+SLKLEG+VG
Sbjct  476   GEDQLFYFAQRGISEEDAVSMLVSGFCKDVLSKLPMEFAAEADKLLSLKLEGTVG  530



>ref|WP_015228979.1| FeS assembly protein SufB [Dactylococcopsis salina]
 ref|YP_007171330.1| FeS assembly protein SufB [Dactylococcopsis salina PCC 8305]
 gb|AFZ49973.1| FeS assembly protein SufB [Dactylococcopsis salina PCC 8305]
Length=478

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/474 (67%), Positives = 391/474 (82%), Gaps = 1/474 (0%)
 Frame = -3

Query  1783  QKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKEP  1604
             +  + + YK+GF  +I++ TLP+GL+E+ IR IS++KNEP++ML+FRLK+Y +++ M EP
Sbjct  5     KTLINQPYKYGFVTDIETETLPRGLNEDIIRAISAKKNEPEFMLDFRLKAYRQWLKMTEP  64

Query  1603  KWSDNRYPEINFQDICYYSEPKKKP-TLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
              W+   Y  I+F DI YYS PK+K     SLDE DP L++ FEKLG+PL+E+ RL NVAV
Sbjct  65    NWAHVGYRPIDFNDIIYYSAPKEKEEKKQSLDEVDPALLETFEKLGIPLSEQKRLGNVAV  124

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DA+ DSVS+ATT ++ L + GVIFCSISEA++EYP+LV+KYLG VVP+ DNF+ ALNSAV
Sbjct  125   DAIFDSVSVATTFKEKLAEEGVIFCSISEALQEYPELVKKYLGSVVPTGDNFFAALNSAV  184

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSFVYVPK  +CPM++STYFRIN  E GQFERTLI+A++ + V YLEGCTAP YD+N
Sbjct  185   FSDGSFVYVPKGVQCPMELSTYFRINTDEAGQFERTLIIAEEGASVSYLEGCTAPMYDSN  244

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAA+VEL   + A+IKYSTVQNW+AGDE G+GGI+NFVTKRGLC G  SKISWTQVET
Sbjct  245   QLHAAIVELVALDDADIKYSTVQNWFAGDENGKGGIYNFVTKRGLCKGKNSKISWTQVET  304

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSA+TWKYPS VL GD SVGEFYS+ALTNNYQQADTGTKMIH GKNT+S IISKGISAGH
Sbjct  305   GSAVTWKYPSCVLAGDNSVGEFYSIALTNNYQQADTGTKMIHIGKNTKSTIISKGISAGH  364

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV++   AD ARN SQCDSMLIG+ A ANT+PYIQ  N   ++EHEA+T+KIG
Sbjct  365   SQNSYRGLVKMGPKADGARNYSQCDSMLIGDQAEANTFPYIQVDNNRTKVEHEASTAKIG  424

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQLFYF QRGI  E A++ ++SGFC++VFN+LP EF AE ++L++LKLE SVG
Sbjct  425   EDQLFYFAQRGISEEDAVSMIVSGFCKEVFNQLPMEFAAEADKLLALKLENSVG  478



>ref|YP_536921.1| putative ABC transporter [Pyropia yezoensis]
 sp|Q1XDP7.1|YCF24_PYRYE RecName: Full=UPF0051 protein ycf24 (chloroplast) [Pyropia yezoensis]
 dbj|BAE92364.1| unnamed protein product [Pyropia yezoensis]
 gb|AGH27565.1| putative ABC transporter (chloroplast) [Pyropia yezoensis]
Length=487

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/474 (66%), Positives = 393/474 (83%), Gaps = 0/474 (0%)
 Frame = -3

Query  1786  LQKFLKRDYKWGFNQEIDSFTLPKGLSEETIRLISSRKNEPDWMLEFRLKSYERFMNMKE  1607
             L   + + YK+GF   ++S   P+G+SE+ +RLIS +K+EP+++L FRLK+Y+++  M  
Sbjct  14    LDYIVNQPYKYGFKTSVESEQFPRGISEDIVRLISKKKDEPEYLLNFRLKAYKKWKKMSS  73

Query  1606  PKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFEKLGVPLNERNRLANVAV  1427
             P W+  ++P I+F  I YY+ PK K  L SLDE DPE++  F KLG+ LNE+ R++NVAV
Sbjct  74    PSWAHIKHPNIDFNTIIYYAVPKLKKELKSLDEVDPEILDTFNKLGISLNEQKRISNVAV  133

Query  1426  DAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLGRVVPSEDNFYGALNSAV  1247
             DAV DSVSIATT +K L ++GVIFCSISEAIR+YP+L++KYLG VVP+ DN++ ALNSAV
Sbjct  134   DAVFDSVSIATTFKKELSEAGVIFCSISEAIRDYPELIKKYLGTVVPAGDNYFAALNSAV  193

Query  1246  FSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDSSFVEYLEGCTAPSYDTN  1067
             FSDGSF Y+P NT CP+++STYFRIN  E+GQFERTLI+AD  S V YLEGCTAP +DTN
Sbjct  194   FSDGSFCYIPPNTVCPLELSTYFRINNEESGQFERTLIIADRGSKVSYLEGCTAPQFDTN  253

Query  1066  QLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKRGLCAGSRSKISWTQVET  887
             QLHAA+VEL   EGAEIKYSTVQNWYAG++EG+GGI+NFVTKRGLC+G+ SKISWTQVET
Sbjct  254   QLHAAIVELVALEGAEIKYSTVQNWYAGNKEGKGGIYNFVTKRGLCSGNNSKISWTQVET  313

Query  886   GSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHKGKNTRSRIISKGISAGH  707
             GSAITWKYPS +L G+ S GEFYSVALTNNYQ+ADTGTKMIH G NT+SRIISKGISAG 
Sbjct  314   GSAITWKYPSCILAGENSQGEFYSVALTNNYQEADTGTKMIHIGNNTKSRIISKGISAGR  373

Query  706   SRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQTKNPSARIEHEATTSKIG  527
             S+N YRGLV+V   + N+RN SQCDS+LIG ++ ANT+PYIQ +NP++++EHEA+TSKI 
Sbjct  374   SKNSYRGLVKVGPQSFNSRNYSQCDSLLIGQSSQANTFPYIQVQNPTSKVEHEASTSKIS  433

Query  526   EDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQLMSLKLEGSVG  365
             EDQ+FYF QRGI+ E+++A MISGFC+DVFNELP EF  E ++L+SLKLEG+VG
Sbjct  434   EDQIFYFLQRGINLEESIALMISGFCKDVFNELPMEFATEADRLLSLKLEGTVG  487



>ref|XP_002501970.1| ATP-binding cassette superfamily [Micromonas sp. RCC299]
 gb|ACO63228.1| ATP-binding cassette superfamily [Micromonas sp. RCC299]
Length=431

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/431 (73%), Positives = 368/431 (85%), Gaps = 0/431 (0%)
 Frame = -3

Query  1657  MLEFRLKSYERFMNMKEPKWSDNRYPEINFQDICYYSEPKKKPTLNSLDEADPELIKYFE  1478
             MLEFRLK++ +++ M+EP WSDNRYP+I++Q + YYS PK      SLDE DPEL+  F+
Sbjct  1     MLEFRLKAFRKWLTMEEPDWSDNRYPDIDYQAVSYYSAPKVMEKKKSLDEVDPELLATFD  60

Query  1477  KLGVPLNERNRLANVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLVRKYLG  1298
             KLG+PL+E+ RL NVAVDAV DSVSIATT R+ L K GVIFCSISEAI+EYP+L++++LG
Sbjct  61    KLGIPLSEQKRLTNVAVDAVFDSVSIATTFREDLAKVGVIFCSISEAIKEYPELIKEHLG  120

Query  1297  RVVPSEDNFYGALNSAVFSDGSFVYVPKNTRCPMQISTYFRINAMETGQFERTLIVADDS  1118
              VVP  DN++ ALN+AVFSDGSF Y+PK  + PM++STYFRINA  +GQFERTLIVA++ 
Sbjct  121   SVVPVSDNYFSALNAAVFSDGSFCYIPKGVKSPMELSTYFRINAESSGQFERTLIVAEEG  180

Query  1117  SFVEYLEGCTAPSYDTNQLHAAVVELYCHEGAEIKYSTVQNWYAGDEEGRGGIFNFVTKR  938
             S+V YLEGCTAP+YD NQLHAAVVE+   + AE+KYSTVQNWYAGDE G+GGI+NFVTKR
Sbjct  181   SYVSYLEGCTAPAYDENQLHAAVVEISAAKDAEVKYSTVQNWYAGDENGKGGIYNFVTKR  240

Query  937   GLCAGSRSKISWTQVETGSAITWKYPSVVLEGDESVGEFYSVALTNNYQQADTGTKMIHK  758
             GLC G  +KISWTQVETGS+ITWKYPSVVL+GD SVGEF+SVALTNN QQADTGTKMIH 
Sbjct  241   GLCKGDNAKISWTQVETGSSITWKYPSVVLKGDNSVGEFFSVALTNNAQQADTGTKMIHV  300

Query  757   GKNTRSRIISKGISAGHSRNCYRGLVQVMSSADNARNSSQCDSMLIGNNAAANTYPYIQT  578
             GKNTRSRI+SKGISAG SRNCYRGLVQV  +A  ARN SQCDSMLIG+ A ANTYPYIQ 
Sbjct  301   GKNTRSRIVSKGISAGKSRNCYRGLVQVQPTATGARNYSQCDSMLIGDKAGANTYPYIQV  360

Query  577   KNPSARIEHEATTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCRDVFNELPDEFGAEVNQ  398
             + PSAR+EHEA+TSKIGEDQLFYFQQRGID E A+  +ISGFC +VFNELP EF AEVNQ
Sbjct  361   REPSARVEHEASTSKIGEDQLFYFQQRGIDPETAVGIIISGFCNEVFNELPMEFAAEVNQ  420

Query  397   LMSLKLEGSVG  365
             LMSLKLEGSVG
Sbjct  421   LMSLKLEGSVG  431



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6749630335086