BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15435_g1_i1 len=956 path=[934:0-866 1801:867-905 1840:906-955]

Length=956
                                                                      Score     E

sp|P14716.1|SPOR2_IPOBA  RecName: Full=Sporamin B; AltName: Full=...    181   2e-51   Ipomoea batatas [batate]
gb|AFR60859.1|  sporamin B                                              179   6e-51   
sp|P10965.1|SPORB_IPOBA  RecName: Full=Sporamin B; Flags: Precursor     179   6e-51   Ipomoea batatas [batate]
gb|ABB97547.1|  sporamin A precursor                                    179   7e-51   Ipomoea batatas [batate]
gb|AFR60858.1|  sporamin A                                              179   8e-51   
gb|AAA33390.1|  sporamin B                                              179   8e-51   Ipomoea batatas [batate]
gb|AFR60864.1|  sporamin B                                              178   1e-50   
gb|AFR60865.1|  sporamin B                                              178   1e-50   
gb|AFR60867.1|  sporamin B                                              178   1e-50   
gb|ABB90968.1|  sporamin B precursor                                    176   6e-50   Ipomoea batatas [batate]
gb|AFR60862.1|  sporamin B                                              176   1e-49   
gb|AFR60860.1|  sporamin B                                              175   2e-49   
gb|AFR60863.1|  sporamin B                                              173   1e-48   
gb|AAB52547.1|  sporamin precursor                                      172   4e-48   Ipomoea batatas [batate]
gb|ABG26232.1|  sporamin A                                              171   7e-48   Ipomoea trifida
sp|P14715.1|SPOR1_IPOBA  RecName: Full=Sporamin A; AltName: Full=...    171   9e-48   Ipomoea batatas [batate]
gb|AFR60855.1|  sporamin A                                              170   2e-47   
gb|AAA33391.1|  sporamin A precursor                                    170   2e-47   Ipomoea batatas [batate]
gb|ABG26230.1|  sporamin A                                              170   2e-47   Ipomoea trifida
gb|AAB52548.1|  sporamin precursor                                      169   4e-47   Ipomoea batatas [batate]
gb|ABB97549.1|  sporamin A precursor                                    169   4e-47   Ipomoea batatas [batate]
gb|ABB97545.1|  sporamin A precursor                                    169   4e-47   Ipomoea batatas [batate]
gb|AAL55800.1|AF289060_1  sporamin                                      169   7e-47   Ipomoea batatas [batate]
gb|ABY19576.1|  sporamin A precursor                                    168   8e-47   Ipomoea batatas [batate]
gb|ABB97544.1|  sporamin A precursor                                    168   1e-46   Ipomoea batatas [batate]
gb|ABG26224.1|  sporamin A                                              168   1e-46   Ipomoea leucantha
gb|ABG26236.1|  sporamin A                                              167   2e-46   Ipomoea trifida
gb|ABB97542.1|  sporamin A precursor                                    166   4e-46   Ipomoea batatas [batate]
gb|ABG26231.1|  sporamin A                                              166   4e-46   Ipomoea trifida
gb|ABG26238.1|  sporamin A                                              166   6e-46   Ipomoea trifida
gb|ABG26235.1|  sporamin A                                              165   1e-45   Ipomoea trifida
gb|AAA86670.1|  preprosporamin                                          165   2e-45   Ipomoea batatas [batate]
gb|ABG26222.1|  sporamin A                                              165   2e-45   Ipomoea leucantha
gb|ABB97543.1|  sporamin A precursor                                    163   4e-45   Ipomoea batatas [batate]
gb|ABG26229.1|  sporamin A                                              162   2e-44   Ipomoea trifida
gb|AFR60856.1|  sporamin A                                              162   3e-44   
gb|ABG26227.1|  sporamin A                                              160   7e-44   Ipomoea leucantha
sp|P10917.1|SPORA_IPOBA  RecName: Full=Sporamin A; Flags: Precursor     156   3e-42   Ipomoea batatas [batate]
gb|AFR60852.1|  sporamin                                                156   3e-42   
gb|AAD40288.1|  sporamin A precursor                                    154   2e-41   Ipomoea batatas [batate]
gb|AAD05567.1|  sporamin A                                              151   3e-40   Ipomoea batatas [batate]
gb|AAB52549.1|  sporamin                                                131   1e-33   Ipomoea batatas [batate]
gb|AAB52550.1|  sporamin                                                112   3e-26   Ipomoea batatas [batate]
gb|AFR60853.1|  truncated sporamin                                    96.3    1e-20   
emb|CAA43267.1|  sporamin                                             91.3    4e-18   Ipomoea batatas [batate]
gb|AAF15901.1|AF208020_1  putative proteinase inhibitor               84.3    9e-16   Nicotiana glutinosa
ref|XP_006441435.1|  hypothetical protein CICLE_v10023257mg           81.3    8e-15   
ref|XP_006441432.1|  hypothetical protein CICLE_v10022276mg           80.5    1e-14   
ref|XP_006495064.1|  PREDICTED: miraculin-like                        79.3    3e-14   
ref|XP_006493430.1|  PREDICTED: miraculin-like                        79.0    4e-14   
ref|XP_006441439.1|  hypothetical protein CICLE_v10022282mg           78.2    8e-14   
ref|XP_006441456.1|  hypothetical protein CICLE_v10023572mg           78.2    8e-14   
ref|XP_004234331.1|  PREDICTED: miraculin                             77.4    1e-13   
ref|XP_006441447.1|  hypothetical protein CICLE_v10021858mg           77.8    2e-13   
emb|CAN81015.1|  hypothetical protein VITISV_025776                   76.6    3e-13   Vitis vinifera
ref|XP_006495063.1|  PREDICTED: miraculin-like                        76.6    3e-13   
ref|XP_006493433.1|  PREDICTED: miraculin-like                        76.6    4e-13   
ref|XP_006441459.1|  hypothetical protein CICLE_v10022284mg           75.9    5e-13   
ref|XP_006493432.1|  PREDICTED: miraculin-like                        77.8    6e-13   
ref|XP_006441441.1|  hypothetical protein CICLE_v10023320mg           75.1    1e-12   
ref|XP_006441438.1|  hypothetical protein CICLE_v10023465mg           74.7    1e-12   
ref|XP_002270111.1|  PREDICTED: miraculin                             74.7    2e-12   Vitis vinifera
emb|CBI35464.3|  unnamed protein product                              74.3    2e-12   
emb|CAN75396.1|  hypothetical protein VITISV_028636                   73.9    2e-12   Vitis vinifera
gb|AAQ96377.1|  miraculin-like protein                                74.3    2e-12   Solanum palustre
ref|XP_006441446.1|  hypothetical protein CICLE_v10023371mg           73.9    3e-12   
gb|AEK26926.1|  Kunitz-type trypsin inhibitor B1                      72.8    9e-12   
gb|ADD51186.1|  tumor-related protein                                 72.4    9e-12   Vitis cinerea var. helleri x Vitis riparia
emb|CAI77764.1|  kunitz trypsin inhibitor                             72.4    1e-11   Populus tremula [European aspen]
emb|CAI77774.1|  kunitz trypsin inhibitor                             72.4    1e-11   Populus tremula [European aspen]
emb|CAI77798.1|  kunitz trypsin inhibitor                             72.4    1e-11   Populus tremula [European aspen]
emb|CAI77775.1|  kunitz trypsin inhibitor                             72.4    1e-11   Populus tremula [European aspen]
emb|CAI77765.1|  kunitz trypsin inhibitor                             72.4    1e-11   Populus tremula [European aspen]
emb|CAI77777.1|  kunitz trypsin inhibitor                             72.4    1e-11   Populus tremula [European aspen]
emb|CAI77793.1|  kunitz trypsin inhibitor                             72.4    1e-11   Populus tremula [European aspen]
ref|XP_002266430.1|  PREDICTED: miraculin                             72.0    1e-11   Vitis vinifera
emb|CAI77800.1|  kunitz trypsin inhibitor                             72.0    1e-11   Populus tremula [European aspen]
emb|CAI77770.1|  kunitz trypsin inhibitor                             72.0    2e-11   Populus tremula [European aspen]
ref|XP_002265965.1|  PREDICTED: miraculin                             71.6    2e-11   Vitis vinifera
emb|CAN65022.1|  hypothetical protein VITISV_027379                   71.6    2e-11   Vitis vinifera
ref|XP_006495061.1|  PREDICTED: miraculin-like                        71.6    2e-11   
emb|CAI77768.1|  kunitz trypsin inhibitor                             71.6    2e-11   Populus tremula [European aspen]
ref|XP_009803614.1|  PREDICTED: miraculin-like                        71.2    2e-11   
emb|CAI77773.1|  kunitz trypsin inhibitor                             71.2    3e-11   Populus tremula [European aspen]
emb|CAI77786.1|  kunitz trypsin inhibitor                             71.2    3e-11   Populus tremula [European aspen]
emb|CAI77772.1|  kunitz trypsin inhibitor                             71.2    3e-11   Populus tremula [European aspen]
ref|XP_002305033.1|  trypsin protein inhibitor 3                      71.2    3e-11   Populus trichocarpa [western balsam poplar]
gb|ABK96521.1|  unknown                                               70.9    3e-11   Populus trichocarpa x Populus deltoides
emb|CAI77782.1|  kunitz trypsin inhibitor                             70.9    4e-11   Populus tremula [European aspen]
emb|CAI77783.1|  kunitz trypsin inhibitor                             70.9    4e-11   Populus tremula [European aspen]
ref|XP_011035403.1|  PREDICTED: 21 kDa seed protein-like              70.5    5e-11   
ref|XP_009608866.1|  PREDICTED: miraculin-like                        70.5    6e-11   
ref|XP_006351546.1|  PREDICTED: miraculin-like                        70.1    6e-11   
emb|CAI77790.1|  kunitz trypsin inhibitor                             70.1    7e-11   Populus tremula [European aspen]
gb|AAC49969.1|  tumor-related protein                                 70.1    8e-11   Nicotiana tabacum [American tobacco]
emb|CAI77769.1|  kunitz trypsin inhibitor                             70.1    8e-11   Populus tremula [European aspen]
emb|CAI77803.1|  kunitz trypsin inhibitor                             69.7    9e-11   Populus tremula [European aspen]
gb|ADK62529.1|  miraculin-like protein                                69.7    1e-10   
ref|XP_009777240.1|  PREDICTED: miraculin-like                        69.3    1e-10   
emb|CAI77766.1|  kunitz trypsin inhibitor                             69.3    1e-10   Populus tremula [European aspen]
ref|XP_009792285.1|  PREDICTED: miraculin                             69.3    1e-10   
emb|CDP18338.1|  unnamed protein product                              69.3    1e-10   
emb|CAI77785.1|  kunitz trypsin inhibitor                             69.3    2e-10   Populus tremula [European aspen]
ref|XP_011035402.1|  PREDICTED: 21 kDa seed protein-like              68.9    2e-10   
emb|CAI77795.1|  kunitz trypsin inhibitor                             68.9    2e-10   Populus tremula [European aspen]
emb|CDP19138.1|  unnamed protein product                              68.6    2e-10   
gb|ABX76298.1|  sexual organ expressed protein                        68.9    3e-10   Nicotiana alata [flowering tobacco]
ref|XP_009627067.1|  PREDICTED: miraculin                             68.2    4e-10   
ref|XP_009615974.1|  PREDICTED: miraculin-like                        67.4    6e-10   
ref|XP_004241479.1|  PREDICTED: miraculin-like                        67.0    7e-10   
emb|CDP19136.1|  unnamed protein product                              67.0    8e-10   
gb|AAQ84217.1|  Kunitz trypsin inhibitor 4                            66.6    1e-09   Populus trichocarpa x Populus deltoides
gb|ABX76297.1|  stigma expressed protein                              66.2    2e-09   Nicotiana alata [flowering tobacco]
ref|XP_008238584.1|  PREDICTED: miraculin-like                        65.5    3e-09   
ref|XP_006347376.1|  PREDICTED: miraculin-like                        65.1    4e-09   
ref|XP_009789071.1|  PREDICTED: cysteine protease inhibitor 8-like    65.5    5e-09   
emb|CDP21726.1|  unnamed protein product                              65.1    5e-09   
ref|XP_006441460.1|  hypothetical protein CICLE_v10024584mg           63.9    5e-09   
gb|AAV41233.1|  putative 21 kDa trypsin inhibitor                     64.7    6e-09   Theobroma bicolor
ref|XP_010663911.1|  PREDICTED: miraculin-like                        64.7    6e-09   
gb|ACS92519.1|  Kunitz-type protease inhibitor KPI-D8                 64.3    7e-09   Populus trichocarpa x Populus nigra
ref|XP_007029361.1|  Kunitz family trypsin and protease inhibitor...  63.9    9e-09   
ref|XP_006372632.1|  hypothetical protein POPTR_0017s03420g           63.9    1e-08   
gb|ACO40073.1|  kunitz trypsin inhibitor 4                            63.2    1e-08   Populus balsamifera [balsam poplar]
ref|XP_007211211.1|  hypothetical protein PRUPE_ppa011496mg           63.2    2e-08   
gb|ACO40086.1|  kunitz trypsin inhibitor 4                            62.8    2e-08   Populus balsamifera [balsam poplar]
gb|ACS92500.1|  Kunitz-type protease inhibitor KPI-D9                 63.2    2e-08   Populus trichocarpa x Populus nigra
gb|ACO40153.1|  kunitz trypsin inhibitor 4                            62.4    2e-08   Populus balsamifera [balsam poplar]
gb|ACO40077.1|  kunitz trypsin inhibitor 4                            62.4    3e-08   Populus balsamifera [balsam poplar]
ref|XP_006372633.1|  hypothetical protein POPTR_0017s03430g           62.4    3e-08   
ref|XP_002266302.2|  PREDICTED: miraculin-like                        62.0    3e-08   Vitis vinifera
gb|ACO40074.1|  kunitz trypsin inhibitor 4                            62.0    3e-08   Populus balsamifera [balsam poplar]
gb|AFL91226.1|  Kunitz-like protease inhibitor                        62.0    3e-08   
gb|ACO40133.1|  kunitz trypsin inhibitor 4                            62.0    4e-08   Populus balsamifera [balsam poplar]
gb|ACO40100.1|  kunitz trypsin inhibitor 4                            62.0    4e-08   Populus balsamifera [balsam poplar]
ref|XP_009793041.1|  PREDICTED: miraculin-like                        62.4    4e-08   
gb|ACO40082.1|  kunitz trypsin inhibitor 4                            61.6    5e-08   Populus balsamifera [balsam poplar]
gb|ACO40093.1|  kunitz trypsin inhibitor 4                            61.6    5e-08   Populus balsamifera [balsam poplar]
ref|XP_006441436.1|  hypothetical protein CICLE_v10023581mg           61.2    6e-08   
ref|XP_006372654.1|  hypothetical protein POPTR_0017s03600g           61.2    8e-08   
gb|ACO40084.1|  kunitz trypsin inhibitor 4                            60.8    8e-08   Populus balsamifera [balsam poplar]
gb|ACO40145.1|  kunitz trypsin inhibitor 4                            60.8    1e-07   Populus balsamifera [balsam poplar]
ref|XP_009113274.1|  PREDICTED: trypsin inhibitor DE-3-like           61.2    1e-07   
gb|ACS92516.1|  Kunitz-type protease inhibitor KPI-D12                60.8    1e-07   Populus trichocarpa x Populus deltoides
ref|XP_008437058.1|  PREDICTED: miraculin-like                        60.8    1e-07   
gb|ACO40144.1|  kunitz trypsin inhibitor 4                            60.5    1e-07   Populus balsamifera [balsam poplar]
gb|ACO40081.1|  kunitz trypsin inhibitor 4                            60.5    1e-07   Populus balsamifera [balsam poplar]
gb|AFL91231.1|  Kunitz-like protease inhibitor                        60.1    1e-07   
emb|CDY59714.1|  BnaC02g46470D                                        61.2    1e-07   
ref|XP_011046091.1|  PREDICTED: miraculin-like                        60.5    1e-07   
gb|ACL12055.1|  Kunitz trypsin inhibitor                              60.5    2e-07   Nicotiana tabacum [American tobacco]
ref|XP_007036750.1|  21 kDa seed protein                              60.8    2e-07   
gb|AFL91227.1|  Kunitz-like protease inhibitor                        60.1    2e-07   
gb|AFL91232.1|  Kunitz-like protease inhibitor                        60.1    2e-07   
gb|ACO40119.1|  kunitz trypsin inhibitor 4                            59.7    2e-07   Populus balsamifera [balsam poplar]
gb|AFL91233.1|  Kunitz-like protease inhibitor                        59.7    2e-07   
ref|XP_010101167.1|  hypothetical protein L484_005403                 59.7    2e-07   
ref|XP_007036746.1|  21 kDa seed protein                              60.1    2e-07   
gb|ACO40104.1|  kunitz trypsin inhibitor 4                            59.3    3e-07   Populus balsamifera [balsam poplar]
emb|CDP21779.1|  unnamed protein product                              59.7    3e-07   
gb|ACO40154.1|  kunitz trypsin inhibitor 4                            59.3    3e-07   Populus balsamifera [balsam poplar]
emb|CDX72972.1|  BnaC06g34200D                                        59.3    3e-07   
emb|CBI35471.3|  unnamed protein product                              62.0    4e-07   
ref|XP_009105982.1|  PREDICTED: subtilisin inhibitor CLSI-II-like     59.3    5e-07   
gb|EYU22302.1|  hypothetical protein MIMGU_mgv1a013790mg              58.9    5e-07   
ref|XP_004137534.1|  PREDICTED: miraculin-like                        58.9    6e-07   
ref|XP_007029360.1|  Kunitz family trypsin and protease inhibitor...  58.5    7e-07   
ref|XP_002305034.2|  hypothetical protein POPTR_0004s06610g           58.5    7e-07   Populus trichocarpa [western balsam poplar]
gb|ADW95380.1|  Kunitz-type trypsin inhibitor                         58.5    7e-07   
gb|AEK26933.1|  Kunitz-type trypsin inhibitor B2                      58.5    8e-07   
ref|XP_007036743.1|  21 kDa seed protein                              58.5    8e-07   
emb|CAI77771.1|  kunitz trypsin inhibitor                             58.5    9e-07   Populus tremula [European aspen]
emb|CDY69418.1|  BnaAnng30440D                                        58.2    9e-07   
emb|CAI77767.1|  kunitz trypsin inhibitor                             58.5    9e-07   Populus tremula [European aspen]
ref|XP_009105981.1|  PREDICTED: 21 kDa seed protein-like              58.2    1e-06   
prf||1802409A  albumin                                                58.2    1e-06
gb|ABK01288.1|  miraculin-like protein                                57.8    2e-06   Coffea arabica [arabica coffee]
ref|XP_006478132.1|  PREDICTED: 21 kDa seed protein-like              57.8    2e-06   
ref|XP_006441467.1|  hypothetical protein CICLE_v10022124mg           57.8    2e-06   
emb|CAN63617.1|  hypothetical protein VITISV_041430                   57.8    2e-06   Vitis vinifera
dbj|BAA05474.1|  tumor-related protein                                56.2    2e-06   Nicotiana glauca x Nicotiana langsdorffii
ref|XP_006347377.1|  PREDICTED: miraculin-like                        57.4    2e-06   
ref|XP_009406658.1|  PREDICTED: miraculin-like                        57.0    2e-06   
sp|P09943.1|IDE3_ERYCA  RecName: Full=Trypsin inhibitor DE-3          56.6    2e-06   Erythrina caffra [lucky beantree]
gb|ACS92509.1|  Kunitz-type protease inhibitor KPI-D2.3               57.4    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_002305032.2|  trypsin protein inhibitor 3                      57.0    3e-06   Populus trichocarpa [western balsam poplar]
gb|AAV41234.1|  putative 21 kDa trypsin inhibitor                     57.4    3e-06   Theobroma microcarpum
ref|XP_010416116.1|  PREDICTED: miraculin-like                        57.0    3e-06   
gb|AFR54471.1|  miraculin-like protein 2                              57.0    3e-06   
ref|XP_010428237.1|  PREDICTED: miraculin-like                        56.6    3e-06   
sp|P68171.1|IDE3_ERYLA  RecName: Full=Trypsin inhibitor DE-3          55.8    4e-06   Erythrina latissima
emb|CDY68006.1|  BnaA02g35870D                                        56.2    4e-06   
gb|ACO40078.1|  kunitz trypsin inhibitor 4                            55.5    5e-06   Populus balsamifera [balsam poplar]
ref|XP_010041215.1|  PREDICTED: miraculin-like                        55.8    5e-06   
ref|XP_006347379.1|  PREDICTED: miraculin-like                        55.8    5e-06   
ref|XP_009149240.1|  PREDICTED: miraculin                             55.8    6e-06   
dbj|BAE79511.1|  miraculin-like protein 2                             56.2    6e-06   Citrus jambhiri [citronelle]
ref|XP_011072079.1|  PREDICTED: miraculin                             55.8    7e-06   
gb|ACO40080.1|  kunitz trypsin inhibitor 4                            55.1    9e-06   Populus balsamifera [balsam poplar]
sp|P81366.1|IDE3_ERYVA  RecName: Full=Trypsin inhibitor DE-3; Alt...  54.7    1e-05   Erythrina variegata [ci tong]
ref|NP_565061.1|  kunitz trypsin inhibitor 1                          55.5    1e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDX83886.1|  BnaC08g17590D                                        55.1    1e-05   
gb|AAV41232.1|  putative 21 kDa trypsin inhibitor                     55.1    1e-05   Theobroma grandiflorum
gb|AAN15685.1|  putative trypsin inhibitor                            55.1    1e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CAC19831.1|  hypothetical protein                                 54.7    1e-05   Avicennia marina
gb|AEK26927.1|  Kunitz-type trypsin inhibitor B4                      54.7    2e-05   
gb|AAV41231.1|  putative 21 kDa trypsin inhibitor                     55.1    2e-05   Theobroma cacao [chocolate]
ref|XP_006441465.1|  hypothetical protein CICLE_v10022129mg           55.1    2e-05   
ref|XP_009127987.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  54.3    2e-05   
emb|CDY19181.1|  BnaC05g13820D                                        54.3    2e-05   
emb|CDY30911.1|  BnaC09g14950D                                        54.3    2e-05   
gb|AIT42216.1|  Kunitz-type inhibitor D                               54.3    2e-05   
ref|XP_010471385.1|  PREDICTED: trypsin inhibitor BvTI-like           54.3    2e-05   
gb|AFL91234.1|  Kunitz-like protease inhibitor                        53.5    2e-05   
emb|CDP20822.1|  unnamed protein product                              53.9    2e-05   
ref|XP_009770904.1|  PREDICTED: miraculin-like                        54.3    3e-05   
emb|CDX96746.1|  BnaA08g22890D                                        53.9    3e-05   
emb|CDY26209.1|  BnaA06g12080D                                        53.5    3e-05   
gb|KCW48670.1|  hypothetical protein EUGRSUZ_K02326                   53.9    3e-05   
ref|XP_009401850.1|  PREDICTED: miraculin-like                        53.9    3e-05   
ref|XP_010537532.1|  PREDICTED: miraculin                             53.5    3e-05   
ref|XP_010037029.1|  PREDICTED: miraculin-like                        54.7    3e-05   
gb|AIT42166.1|  Kunitz-type inhibitor A                               53.9    4e-05   
ref|XP_010683194.1|  PREDICTED: miraculin-like                        53.5    4e-05   
ref|XP_011035401.1|  PREDICTED: miraculin-like                        53.5    4e-05   
ref|XP_007210537.1|  hypothetical protein PRUPE_ppa011653mg           53.5    4e-05   
ref|XP_006360287.1|  PREDICTED: 21 kDa seed protein-like              53.5    5e-05   
gb|AEK31202.1|  miraculin-like protein 2                              52.8    5e-05   
ref|XP_010042449.1|  PREDICTED: miraculin-like                        53.9    5e-05   
ref|XP_003620184.1|  Pathogen-inducible trypsin-inhibitor-like pr...  53.1    5e-05   
emb|CDO98552.1|  unnamed protein product                              53.1    5e-05   
sp|P13087.3|MIRA_SYNDU  RecName: Full=Miraculin; Short=MIR; Flags...  53.1    7e-05   Synsepalum dulcificum [miracle fruit]
gb|AFL91228.1|  Kunitz-like protease inhibitor                        52.4    7e-05   
emb|CDY45152.1|  BnaA09g14400D                                        52.4    7e-05   
emb|CDY11118.1|  BnaC06g23700D                                        52.8    7e-05   
gb|AAG52121.1|AC010556_3  putative trypsin inhibitor; 19671-20297     52.8    8e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128561.1|  PREDICTED: 21 kDa seed protein-like              52.8    8e-05   
gb|AFL91229.1|  Kunitz-like protease inhibitor                        52.0    9e-05   
gb|AIT42155.1|  Kunitz-type inhibitor A                               52.8    1e-04   
ref|XP_010428240.1|  PREDICTED: trypsin inhibitor BvTI-like           52.4    1e-04   
ref|XP_010693983.1|  PREDICTED: factor Xa inhibitor BuXI-like         52.0    1e-04   
gb|AAL60248.1|AF459083_1  putative Kunitz-type tuber invertase in...  52.0    1e-04   Solanum tuberosum [potatoes]
ref|XP_007036748.1|  21 kDa seed protein, putative                    52.4    1e-04   
gb|AAL85640.1|  trypsin inhibitor                                     51.2    1e-04   Herrania albiflora
gb|AFL91230.1|  Kunitz-like protease inhibitor                        51.2    1e-04   
gb|AAL85656.1|  trypsin inhibitor                                     51.2    1e-04   Theobroma microcarpum
dbj|BAA82843.1|  miraculin homologue                                  51.2    1e-04   Solanum melongena [aubergine]
ref|XP_009110379.1|  PREDICTED: miraculin-like                        51.6    2e-04   
gb|AIT42159.1|  Kunitz-type inhibitor A                               52.0    2e-04   
gb|AAL60247.1|AF459082_1  putative Kunitz-type tuber invertase in...  51.2    2e-04   Solanum tuberosum [potatoes]
gb|AAL85637.1|  trypsin inhibitor                                     50.8    2e-04   Herrania mariae
ref|NP_173228.1|  kunitz family trypsin and protease inhibitor pr...  51.6    2e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KDO40852.1|  hypothetical protein CISIN_1g046118mg                 52.0    2e-04   
ref|XP_004299457.1|  PREDICTED: miraculin-like                        51.6    2e-04   
gb|AEK31196.1|  miraculin-like protein 2                              50.8    2e-04   
ref|XP_006353923.1|  PREDICTED: cysteine protease inhibitor 1-like    51.6    2e-04   
dbj|BAC55863.1|  mwti1b                                               51.2    2e-04   
gb|AEO27899.1|  miraculin-like protein                                50.4    3e-04   
gb|AIT42157.1|  Kunitz-type inhibitor A                               51.2    3e-04   
gb|AIT42164.1|  Kunitz-type inhibitor A                               51.2    3e-04   
ref|XP_004241480.1|  PREDICTED: miraculin-like                        50.8    3e-04   
emb|CDX72971.1|  BnaC06g34190D                                        50.8    3e-04   
dbj|BAA04148.1|  proteinase inhibitor                                 50.8    4e-04   Solanum tuberosum [potatoes]
ref|XP_010683193.1|  PREDICTED: miraculin-like                        50.4    4e-04   
gb|AEK31197.1|  miraculin-like protein 2                              50.1    4e-04   
gb|AEK31201.1|  miraculin-like protein 2                              50.1    4e-04   
ref|XP_010536414.1|  PREDICTED: miraculin-like                        50.4    4e-04   
ref|NP_001241106.1|  uncharacterized protein LOC100790688 precursor   50.4    4e-04   
gb|AAL85660.1|  trypsin inhibitor                                     49.7    4e-04   Theobroma sylvestre
ref|XP_004955100.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  50.4    5e-04   
ref|XP_011035408.1|  PREDICTED: miraculin-like                        50.1    5e-04   
gb|AAL85643.1|  trypsin inhibitor                                     49.3    5e-04   Theobroma angustifolium
gb|ABR17296.1|  unknown                                               50.1    6e-04   Picea sitchensis
gb|AAL85652.1|  trypsin inhibitor                                     48.9    6e-04   Theobroma mammosum
gb|AAL85651.1|  trypsin inhibitor                                     48.9    7e-04   Theobroma mammosum
ref|XP_004301214.1|  PREDICTED: miraculin-like                        50.1    7e-04   
gb|AAL85648.1|  trypsin inhibitor                                     48.9    7e-04   Theobroma obovatum
gb|ACR54294.1|  Kunitz-type proteinase inhibitor group A1             49.3    8e-04   Solanum tuberosum subsp. andigenum
gb|ACR54296.1|  Kunitz-type proteinase inhibitor group A3             49.3    8e-04   Solanum tuberosum subsp. andigenum
ref|XP_004234308.1|  PREDICTED: serine protease inhibitor 5-like      49.7    9e-04   
ref|NP_001237333.1|  uncharacterized protein LOC100500648 precursor   49.7    0.001   
sp|P32877.1|IT1B_PSOTE  RecName: Full=Trypsin inhibitor 1B; AltNa...  48.9    0.001   



>sp|P14716.1|SPOR2_IPOBA RecName: Full=Sporamin B; AltName: Full=Clone PIM0535; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33198.1| unnamed protein product [Ipomoea batatas]
Length=216

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 132/203 (65%), Gaps = 8/203 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEW  679
            P+PT +  NPI RLR A    ASS  PV+D +GD ++ G  Y + S  WGAG G ++L  
Sbjct  16   PNPTHSKFNPI-RLRPAH-ETASSETPVLDINGDEVRAGENYYMVSAIWGAGGGGLRLVR  73

Query  678  --RSETKCPSDVI----SWLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLY  517
               S  +C SDVI     +   DP+ ITPADP+AT V+ ST+ +F+FN+ TN LC  N+ 
Sbjct  74   LDSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNIATNKLCVNNVN  133

Query  516  WGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQ  337
            WG++HDS +GQ FV++ EFV + S++FKIE +   +  Y I+YC  GT+KC+ VGR YD 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  336  SIKSTRLALSDFPFVLLFKKTSL  268
              ++TRLALS+ PFV + K T +
Sbjct  194  LTRATRLALSNIPFVFVIKPTDM  216



>gb|AFR60859.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 131/203 (65%), Gaps = 8/203 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEW  679
            P+P  +  NPI RLR A    ASS  PV+D +GD ++ G  Y I S  WGAG G ++L  
Sbjct  16   PNPAHSKFNPI-RLRPAH-ETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVR  73

Query  678  --RSETKCPSDVI----SWLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLY  517
               S  +C SDVI     +   DP+ ITPADP++T V+ STF +F+FN+ TN LC  N+ 
Sbjct  74   LDSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNVN  133

Query  516  WGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQ  337
            WG++HDS +GQ FV++ EFV + S++FKIE +   +  Y I+YC  GT+KC+ VGR YD 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  336  SIKSTRLALSDFPFVLLFKKTSL  268
              ++TRLALS+ PFV + K T +
Sbjct  194  LTRATRLALSNTPFVFVIKPTDM  216



>sp|P10965.1|SPORB_IPOBA RecName: Full=Sporamin B; Flags: Precursor [Ipomoea batatas]
 emb|CAA31863.1| unnamed protein product [Ipomoea batatas]
 gb|AFR60861.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 131/203 (65%), Gaps = 8/203 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEW  679
            P+P  +  NPI RLR A    ASS  PV+D +GD ++ G  Y I S  WGAG G ++L  
Sbjct  16   PNPAHSKFNPI-RLRPAH-ETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVR  73

Query  678  --RSETKCPSDVI----SWLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLY  517
               S  +C SDVI     +   DP+ ITPADP+AT V+ ST+ +F+FN+ TN LC  N+ 
Sbjct  74   LDSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNIATNKLCVNNVN  133

Query  516  WGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQ  337
            WG++HDS +GQ FV++ EFV + S++FKIE +   +  Y I+YC  GT+KC+ VGR YD 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  336  SIKSTRLALSDFPFVLLFKKTSL  268
              ++TRLALS+ PFV + K T +
Sbjct  194  LTRATRLALSNTPFVFVIKPTDM  216



>gb|ABB97547.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97548.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   179 bits (454),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 133/204 (65%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WG G G  +L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEIRAGGNYYMVSAIWGVGGGGPRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE ++A + +Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PFV + K T +
Sbjct  196  HMLRTTRLALSNSPFVFVIKPTDV  219



>gb|AFR60858.1| sporamin A [Ipomoea batatas]
Length=216

 Score =   179 bits (453),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 131/203 (65%), Gaps = 8/203 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEW  679
            P+P  +  NPI RLR A    ASS  PV+D +GD ++ G  Y I S  WGAG G ++L  
Sbjct  16   PNPAHSKFNPI-RLRPAH-ETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVR  73

Query  678  --RSETKCPSDVI----SWLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLY  517
               S  +C SDVI     +   DP+ ITPADP+AT V+ ST+ +F+FN+ TN LC  N+ 
Sbjct  74   LDSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNIATNKLCVNNVN  133

Query  516  WGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQ  337
            WG++HDS +GQ FV++ EFV + S++FKIE +   +  Y I+YC  GT+KC+ VGR YD 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  336  SIKSTRLALSDFPFVLLFKKTSL  268
              ++TRLALS+ PFV + K T +
Sbjct  194  LTRATRLALSNTPFVFVIKPTDM  216



>gb|AAA33390.1| sporamin B [Ipomoea batatas]
 gb|AFR60866.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   179 bits (453),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 131/203 (65%), Gaps = 8/203 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEW  679
            P+P  +  NPI RLR A    ASS  PV+D +GD ++ G  Y I S  WGAG G ++L  
Sbjct  16   PNPAHSKFNPI-RLRPAH-ETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVR  73

Query  678  --RSETKCPSDVI----SWLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLY  517
               S  +C SDVI     +   DP+ ITPADP++T V+ STF +F+FN+ TN LC  N+ 
Sbjct  74   LDSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNVN  133

Query  516  WGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQ  337
            WG++HDS +GQ FV++ EFV + S++FKIE +   +  Y I+YC  GT+KC+ VGR YD 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  336  SIKSTRLALSDFPFVLLFKKTSL  268
              ++TRLALS+ PFV + K T +
Sbjct  194  LTRATRLALSNTPFVFVIKPTDM  216



>gb|AFR60864.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 130/203 (64%), Gaps = 8/203 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEW  679
            P+P  +  NPI RLR A    ASS  PV+D +GD ++ G  Y I S  WGAG G ++L  
Sbjct  16   PNPAHSKFNPI-RLRPAH-ETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVR  73

Query  678  --RSETKCPSDVI----SWLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLY  517
               S  +C SDVI     +   DP  ITPADP+AT V+ ST+ +F+FN+ TN LC  N+ 
Sbjct  74   LDSSSNECASDVIVSRSDFDNGDPTTITPADPEATVVMPSTYQTFRFNIATNKLCVNNVN  133

Query  516  WGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQ  337
            WG++HDS +GQ FV++ EFV + S++FKIE +   +  Y I+YC  GT+KC+ VGR YD 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEAVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  336  SIKSTRLALSDFPFVLLFKKTSL  268
              ++TRLALS+ PFV + K T +
Sbjct  194  LTRATRLALSNTPFVFVIKPTDM  216



>gb|AFR60865.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 132/203 (65%), Gaps = 8/203 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEW  679
            P+PT +  NPI RLR A    ASS  PV+D +GD ++ G  Y + S  WGAG G ++L  
Sbjct  16   PNPTHSKFNPI-RLRPAH-ETASSETPVLDINGDEVRAGENYYMVSAIWGAGGGGLRLVR  73

Query  678  --RSETKCPSDVI----SWLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLY  517
               S  +C SDVI     +   DP+ ITPADP++T V+ ST+ +F+FN+ TN LC  N+ 
Sbjct  74   LDSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTYQTFRFNIATNKLCVNNVN  133

Query  516  WGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQ  337
            WG++HDS +GQ FV++ EFV + S++FKIE +   +  Y I+YC  GT+KC+ VGR YD 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  336  SIKSTRLALSDFPFVLLFKKTSL  268
              ++TRLALS+ PFV + K T +
Sbjct  194  LTRATRLALSNTPFVFVIKPTDM  216



>gb|AFR60867.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 131/203 (65%), Gaps = 8/203 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEW  679
            P+P  +  NPI RLR A    ASS  PV+D +GD ++ G  Y I S  WGAG G ++L  
Sbjct  16   PNPAHSKFNPI-RLRPAH-ETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVR  73

Query  678  --RSETKCPSDVI----SWLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLY  517
               S  +C SDV+     +   DP+ ITPADP++T V+ STF +F+FN+ TN LC  N+ 
Sbjct  74   LDSSSNECASDVVVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNVN  133

Query  516  WGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQ  337
            WG++HDS +GQ FV++ EFV + S++FKIE +   +  Y I+YC  GT+KC+ VGR YD 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  336  SIKSTRLALSDFPFVLLFKKTSL  268
              ++TRLALS+ PFV + K T +
Sbjct  194  LTRATRLALSNTPFVFVIKPTDM  216



>gb|ABB90968.1| sporamin B precursor [Ipomoea batatas]
Length=216

 Score =   176 bits (447),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 130/202 (64%), Gaps = 8/202 (4%)
 Frame = -3

Query  855  HPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEW-  679
            +P  +  NPI RLR A    ASS  PV+D +GD ++ G  Y I S  WGAG G ++L   
Sbjct  17   NPAHSKFNPI-RLRPAH-ETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRL  74

Query  678  -RSETKCPSDVI----SWLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYW  514
              S  +C SDVI     +   DP+ ITPADP++T V+ STF +F+FN+ TN LC  N+ W
Sbjct  75   DSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNVNW  134

Query  513  GVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQS  334
            G++HDS +GQ FV++ EFV + S++FKIE +   +  Y I+YC  GT+KC+ VGR YD  
Sbjct  135  GIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPL  194

Query  333  IKSTRLALSDFPFVLLFKKTSL  268
             ++TRLALS+ PFV + K T +
Sbjct  195  TRATRLALSNTPFVFVIKPTDM  216



>gb|AFR60862.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 130/202 (64%), Gaps = 8/202 (4%)
 Frame = -3

Query  855  HPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEW-  679
            +P  +  NPI RLR A    ASS  PV+D +GD ++ G  Y I S  WGAG G ++L   
Sbjct  17   NPAHSKFNPI-RLRPAH-ETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRL  74

Query  678  -RSETKCPSDVI----SWLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYW  514
              S  +C SDV+     +   DP+ ITPADP++T V+ STF +F+FN+ TN LC  N+ W
Sbjct  75   DSSSNECASDVMVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNVNW  134

Query  513  GVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQS  334
            G++HDS +GQ FV++ EFV + S++FKIE +   +  Y I+YC  GT+KC+ VGR YD  
Sbjct  135  GIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPL  194

Query  333  IKSTRLALSDFPFVLLFKKTSL  268
             ++TRLALS+ PFV + K T +
Sbjct  195  TRATRLALSNTPFVFVIKPTDM  216



>gb|AFR60860.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 130/202 (64%), Gaps = 8/202 (4%)
 Frame = -3

Query  855  HPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEW-  679
            +P  +  NPI RLR A    ASS  PV+D +GD ++ G  Y I S  WGAG G ++L   
Sbjct  17   NPAYSKFNPI-RLRPAR-ETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRL  74

Query  678  -RSETKCPSDVI----SWLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYW  514
              S  +C SDVI     +   DP+ ITPADP++T V+ STF +F+FN+ TN LC  N+ W
Sbjct  75   DSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNVNW  134

Query  513  GVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQS  334
            G++HDS +GQ FV++ EFV + S++FKIE +   +  Y I+YC  GT+KC+ VGR YD  
Sbjct  135  GIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPL  194

Query  333  IKSTRLALSDFPFVLLFKKTSL  268
             ++TRLALS+ PFV + K T +
Sbjct  195  TRATRLALSNTPFVFVIKPTDM  216



>gb|AFR60863.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 130/203 (64%), Gaps = 8/203 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEW  679
            P+P  +  NPI RLR A    ASS  PV+D +GD ++ G  Y I S  WGAG G ++L  
Sbjct  16   PNPAHSKFNPI-RLRPAH-ETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVR  73

Query  678  --RSETKCPSDVI----SWLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLY  517
               S  +C SDVI     +   DP+ I PADP++T V+ STF +F+F++ TN LC  N+ 
Sbjct  74   LDSSSNECASDVIVSRSDFDNGDPITIRPADPESTVVMPSTFQTFRFSIPTNKLCVNNVN  133

Query  516  WGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQ  337
            WG++HDS +GQ FV++ EFV + S++FKIE +   +  Y I+YC  GT+KC+ VGR YD 
Sbjct  134  WGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDP  193

Query  336  SIKSTRLALSDFPFVLLFKKTSL  268
              ++TRLALS+ PFV + K T +
Sbjct  194  LTRATRLALSNTPFVFVIKPTDM  216



>gb|AAB52547.1| sporamin precursor [Ipomoea batatas]
 gb|ABB97540.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97541.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97546.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 135/204 (66%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE ++A + +Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PFV + K T +
Sbjct  196  HMLRTTRLALSNSPFVFVIKPTDV  219



>gb|ABG26232.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   171 bits (433),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 135/204 (66%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
              + +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALSD PFV + K T +
Sbjct  196  PMLRTTRLALSDSPFVFVIKPTDV  219



>sp|P14715.1|SPOR1_IPOBA RecName: Full=Sporamin A; AltName: Full=Clone PIM0335; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33197.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score =   171 bits (433),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 135/204 (66%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +KC +DVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDMMSKCATDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE ++A + +Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PFV + K T +
Sbjct  196  HMLRTTRLALSNSPFVFVIKPTDV  219



>gb|AFR60855.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 134/204 (66%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE ++A + +Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
               ++TRLALS+ PFV + K T +
Sbjct  196  HMSRTTRLALSNSPFVFVIKPTDV  219



>gb|AAA33391.1| sporamin A precursor [Ipomoea batatas]
 gb|ABG26237.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 135/204 (66%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
              + +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PFV + K T +
Sbjct  196  PMLRTTRLALSNSPFVFVIKPTDV  219



>gb|ABG26230.1| sporamin A [Ipomoea trifida]
 gb|AFR60857.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 135/204 (66%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
              + +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PFV + K T +
Sbjct  196  PMLRTTRLALSNSPFVFVIKPTDV  219



>gb|AAB52548.1| sporamin precursor [Ipomoea batatas]
Length=219

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 134/204 (66%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PFV + K T +
Sbjct  196  PMLRTTRLALSNSPFVFVIKPTDV  219



>gb|ABB97549.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97550.1| sporamin A precursor [Ipomoea batatas]
 gb|AFR60854.1| sporamin [Ipomoea batatas]
Length=219

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 134/204 (66%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PFV + K T +
Sbjct  196  PMLRTTRLALSNSPFVFVIKPTDV  219



>gb|ABB97545.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 134/204 (66%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDMMSKCASDVIISPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PFV + K T +
Sbjct  196  PMLRTTRLALSNSPFVFVIKPTDV  219



>gb|AAL55800.1|AF289060_1 sporamin [Ipomoea batatas]
Length=219

 Score =   169 bits (427),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 134/204 (66%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PFV + K T +
Sbjct  196  PLMRTTRLALSNSPFVFVIKPTDV  219



>gb|ABY19576.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   168 bits (426),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 134/204 (66%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+Q DS +GQ F+++ EFV + S++FKIE ++A + +Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQQDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TR+ALS+ PFV + K T +
Sbjct  196  HMLRTTRIALSNSPFVFVIKPTDV  219



>gb|ABB97544.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 134/204 (66%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+Q DS +GQ F+++ EFV + S++FKIE ++A + +Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQQDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TR+ALS+ PFV + K T +
Sbjct  196  HMLRTTRIALSNSPFVFVIKPTDV  219



>gb|ABG26224.1| sporamin A [Ipomoea leucantha]
 gb|ABG26226.1| sporamin A [Ipomoea leucantha]
 gb|ABG26228.1| sporamin A [Ipomoea leucantha]
 gb|ABG26233.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 134/204 (66%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P  SS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-PSSQTPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
              + +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDTMSKCASDVIVSPNDLDNGDPITITPAAADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PFV + K T +
Sbjct  196  PMLRTTRLALSNSPFVFVIKPTDV  219



>gb|ABG26236.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 133/204 (65%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P     NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHPRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
              + +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             W +QHDS +GQ F+++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR +D
Sbjct  136  NWRIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALSD PFV + K T +
Sbjct  196  PMLRTTRLALSDSPFVFVIKPTDV  219



>gb|ABB97542.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 134/204 (66%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEW  679
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLGH  75

Query  678  RSE-TKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE ++A + +Y +TYC  G DKCY VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGADKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PFV + K T +
Sbjct  196  HMLRTTRLALSNSPFVFVIKPTDV  219



>gb|ABG26231.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 134/204 (66%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
              + +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE  +A +  Y +TYC  G+DKC+ VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVDDANLNFYKLTYCQFGSDKCHNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PFV + K T +
Sbjct  196  PMLRTTRLALSNSPFVFVIKPTDV  219



>gb|ABG26238.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   166 bits (421),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 134/204 (66%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
              + +KC SDVI         DP+ ITPA  DP++T V+  T+ +F+FN+ TN LC  N+
Sbjct  76   LDTMSKCASDVIVSPNDLDDGDPITITPAAADPESTVVMALTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCRFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PFV + K T +
Sbjct  196  PMLRTTRLALSNSPFVFVIKPTDV  219



>gb|ABG26235.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 135/204 (66%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P +SS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-SSSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +KC SDVI         DP+ ITPA  DP+++ ++ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESSVIMTSTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG++HDS +GQ F+++ EFV + S++FKIE ++A + +Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIRHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PFV + K T +
Sbjct  196  PMMRTTRLALSNSPFVFVIKPTDV  219



>gb|AAA86670.1| preprosporamin [Ipomoea batatas]
Length=219

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 132/204 (65%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
              + +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+  N LC  N+
Sbjct  76   LDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIANNKLCVKNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F++  EFV + S++FKIE ++A +  Y +TYC  G+DKCY  GR +D
Sbjct  136  NWGIQHDSASGQYFLKDGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNCGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PFV + K T +
Sbjct  196  PMLRTTRLALSNSPFVFVIKPTDV  219



>gb|ABG26222.1| sporamin A [Ipomoea leucantha]
 gb|ABG26223.1| sporamin A [Ipomoea leucantha]
 gb|ABG26225.1| sporamin A [Ipomoea leucantha]
 gb|ABG26234.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 133/204 (65%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P  SS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-PSSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITP--ADPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +KC SDVI         DP+ ITP  ADP+++ ++ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PFV + K T +
Sbjct  196  PMLRTTRLALSNSPFVFVIKPTDV  219



>gb|ABB97543.1| sporamin A precursor [Ipomoea batatas]
Length=199

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 131/200 (66%), Gaps = 9/200 (5%)
 Frame = -3

Query  846  RATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-EWRSE  670
             +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L      
Sbjct  2    HSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLDMM  59

Query  669  TKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV  508
            +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+ WG+
Sbjct  60   SKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNWGI  119

Query  507  QHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIK  328
            QHDS +GQ F+++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR +D  ++
Sbjct  120  QHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDPMLR  179

Query  327  STRLALSDFPFVLLFKKTSL  268
            +TRLALS+ PFV + K T +
Sbjct  180  TTRLALSNSPFVFVIKPTDV  199



>gb|ABG26229.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 132/204 (65%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN L   N+
Sbjct  76   LDMMSKCASDVIVSPNGLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLRVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PF  + + T +
Sbjct  196  PMLRTTRLALSNSPFAFVIRPTDV  219



>gb|AFR60856.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 131/204 (64%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+Q DS +GQ F+++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR  D
Sbjct  136  NWGIQQDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFKD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS +PF  + K T +
Sbjct  196  PMLRTTRLALSYYPFFFVIKPTDV  219



>gb|ABG26227.1| sporamin A [Ipomoea leucantha]
Length=219

 Score =   160 bits (406),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 131/204 (64%), Gaps = 9/204 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P   S  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-PPSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITP--ADPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +KC SDV          DP+ ITP  ADP+++ ++ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDMMSKCASDVTVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+QHDS +GQ F+++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR +D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  339  QSIKSTRLALSDFPFVLLFKKTSL  268
              +++TRLALS+ PFV + K T +
Sbjct  196  PMLRTTRLALSNSPFVFVIKPTDV  219



>sp|P10917.1|SPORA_IPOBA RecName: Full=Sporamin A; Flags: Precursor [Ipomoea batatas]
 emb|CAA31862.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 124/202 (61%), Gaps = 9/202 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y +     GA  G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVYAILGACGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                  C SDVI         D + ITPA  DP+AT V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+Q+DS +GQ  +++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR  D
Sbjct  136  NWGIQYDSASGQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFKD  195

Query  339  QSIKSTRLALSDFPFVLLFKKT  274
              +++TRLALS +PF  + K T
Sbjct  196  PMLRTTRLALSYYPFFFVIKPT  217



>gb|AFR60852.1| sporamin [Ipomoea batatas]
Length=219

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 128/202 (63%), Gaps = 9/202 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P  SS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-PSSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +KC SDVI         DP+ ITPA  DP+AT V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPEATVVMTSTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+Q+DS + Q  +++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR  D
Sbjct  136  NWGIQYDSASVQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFND  195

Query  339  QSIKSTRLALSDFPFVLLFKKT  274
              +++TRLALS +PF  + K T
Sbjct  196  PMLRTTRLALSYYPFFFVIKPT  217



>gb|AAD40288.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 124/202 (61%), Gaps = 9/202 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEW  679
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S   GA  G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAILGACGGGLRLAH  75

Query  678  RS-ETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                  C SDVI         D + ITPA  DP+AT V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+Q+DS + Q  +++ EFV + S++FKIE ++A +  Y +TYC  G+DKCY VGR  D
Sbjct  136  NWGIQYDSASVQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFND  195

Query  339  QSIKSTRLALSDFPFVLLFKKT  274
              +++TRLA+S +PF  + K T
Sbjct  196  PMLRTTRLAISYYPFFFVIKPT  217



>gb|AAD05567.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 124/202 (61%), Gaps = 9/202 (4%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEW  679
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S   GA  G ++L  
Sbjct  18   PNPAHSGFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYLVSAILGACGGGLRLAH  75

Query  678  RS-ETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                  C SDVI         D + ITPA  DP+AT V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYD  340
             WG+Q+DS + Q  +++ E V +++++FKIE ++A +  Y +TYC  G+DKCY VGR  D
Sbjct  136  NWGIQYDSASVQSLLKAGESVSDKTNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFND  195

Query  339  QSIKSTRLALSDFPFVLLFKKT  274
              +++TRLALS +PF  + K T
Sbjct  196  PMLRTTRLALSYYPFFFVIKPT  217



>gb|AAB52549.1| sporamin [Ipomoea batatas]
Length=121

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 89/121 (74%), Gaps = 2/121 (2%)
 Frame = -3

Query  624  VVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
            + ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+ WG+QHDS +GQ F+++ EFV +
Sbjct  1    ITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNWGIQHDSASGQYFLKAGEFVSD  60

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTRLALSDFPFVLLFKKTS  271
             S++FKIE ++A +  Y +TYC  G+DKCY VGR +D  +++TRLALS+ PFV + K T 
Sbjct  61   NSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDHMLRTTRLALSNSPFVFVIKPTD  120

Query  270  L  268
            +
Sbjct  121  V  121



>gb|AAB52550.1| sporamin [Ipomoea batatas]
Length=171

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = -3

Query  603  PKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVENQSDRFKIER  424
            P++T V+ ST+ +F+FN+ TN LC  N+ WG+Q+DS + Q  +++ EFV + S++FKIE 
Sbjct  60   PESTVVMASTYQTFRFNIATNKLCVNNVNWGIQYDSASVQSLLKAGEFVSDNSNQFKIEV  119

Query  423  LEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTRLALSDFPFVLLFKKT  274
            ++A +  Y +TYC  G+DKCY VGR  D  +++TRLALS +PF  + K T
Sbjct  120  VDANLNFYKLTYCLFGSDKCYNVGRFKDPMLRTTRLALSSYPFFFVIKPT  169



>gb|AFR60853.1| truncated sporamin [Ipomoea batatas]
Length=146

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 82/131 (63%), Gaps = 9/131 (7%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL-E  682
            P+P  +  NPI RL T   P ASS  PV+D +GD ++ GG Y + S  WGAG G ++L  
Sbjct  18   PNPAHSRFNPI-RLPTTHEP-ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  681  WRSETKCPSDVI----SWLYADPVVITPA--DPKATDVIESTFLSFKFNVVTNFLCSGNL  520
              + +KC SDVI         DP+ ITPA  DP++T V+ ST+ +F+FN+ TN LC  N+
Sbjct  76   LDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNV  135

Query  519  YWGVQHDSGTG  487
             WG+QHDS +G
Sbjct  136  NWGIQHDSASG  146



>emb|CAA43267.1| sporamin [Ipomoea batatas]
Length=236

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 94/185 (51%), Gaps = 17/185 (9%)
 Frame = +1

Query  289  KHEGEITQSQTRRLNGLVIFSANVVAFVGAGGTISDYISGDDGFEPLNLEPVALVLDKLV  468
            K +G I +SQTR     V+ SAN+VAFVGA  T+S+++    G   LNLE VA+V  KL 
Sbjct  39   KTQGRIGESQTRGPQHGVMESANIVAFVGAELTVSEFVEVKVGIHQLNLELVAIVGHKLA  98

Query  469  GPHEILPGTTVVLDPPVQVT*AEKVGDDVEFEAQESGLDDIGGFGVRRRDHHGVGVEPRD  648
            G  EILPG  VVLD PV V  AE VG DVE E+      D GGF V RR    + V    
Sbjct  99   GFQEILPGRAVVLDSPVHVVHAELVGGDVEPESLVRRRHDHGGFRVGRR---AIAVVMGS  155

Query  649  HVAGALG--FTSPLEFHFSGTG--------APCDGGYVVNPADLERVTVGVNHWS---AG  789
             ++ +LG   TS        +G         P    +VV PA    V V V +WS    G
Sbjct  156  PLSKSLGDTMTSLAHLDIMSSGRVLALPRRLPIWRRHVVVPAG-SVVAVDVQYWSFRGGG  214

Query  790  RRYWY  804
             R W+
Sbjct  215  VRVWF  219



>gb|AAF15901.1|AF208020_1 putative proteinase inhibitor [Nicotiana glutinosa]
Length=241

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 89/188 (47%), Gaps = 26/188 (14%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYA-------DPVV  619
            V+D +G+ LQ+G  Y+I S  WGAG G V L +   T+CP+DV+            + + 
Sbjct  53   VLDINGEPLQIGEKYHIVSAIWGAGGGGVYLTYVRNTRCPNDVVQHGRTPKKACPLNSLP  112

Query  618  ITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGT--GQDFVRSDEFVENQS  445
            + P  P    V E+  ++  F+V T+ LC     W V     T  G  FV +   + N  
Sbjct  113  LAPGPPPFNVVRETNNINIMFSVPTSRLCVNETVWKVGDPDLTARGTRFVVTGGTLGNPR  172

Query  444  DR-----FKIERLEAIIPTYIITYCPSG-------TDKCYYVGREYDQSIKSTRLALSDF  301
                   FKIE++    P Y + YCP          D C  VG  +++     RLAL++ 
Sbjct  173  PETINSWFKIEKVTKTAPFYKLRYCPDNFLCPECHPDVCLDVGLTHER-----RLALTNQ  227

Query  300  PFVLLFKK  277
            PF++LF+K
Sbjct  228  PFMVLFRK  235



>ref|XP_006441435.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
 gb|ESR54675.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
Length=206

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 89/181 (49%), Gaps = 19/181 (10%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-CPSDVI----SWLYADPVVI  616
            PV+D  G  L+ G  Y I  +T G G G + L  RS  K CP DV+    S+    PV  
Sbjct  31   PVLDIAGKQLRAGSKYYILPVTKGRGGG-LTLAGRSNNKTCPVDVVQEQHSFRNGLPVTF  89

Query  615  TPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVENQSDR  439
            +P +PK   V EST L+ KF+  T+  C+ +  W + + D+  GQ  V +     N   R
Sbjct  90   SPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAALGQWLVTTGGVEGNPGPR  147

Query  438  -----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFK  280
                 FKIE+       Y + YCPS  + C  + R+    I     RLALSD PF ++FK
Sbjct  148  TMRNWFKIEKFFG---NYKLVYCPSVCNFCRGLCRDVGIFINGGVRRLALSDVPFKVVFK  204

Query  279  K  277
            K
Sbjct  205  K  205



>ref|XP_006441432.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
 gb|ESR54672.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
Length=206

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 91/185 (49%), Gaps = 19/185 (10%)
 Frame = -3

Query  792  SSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-CPSDVI----SWLYAD  628
            +S  PV+D  G  L+ G  Y I  +T G G G + L  RS  K CP DV+    S+    
Sbjct  27   ASADPVLDIAGKQLRAGSKYYILPVTKGRGGG-LTLAGRSNNKTCPVDVVQEQHSFRNGL  85

Query  627  PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVEN  451
            PV  +P +PK   V EST ++ KF+  T+  C+ +  W + + D+  GQ  V +     N
Sbjct  86   PVTFSPVNPKKGVVRESTDINIKFDAATS--CAQSTVWKLDNFDAAIGQWLVTTGGVEGN  143

Query  450  QSDR-----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFV  292
               R     FKIE+       Y + YCPS  + C  + R+    I     RLALSD PF 
Sbjct  144  PGPRTMRNWFKIEKFFG---DYKLVYCPSVCNFCRGLCRDVGIFINGGVRRLALSDVPFK  200

Query  291  LLFKK  277
            ++FKK
Sbjct  201  VVFKK  205



>ref|XP_006495064.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 89/181 (49%), Gaps = 19/181 (10%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-CPSDVI----SWLYADPVVI  616
            PV+D  G  L+ G  Y I  +T G G G + L  RS  K CP DV+    S+    PV  
Sbjct  31   PVLDISGKQLRAGSKYYILPVTKGRGGG-LTLAGRSNNKTCPVDVVQEQHSFKNGFPVTF  89

Query  615  TPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVENQSDR  439
            +P +PK   V EST L+ KF+  T+  C+ +  W + + D+  GQ  V +     N   R
Sbjct  90   SPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGPR  147

Query  438  -----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFK  280
                 FKIE+       Y + YCPS  + C  + R+    I     RLALSD PF ++FK
Sbjct  148  TMRNWFKIEKF---FGDYKLVYCPSVCNFCRGLCRDVGIFINGGVRRLALSDVPFKVVFK  204

Query  279  K  277
            K
Sbjct  205  K  205



>ref|XP_006493430.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 89/181 (49%), Gaps = 19/181 (10%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-CPSDVI----SWLYADPVVI  616
            PV+D  G  L+ G  Y I  +T G G G + L  RS  K CP DV+    S+    PV  
Sbjct  31   PVLDISGKQLRAGSKYYILPVTKGRGGG-LTLAGRSNNKTCPVDVVQEQHSFRNGLPVTF  89

Query  615  TPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVENQSDR  439
            +P +PK   V EST L+ KF+  T+  C+ +  W + + D+  GQ  V +     N   R
Sbjct  90   SPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWVVTTGGVEGNPGPR  147

Query  438  -----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFK  280
                 FKIE+       Y + YCPS  + C  + R+    I     RLALSD PF ++FK
Sbjct  148  TMRNWFKIEKF---FGDYKLVYCPSVCNFCRGLCRDVGIFINGGVRRLALSDVPFKVVFK  204

Query  279  K  277
            K
Sbjct  205  K  205



>ref|XP_006441439.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
 gb|ESR54679.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
Length=206

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 88/181 (49%), Gaps = 19/181 (10%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-CPSDVI----SWLYADPVVI  616
            PV+D  G  L+ G  Y I  +T G G G + L  R   K CP DV+    S+    PV  
Sbjct  31   PVLDIAGKQLRAGSKYYILPVTKGRGGG-LTLAGRGNNKTCPLDVVQEQHSFKNGLPVTF  89

Query  615  TPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVENQSDR  439
            +P +PK   V EST L+ KF+  T+  C+ +  W + + D+  GQ  V +     N   R
Sbjct  90   SPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGPR  147

Query  438  -----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFK  280
                 FKIE+       Y + YCPS  + C  + R+    I     RLALSD PF ++FK
Sbjct  148  TMRNWFKIEKFFG---DYKLVYCPSVCNFCRGLCRDVGIFINGGVRRLALSDIPFKVVFK  204

Query  279  K  277
            K
Sbjct  205  K  205



>ref|XP_006441456.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
 gb|ESR54696.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
Length=206

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 88/181 (49%), Gaps = 19/181 (10%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-CPSDVI----SWLYADPVVI  616
            PV+D  G  L+ G  Y I  +T G G G + L  RS  K CP DV+    S     PV  
Sbjct  31   PVLDIAGKQLRAGSKYYILPVTKGQGGG-LTLAGRSNNKTCPLDVVQEQHSLRNGFPVTF  89

Query  615  TPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVENQSDR  439
            +P +PK   V EST L+ KF+  T+  C+ +  W + + D+  GQ  V +     N   R
Sbjct  90   SPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAALGQWLVTTGGVEGNPGPR  147

Query  438  -----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFK  280
                 FKIE+       Y + +CPS  + C  + R+    I     RLALSD PF ++FK
Sbjct  148  TMRNWFKIEKFYG---DYKLVFCPSVCNFCRGLCRDVGIFINGGVRRLALSDVPFKVVFK  204

Query  279  K  277
            K
Sbjct  205  K  205



>ref|XP_004234331.1| PREDICTED: miraculin [Solanum lycopersicum]
 gb|AAC63057.1| Lemir [Solanum lycopersicum]
Length=205

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 90/186 (48%), Gaps = 19/186 (10%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD----  628
            A S   VVD DG  L+ G  Y I  +  G G G + ++   +  CP D +   + +    
Sbjct  25   AESPPEVVDIDGKILRTGVDYYILPVVRGRGGG-LTMDSIGDKMCPLDAVVQEHNEIDQG  83

Query  627  -PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQ-HDSGTGQDFV-----RS  469
             P+  TP DPK   + EST L+  F+   N +C     W +   D  TGQ F+     + 
Sbjct  84   LPLTFTPVDPKKGVIRESTDLNIIFS--ANSICVQTTQWKLDDFDETTGQYFITLGGDQG  141

Query  468  DEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPF  295
            +  VE  S+ FKIE+ +     Y + YCP+  D C  + R+    I+    RLALSD PF
Sbjct  142  NPGVETISNWFKIEKYDR---DYKLLYCPTVCDFCKVICRDIGIFIQDGVRRLALSDVPF  198

Query  294  VLLFKK  277
             ++FKK
Sbjct  199  KVMFKK  204



>ref|XP_006441447.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
 gb|ESR54687.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
Length=249

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 91/185 (49%), Gaps = 19/185 (10%)
 Frame = -3

Query  792  SSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-CPSDVI----SWLYAD  628
            +S  PV+D  G  L+ G  Y I  +T G G G + L  RS  K CP DV+    S+    
Sbjct  70   ASPDPVLDIAGKQLRTGSKYYILPVTKGRGGG-LTLAGRSNNKTCPLDVVQEQHSFKNGL  128

Query  627  PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVEN  451
            PV  +P +PK   V EST L+ KF+  T+  C+ +  W + + D+  GQ  + +     N
Sbjct  129  PVTFSPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAVLGQWLLTTGGVEGN  186

Query  450  QSDR-----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFV  292
               R     FKIE+       Y + YCPS  + C  + R+    I     RLALSD PF 
Sbjct  187  PGPRTMRNWFKIEKF---FGDYKLVYCPSVCNFCRGLCRDVGIFINGGVRRLALSDVPFK  243

Query  291  LLFKK  277
            ++FKK
Sbjct  244  IVFKK  248



>emb|CAN81015.1| hypothetical protein VITISV_025776 [Vitis vinifera]
Length=203

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 92/188 (49%), Gaps = 19/188 (10%)
 Frame = -3

Query  801  PIA--SSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY--  634
            P+A  SS  PV+D++G  L+ G  Y I  +  G G G + L       CP DV+   +  
Sbjct  21   PVAAESSPDPVLDTEGKQLRSGVDYYILPVIRGRGGG-LTLASTGNENCPLDVVQEQHEV  79

Query  633  --ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDF-----V  475
                P+  TP +PK   +  ST  + KF+  T  +C  +  W +++D  +GQ F     V
Sbjct  80   SNGLPLTFTPVNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQRFVTTGGV  137

Query  474  RSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDF  301
              +   E   + FKIE+ E     Y + +CP+  D C  V  +    I++   RLALSD 
Sbjct  138  EGNPGXETLDNWFKIEKYED---DYKLVFCPTVCDFCKPVCGDIGIYIQNGYRRLALSDV  194

Query  300  PFVLLFKK  277
            PF ++FKK
Sbjct  195  PFKVMFKK  202



>ref|XP_006495063.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 88/181 (49%), Gaps = 19/181 (10%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-CPSDVI----SWLYADPVVI  616
            PV+D  G  L+ G  Y I  +T G G G + L  RS  K CP DV+    S+    PV  
Sbjct  31   PVLDIAGKQLRAGSKYYILPVTKGRGGG-LTLAGRSNNKTCPLDVVQEQHSFRNGLPVTF  89

Query  615  TPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVENQSDR  439
            +P +PK   V EST L+ KF+  T+  C+ +  W + + D+  GQ  V +     N   R
Sbjct  90   SPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDTAFGQWLVTTGGVEGNPGPR  147

Query  438  -----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFK  280
                 FKIE+       Y + +CPS  + C  + R+    I     RLALSD P  ++FK
Sbjct  148  TMRNWFKIEKFYG---DYKLVFCPSVCNFCRGLCRDVGIFINGGVRRLALSDVPLKVVFK  204

Query  279  K  277
            K
Sbjct  205  K  205



>ref|XP_006493433.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=221

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 85/183 (46%), Gaps = 17/183 (9%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVI----SWLYADPVVIT  613
            PV+D  G  L+ G  Y I  +T G G G      R+   CP DV+    S+    PV  +
Sbjct  31   PVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRRNNKTCPLDVVQEQHSFKNGLPVTFS  90

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVENQSDR-  439
            P +PK   V EST L+ KF+  T+  C+ +  W + + D+  GQ  V +     N   R 
Sbjct  91   PVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGPRT  148

Query  438  ----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFKK  277
                FKIE+       Y + YCPS  + C  + R+    I     RLALSD PF ++  K
Sbjct  149  MRNWFKIEKFFG---DYKLVYCPSVCNFCRGLCRDVGIFINGGVRRLALSDVPFKVVSSK  205

Query  276  TSL  268
              L
Sbjct  206  KKL  208



>ref|XP_006441459.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
 gb|ESR54699.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
Length=206

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 87/181 (48%), Gaps = 19/181 (10%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-CPSDVI----SWLYADPVVI  616
            PV+D  G  L+ G  Y I  +T G G G + L  RS  K CP DV+    S+    PV  
Sbjct  31   PVLDVAGKKLRAGSKYYILPVTKGQGGG-LTLAGRSNNKTCPLDVVQEQHSFRNGLPVTF  89

Query  615  TPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVENQSDR  439
            +P +PK   V EST  + KF+  T+  C+ +  W + + D+  GQ  V +     N   R
Sbjct  90   SPVNPKKGVVRESTDFNIKFDAATS--CAQSTVWKLDNFDAALGQWLVTTGGVEGNPGPR  147

Query  438  -----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFK  280
                 FKIE+       Y + +CPS  + C  + R+    I     RLALSD P  ++FK
Sbjct  148  TMRNWFKIEKFYG---DYKLVFCPSVCNFCRGLCRDVGIFINGGVRRLALSDVPLKVVFK  204

Query  279  K  277
            K
Sbjct  205  K  205



>ref|XP_006493432.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=342

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 90/186 (48%), Gaps = 19/186 (10%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-CPSDVI----SWLYADPVVI  616
            PVVD  G  L+ G  Y I  +T G G G + L  RS  K CP DV+    S+    PV  
Sbjct  31   PVVDIAGKQLRAGSKYYILPVTKGRGGG-LTLAGRSNNKTCPLDVVQEQHSFRNGLPVTF  89

Query  615  TPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVENQSDR  439
            +P +PK   V EST L+ KF+  T+  C+ +  W + + D+  GQ  V +     N   R
Sbjct  90   SPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAVLGQWLVTTGGVEGNPGPR  147

Query  438  -----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFK  280
                 FKIE+       Y + +CPS  + C  + R+    I     RLALSD P  ++FK
Sbjct  148  TMRNWFKIEKFYG---DYKLVFCPSVCNFCRGLCRDVGIFINGGVRRLALSDVPLKVVFK  204

Query  279  KTSLAS  262
            K  + S
Sbjct  205  KLRVGS  210



>ref|XP_006441441.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
 gb|ESR54681.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
Length=206

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 87/181 (48%), Gaps = 19/181 (10%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-CPSDVI----SWLYADPVVI  616
            PV+D  G  L+ G  Y I  +T G G G + L  R   K CP DV+    S+    PV  
Sbjct  31   PVLDIAGKQLRAGSKYYILPVTKGRGGG-LTLAGRGNNKTCPLDVVQEQHSFKNGLPVTF  89

Query  615  TPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVENQSDR  439
            +P +PK   V EST ++ K +  T+  C+ +  W + + D+  GQ  V +     N   R
Sbjct  90   SPVNPKKGVVRESTDINIKLDAATS--CAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGPR  147

Query  438  -----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFK  280
                 FKIE+       Y + YCPS  + C  + R+    I     RLALSD PF ++FK
Sbjct  148  TMRNWFKIEKFFG---DYKLVYCPSVCNFCRGLCRDVGIFINGGVRRLALSDIPFKVVFK  204

Query  279  K  277
            K
Sbjct  205  K  205



>ref|XP_006441438.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
 gb|ESR54678.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
Length=206

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 90/183 (49%), Gaps = 23/183 (13%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-CPSDVI----SWLYADPVVI  616
            PV+D  G  L+ G  Y I  +T G G G + L  RS  K CP DV+    S+    PV  
Sbjct  31   PVLDIAGKQLRAGSKYYILPVTKGRGGG-LTLAGRSNNKTCPLDVVQEQHSFRNGLPVTF  89

Query  615  TPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVENQSDR  439
            +P +PK   V EST ++ KF+  T+  C+ +  W + + D+  GQ  V +     N   R
Sbjct  90   SPVNPKKGVVRESTDINIKFDAATS--CAQSTVWKLDNFDAALGQWLVTTGGVEGNPGPR  147

Query  438  -----FKIERLEAIIPTYIITYCPSGTD----KCYYVGREYDQSIKSTRLALSDFPFVLL  286
                 FKIE+       Y + +CPS  +     C  VG   +  ++  RLALSD PF ++
Sbjct  148  TMRNWFKIEKFYG---DYKLVFCPSVCNIFRGLCRDVGIFINGGVR--RLALSDVPFKVV  202

Query  285  FKK  277
            FKK
Sbjct  203  FKK  205



>ref|XP_002270111.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35474.3| unnamed protein product [Vitis vinifera]
Length=203

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 88/187 (47%), Gaps = 17/187 (9%)
 Frame = -3

Query  804  VPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY---  634
            V   SS  PV+D++G  L  G  Y I  +  G G G + L       CP DV+   +   
Sbjct  22   VAAESSPDPVLDTEGKQLWSGVDYYILPVIRGRGGG-LTLASTGNENCPLDVVQEQHEVS  80

Query  633  -ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFV  457
               P+  TP +PK   +  ST  + KF+  T  +C  +  W +++D  +GQ FV +    
Sbjct  81   NGLPLTFTPVNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQRFVTTGGVE  138

Query  456  ENQSDR-----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFP  298
             N         FKIE+ E     Y + +CP+  D C  V  +    I++   RLALSD P
Sbjct  139  GNPGHETLDNWFKIEKYED---DYKLVFCPTVCDFCKPVCGDIGIYIQNGYRRLALSDVP  195

Query  297  FVLLFKK  277
            F ++FKK
Sbjct  196  FKVMFKK  202



>emb|CBI35464.3| unnamed protein product [Vitis vinifera]
Length=225

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 90/194 (46%), Gaps = 31/194 (16%)
 Frame = -3

Query  804  VPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY---  634
            V   S+  PV+D++G  L+ G  Y I  +  G G G       +ET CP DV+       
Sbjct  44   VAAESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNET-CPLDVVQEQQEVS  102

Query  633  -ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFV  457
               P+  TP +PK   +  ST  + KF+  T  +C  +  W +++D  +GQ FV +   V
Sbjct  103  NGLPLTFTPVNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQRFVTTGG-V  159

Query  456  ENQSDR------FKIERLEAIIPTYIITYCPSGTDKC--------YYVGREYDQSIKSTR  319
            E    R      FKIE+ E     Y + +CP+  D C         Y+  EY       R
Sbjct  160  EGNPGRETLDNWFKIEKYED---DYKLVFCPTVCDFCKPVCGDIGIYIQNEY------RR  210

Query  318  LALSDFPFVLLFKK  277
            LALSD PF ++FKK
Sbjct  211  LALSDVPFKVMFKK  224



>emb|CAN75396.1| hypothetical protein VITISV_028636 [Vitis vinifera]
Length=203

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 91/188 (48%), Gaps = 19/188 (10%)
 Frame = -3

Query  804  VPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY---  634
            V   S+  PV+D++G  L+ G  Y I  +  G G G       +ET CP DV+       
Sbjct  22   VAAESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNET-CPLDVVQEQQEVS  80

Query  633  -ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFV  457
               P+  TP +PK   +  ST  + KF+  T  +C  +  W +++D  +GQ FV +   V
Sbjct  81   NGLPLTFTPVNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQRFVTTGG-V  137

Query  456  ENQSDR------FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKST--RLALSDF  301
            E    R      FKIE+ E     Y + +CP+  D C  V  +    I++   RLALSD 
Sbjct  138  EGNPGRETLDNWFKIEKYED---DYKLVFCPTVCDFCKPVCGDIGIYIQNXYRRLALSDV  194

Query  300  PFVLLFKK  277
            PF ++FKK
Sbjct  195  PFKVMFKK  202



>gb|AAQ96377.1| miraculin-like protein [Solanum palustre]
Length=209

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 89/186 (48%), Gaps = 19/186 (10%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD----  628
            A S   VVD DG  L+ G  Y I  +  G G G + ++   +  CP D +   + +    
Sbjct  29   AESPPEVVDIDGKILRTGVDYYILPVVRGRGGG-LTMDSIGDKICPLDAVVQEHQEIDQG  87

Query  627  -PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQ-HDSGTGQDFV-----RS  469
             P+  TP +PK   + EST L+  F+   N +C     W +   D  TGQ F+     + 
Sbjct  88   LPLTFTPVNPKKGVIRESTDLNIIFS--ANSICVQTTQWKLDDFDETTGQYFITLGGNQG  145

Query  468  DEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPF  295
            +   E  S+ FKIE+ +     Y + YCP+  D C  + +E    I+    RLALSD PF
Sbjct  146  NPGRETISNWFKIEKFDR---DYKLLYCPTVCDFCKVICKEIGIFIQDGVRRLALSDVPF  202

Query  294  VLLFKK  277
             ++FKK
Sbjct  203  KVMFKK  208



>ref|XP_006441446.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
 gb|ESR54686.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
Length=206

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 88/182 (48%), Gaps = 19/182 (10%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-CPSDVI----SWLYADPVVI  616
            PV+D  G  L+ G  Y I  +T G G G + L  RS  K C  DV+    S+    PV  
Sbjct  31   PVLDIAGKQLRAGSKYYILPVTKGRGGG-LTLAGRSNNKTCLLDVVQEQHSFRNGLPVTF  89

Query  615  TPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVENQSDR  439
            +P +PK   V EST L+ KF+  T+  C+ +  W + + D+  GQ  + +     N   R
Sbjct  90   SPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAVLGQWLLTTGGVEGNPGPR  147

Query  438  -----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFK  280
                 FKIE+       Y + YCPS  + C  + R+    I     RLALSD PF ++FK
Sbjct  148  TMRNWFKIEKFFG---DYKLVYCPSVCNFCRGLCRDVGIFINGGVRRLALSDVPFKVVFK  204

Query  279  KT  274
            K 
Sbjct  205  KV  206



>gb|AEK26926.1| Kunitz-type trypsin inhibitor B1 [Populus nigra]
Length=212

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 90/184 (49%), Gaps = 22/184 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  29   PVLDIQGEELKAGTEYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLPVTFS  85

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA  +   +  ST L+ KF++     C  +  W +Q  S +  Q FV       +  V  
Sbjct  86   PASSEDDVIRVSTDLNIKFSIKKA--CDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHT  143

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD--FPFVLL  286
             ++ FKIE+  A I  Y + +CP     C  + R+   Y ++ +   L+LSD   PFV+L
Sbjct  144  LTNWFKIEK--AGILGYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSDKLSPFVVL  201

Query  285  FKKT  274
            FKK 
Sbjct  202  FKKV  205



>gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri x Vitis riparia]
Length=203

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 91/188 (48%), Gaps = 19/188 (10%)
 Frame = -3

Query  804  VPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY---  634
            V   S+  PV+D++G  L+ G  Y I  +  G G G       +ET CP DV+       
Sbjct  22   VAAESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNET-CPLDVVQEQQEVS  80

Query  633  -ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFV  457
               P+  TP +PK   +  ST  + KF+  T  +C  +  W +++D  +GQ FV +   V
Sbjct  81   NGLPLTFTPVNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQRFVTTGG-V  137

Query  456  ENQSDR------FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDF  301
            E    R      FKIE+ +     Y + +CP+  D C  V  +    I++   RLALSD 
Sbjct  138  EGNPGRETLDNWFKIEKYDD---DYKLVFCPTVCDFCKPVCGDIGIYIQNGYRRLALSDV  194

Query  300  PFVLLFKK  277
            PF ++FKK
Sbjct  195  PFKVMFKK  202



>emb|CAI77764.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 94/191 (49%), Gaps = 25/191 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +S  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVA---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDHSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+   I+  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEKGAGIL-GYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  194

Query  303  --FPFVLLFKK  277
               PF++LFKK
Sbjct  195  KLSPFLVLFKK  205



>emb|CAI77774.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 94/191 (49%), Gaps = 25/191 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +S  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVA---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDHSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+   I+  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEKGAGIL-GYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  194

Query  303  --FPFVLLFKK  277
               PF++LFKK
Sbjct  195  KLSPFLVLFKK  205



>emb|CAI77798.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77799.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77806.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77807.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 94/191 (49%), Gaps = 25/191 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +S  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVS---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+   I+  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEKGAGIL-GYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  194

Query  303  --FPFVLLFKK  277
               PF++LFKK
Sbjct  195  KLSPFLVLFKK  205



>emb|CAI77775.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 94/191 (49%), Gaps = 25/191 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +S  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVA---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+   I+  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEKGAGIL-GYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  194

Query  303  --FPFVLLFKK  277
               PF++LFKK
Sbjct  195  KLSPFLVLFKK  205



>emb|CAI77765.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77792.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77796.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77797.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77801.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 94/191 (49%), Gaps = 25/191 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +S  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVA---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+   I+  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEKGAGIL-GYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  194

Query  303  --FPFVLLFKK  277
               PF++LFKK
Sbjct  195  KLSPFLVLFKK  205



>emb|CAI77777.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 94/192 (49%), Gaps = 25/192 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +S  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVA---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+   I+  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEKGAGIL-GYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  194

Query  303  --FPFVLLFKKT  274
               PF++LFKK 
Sbjct  195  KLSPFLVLFKKV  206



>emb|CAI77793.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 94/191 (49%), Gaps = 25/191 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +S  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVA---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+   I+  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEKGAGIL-GYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  194

Query  303  --FPFVLLFKK  277
               PF++LFKK
Sbjct  195  KLSPFLVLFKK  205



>ref|XP_002266430.1| PREDICTED: miraculin [Vitis vinifera]
Length=203

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 90/188 (48%), Gaps = 19/188 (10%)
 Frame = -3

Query  804  VPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY---  634
            V   S+  PV+D++G  L+ G  Y I  +  G G G       +ET CP DV+       
Sbjct  22   VAAESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGNET-CPLDVVQEQQEVS  80

Query  633  -ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFV  457
               P+  TP +PK   +  ST  + KF+  T  +C  +  W +++D  +GQ FV +   V
Sbjct  81   NGLPLTFTPVNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQRFVTTGG-V  137

Query  456  ENQSDR------FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKST--RLALSDF  301
            E    R      FKIE+ E     Y + +CP+  D C  V  +    I++   RLALSD 
Sbjct  138  EGNPGRETLDNWFKIEKYED---DYKLVFCPTVCDFCKPVCGDIGIYIQNEYRRLALSDV  194

Query  300  PFVLLFKK  277
            PF + FKK
Sbjct  195  PFKVKFKK  202



>emb|CAI77800.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 94/191 (49%), Gaps = 25/191 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +S  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVA---ATNKTCPDDVIQYSLDLLQV  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+   I+  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEKGAGIL-GYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  194

Query  303  --FPFVLLFKK  277
               PF++LFKK
Sbjct  195  KLSPFLVLFKK  205



>emb|CAI77770.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 92/191 (48%), Gaps = 25/191 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +S  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVA---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI-----KSTRLALSD  304
                   ++ FKIE+   I+  Y + YCP   D C  VG   D  I     +   L+LSD
Sbjct  138  NPGCDTFTNWFKIEKGAGIL-GYKLVYCPE--DICPSVGLCRDVGIYFETNRGRILSLSD  194

Query  303  --FPFVLLFKK  277
               PF++LFKK
Sbjct  195  KLSPFLVLFKK  205



>ref|XP_002265965.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35463.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 94/190 (49%), Gaps = 20/190 (11%)
 Frame = -3

Query  804  VPIASSGAP--VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVIS----  643
            +P A+  AP  V+D +G  L+ G  Y I  +  G G G      R++T CP DV+     
Sbjct  21   LPGAAEAAPDPVLDIEGKQLRSGVDYYILPVIRGRGGGLTVASVRNKT-CPLDVVQDKLE  79

Query  642  WLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDE  463
              +  P+  TP +PK   +  ST  + KF+  T  +C+ +  W +++D  TGQ F+ +  
Sbjct  80   VSHGLPLTFTPVNPKQDVIRVSTDHNIKFSAAT--ICAQSTVWKLEYDESTGQRFITTGG  137

Query  462  FVENQ-----SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLAL-S  307
               N      S+ FKIE+       Y + +CP+  + C  + R+    I+    RLAL +
Sbjct  138  VEGNPGRGTLSNWFKIEKYGD---DYKLVFCPTVCNFCKVICRDVGVYIQKGYRRLALTT  194

Query  306  DFPFVLLFKK  277
            D PF ++FKK
Sbjct  195  DAPFRVMFKK  204



>emb|CAN65022.1| hypothetical protein VITISV_027379 [Vitis vinifera]
Length=203

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 90/188 (48%), Gaps = 19/188 (10%)
 Frame = -3

Query  804  VPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY---  634
            V   S+  PV+D++G  L+ G  Y I  +  G G G + L       CP DV+       
Sbjct  22   VAAESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGG-LTLASTGNESCPLDVVQEQQEVS  80

Query  633  -ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFV  457
               P+  TP +PK   +  ST  + KF+  T  +C  +  W +++D  +GQ FV +   V
Sbjct  81   NGLPLTFTPVNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQWFVTTGG-V  137

Query  456  ENQSDR------FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDF  301
            E    R      FKIE+ E     Y + +CP+  D C  V  +    I++   RLALSD 
Sbjct  138  EGNPGRETLDNWFKIEKYED---DYKLVFCPTVCDFCKPVCGDIGIYIQNGYRRLALSDV  194

Query  300  PFVLLFKK  277
            PF ++FKK
Sbjct  195  PFKVMFKK  202



>ref|XP_006495061.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 83/173 (48%), Gaps = 19/173 (11%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-CPSDVI----SWLYADPVVI  616
            PV+D  G  L+ G  Y I  +T G G G + L  RS  K CP DV+    S+    PV  
Sbjct  31   PVLDIAGKQLRAGSKYYILPVTKGRGGG-LTLAGRSNNKTCPLDVVQEQHSFRNGLPVTF  89

Query  615  TPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVENQSDR  439
            +P +PK   V EST L+ KF+  T+  C+ +  W + + D+  GQ  V +     N   R
Sbjct  90   SPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGPR  147

Query  438  -----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDF  301
                 FKIE+       Y + YCPS  + C  + R+    I     RLALSDF
Sbjct  148  TMRNWFKIEKFFG---DYKLVYCPSVCNFCRGLCRDVGIFINGGVRRLALSDF  197



>emb|CAI77768.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 94/191 (49%), Gaps = 25/191 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +S  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVS---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RS  469
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +  Q  V       
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDHSSVWKIQKSSNSEVQRLVTTGGEEG  137

Query  468  DEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
            +   +  ++ FKIE+   I+  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEKGAGIL-GYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  194

Query  303  --FPFVLLFKK  277
               PF++LFKK
Sbjct  195  KLSPFLVLFKK  205



>ref|XP_009803614.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=210

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 87/189 (46%), Gaps = 22/189 (12%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWL----YAD  628
             SS +PV+D +GD +QVG  Y +  +  G G G      +    CP D+I  +       
Sbjct  28   GSSPSPVLDINGDKVQVGLNYFVLPVIRGRGGGLYPSNVKQNNTCPRDIIQEVDEVQQGL  87

Query  627  PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDF-----VRSD  466
            PVV TP D K   V  ST L+ +F   T  +C+    W +  +D    Q F     V  +
Sbjct  88   PVVFTPFDAKKGVVRLSTDLNVRF--FTPTICARETIWKLGTYDDKLKQYFMVTGGVEGN  145

Query  465  EFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTR-----LALSDF  301
               +  S  FKIE+L      Y   +CPS    C  + +  D  I ST+     +ALSD 
Sbjct  146  PGPQTLSSWFKIEKLGT---DYKFVFCPSVCKICKVICK--DVGIYSTKDGVRFMALSDT  200

Query  300  PFVLLFKKT  274
            PF ++FKKT
Sbjct  201  PFRVMFKKT  209



>emb|CAI77773.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 94/192 (49%), Gaps = 26/192 (14%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +S  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVA---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+  A +  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEK--AGVLGYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  193

Query  303  --FPFVLLFKKT  274
               PF++LFKK 
Sbjct  194  KLSPFLVLFKKV  205



>emb|CAI77786.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 94/191 (49%), Gaps = 26/191 (14%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +S  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVA---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+  A +  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEK--AGVLGYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  193

Query  303  --FPFVLLFKK  277
               PF++LFKK
Sbjct  194  KLSPFLVLFKK  204



>emb|CAI77772.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77776.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77780.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77781.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77791.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77802.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 94/191 (49%), Gaps = 25/191 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I ++  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEANTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVS---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+   I+  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEKGAGIL-GYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  194

Query  303  --FPFVLLFKK  277
               PF++LFKK
Sbjct  195  KLSPFLVLFKK  205



>ref|XP_002305033.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|EEE85544.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92484.1| Kunitz-type protease inhibitor KPI-D1.2 [Populus trichocarpa]
 gb|ADW95379.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=212

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 89/183 (49%), Gaps = 22/183 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  29   PVLDIQGEELKAGTEYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLPVTFS  85

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA  +   +  ST L+ KF++     C  +  W +Q  S +  Q FV       +  V  
Sbjct  86   PASSEDDVIRVSTDLNIKFSIKKA--CDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHT  143

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD--FPFVLL  286
             ++ FKIE+   +   Y + +CP     C  + R+   Y ++ +   L+LSD   PFV+L
Sbjct  144  LTNWFKIEKAGTL--GYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSDKLSPFVVL  201

Query  285  FKK  277
            FKK
Sbjct  202  FKK  204



>gb|ABK96521.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ACS92517.1| Kunitz-type protease inhibitor KPI-D11 [Populus trichocarpa x 
Populus deltoides]
Length=212

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 91/184 (49%), Gaps = 22/184 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y I+S  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  29   PVLDIQGEQLKAGTEYIISSAIWGAGGGDVS---ATNKTCPDDVIQYSLDLLQGLPVTFS  85

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA  +   +  ST L+ KF++  +  C  +  W +Q  S +  Q FV       +  V  
Sbjct  86   PASSEDDVIRVSTDLNIKFSIKKD--CDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHT  143

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD--FPFVLL  286
             ++ FKIE+  A I  Y + +CP     C  + R+   Y ++ +   L+LSD   PF++L
Sbjct  144  ITNWFKIEK--AGILGYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSDKLSPFLVL  201

Query  285  FKKT  274
            FKK 
Sbjct  202  FKKV  205



>emb|CAI77782.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77794.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 94/191 (49%), Gaps = 25/191 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +S  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVA---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+   I+  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEKGAGIL-GYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  194

Query  303  --FPFVLLFKK  277
               PF+++FKK
Sbjct  195  KLSPFLVVFKK  205



>emb|CAI77783.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77784.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77788.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77789.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77804.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77805.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 93/191 (49%), Gaps = 25/191 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +S  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVA---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+   I+  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEKGAGIL-GYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  194

Query  303  --FPFVLLFKK  277
               PF++ FKK
Sbjct  195  KLSPFLVFFKK  205



>ref|XP_011035403.1| PREDICTED: 21 kDa seed protein-like [Populus euphratica]
Length=212

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 93/185 (50%), Gaps = 24/185 (13%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y I+S  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  29   PVLDIQGEELKAGAEYIISSAIWGAGGGDVS---ATNKTCPDDVIQYSLDLLRGLPVTFS  85

Query  612  PADPKATDVIE-STFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVE  454
            PA+    DVI  ST L+ KF++     C  +  W +Q  S +  Q FV       +  V+
Sbjct  86   PAN-YGDDVIRISTDLNIKFSIKKA--CDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVD  142

Query  453  NQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD--FPFVL  289
              ++ FKIE+  A I  Y + +CP     C  + R+   Y ++ +   L+LSD   PFV+
Sbjct  143  TLTNWFKIEK--AGILGYKLVFCPKDICHCGVLCRDIGIYFENNRGRILSLSDQLSPFVV  200

Query  288  LFKKT  274
            +FKK 
Sbjct  201  VFKKV  205



>ref|XP_009608866.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 84/184 (46%), Gaps = 17/184 (9%)
 Frame = -3

Query  789  SGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVIS----WLYADPV  622
            S +PV+D++GD ++ G  Y +  +  G G G      +    CP D+I          PV
Sbjct  30   SPSPVLDTNGDKIRTGSNYFVLPVIRGRGGGLFPSNVKQNNTCPRDIIQESLDVQQGLPV  89

Query  621  VITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEFVENQ-  448
            V TP DPK   +  S+ L+ +F   T  +C+    W V   D    Q FV +     N  
Sbjct  90   VFTPVDPKKGVIRLSSDLNVRFFTPT--ICARETIWKVGDFDEKLKQYFVVTGGVEGNPG  147

Query  447  ----SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLL  286
                S+ FKIE+L      Y   +CPS    C  + ++     K+    LALSD PF ++
Sbjct  148  PQTVSNWFKIEKLGT---DYKFVFCPSVCSFCKVICKDVGIFTKNGVRFLALSDTPFRVM  204

Query  285  FKKT  274
            FKKT
Sbjct  205  FKKT  208



>ref|XP_006351546.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=205

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 88/186 (47%), Gaps = 19/186 (10%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD----  628
            A S   VVD DG  L+ G  Y I  +  G G G + ++   +  CP D +   + +    
Sbjct  25   AESPPEVVDIDGKILRTGVDYYILPVVRGRGGG-LTMDSIGDKICPLDAVVQEHHEIDQG  83

Query  627  -PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFV-----RS  469
             P+  TP +PK   + EST L+  F+   N +C     W +   D  TGQ F+     + 
Sbjct  84   LPLTFTPVNPKKGVIRESTDLNIIFS--ANSICVQTTQWKLDDFDETTGQYFITLGGTQG  141

Query  468  DEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPF  295
            +   E  S+  KIE+ +     Y + YCP+  D C  + ++    I+    RLALSD PF
Sbjct  142  NPGRETVSNWIKIEKFDR---DYKLLYCPTVCDICKVICKDIGIFIQDGVRRLALSDAPF  198

Query  294  VLLFKK  277
             ++FKK
Sbjct  199  KVMFKK  204



>emb|CAI77790.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 94/191 (49%), Gaps = 26/191 (14%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I ++  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEANTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVS---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+  A +  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEK--AGVLGYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  193

Query  303  --FPFVLLFKK  277
               PF++LFKK
Sbjct  194  KLSPFLVLFKK  204



>gb|AAC49969.1| tumor-related protein [Nicotiana tabacum]
Length=210

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 59/193 (31%), Positives = 90/193 (47%), Gaps = 21/193 (11%)
 Frame = -3

Query  795  ASSGAP--VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD--  628
            +S+ AP  VVD  G  L+ G  Y I  +  G G G + L+      CP D +     +  
Sbjct  23   SSAEAPPAVVDIAGKKLRTGIDYYILPVVRGRGGG-LTLDSTGNESCPLDAVVQEQQEIK  81

Query  627  ---PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQ-HDSGTGQDFV-----  475
               P+  TP +PK   + EST L+ KF+  +  +C     W +   D  TG+ F+     
Sbjct  82   NGLPLTFTPVNPKKGVIRESTDLNIKFSAAS--ICVQTTLWKLDDFDETTGKYFITIGGN  139

Query  474  RSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDF  301
              +   E  S+ FKIE+ E     Y + YCP+  + C  + ++    I+    RLALSD 
Sbjct  140  EGNPGRETISNWFKIEKFER---DYKLVYCPTVCNFCKVICKDVGIFIQDGIRRLALSDV  196

Query  300  PFVLLFKKTSLAS  262
            PF ++FKK  +  
Sbjct  197  PFKVMFKKAQVVK  209



>emb|CAI77769.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77787.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 94/191 (49%), Gaps = 26/191 (14%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +S  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVA---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+  A +  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEK--AGVLGYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  193

Query  303  --FPFVLLFKK  277
               PF+++FKK
Sbjct  194  KLSPFLVVFKK  204



>emb|CAI77803.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 94/191 (49%), Gaps = 25/191 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I ++  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEANTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVS---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+   I+  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEKGAGIL-GYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  194

Query  303  --FPFVLLFKK  277
               PF+++FKK
Sbjct  195  KLSPFLVVFKK  205



>gb|ADK62529.1| miraculin-like protein [Nicotiana benthamiana]
Length=205

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 87/186 (47%), Gaps = 19/186 (10%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD----  628
            A +   VVD  G  L+ G  Y I  +  G G G + L+      CP D +     +    
Sbjct  25   AEAPPAVVDIAGKKLRTGIDYYILPVVRGRGGG-LTLDSTGNESCPLDAVVQEQKEINNG  83

Query  627  -PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFV-----RS  469
             P+  TP +PK   + EST L+ KF+  +  +C     W +   D  TG+ F+       
Sbjct  84   FPLTFTPVNPKKGVIRESTDLNIKFSAAS--ICVQTTLWKLDDFDETTGKYFITIGGNEG  141

Query  468  DEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIK--STRLALSDFPF  295
            +   E  S+ FKIE+ E     Y + YCP+  + C  + ++    I+  + RLALSD PF
Sbjct  142  NPGRETISNWFKIEKFER---DYKLVYCPTVCNFCKVICKDIGIFIQDGTRRLALSDVPF  198

Query  294  VLLFKK  277
             ++FKK
Sbjct  199  KVMFKK  204



>ref|XP_009777240.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 86/189 (46%), Gaps = 17/189 (9%)
 Frame = -3

Query  804  VPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVIS----WL  637
            V    S +PV+D++GD ++ G  Y +  +  G G G +    +    CP D+I       
Sbjct  25   VSAGPSPSPVLDTNGDKIRAGSNYFVLPVIRGRGGGLLPSNVKQNNSCPRDIIQNSNEVQ  84

Query  636  YADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEF  460
               PVV TP DPK   +  ST L+ +F   T  +C+    W +  +D    Q F+ +   
Sbjct  85   EGLPVVFTPVDPKKGVIRLSTDLNVRF--FTPTICARETIWKLGTYDEKLKQYFIVTGGV  142

Query  459  VENQ-----SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDF  301
              N      S+ FKIE+L      Y   +CPS    C  + ++     K     LALSD 
Sbjct  143  EGNPGPLTVSNWFKIEKLGT---DYKFVFCPSVCTFCKVICKDVGIYNKDGVRFLALSDT  199

Query  300  PFVLLFKKT  274
            PF ++FK+T
Sbjct  200  PFRVMFKRT  208



>emb|CAI77766.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 91/191 (48%), Gaps = 25/191 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +S  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVA---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  QS------DRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI-----KSTRLALSD  304
                    + FKIE+   I+  Y + YCP   D C  VG   D  I     +   L+LSD
Sbjct  138  NPGCDTFINWFKIEKGAGIL-GYKLVYCPE--DICPSVGLCRDVGIYFETNRGRILSLSD  194

Query  303  --FPFVLLFKK  277
               PF+++FKK
Sbjct  195  KLSPFLVVFKK  205



>ref|XP_009792285.1| PREDICTED: miraculin [Nicotiana sylvestris]
Length=210

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 87/191 (46%), Gaps = 19/191 (10%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD----  628
            A +   VVD  G  L+ G  Y I  +  G G G + L+      CP D +     +    
Sbjct  25   AEAPPAVVDIAGKKLRTGIDYYILPVVRGRGGG-LTLDSTGNESCPLDAVVQEQQEIKNG  83

Query  627  -PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQ-HDSGTGQDFV-----RS  469
             P+  TP +PK   + EST L+ KF+  +  +C     W +   D  TG+ F+       
Sbjct  84   LPLTFTPVNPKKGVIRESTDLNIKFSAAS--ICVQTTLWKLDDFDETTGKYFITIGGNEG  141

Query  468  DEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPF  295
            +   E  S+ FKIE+ E     Y + YCP+  + C  + ++    I+    RLALSD PF
Sbjct  142  NPGRETISNWFKIEKFER---DYKLVYCPTVCNFCKVICKDVGIFIQDGIRRLALSDVPF  198

Query  294  VLLFKKTSLAS  262
             ++FKK  +  
Sbjct  199  KVMFKKAQVVK  209



>emb|CDP18338.1| unnamed protein product [Coffea canephora]
Length=215

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 89/190 (47%), Gaps = 20/190 (11%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-CPSDVISWL----YA  631
            A    PV+D +G+ ++ G  Y+I S  +G G G V        + CP  V+  L      
Sbjct  21   AEEPNPVLDINGEEIRPGVEYHIVSAIFGGGGGGVTYGKGPGNQICPLAVVQALSDLNRG  80

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEF---  460
             PV  TP +P+   V  ST L+ KF+   NF C G+  W V  +    Q FV +D     
Sbjct  81   HPVSFTPVNPEEGVVRVSTDLNIKFSPFINF-CRGSNVWKVHFNEALEQHFVLTDGVEGN  139

Query  459  --VENQSDRFKIERLEAIIPTYIITYCPSGTDK-----CYYVGREYDQSIKSTRLALSDF  301
               E +++ FKI   E   P Y + +CP+  D      C  VG  YD    + RLALSD 
Sbjct  140  SGCETEANWFKI---EGNYPFYKLVFCPAVCDSSSEAICKDVGIYYDDD-GTRRLALSDR  195

Query  300  PFVLLFKKTS  271
            PFV+ F K +
Sbjct  196  PFVVFFSKKN  205



>emb|CAI77785.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 93/191 (49%), Gaps = 25/191 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +S   V+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEASTESVLDIQGEELKAGTEYIISSIFWGAGGGDVA---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+   I+  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEKGAGIL-GYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  194

Query  303  --FPFVLLFKK  277
               PF++LFKK
Sbjct  195  KLSPFLVLFKK  205



>ref|XP_011035402.1| PREDICTED: 21 kDa seed protein-like [Populus euphratica]
Length=212

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 89/184 (48%), Gaps = 22/184 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y I+S  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  29   PVLDIQGEELKAGAEYIISSAIWGAGGGDVS---ATNKTCPDDVIQYSLDLLRGLPVTFS  85

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA      +  ST L+ KF++     C  +  W +Q  S +  Q FV       +  V+ 
Sbjct  86   PASSDDDVIRVSTDLNIKFSIEKA--CDHSSVWKIQKSSNSEVQWFVTTGGAEGNPGVDT  143

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD--FPFVLL  286
              + FKIE+  A I  Y + +CP     C  + R+   Y ++ +   L+LSD   PFV++
Sbjct  144  LFNWFKIEK--AGILGYKLVFCPKDICHCGVLCRDIGIYFENNRGRILSLSDQLSPFVVV  201

Query  285  FKKT  274
            FKK 
Sbjct  202  FKKV  205



>emb|CAI77795.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 94/191 (49%), Gaps = 26/191 (14%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I ++  PV+D  G+ L+ G  Y I+SI WGAG G+V     +   CP DVI +    L  
Sbjct  23   IEANTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVS---ATNKTCPDDVIQYSLDLLQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKKA--CDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTR---LALSD  304
                   ++ FKIE+  A +  Y + YCP   D C  VG   D  I  +S R   L+LSD
Sbjct  138  NPGCDTFTNWFKIEK--AGVLGYKLVYCPE--DICPSVGLCRDVGIYFESNRGRILSLSD  193

Query  303  --FPFVLLFKK  277
               PF+++FKK
Sbjct  194  KLSPFLVVFKK  204



>emb|CDP19138.1| unnamed protein product [Coffea canephora]
Length=218

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 94/192 (49%), Gaps = 21/192 (11%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-CPSDVIS----WLYA  631
            A    PV+D +G+ ++ G  Y++ S+ WGAG G V        + CP  V+         
Sbjct  21   AEEPNPVLDINGEEIRPGVEYHVVSLFWGAGGGGVTYGKGPGNEICPLAVVQEPSDRNRG  80

Query  630  DPVVITPADPKATDVIESTFLSFKFNV--VTNFLCSGNLYWGVQHDSGTGQDFVRSDEF-  460
             PV  TP +P+   V  ST L+ KF    + NF C G+  W V  +    Q FV +D   
Sbjct  81   HPVTFTPVNPEEGVVRVSTDLNIKFAEPPIINF-CRGSNVWKVHFNEALEQHFVLTDGVE  139

Query  459  ----VENQSDRFKIERLEAIIPTYIITYCPSGTDK-----CYYVGREYDQSIKSTRLALS  307
                 E +++ FKIE + ++   Y + YCP+  D      C  VG  YD   ++ RLALS
Sbjct  140  GNSGCETEANWFKIEAIGSL--GYKLVYCPAVCDSSSEAICKDVGIYYDDD-RTRRLALS  196

Query  306  DFPFVLLFKKTS  271
            D PF+++F K S
Sbjct  197  DQPFLVVFIKKS  208



>gb|ABX76298.1| sexual organ expressed protein [Nicotiana alata]
Length=242

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 86/189 (46%), Gaps = 27/189 (14%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVITP  610
            V+D +G+ L VG  Y+I S   GAG G V L +   TKCP+ V+      L   PV    
Sbjct  53   VLDINGEPLHVGEEYHIISAIRGAGGGGVYLTYVGNTKCPNGVLQHGTDTLPGMPVKFVT  112

Query  609  ADPKATDVI-ESTFLSFKFNVVTNFLCSGNLYWGVQHDSGT--GQDFVRSDEFVENQ---  448
               +  +V+ E+T ++  F+V T  LC     W V     T  G  FV +   + N    
Sbjct  113  THSRPFNVVRENTDINIMFSVATTRLCVNQTVWKVGDPDLTARGTRFVVTGGTLGNPGPE  172

Query  447  --SDRFKIERLEAIIPTYIITYCPSGTDK----------CYYVGREYDQSIKSTRLALSD  304
              ++ FKIE++    P Y + YCP   DK          C  VG          RLAL++
Sbjct  173  TINNWFKIEKVTKQAPFYKLRYCP---DKLLCPECHPVDCLDVG--VTDHFGRRRLALTN  227

Query  303  FPFVLLFKK  277
             PF++ F+K
Sbjct  228  QPFMVYFRK  236



>ref|XP_009627067.1| PREDICTED: miraculin [Nicotiana tomentosiformis]
Length=205

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 87/185 (47%), Gaps = 19/185 (10%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD----  628
            A +   V+D  G  L+ G  Y I  +  G G G + L+      CP D +   + +    
Sbjct  25   AEAPPAVIDIAGKKLRTGVDYYILPVVRGRGGG-LTLDSTGNESCPLDAVVQEHHEIKNG  83

Query  627  -PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFV-----RS  469
             P+  TP +PK   + EST L+ KF+  +  +C     W +   D  TG+ F+       
Sbjct  84   LPLTFTPVNPKKGVIRESTDLNIKFSAAS--ICVQTTLWKLDDFDEATGKYFITIGGNEG  141

Query  468  DEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIK--STRLALSDFPF  295
            +   E  S+ FKI++ E     Y + YCP+  + C  + ++    I+  + RLALSD PF
Sbjct  142  NPGRETISNWFKIDKFER---DYKLVYCPTVCNFCKVICKDVGIFIQDGTRRLALSDVPF  198

Query  294  VLLFK  280
             ++FK
Sbjct  199  KVMFK  203



>ref|XP_009615974.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 84/186 (45%), Gaps = 17/186 (9%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVIS----WLYAD  628
             SS +PV+D +GD ++VG  Y +  +  G G G +    +    CP D+I          
Sbjct  28   GSSPSPVLDINGDKVRVGSNYFVLPVIRGRGGGLLPSNVKQINTCPRDIIQNSDEVQQGL  87

Query  627  PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEFVEN  451
            PVV TP D K   V  ST L+ +F   T  +C+    W +  +D    Q F+ +     N
Sbjct  88   PVVFTPFDAKKGVVRLSTDLNVRFYTPT--ICARETIWKLGTYDDKLKQYFIVTGGVEGN  145

Query  450  Q-----SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTR--LALSDFPFV  292
                  S  FKIE+L      Y   +CPS    C  + ++     K     LALSD PF 
Sbjct  146  PGPQTVSSWFKIEKLGT---DYKFLFCPSVCKICKVICKDVGIYTKDGVRFLALSDTPFR  202

Query  291  LLFKKT  274
            ++FKKT
Sbjct  203  VMFKKT  208



>ref|XP_004241479.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=200

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 90/188 (48%), Gaps = 19/188 (10%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVK-LEWRSETKCPSDVISWLYAD---  628
            +SS +PV+D +GD +Q G  Y I  +  G G G +     ++   CP D+I W   +   
Sbjct  17   SSSLSPVLDVNGDEVQAGPNYFILPVIRGRGGGGLSPFNVKNNNTCPRDIIQWDDEEQEG  76

Query  627  -PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDF-----VRS  469
             PVV T  D K + V  ST ++ +F   T  +C+    W +  +D    + F     V  
Sbjct  77   LPVVFTRIDAKKSVVRVSTDVNVRFYTPT--ICARETIWKLGDYDDKLKKYFVVTGGVEG  134

Query  468  DEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS---TRLALSDFP  298
            +  ++   + FKIER  +    Y + YCPS    C  + ++    I +     LALSD P
Sbjct  135  NPGLKTVGNWFKIERFGS---GYKLVYCPSVCKFCKVICKDVGIFITNDGVRLLALSDTP  191

Query  297  FVLLFKKT  274
            + ++FKKT
Sbjct  192  YKVMFKKT  199



>emb|CDP19136.1| unnamed protein product [Coffea canephora]
Length=216

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 89/191 (47%), Gaps = 22/191 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSI-TWGAGAGEVKLEWRSETKCPSDVIS----WLYADPVVI  616
            PVVD +G+ ++ G  Y + S+   G G+G    +      CP  V+     +    PV  
Sbjct  26   PVVDFNGEEIRPGVDYYVVSVFPGGRGSGVTYGKGPGNEICPLAVVQARPDFNRGHPVTF  85

Query  615  TPADPKATDVIESTFLSFKFNV--VTNFLCSGNLYWGVQHDSGTGQDFVRSDEF-----V  457
            TP +P+ + V  ST L+ KF+     NF C G+  W V  +    Q FV +D        
Sbjct  86   TPVNPEESVVRVSTDLNIKFSEPPFINF-CRGSNVWKVHFNEALKQHFVLTDGVEGNSGC  144

Query  456  ENQSDRFKIERLEAIIPTYIITYCPSGTDK-----CYYVGREYDQSIKSTRLALSDFPFV  292
            E +++ FKIE    +   Y   +CP+  D      C  VG  YD    + RLALSD PFV
Sbjct  145  ETEANWFKIELTGNV--GYKFVFCPAVCDSSSEAICKDVGIYYDDD-GTRRLALSDQPFV  201

Query  291  LLF-KKTSLAS  262
            + F KK  L S
Sbjct  202  VFFIKKMDLKS  212



>gb|AAQ84217.1| Kunitz trypsin inhibitor 4 [Populus trichocarpa x Populus deltoides]
 gb|ACS92488.1| Kunitz-type protease inhibitor KPI-D10.2 [Populus trichocarpa 
x Populus deltoides]
Length=212

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 89/184 (48%), Gaps = 22/184 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y I SI +GAG G+V     +   CP DVI +    L   PV  +
Sbjct  29   PVLDIQGEELKAGTEYIIGSIFFGAGGGDVS---ATNKTCPDDVIQYSSDLLQGLPVTFS  85

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA      +  ST L+ KF++     C  +  W +Q  S +  Q FV       +  ++ 
Sbjct  86   PASSDDDVIRVSTDLNIKFSIKKA--CDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGIDT  143

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD--FPFVLL  286
             ++ FKIE+  A I  Y +  CP G   C  + R+   Y ++     L+LSD   PF++L
Sbjct  144  LTNWFKIEK--AGILGYKLVSCPEGICHCGVLCRDIGIYRENDGRRILSLSDKLSPFLVL  201

Query  285  FKKT  274
            FKK 
Sbjct  202  FKKV  205



>gb|ABX76297.1| stigma expressed protein [Nicotiana alata]
Length=243

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 93/198 (47%), Gaps = 25/198 (13%)
 Frame = -3

Query  807  DVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVIS-WLYA  631
            D+P+ S    V+D++G  LQ+G  Y+I S +W  G G V L   + TKCP+DV+  W  +
Sbjct  44   DLPVLSE---VLDTNGKPLQIGEEYHIISASWRTGGG-VYLTNLTNTKCPNDVVQHWEGS  99

Query  630  D---PVVITPADPK---ATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQD--FV  475
                PV     DP+   ++ V E+  ++  F+V T  LC     W V     T Q   FV
Sbjct  100  KDGMPVKFFTMDPEVAPSSVVRETNDINIMFSVPTTKLCVNETVWKVGDPDSTEQGVRFV  159

Query  474  RSDEFVE-----NQSDRFKIERLEAIIPTYIITYCPSG--TDKCYY----VGREYDQS-I  331
             +   +           FKIE++    P Y + YCP       CY     VG   D+  +
Sbjct  160  VTGGTLGYPGPITIKSWFKIEKVTKTAPFYKLRYCPDRYLCPMCYVGCSDVGLTADRDVV  219

Query  330  KSTRLALSDFPFVLLFKK  277
               RL L+D PF ++F+K
Sbjct  220  GDKRLVLNDQPFWVVFEK  237



>ref|XP_008238584.1| PREDICTED: miraculin-like [Prunus mume]
Length=208

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/192 (30%), Positives = 87/192 (45%), Gaps = 17/192 (9%)
 Frame = -3

Query  816  RTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWL  637
            +   V   ++ +PV+D  G+ LQ G  Y I  +  G G G       ++T CP DV+   
Sbjct  21   KQGSVAADAAPSPVLDITGNKLQTGVNYYILPVIRGRGGGLTLASTSNKTSCPLDVVQEQ  80

Query  636  ----YADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVR  472
                    +  +P +     V+ ST L+ KF+  T  +C  +  W + + D  TGQ FV 
Sbjct  81   NEVSNGLSLKFSPVNVTKGVVLVSTDLNIKFSATT--ICVQSTVWKLGKFDEQTGQWFVT  138

Query  471  SDEFVEN-----QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIK--STRLA  313
            S     N      S+ FKIE+       Y + +CP+  + C  + R+     +    RLA
Sbjct  139  SGGVEGNPGRQTTSNWFKIEKFG---DDYKLVFCPTVCNFCKVICRDVGIFFQDGKRRLA  195

Query  312  LSDFPFVLLFKK  277
            LSD PF  +FKK
Sbjct  196  LSDVPFRAMFKK  207



>ref|XP_006347376.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=202

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 87/185 (47%), Gaps = 23/185 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVK-LEWRSETKCPSDVISWLYAD----PVVI  616
            PV+D +G+ ++ G  Y I  +  G G G +     +    CP D+I W   +    PVV 
Sbjct  24   PVLDVNGNEVEAGPNYFILPVIRGRGGGGLSPFNVKQNNTCPRDIIQWDDEEQEGLPVVF  83

Query  615  TPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDF-----VRSDEFVE  454
            T  D K + V  ST ++ +F   T  +C+    W + ++D    Q F     V  +  ++
Sbjct  84   TRIDAKKSVVRVSTDVNVRFYTPT--ICARETIWKLGEYDENLKQYFVVTGGVEGNPGLK  141

Query  453  NQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTR-----LALSDFPFVL  289
               + FKIE+ E+    Y   YCPS    C  + +  D  I  T+     LALSD P+ +
Sbjct  142  TVGNWFKIEKFES---GYKFVYCPSVCKFCKVICK--DVGILITKDGVRLLALSDTPYKV  196

Query  288  LFKKT  274
            +FKKT
Sbjct  197  MFKKT  201



>ref|XP_009789071.1| PREDICTED: cysteine protease inhibitor 8-like [Nicotiana sylvestris]
Length=242

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 85/189 (45%), Gaps = 27/189 (14%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVITP  610
            V+D +G+ L VG  Y+I S   GAG G V L +   TKCP+ V+          PV    
Sbjct  53   VLDINGEPLHVGEEYHIISAIRGAGGGGVYLTYVGNTKCPNGVLQHGRDTRPGMPVKFVT  112

Query  609  ADPKATDVI-ESTFLSFKFNVVTNFLCSGNLYWGVQHDSGT--GQDFVRSDEFVENQ---  448
               +  +V+ E+T ++  F+V T+ LC     W V     T  G  FV +   + N    
Sbjct  113  THSRPFNVVRENTDINIMFSVSTSRLCVNETVWKVGDPDLTTRGTRFVVTGGTLGNSRPE  172

Query  447  --SDRFKIERLEAIIPTYIITYCPSGTDK----------CYYVGREYDQSIKSTRLALSD  304
              ++ FKIE++    P Y + YCP   DK          C  VG          RLAL+ 
Sbjct  173  TTNNWFKIEKVTKQAPFYKLRYCP---DKFLCPECHPVDCLDVG--VTDHFGYRRLALTK  227

Query  303  FPFVLLFKK  277
             PF++ F+K
Sbjct  228  QPFMVFFRK  236



>emb|CDP21726.1| unnamed protein product [Coffea canephora]
Length=215

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 87/185 (47%), Gaps = 20/185 (11%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-CPSDVISWL----YADPVVI  616
            PV+D +G+ ++ G  Y+I S  +G G G V        + CP  V+  L       PV  
Sbjct  26   PVLDINGEEIRPGVEYHIESAIFGGGGGGVTYGKGPGNEICPLAVVQALSDVNRGHPVTF  85

Query  615  TPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEF-----VEN  451
            TP +P+   +  ST L+ KF+   NF C G+  W V  +    Q FV +D        E 
Sbjct  86   TPVNPEEGVIRVSTDLNIKFSPFINF-CRGSNVWKVHFNEALEQHFVLTDGVEGNSGCET  144

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDK-----CYYVGREYDQSIKSTRLALSDFPFVLL  286
            +++ FKI   E   P Y + +CP+  D      C  VG  YD    + RLALSD PF + 
Sbjct  145  EANWFKI---EGNYPFYRLVFCPAVCDSSSEAICKDVGIYYDDD-GTRRLALSDRPFGVY  200

Query  285  FKKTS  271
            F K +
Sbjct  201  FSKKN  205



>ref|XP_006441460.1| hypothetical protein CICLE_v10024584mg, partial [Citrus clementina]
 gb|ESR54700.1| hypothetical protein CICLE_v10024584mg, partial [Citrus clementina]
Length=153

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 75/155 (48%), Gaps = 18/155 (12%)
 Frame = -3

Query  702  AGEVKLEWRSETK-CPSDVI----SWLYADPVVITPADPKATDVIESTFLSFKFNVVTNF  538
             G + L  RS  K CP DV+    S+    PV  +P +PK   V EST L+ KF+  T+ 
Sbjct  3    GGGLTLAGRSNNKTCPLDVVQEQHSFKNGFPVTFSPVNPKKGVVRESTDLNIKFDAATS-  61

Query  537  LCSGNLYWGVQH-DSGTGQDFVRSDEFVENQSDR-----FKIERLEAIIPTYIITYCPSG  376
             C+ +  W + + D+  GQ  V +     N   R     FKIE+       Y + YCPS 
Sbjct  62   -CAQSTVWKLDNFDAAFGQWLVTTGGVEGNPGPRTMRNWFKIEKF---FGDYKLVYCPSV  117

Query  375  TDKCYYVGREYDQSIKS--TRLALSDFPFVLLFKK  277
             + C  + R+    I     RLALSD PF ++FKK
Sbjct  118  CNFCRGLCRDVGIFINGGVRRLALSDVPFKVVFKK  152



>gb|AAV41233.1| putative 21 kDa trypsin inhibitor [Theobroma bicolor]
Length=221

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 90/188 (48%), Gaps = 17/188 (9%)
 Frame = -3

Query  792  SSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWL----YADP  625
            ++ +PV+D+DGD L+ G  Y + S  WGAG G + L   +   CP  V+          P
Sbjct  26   AANSPVLDTDGDELRTGVRYYVVSSIWGAGGGGLALGRATGQSCPEIVVQRRSDLDNGTP  85

Query  624  VVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQ-----DFVRSDE  463
            V+ + AD K   V  ST ++ +F  + + LCS +  W +  +D+  G+     D VR   
Sbjct  86   VIFSNADSKDGVVRLSTDINIEFVPIRDRLCSTSTVWKLDNYDNSAGKWWVTTDGVRGQP  145

Query  462  FVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYY----VGREYDQSIKSTRLALSDFPF  295
                 +  FKIER  A +  Y   +CPS  D C      +GR  D      RLALSD  +
Sbjct  146  GPNTLTSWFKIER--AGVLGYKFRFCPSVCDSCKTLCSDIGRHSDDD-GQIRLALSDNGW  202

Query  294  VLLFKKTS  271
              +FKK S
Sbjct  203  PWMFKKAS  210



>ref|XP_010663911.1| PREDICTED: miraculin-like [Vitis vinifera]
Length=209

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 88/188 (47%), Gaps = 18/188 (10%)
 Frame = -3

Query  801  PIASSGAP--VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY--  634
            P+A+  AP  V+D +G  L+      I  +    G G + L    +  CP DV+   +  
Sbjct  26   PVAAEAAPDPVLDIEGKKLRSEVDCYILPVIRRRGGGGLTLASTGKETCPLDVVQEQHEV  85

Query  633  --ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEF  460
                P++  P +PK   +  ST  + +F+  T  +C  +  W +++D  +GQ FV +   
Sbjct  86   SNGLPLMFIPVNPKKGVIRVSTDHNIEFSAAT--ICIQSTVWKLEYDESSGQQFVTTGGV  143

Query  459  VENQ-----SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDF  301
              N      S+ FKIE+ E       + +CP+  D C  V  +    I+    RLALSD 
Sbjct  144  EGNPGRGTLSNWFKIEKYED---DNNLVFCPTVCDFCKPVCGDIVIYIQDGYRRLALSDV  200

Query  300  PFVLLFKK  277
            PF ++FKK
Sbjct  201  PFKVMFKK  208



>gb|ACS92519.1| Kunitz-type protease inhibitor KPI-D8 [Populus trichocarpa x 
Populus nigra]
Length=211

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 87/183 (48%), Gaps = 23/183 (13%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITSI WGA  G+V     +   CP DVI +    L   PV  +
Sbjct  29   PVLDIQGEELKAGTEYIITSIFWGALGGDVS---ATNKTCPDDVIQYSSDLLQGLPVTFS  85

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA  +   +  ST L+ KF++     C  +  W +Q  S +  Q FV       +  ++ 
Sbjct  86   PASSEDDIIRVSTDLNIKFSIKKA--CDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGIDT  143

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD--FPFVLL  286
             ++ FKIE+       Y +  CP     C  + R+   Y ++     L+LSD   PF++L
Sbjct  144  LTNWFKIEKAGI---GYKLVSCPENICHCGVLCRDIGIYRENNGRRILSLSDKLSPFLVL  200

Query  285  FKK  277
            FKK
Sbjct  201  FKK  203



>ref|XP_007029361.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
 gb|EOY09863.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
Length=198

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 82/181 (45%), Gaps = 21/181 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVIT  613
            PV+D  G+ L+ G  Y I  +  G G G       +ET CP DV+          P+  +
Sbjct  25   PVLDISGEELRTGTDYYILPVIRGGGGGLTLASTGNET-CPLDVVQEQLEVSNGLPLTFS  83

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQ-----DFVRSDEFVENQ  448
            P +     V  ST L+ KF+  T  +C  +  W + +D  T +       V  +  +E  
Sbjct  84   PVNITKGVVRVSTDLNIKFSAAT--ICVQSTVWKLDNDEATQKMVVTTGGVEGNPGIETL  141

Query  447  SDRFKIERLEAIIPTYIITYCPSGTDKCYYV----GREYDQSIKSTRLALSDFPFVLLFK  280
            S+ FKIER E     Y + +CP   D C  V    G   D  I+  RLALSD P  ++FK
Sbjct  142  SNWFKIERYE---DDYKLVFCPGVCDFCRPVCGDLGVFIDAGIR--RLALSDVPLKVMFK  196

Query  279  K  277
            +
Sbjct  197  R  197



>ref|XP_006372632.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
 gb|ERP50429.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
Length=206

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/189 (29%), Positives = 89/189 (47%), Gaps = 21/189 (11%)
 Frame = -3

Query  798  IASSGAP--VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD-  628
            +A++ AP  V+D  G  L++G  Y I  +  G G G +K+       CP DV+   Y   
Sbjct  23   VAATAAPEPVLDVTGKILRIGTSYYILPVIRGRGGG-LKMASTVRRTCPLDVVQDRYEAS  81

Query  627  ---PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEF  460
               P+  TP + K   V   T L+ +F+  +  +C  +  W +  +D  T Q FV +D  
Sbjct  82   NGLPLKFTPVNTKKGVVRVHTDLNIRFSAAS--ICHQSTAWKLDNYDEWTKQWFVTTDGV  139

Query  459  V-----ENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
                  E  ++ FKIE+ E     Y + +CP+    C  + ++   Y  +    RLAL++
Sbjct  140  EGNPGPETTNNWFKIEKFE---DKYKLVFCPTVCQHCKVMCKDIGIYVDAKGVRRLALTN  196

Query  303  FPFVLLFKK  277
             P  ++FKK
Sbjct  197  VPLKVMFKK  205



>gb|ACO40073.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40075.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40076.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40079.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40085.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40087.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40088.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40089.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40092.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40095.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40096.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40097.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40098.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40099.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40102.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40103.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40107.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40109.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40111.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40112.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40113.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40114.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40121.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40122.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40125.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40126.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40129.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40131.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40134.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40135.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40136.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40137.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40147.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40152.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40160.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40162.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40164.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 82/172 (48%), Gaps = 20/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLPVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA  +   +  ST L+ KF++     C  +  W +Q  S +  Q FV       +  V  
Sbjct  71   PASSEDDVIRVSTDLNIKFSI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+  A I  Y + +CP     C  + R+   Y ++ +   L+LSD
Sbjct  129  LTNWFKIEK--AGILGYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>ref|XP_007211211.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
 gb|EMJ12410.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
Length=208

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 60/194 (31%), Positives = 87/194 (45%), Gaps = 19/194 (10%)
 Frame = -3

Query  822  RLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVIS  643
            +LR+     A S  PV+D  G+ LQ G  Y I  +  G G G       ++T CP DV+ 
Sbjct  21   KLRSVAADAAPS--PVLDITGNKLQTGVDYYILPVIRGRGGGLTLASTSNKTSCPLDVVQ  78

Query  642  WL----YADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDF  478
                     P+  +P +     V  ST L+ KF+  T  +C  +  W + + D  TGQ F
Sbjct  79   EQNEVSNGLPLKFSPVNVTKGVVRVSTDLNIKFSATT--ICVQSTVWKLGKFDEQTGQWF  136

Query  477  VRSDEFVEN-----QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIK--STR  319
            V S     N      S+ FKIE+       Y + +CP+  + C  +  +     +    R
Sbjct  137  VTSGGVEGNPGRQTTSNWFKIEKFG---DDYKLVFCPTVCNFCKVICGDVGIFFQDGKRR  193

Query  318  LALSDFPFVLLFKK  277
            LALSD PF  +FKK
Sbjct  194  LALSDVPFRAMFKK  207



>gb|ACO40086.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40141.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40149.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40150.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40151.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 82/172 (48%), Gaps = 20/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLPVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA  +   +  ST L+ KF++     C  +  W +Q  S +  Q FV       +  V  
Sbjct  71   PASSEDDVIRVSTDLNIKFSI--KKACVHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+  A I  Y + +CP     C  + R+   Y ++ +   L+LSD
Sbjct  129  LTNWFKIEK--AGILGYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>gb|ACS92500.1| Kunitz-type protease inhibitor KPI-D9 [Populus trichocarpa x 
Populus nigra]
Length=211

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 87/183 (48%), Gaps = 23/183 (13%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y I+SI WGA  G+V     +   CP DVI +    L   PV  +
Sbjct  29   PVLDIQGEELKAGTEYIISSIFWGARGGDVS---ATNKTCPDDVIKYSSDRLQGLPVTFS  85

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA  +   +  ST L+ KF++     C  +  W +Q  S +  Q FV       +  ++ 
Sbjct  86   PASSEDDVIRVSTDLNIKFSIKK--ACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGIDT  143

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD--FPFVLL  286
             ++ FKIE+       Y +  CP     C  + R+   Y ++     L+LSD   PF++L
Sbjct  144  LTNWFKIEKAGI---GYKLVSCPEDICHCGVLCRDIGIYRENNGRKILSLSDQLSPFLVL  200

Query  285  FKK  277
            FKK
Sbjct  201  FKK  203



>gb|ACO40153.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 81/172 (47%), Gaps = 20/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLPVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA      +  ST L+ KF++     C  +  W +Q  S +  Q FV       +  V  
Sbjct  71   PASSDDDVIRVSTDLNIKFSI--KKACDHSSVWKIQKSSNSKVQWFVTTGGEEGNPGVHT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+  A I  Y + +CP     C  + R+   Y ++ +   L+LSD
Sbjct  129  LTNWFKIEK--AGILGYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>gb|ACO40077.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40090.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40115.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40116.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40120.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40132.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40156.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 81/172 (47%), Gaps = 20/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLPVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA      +  ST L+ KF++     C  +  W +Q  S +  Q FV       +  V  
Sbjct  71   PASSDDDVIRVSTDLNIKFSI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+  A I  Y + +CP     C  + R+   Y ++ +   L+LSD
Sbjct  129  LTNWFKIEK--AGILGYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>ref|XP_006372633.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
 gb|ERP50430.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
Length=206

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/189 (29%), Positives = 88/189 (47%), Gaps = 21/189 (11%)
 Frame = -3

Query  798  IASSGAP--VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD-  628
            +A++ AP  V+D  G  L+ G  Y I  +  G G G +K+       CP DV+   Y   
Sbjct  23   VAATAAPEPVLDVTGKILRTGTSYYILPVIRGRGGG-LKMASTVRRTCPLDVVQDRYEAS  81

Query  627  ---PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEF  460
               P+  TP + K   V   T L+ +F+  +  +C  +  W +  +D  T Q FV +D  
Sbjct  82   NGLPLKFTPVNTKKGVVRVHTDLNIRFSAAS--ICHQSTAWKLDNYDEWTKQWFVTTDGV  139

Query  459  V-----ENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
                  E  ++ FKIE+ E     Y + +CP+    C  + ++   Y  +    RLAL++
Sbjct  140  EGNPGPETTNNWFKIEKFE---DKYKLVFCPTVCQHCKVMCKDIGIYVDAKGVRRLALTN  196

Query  303  FPFVLLFKK  277
             P  ++FKK
Sbjct  197  VPLKVMFKK  205



>ref|XP_002266302.2| PREDICTED: miraculin-like, partial [Vitis vinifera]
Length=162

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 78/165 (47%), Gaps = 19/165 (12%)
 Frame = -3

Query  735  YNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVITPADPKATDVIESTFL  568
            Y I  +  G G G       +ET CP DV+          P+  TP +PK   +  ST  
Sbjct  4    YYILPVFRGRGGGLTLASTGNET-CPLDVVQEQQEVSNGLPLTFTPVNPKKGVIRVSTDH  62

Query  567  SFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVENQSDR------FKIERLEAIIP  406
            + KF+  T  +C  +  W +++D  +GQ FV +   VE    R      FKIE+ E    
Sbjct  63   NIKFSAST--ICVQSTLWKLEYDESSGQRFVTTGG-VEGNPGRETLDNWFKIEKYED---  116

Query  405  TYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFKK  277
             Y + +CP+  D C  V  +    I++   RLALSD PF ++FKK
Sbjct  117  DYKLVFCPTVCDFCKPVCGDIGIYIQNGYRRLALSDVPFKVMFKK  161



>gb|ACO40074.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40083.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40091.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40101.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40108.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40117.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40123.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40138.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40148.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40155.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 81/172 (47%), Gaps = 20/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLPVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA  +   +  ST L+ KF +     C  +  W +Q  S +  Q FV       +  V  
Sbjct  71   PASSEDDVIRVSTDLNIKFYI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+  A I  Y + +CP     C  + R+   Y ++ +   L+LSD
Sbjct  129  LTNWFKIEK--AGILGYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>gb|AFL91226.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 84/182 (46%), Gaps = 24/182 (13%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVITP  610
            V D DG+ L+ G  Y I  +  G G G      R+E+ CP DV+   +      P+  TP
Sbjct  4    VRDIDGNLLRSGTEYYILPVFRGRGGGVTLAPTRNES-CPLDVVQEGFELDNGLPLTFTP  62

Query  609  ADPKATDVIESTFLSFKFNVVTNFLCSGNLYW------GVQHDSGTGQDFVRSDEFVENQ  448
             DPK   + EST L+  F+  +  +C  +  W      G +  SG G       E + N 
Sbjct  63   VDPKKGVIRESTDLNIIFSASS--ICIQSNVWMLEEYEGQRIISGRGTSGNPGGETISNW  120

Query  447  SDRFKIERLEAIIPTYIITYCPSGTDKCYYV----GREYDQSIKSTRLALSDFPFVLLFK  280
               FKIE+ E     Y + YCP+  D C  V    G  + ++  S RLA+SD PF + F+
Sbjct  121  ---FKIEKYEN---GYKLVYCPTVCDLCRPVCGDIGVVFAEN-GSRRLAISDVPFKIKFR  173

Query  279  KT  274
            K 
Sbjct  174  KA  175



>gb|ACO40133.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 81/172 (47%), Gaps = 20/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLPVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA      +  ST L+ KF++     C  +  W +Q  S +  Q FV       +  V  
Sbjct  71   PASSDDDVIRVSTDLNIKFSI--KKACVHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+  A I  Y + +CP     C  + R+   Y ++ +   L+LSD
Sbjct  129  LTNWFKIEK--AGILGYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>gb|ACO40100.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 81/172 (47%), Gaps = 20/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  14   PVLDIQGEELKAGREYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLPVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA  +   +  ST L+ KF +     C  +  W +Q  S +  Q FV       +  V  
Sbjct  71   PASSEDDVIRVSTDLNIKFYIKK--ACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+  A I  Y + +CP     C  + R+   Y ++ +   L+LSD
Sbjct  129  LTNWFKIEK--AGILGYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>ref|XP_009793041.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 82/186 (44%), Gaps = 17/186 (9%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVIS----WLYAD  628
             SS +PV+D +GD ++VG  Y +  +  G G G +    +    CP D+I          
Sbjct  28   GSSPSPVLDINGDKVKVGLNYFVLPVIRGRGGGLLPSNVKQNNTCPRDIIQNSDEVQEGL  87

Query  627  PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDF-----VRSD  466
            PVV TP + K   V  S  L+ +F   T  +C+    W +  +D    Q F     V  +
Sbjct  88   PVVFTPFNTKKGVVRLSIDLNVRF--FTPTICARETIWKLGTYDDKLKQYFIVTGGVEGN  145

Query  465  EFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTR--LALSDFPFV  292
               +  S  FKIE+L      Y   +CPS    C  + ++     K     LALSD P  
Sbjct  146  PGPQTLSSWFKIEKLGT---DYKFVFCPSVCKICKVICKDVGIYTKDGVRFLALSDTPLR  202

Query  291  LLFKKT  274
            ++FKKT
Sbjct  203  VMFKKT  208



>gb|ACO40082.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40094.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40118.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40124.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40128.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40146.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 81/172 (47%), Gaps = 20/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLPVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA  +   +  ST L+ KF++     C  +  W +Q  S +  Q FV       +  V  
Sbjct  71   PASSEDDVIRVSTDLNIKFSI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+   +   Y + +CP     C  + R+   Y ++ +   L+LSD
Sbjct  129  LTNWFKIEKAGTL--GYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>gb|ACO40093.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40143.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 81/172 (47%), Gaps = 20/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLPVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA  +   +  S  L+ KF++     C  +  W +Q  S +  Q FV       +  V  
Sbjct  71   PASSEDDVIRVSADLNIKFSI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+  A I  Y + +CP     C  + R+   Y ++ +   L+LSD
Sbjct  129  LTNWFKIEK--AGILGYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>ref|XP_006441436.1| hypothetical protein CICLE_v10023581mg [Citrus clementina]
 gb|ESR54676.1| hypothetical protein CICLE_v10023581mg [Citrus clementina]
Length=187

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 81/185 (44%), Gaps = 36/185 (19%)
 Frame = -3

Query  792  SSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVI----SWLYADP  625
            +S  PV+D  G  L+ G   N                     KCP DV+    S+    P
Sbjct  27   ASPDPVLDIAGKQLRAGSKSN-------------------NKKCPLDVVQEQHSFKNGLP  67

Query  624  VVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVENQ  448
            V  +P +PK   V EST L+ KF+  T+  C+ +  W + + D+  GQ  + +     N 
Sbjct  68   VTFSPVNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAVLGQWLLTTGGVEGNP  125

Query  447  SDR-----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVL  289
              R     FKIE+       Y + YCPS  + C  + R+    I     RLALSD PF +
Sbjct  126  GPRTMRNWFKIEKFFG---DYKLVYCPSVCNFCRGLCRDVGIFINGGVRRLALSDVPFKV  182

Query  288  LFKKT  274
            +FKK 
Sbjct  183  VFKKV  187



>ref|XP_006372654.1| hypothetical protein POPTR_0017s03600g [Populus trichocarpa]
 gb|ERP50451.1| hypothetical protein POPTR_0017s03600g [Populus trichocarpa]
Length=206

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 54/189 (29%), Positives = 88/189 (47%), Gaps = 21/189 (11%)
 Frame = -3

Query  798  IASSGAP--VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD-  628
            +A++ AP  V+D  G  L+ G  Y I  +  G G G +K+       CP DV+   Y   
Sbjct  23   VAATAAPEPVLDVTGKILRTGTSYYILPVIRGRGGG-LKMASTVRRTCPLDVVQDRYEAS  81

Query  627  ---PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEF  460
               P+  TP + K   V   T L+ +F+  +  +C  +  W +  +D  T Q FV +D  
Sbjct  82   NGLPLKFTPVNTKKGVVRVHTDLNIRFSAGS--ICHQSTAWKLDNYDEWTKQWFVTTDGV  139

Query  459  V-----ENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
                  E  ++ FKIE+ E     Y + +CP+    C  + ++   Y  +    RLAL++
Sbjct  140  EGNPGPETTNNWFKIEKFE---DKYKLVFCPTVCQHCKVMCKDIGIYVDAKGVRRLALTN  196

Query  303  FPFVLLFKK  277
             P  ++FKK
Sbjct  197  VPLKVMFKK  205



>gb|ACO40084.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 81/172 (47%), Gaps = 20/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV++  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  14   PVLEIQGEELKAGTEYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLPVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA      +  ST L+ KF++     C  +  W +Q  S +  Q FV       +  V  
Sbjct  71   PASSDDDVIRVSTDLNIKFSI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+  A I  Y + +CP     C  + R+   Y ++ +   L+LSD
Sbjct  129  LTNWFKIEK--AGILGYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>gb|ACO40145.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 80/172 (47%), Gaps = 20/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLPVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA      +  S  L+ KF++     C  +  W +Q  S +  Q FV       +  V  
Sbjct  71   PASSDDDVIRVSADLNIKFSI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+  A I  Y + +CP     C  + R+   Y ++ +   L+LSD
Sbjct  129  LTNWFKIEK--AGILGYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>ref|XP_009113274.1| PREDICTED: trypsin inhibitor DE-3-like [Brassica rapa]
Length=218

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 86/201 (43%), Gaps = 14/201 (7%)
 Frame = -3

Query  840  TLNPIHRLRTADVPIAS---SGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSE  670
            T+NP+    T    +A+   +G PV+DS G  +  G  Y I  I +GA  G + L  R +
Sbjct  21   TMNPMFYFLTLTAVLAATANAGGPVLDSKGHHIFSGSYYVIPRI-FGAAGGGLTLVPRGD  79

Query  669  TKCP----SDVISWLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH  502
             +CP     + +      PV  +    +   V ES  L+   +         N +W    
Sbjct  80   KQCPLYVGHETLEVKMGIPVKFSSWMSRVGFVPESENLNIMMDAKATTCSQSNYWWVAPS  139

Query  501  DSGTGQDFVRSDEFVENQSDR----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQS  334
            D      F+ +    + + DR    F+I++    +  Y I YCP G D C  VG   D++
Sbjct  140  DKDRKTWFIAAGPKPKTKEDRSMTSFQIKKTGDSLKGYKIVYCPKGKD-CINVGIVKDKN  198

Query  333  IKSTRLALSDFPFVLLFKKTS  271
                RL LS  PF ++F K +
Sbjct  199  -GVRRLVLSSKPFPVVFVKAT  218



>gb|ACS92516.1| Kunitz-type protease inhibitor KPI-D12 [Populus trichocarpa x 
Populus deltoides]
Length=206

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/189 (29%), Positives = 87/189 (46%), Gaps = 21/189 (11%)
 Frame = -3

Query  798  IASSGAP--VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD-  628
            +A++ AP  V+D  G  L+ G  Y I  +  G G G +K+       CP DV+   Y   
Sbjct  23   VAATAAPEPVLDVTGKILRTGTGYYILPVIRGRGGG-LKMASTGRRTCPLDVVQDRYEAS  81

Query  627  ---PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEF  460
               P+  TP + K   V   T L+ +F+  +  +C  +  W +  +D  T Q FV ++  
Sbjct  82   NGLPLKFTPVNTKKGVVRVHTDLNIRFSAAS--ICHQSTAWKLGSYDEWTKQWFVTTNGV  139

Query  459  V-----ENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
                  E  ++ FKIE+ E     Y + +CP+    C  + ++   Y  +    RLALS 
Sbjct  140  EGNPGPETTNNWFKIEKFE---DKYKLVFCPTVCQHCKVMCKDIGIYVDAKGVRRLALSS  196

Query  303  FPFVLLFKK  277
             P  ++FKK
Sbjct  197  VPLKVMFKK  205



>ref|XP_008437058.1| PREDICTED: miraculin-like [Cucumis melo]
Length=205

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 91/194 (47%), Gaps = 22/194 (11%)
 Frame = -3

Query  822  RLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVIS  643
            R  TAD    +S   V+D DG  L+ G  Y I  +  G G G      +SE  CP +V+ 
Sbjct  21   RFSTAD----ASPEAVLDIDGKKLRAGVNYYILPVFRGRGGGLTLGNLQSEI-CPVNVVQ  75

Query  642  ----WLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDF  478
                 +   P    P +PK   V  ST L+ +F+  T  +C  +  W + + D  TGQ F
Sbjct  76   EQFELMNGFPTTFHPVNPKKGVVRVSTDLNVQFDAST--ICVTSTVWKLDKFDESTGQWF  133

Query  477  V-----RSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTR--  319
            V     R +  VE   + FKIE+       Y + +CP+  + C  + R+     K+ +  
Sbjct  134  VTIGGSRGNPGVETVDNWFKIEKHGK---DYKLVFCPTVCNFCKVMCRDIGIFFKNGKRA  190

Query  318  LALSDFPFVLLFKK  277
            LALSD PF ++FKK
Sbjct  191  LALSDTPFPVMFKK  204



>gb|ACO40144.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40158.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 80/172 (47%), Gaps = 20/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLPVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA  +   +  ST L+ KF +     C  +  W +Q  S +  Q FV       +  V  
Sbjct  71   PASSEDDVIRVSTDLNIKFYI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+   +   Y + +CP     C  + R+   Y ++ +   L+LSD
Sbjct  129  LTNWFKIEKAGTL--GYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>gb|ACO40081.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 80/172 (47%), Gaps = 20/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLPVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA  +   +  S  L+ KF +     C  +  W +Q  S +  Q FV       +  V  
Sbjct  71   PASSEDDVIRVSADLNIKFYIKK--ACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+  A I  Y + +CP     C  + R+   Y ++ +   L+LSD
Sbjct  129  LTNWFKIEK--AGILGYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>gb|AFL91231.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 86/180 (48%), Gaps = 20/180 (11%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVITP  610
            V D DG+ ++ G  Y I  +  G G G      R+E+ CP DV+   +      P+  TP
Sbjct  4    VRDIDGNLVRSGTEYYILPVFRGRGGGVTLAPTRNES-CPLDVVQEGFELDDGLPLTFTP  62

Query  609  ADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSG----TGQDFVRSDEFVENQSD  442
             DPK   + EST L+  F+  +  +C  +  W ++   G    +G+     +   E  S+
Sbjct  63   VDPKKGVIRESTDLNIIFSASS--ICIQSNVWMLEEYEGQRIISGRG-TAGNPGGETISN  119

Query  441  RFKIERLEAIIPTYIITYCPSGTDKCYYV----GREYDQSIKSTRLALSDFPFVLLFKKT  274
             FKIE+ E     Y + YCP+  D C  V    G  + ++  S RLA+SD PF + F+K 
Sbjct  120  WFKIEKYEN---GYKLVYCPTVCDLCRPVCGDIGVVFAEN-GSRRLAISDVPFKIKFRKA  175



>emb|CDY59714.1| BnaC02g46470D [Brassica napus]
Length=232

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/216 (26%), Positives = 87/216 (40%), Gaps = 24/216 (11%)
 Frame = -3

Query  855  HPTRATLNPIHRLRTAD-------------VPIASSGAPVVDSDGDALQVGGVYNITSIT  715
            HP   + N +H+ +  +                 ++  PV+D+DGD +  G  Y + +I 
Sbjct  7    HPVTISYNQLHKHKRINPMFYFLLALTALLAATPNAAKPVLDTDGDFIFDGSYYVLPAI-  65

Query  714  WGAGAGEVKLEWRSETKCP----SDVISWLYADPVVITPADPKATDVIESTFLSFKFNVV  547
            +GA  G + L  R   +CP     ++       PV  +    K   V ES  L+ K +V 
Sbjct  66   FGAAGGGLNLASRGSNQCPLFVGQEISEVDRGIPVKFSNWRLKVGFVPESEKLNIKMDVE  125

Query  546  TNFLCSGNLYWGVQHDSGTGQDFVRSDEFVENQSDR----FKIERLEAIIPTYIITYCPS  379
                     +W     SG    F+ +    E   D     F+IE+ +     Y I +CP+
Sbjct  126  ATICVQSTYWWVTAAPSGFRTSFITAGPNPEAGEDSSRSFFQIEKAKGFPDGYHIMFCPN  185

Query  378  GTDKCYYVGREYDQSIKSTRLALSDFPFVLLFKKTS  271
              D C  VG   D+     RLALS  PF  +F K +
Sbjct  186  DND-CINVGIVVDE-YGVRRLALSSMPFPFVFMKAT  219



>ref|XP_011046091.1| PREDICTED: miraculin-like [Populus euphratica]
Length=206

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/189 (29%), Positives = 87/189 (46%), Gaps = 21/189 (11%)
 Frame = -3

Query  798  IASSGAP--VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD-  628
            +A++ AP  V++  G  L+ G  Y I  +  G G G +K+       CP DV+   Y   
Sbjct  23   VAATAAPEPVLNVTGKILRTGTGYYILLVIRGRGGG-LKMASTVRRTCPLDVVQERYEAS  81

Query  627  ---PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEF  460
               P+  TP + K   V   T L+ +F+  +  +C  +  W +  +D  T Q FV ++  
Sbjct  82   NGLPLKFTPVNTKKGVVRVHTDLNIRFSAAS--ICQQSTAWKLDSYDEWTKQWFVTTNGV  139

Query  459  -----VENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
                  E  ++ FKIE+LE     Y +  CP+    C  + ++   Y  +I   RLAL  
Sbjct  140  EGNPGSETTNNWFKIEKLE---DKYKLVVCPTVCQHCKVMCKDIGIYVDAIGVRRLALGG  196

Query  303  FPFVLLFKK  277
             P  ++FKK
Sbjct  197  VPLKVMFKK  205



>gb|ACL12055.1| Kunitz trypsin inhibitor [Nicotiana tabacum]
Length=209

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 81/186 (44%), Gaps = 17/186 (9%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVIS----WLYAD  628
             SS +PV+D +GD ++VG  Y +  +  G G G +    +    CP D+I          
Sbjct  28   GSSPSPVLDINGDKVKVGLNYFVLPVIRGRGGGLLPSNVKQNNTCPRDIIQNSDEVQEGL  87

Query  627  PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDF-----VRSD  466
            PVV  P + K   V  S  L+ +F   T  +C+    W +  +D    Q F     V  +
Sbjct  88   PVVFAPFNTKKGVVRLSIDLNVRF--FTPTICARETIWKLGTYDDKLKQYFIVTGGVEGN  145

Query  465  EFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTR--LALSDFPFV  292
               +  S  FKIE+L      Y   +CPS    C  + ++     K     LALSD P  
Sbjct  146  PGPQTLSSWFKIEKLGT---DYKFVFCPSVCKICKVICKDVGIYTKDGVRFLALSDTPLR  202

Query  291  LLFKKT  274
            ++FKKT
Sbjct  203  VMFKKT  208



>ref|XP_007036750.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21251.1| 21 kDa seed protein [Theobroma cacao]
Length=219

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 88/180 (49%), Gaps = 13/180 (7%)
 Frame = -3

Query  783  APVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD---PVVIT  613
            +PV+DSDGD L+ G  Y + S  WGAG G + L   +   CP  V+     D   PV+ +
Sbjct  29   SPVLDSDGDELRTGVEYYVVSAIWGAGGGGLALGRVTGQSCPEIVVQRGSDDDGLPVIFS  88

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQ-----DFVRSDEFVEN  451
             AD K   V  ST ++ +F  + + LC  +  W +  +D  TG+     D V+ D     
Sbjct  89   NADGKDGVVRLSTDVNIEFVPIRDRLCLTSTVWKLDDYDPSTGKWWVTTDGVKGDPGHNT  148

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIK--STRLALSDFPFVLLFKK  277
             +  FKIE   A+   Y   +CPS  D C ++  ++ +       RLALS+  +  +FKK
Sbjct  149  LTSWFKIENAGAL--GYKFRFCPSVCDSCIHLCNDFGRHGHDGQVRLALSENGWPWIFKK  206



>gb|AFL91227.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 85/180 (47%), Gaps = 20/180 (11%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVITP  610
            V D DG+ +  G  Y I  +  G G G      R+E+ CP DV+   +      P+  TP
Sbjct  4    VRDXDGNLVXSGTEYYILPVFRGRGGGVTLAPTRNES-CPLDVVQEGFELDDGLPLTFTP  62

Query  609  ADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSG----TGQDFVRSDEFVENQSD  442
             DPK   + EST L+  F+  +  +C  +  W ++   G    +G+     +   E  S+
Sbjct  63   VDPKKGVIRESTDLNIIFSASS--ICIQSNVWMLEEYEGQRIISGRG-TAGNPGGETISN  119

Query  441  RFKIERLEAIIPTYIITYCPSGTDKCYYV----GREYDQSIKSTRLALSDFPFVLLFKKT  274
             FKIE+ E     Y + YCP+  D C  V    G  + ++  S RLA+SD PF + F+K 
Sbjct  120  WFKIEKYEN---GYKLVYCPTVCDLCRPVCGDIGVVFAEN-GSRRLAISDVPFKIKFRKA  175



>gb|AFL91232.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=172

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 85/180 (47%), Gaps = 20/180 (11%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVITP  610
            V D DG+ +  G  Y I  +  G G G      R+E+ CP DV+   +      P+  TP
Sbjct  1    VRDIDGNLVXXGXEYYILPVFRGRGGGVTLAPTRNES-CPLDVVQEGFELDDGLPLTFTP  59

Query  609  ADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSG----TGQDFVRSDEFVENQSD  442
             DPK   + EST L+  F+  +  +C  +  W ++   G    +G+     +   E  S+
Sbjct  60   VDPKKGVIRESTDLNIIFSASS--ICIQSNVWMLEEYEGQRIISGRG-TAGNPGGETISN  116

Query  441  RFKIERLEAIIPTYIITYCPSGTDKCYYV----GREYDQSIKSTRLALSDFPFVLLFKKT  274
             FKIE+ E     Y + YCP+  D C  V    G  + ++  S RLA+SD PF + F+K 
Sbjct  117  WFKIEKYEN---GYKLVYCPTVCDLCRPVCGDIGVVFAEN-GSRRLAISDVPFKIKFRKA  172



>gb|ACO40119.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40127.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40130.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40142.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40157.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 80/172 (47%), Gaps = 20/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L   PV  +
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLPVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA  +   +  S  L+ KF++     C  +  W +Q  S +  Q FV       +  V  
Sbjct  71   PASSEDDVIRVSADLNIKFSI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+   +   Y + +CP     C  + R+   Y ++ +   L+LSD
Sbjct  129  LTNWFKIEKAGTL--GYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>gb|AFL91233.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 85/180 (47%), Gaps = 20/180 (11%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVITP  610
            V D DG+ +  G  Y I  +  G G G      R+E+ CP DV+   +      P+  TP
Sbjct  4    VRDIDGNLVXSGTEYYILPVFRGXGGGVTLAPTRNES-CPLDVVQEGFELDDGLPLTFTP  62

Query  609  ADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSG----TGQDFVRSDEFVENQSD  442
             DPK   + EST L+  F+  +  +C  +  W ++   G    +G+     +   E  S+
Sbjct  63   VDPKKGVIRESTDLNIIFSASS--ICIQSNVWMLEEYEGQRIISGRG-TAGNPGGETISN  119

Query  441  RFKIERLEAIIPTYIITYCPSGTDKCYYV----GREYDQSIKSTRLALSDFPFVLLFKKT  274
             FKIE+ E     Y + YCP+  D C  V    G  + ++  S RLA+SD PF + F+K 
Sbjct  120  WFKIEKYEN---GYKLVYCPTVCDLCRPVCGDIGVVFAEN-GSRRLAISDVPFKIKFRKA  175



>ref|XP_010101167.1| hypothetical protein L484_005403 [Morus notabilis]
 gb|EXB87528.1| hypothetical protein L484_005403 [Morus notabilis]
Length=197

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 84/182 (46%), Gaps = 18/182 (10%)
 Frame = -3

Query  783  APVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVI  616
            + V+D  G  LQ G  Y I  +  G G G      R++T  P DV+   +      P+  
Sbjct  22   SAVLDLSGKKLQKGVDYYILPVIRGRGGGLKLANARNKTS-PLDVVQDQFEVSSGFPLTF  80

Query  615  TPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEFVENQ---  448
            +PA+   + V  ST L+ KF+  T   C+ +  W +   D   GQ FV S     N    
Sbjct  81   SPANQNQSFVCLSTDLNIKFSAATT--CAQSTVWKLDSFDESLGQWFVTSGGVEGNPGRQ  138

Query  447  --SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFK  280
              S+ FKIE+       Y + +CP+  + C  + R+    IK    RLALSD PF++ FK
Sbjct  139  TISNWFKIEKYN---DDYKLVFCPTVCNFCKVLCRDVGIYIKDGIRRLALSDQPFIVGFK  195

Query  279  KT  274
            + 
Sbjct  196  RA  197



>ref|XP_007036746.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21247.1| 21 kDa seed protein [Theobroma cacao]
Length=219

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 88/180 (49%), Gaps = 13/180 (7%)
 Frame = -3

Query  783  APVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD---PVVIT  613
            +PV+DSDGD L+ G  Y + S  WGAG G + L   +   CP  V+     D   PV+ +
Sbjct  29   SPVLDSDGDELRTGVEYYVVSAIWGAGGGGLALGRVTGQSCPEIVVQRGSDDDGLPVIFS  88

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQ-----DFVRSDEFVEN  451
             AD K   V  ST ++ +F  + + LC  +  W +  +D  TG+     D V+ D     
Sbjct  89   NADGKDGVVRLSTDVNIEFVPIRDRLCLTSTVWKLDDYDPSTGKWWVTTDGVKGDPGHNT  148

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIK--STRLALSDFPFVLLFKK  277
             +  FKIE   A+   Y   +CPS  D C ++  ++ +       RLALS+  +  +FKK
Sbjct  149  LTSWFKIEDAGAL--GYKFRFCPSVCDSCIHLCNDFGRHGHDGQVRLALSENGWPWIFKK  206



>gb|ACO40104.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40105.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40106.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40110.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40139.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40140.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40159.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40161.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40163.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 80/172 (47%), Gaps = 20/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L    V  +
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLTVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA      +  ST L+ KF++     C  +  W +Q  S +  Q FV       +  V  
Sbjct  71   PASSDDDVIRVSTDLNIKFSI--KKACDHSSVWKIQKSSNSKVQWFVTTGGEEGNPGVHT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+  A I  Y + +CP     C  + R+   Y ++ +   L+LSD
Sbjct  129  LTNWFKIEK--AGILGYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>emb|CDP21779.1| unnamed protein product [Coffea canephora]
Length=213

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 87/190 (46%), Gaps = 20/190 (11%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVI-SWLY-ADPV  622
            A    PV+D++G+ ++ G  Y + +I +  G G    +      CP  V+ +WL   DPV
Sbjct  21   AEEPNPVLDTNGEEIRPGVEYYMGTI-FRPGGGVTYGKGPGNEICPLAVVQAWLQRGDPV  79

Query  621  VITPADPKATDVIESTFLSFKFNV--VTNFLCSGNLYWGVQHDSGTGQDFVRSDEF----  460
              TP +P+   V  ST L+ KF    + NF C G+  W V  +    Q FV +D      
Sbjct  80   TFTPVNPEEGVVRVSTDLNIKFAEPPIINF-CRGSNVWKVHFNEALKQHFVLTDGVEGNS  138

Query  459  -VENQSDRFKIERLEAIIPTYIITYCPSGTDK-----CYYVGREYDQSIKSTRLALSDFP  298
              E  ++ FKIE +      Y   +CP+  D      C  VG   D   +  RLAL   P
Sbjct  139  GCETTANWFKIEAVSD--RDYKFVFCPTVCDSSSEAICKDVGIYMDDGTR--RLALGGQP  194

Query  297  FVLLFKKTSL  268
            + ++F K ++
Sbjct  195  YAVVFIKKNV  204



>gb|ACO40154.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 80/172 (47%), Gaps = 20/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITS  WGAG G+V     +   CP DVI +    L    V  +
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDVS---ATNKTCPDDVIQYSLDQLQGLTVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA      +  ST L+ KF++     C  +  W +Q  S +  Q FV       +  V  
Sbjct  71   PASSDDDVIRVSTDLNIKFSI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGVHT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+  A I  Y + +CP     C  + R+   Y ++ +   L+LSD
Sbjct  129  LTNWFKIEK--AGILGYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSD  178



>emb|CDX72972.1| BnaC06g34200D [Brassica napus]
Length=205

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 83/183 (45%), Gaps = 15/183 (8%)
 Frame = -3

Query  792  SSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD-----  628
            ++G PV+D+DGD +  GG Y +  I  G G   + L  R   +CP   I   Y+D     
Sbjct  20   NAGGPVLDTDGDFILDGGSYYVLPIFSGGG---LTLTPRGGNQCPL-YIGQEYSDVNRGI  75

Query  627  PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFV----RSDEF  460
            PV  +    K   V+ES  L+ + +V          +W  + D    + FV    + +  
Sbjct  76   PVRFSNCKSKFGFVLESVNLNIEMDVKATICVQSTYWWVAESDMAIKKFFVVAGPKPEPG  135

Query  459  VENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTRLALSDFPFVLLFK  280
             E+    F+I++ +     Y I +CP+  D C  VG   D+     RLALS  PF ++F 
Sbjct  136  EESLKSFFQIKKTKYFHNGYTIAFCPNDND-CIDVGIFVDE-YGVWRLALSPTPFPVMFV  193

Query  279  KTS  271
            K +
Sbjct  194  KAT  196



>emb|CBI35471.3| unnamed protein product [Vitis vinifera]
Length=2095

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 78/165 (47%), Gaps = 19/165 (12%)
 Frame = -3

Query  735   YNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVITPADPKATDVIESTFL  568
             Y I  +  G G G       +ET CP DV+          P+  TP +PK   +  ST  
Sbjct  1937  YYILPVFRGRGGGLTLASTGNET-CPLDVVQEQQEVSNGLPLTFTPVNPKKGVIRVSTDH  1995

Query  567   SFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVENQSDR------FKIERLEAIIP  406
             + KF+  T  +C  +  W +++D  +GQ FV +   VE    R      FKIE+ E    
Sbjct  1996  NIKFSAST--ICVQSTLWKLEYDESSGQRFVTTGG-VEGNPGRETLDNWFKIEKYED---  2049

Query  405   TYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFKK  277
              Y + +CP+  D C  V  +    I++   RLALSD PF ++FKK
Sbjct  2050  DYKLVFCPTVCDFCKPVCGDIGIYIQNGYRRLALSDVPFKVMFKK  2094



>ref|XP_009105982.1| PREDICTED: subtilisin inhibitor CLSI-II-like [Brassica rapa]
Length=211

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 78/183 (43%), Gaps = 12/183 (7%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCP----SDVISWLYAD  628
            A++G PV+D+DGD +   G Y +  + WG   G + L      KCP     D        
Sbjct  19   ANAGGPVLDADGDII-FNGSYYVLPLVWGPAGGGLTLTSGDYKKCPLYIGQDSSEVNMGI  77

Query  627  PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRS----DEF  460
            P+  +    K   V ES  LS + +     +C  + YW V         FV +     E 
Sbjct  78   PIKFSNWKSKVGFVPESESLSIEMDTKAT-ICGQSTYWWVAAPDMPKMLFVTAGPNPKEH  136

Query  459  VEN-QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTRLALSDFPFVLLF  283
            VE+ +   F+I++ E     Y I +CP   + C  VG   D +    RLALS  PF + F
Sbjct  137  VEDSRRSFFQIKKAEDFRIGYKIVFCPQ-DNYCMDVGIHEDDNHGIRRLALSSEPFSVRF  195

Query  282  KKT  274
             K 
Sbjct  196  VKA  198



>gb|EYU22302.1| hypothetical protein MIMGU_mgv1a013790mg [Erythranthe guttata]
Length=210

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 86/195 (44%), Gaps = 24/195 (12%)
 Frame = -3

Query  804  VPIASSGA----PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVIS--  643
            +P+ SS A    PV+D  G  L+ G  Y I  +  G G G + L       CP  V+   
Sbjct  20   IPLLSSAAEAPPPVLDISGKELRAGVNYYILPVIRGRGGG-LSLASTGNNTCPLSVVQEQ  78

Query  642  --WLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRS  469
                   P+   P DPK   V  ST  + KF+  T  +C  +  W + +D  TG+ FV +
Sbjct  79   SELKKGLPLTFHPVDPKKGVVRLSTDHNIKFSAST--ICVQSTVWRLDNDESTGKYFVNT  136

Query  468  DEFVENQ-----SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTR----L  316
                 N      S+ FKIE   +    Y + +CP+  + C  + R+    ++  +    L
Sbjct  137  GGVEGNPGSGSISNWFKIEAYGS--SDYKLLFCPTVCNFCKVICRDVGIVVQDGKRRLGL  194

Query  315  ALSD--FPFVLLFKK  277
             L+D   PF ++FKK
Sbjct  195  TLTDDVTPFPIMFKK  209



>ref|XP_004137534.1| PREDICTED: miraculin-like [Cucumis sativus]
 ref|XP_004165460.1| PREDICTED: miraculin-like [Cucumis sativus]
 gb|KGN64217.1| Tumor-related protein [Cucumis sativus]
Length=206

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 89/194 (46%), Gaps = 22/194 (11%)
 Frame = -3

Query  822  RLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVIS  643
            R  TAD    +S   V+D DG  L+ G  Y I  +  G G G      +SE KCP +V+ 
Sbjct  22   RFSTAD----ASPEAVLDIDGKKLRAGVNYYILPVFRGRGGGLTLGNLQSE-KCPLNVVQ  76

Query  642  ----WLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDF  478
                 +   P    P +PK   V  ST L+ +F   T  +C  +  W + + D  TGQ  
Sbjct  77   EQLEVMNGFPTTFHPVNPKKGVVRVSTDLNVQFEAST--ICVTSTVWKLDKFDESTGQWL  134

Query  477  V-----RSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTR--  319
            V     R +  VE   + FKIE+       Y + +CP+  + C  + R+     K+    
Sbjct  135  VTIGGSRGNPGVETVDNWFKIEKHGK---DYKLVFCPTVCNFCKVMCRDIGIFFKNGERA  191

Query  318  LALSDFPFVLLFKK  277
            LALSD PF ++FKK
Sbjct  192  LALSDTPFPVMFKK  205



>ref|XP_007029360.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
 gb|EOY09862.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
Length=195

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 79/181 (44%), Gaps = 20/181 (11%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVIT  613
            PV+D  G  L+ G  Y I  +  G G G + L       CP DV+          PV  +
Sbjct  21   PVLDISGKKLRTGTDYYILPVFRGRGGG-LTLASTGNESCPLDVVQEQLEVSDGLPVTFS  79

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVENQSDR-  439
            P + K   V  ST  + KF+  T  +C     W +   D  T Q FV +   VE    R 
Sbjct  80   PVNIKKGVVRVSTDQNIKFSAAT--ICVQPTLWKLDSFDDSTRQWFVTTGG-VEGNPGRE  136

Query  438  -----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFK  280
                 FKIE+ E     Y + +CP+  D C  + R+    I     RLALSD PF ++FK
Sbjct  137  TIDNWFKIEKYE---DDYKLVFCPTVCDFCKVMCRDVGVFIDGGVRRLALSDVPFKVMFK  193

Query  279  K  277
            +
Sbjct  194  R  194



>ref|XP_002305034.2| hypothetical protein POPTR_0004s06610g [Populus trichocarpa]
 gb|EEE85545.2| hypothetical protein POPTR_0004s06610g [Populus trichocarpa]
Length=207

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 87/201 (43%), Gaps = 23/201 (11%)
 Frame = -3

Query  828  IHRLRTADVPIASSGA---PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCP  658
            +  L    +P  ++GA   PV+D  G  L+ G  Y+I  +  G G G +         CP
Sbjct  12   LFALAAKPLPRVAAGAAPEPVLDIAGKVLRTGTYYDILPVERGRGGG-ITFACTGHKSCP  70

Query  657  SDVISWLYAD----PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQ-HDSG  493
             DV+   Y D    P+   PA+ K   +  ST L+ KF    +  C+    W V+ +D  
Sbjct  71   VDVMLEDYEDSDGLPLQFIPANRKKGVIRLSTDLNIKFPGPAS--CAATAVWKVEKYDEL  128

Query  492  TGQDF-----VRSDEFVENQSDRFKIERLEAIIPTYIITYCPS-GTDKCYYVGRE---YD  340
            T Q F     V  +   E   + FKIE+       Y + +CP+   D C  + ++   Y 
Sbjct  129  TSQMFISTSGVEGNPGPETVDNWFKIEKYGN---DYKLVFCPTVCNDHCKVLCKDIGIYV  185

Query  339  QSIKSTRLALSDFPFVLLFKK  277
                  RLALSD P  + FKK
Sbjct  186  DKEGFKRLALSDVPLKVKFKK  206



>gb|ADW95380.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=210

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 87/201 (43%), Gaps = 23/201 (11%)
 Frame = -3

Query  828  IHRLRTADVPIASSGA---PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCP  658
            +  L    +P  ++GA   PV+D  G  L+ G  Y+I  +  G G G +         CP
Sbjct  15   LFALAAKPLPRVAAGAAPEPVLDIAGKVLRTGTYYDILPVERGRGGG-ITFACTGHKSCP  73

Query  657  SDVISWLYAD----PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQ-HDSG  493
             DV+   Y D    P+   PA+ K   +  ST L+ KF    +  C+    W V+ +D  
Sbjct  74   VDVMLEDYEDSDGLPLQFIPANRKKGVIRLSTDLNIKFPGPAS--CAATAVWKVEKYDEL  131

Query  492  TGQDF-----VRSDEFVENQSDRFKIERLEAIIPTYIITYCPS-GTDKCYYVGRE---YD  340
            T Q F     V  +   E   + FKIE+       Y + +CP+   D C  + ++   Y 
Sbjct  132  TSQMFISTSGVEGNPGPETVDNWFKIEKYGN---DYKLVFCPTVCNDHCKVLCKDIGIYV  188

Query  339  QSIKSTRLALSDFPFVLLFKK  277
                  RLALSD P  + FKK
Sbjct  189  DKEGFKRLALSDVPLKVKFKK  209



>gb|AEK26933.1| Kunitz-type trypsin inhibitor B2 [Populus nigra]
Length=215

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 86/182 (47%), Gaps = 22/182 (12%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVI----SWLYADPVVITP  610
            V+D+DG+ L+ G  Y I  +  G G G      R ET CP DV+          P+  TP
Sbjct  33   VLDTDGEKLRAGTEYYILPVFRGRGGGLTMASTRDET-CPLDVVQDPLEISKGLPLTFTP  91

Query  609  ADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDF------VRSDEFVENQ  448
             +PK   +  ST L+ KF+  +  +C  +  W +Q    +   +      V  +  +E  
Sbjct  92   VNPKKGVIRVSTDLNIKFSASS--ICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIETI  149

Query  447  SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE-----YDQSIKSTRLALSDFPFVLLF  283
            ++ FKIE+ +     Y + +CP+  D C  + R+     +D  +++  L+ +  PF++ F
Sbjct  150  TNWFKIEKAD---DDYKLVFCPTVCD-CGALCRDVGIYIHDNGVRTLSLSDALQPFLVNF  205

Query  282  KK  277
            KK
Sbjct  206  KK  207



>ref|XP_007036743.1| 21 kDa seed protein [Theobroma cacao]
 sp|P32765.1|ASP_THECC RecName: Full=21 kDa seed protein; Flags: Precursor [Theobroma 
cacao]
 pir||S16252 trypsin inhibitor homolog - soybean
 emb|CAA39860.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21244.1| 21 kDa seed protein [Theobroma cacao]
Length=221

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 89/188 (47%), Gaps = 17/188 (9%)
 Frame = -3

Query  792  SSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWL----YADP  625
            ++ +PV+D+DGD LQ G  Y + S   GAG G + L   +   CP  V+          P
Sbjct  26   AANSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQSCPEIVVQRRSDLDNGTP  85

Query  624  VVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQ-----DFVRSDE  463
            V+ + AD K   V  ST ++ +F  + + LCS +  W +  +D+  G+     D V+ + 
Sbjct  86   VIFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEP  145

Query  462  FVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYY----VGREYDQSIKSTRLALSDFPF  295
                    FKIE+  A +  Y   +CPS  D C      +GR  D      RLALSD  +
Sbjct  146  GPNTLCSWFKIEK--AGVLGYKFRFCPSVCDSCTTLCSDIGRHSDDD-GQIRLALSDNEW  202

Query  294  VLLFKKTS  271
              +FKK S
Sbjct  203  AWMFKKAS  210



>emb|CAI77771.1| kunitz trypsin inhibitor [Populus tremula]
Length=215

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 90/192 (47%), Gaps = 25/192 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +   PV+D  G+ L+ G  Y ITSI  GAG G+V     +   CP DVI +       
Sbjct  23   IEADTEPVLDIQGEELKAGTEYIITSIFRGAGGGDVA---ATNKTCPDDVIQYSLDVFQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKK--ACDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIP-TYIITYCPSGTDKCYYVG--RE---YDQSIKSTRLALS  307
                   ++ FKIE+        Y + +CP   D C  VG  R+   Y +S +   L+LS
Sbjct  138  NPGCDTFTNWFKIEKGAGTFGYNYKLVFCPE--DICPSVGLCRDVGIYFESNRGRILSLS  195

Query  306  D--FPFVLLFKK  277
            D   PF+++F+K
Sbjct  196  DKLSPFLVVFRK  207



>emb|CDY69418.1| BnaAnng30440D [Brassica napus]
Length=205

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 91/187 (49%), Gaps = 25/187 (13%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD----  628
            A++G PV+D +GD +  G  Y +  I +G G G + L  R    CP   I   Y++    
Sbjct  19   ANAGGPVLDINGDIIFDGSYYVLPRI-FGPGGGGLTLAPRGGNHCPL-YIGQEYSEVNMG  76

Query  627  -PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFV--  457
             PV  +    K   V ES  L+ K +V    +C+ + YW V      G D V  + ++  
Sbjct  77   IPVRFSDWRIKVAFVPESANLNIKMDVAAT-ICAQSTYWNV-----AGPDIVMKEVYLPA  130

Query  456  --ENQSDRFKIERLEAIIPTYIITYCPSGTDKCYY--VGREYD-QSIKSTRLALSDFPFV  292
              +  +  F+I++++  +  Y I YCP+G+   YY  +G   D Q ++  RLALS   F 
Sbjct  131  GPKPSNGLFQIKKIKDALAGYKIVYCPNGS---YYSDIGIFVDKQGVR--RLALSSTSFE  185

Query  291  LLFKKTS  271
            ++F K +
Sbjct  186  VVFVKAT  192



>emb|CAI77767.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77778.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77779.1| kunitz trypsin inhibitor [Populus tremula]
Length=215

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 90/192 (47%), Gaps = 25/192 (13%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYA  631
            I +   PV+D  G+ L+ G  Y ITSI  GAG G+V     +   CP DVI +       
Sbjct  23   IEADTEPVLDIQGEELKAGTEYIITSIFRGAGGGDVA---ATNKTCPDDVIQYSLDVFQG  79

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVEN  451
             PV  +PA  +   +  ST L+ KF++     C  +  W +Q  S +   ++ +    E 
Sbjct  80   LPVTFSPASSEDDVIRVSTDLNIKFSIKK--ACDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  450  Q------SDRFKIERLEAIIP-TYIITYCPSGTDKCYYVG--RE---YDQSIKSTRLALS  307
                   ++ FKIE+        Y + +CP   D C  VG  R+   Y +S +   L+LS
Sbjct  138  NPGCDTFTNWFKIEKGAGTFGYNYKLVFCPE--DICPSVGLCRDVGIYFESNRGRILSLS  195

Query  306  D--FPFVLLFKK  277
            D   PF+++F+K
Sbjct  196  DKLSPFLVVFRK  207



>ref|XP_009105981.1| PREDICTED: 21 kDa seed protein-like [Brassica rapa]
 emb|CDX96462.1| BnaA07g30730D [Brassica napus]
Length=209

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 85/183 (46%), Gaps = 17/183 (9%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD----  628
            A++G PV+D+DGD +  GG Y +  I  G G   + L  R   +CP   I   Y+D    
Sbjct  19   ANAGGPVLDTDGDFILDGGSYYVLPIFSGGG---LTLTPRGGNQCPLH-IGQEYSDVNKG  74

Query  627  -PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVE  454
             PV  +    K   V+ES  L+ + +V    +C  + YW V   D    + F+ S    +
Sbjct  75   IPVKFSNCRSKFGFVLESVNLNIEMDVKAT-ICFQSTYWWVDECDMAIKKFFIMSGPKPK  133

Query  453  NQSDR----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTRLALSDFPFVLL  286
               D     F+I++ +     Y I +CP+  D C  VG   D+     RLALS  PF ++
Sbjct  134  PGEDSSKSFFQIKKTKYFHNGYTIAFCPNDND-CIDVGIFVDE-YGVWRLALSPTPFPVM  191

Query  285  FKK  277
            F K
Sbjct  192  FVK  194



>prf||1802409A albumin
Length=221

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 89/188 (47%), Gaps = 17/188 (9%)
 Frame = -3

Query  792  SSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWL----YADP  625
            ++ +PV+D+DGD LQ G  Y + S   GAG G + L   +   CP  V+          P
Sbjct  26   AANSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQSCPEIVVQRRSDLDNGTP  85

Query  624  VVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQ-----DFVRSDE  463
            V+ + AD K   V  ST ++ +F  + + LCS +  W +  +D+  G+     D V+ + 
Sbjct  86   VIFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEP  145

Query  462  FVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYY----VGREYDQSIKSTRLALSDFPF  295
                    FKIE+  A +  Y   +CPS  D C      +GR  D      RLALSD  +
Sbjct  146  GPNTLCSWFKIEK--AGVLGYKFRFCPSVCDSCTTLCSDIGRHSDDD-GQIRLALSDNEW  202

Query  294  VLLFKKTS  271
              +FKK S
Sbjct  203  AWMFKKAS  210



>gb|ABK01288.1| miraculin-like protein [Coffea arabica]
Length=214

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 84/183 (46%), Gaps = 17/183 (9%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVI-SWLYAD-PVVITPA  607
            PV+D +G+ ++ G  Y I + T+  G G    +      CP  V  +WL    PV  TP 
Sbjct  26   PVLDINGEEIRPGVEYYIGT-TFRPGGGVTYGKGPGNEICPLAVAQAWLQRGLPVTFTPV  84

Query  606  DPKATDVIESTFLSFKF-NVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVENQ-----S  445
            +P+   V  ST L+ KF       +CSG+  W V  +    + FV +D    N      +
Sbjct  85   NPEEGVVRVSTDLNIKFAEPPVGRICSGSNVWKVHFNDLFEKHFVLTDGVEGNSGCGTTA  144

Query  444  DRFKIERLEAIIPTYIITYCPSGTDK-----CYYVGREYDQSIKSTRLALSDFPFVLLFK  280
            + FKIE +      Y + +CP+  D      C YVG  +D    + RLAL   PFV+ F 
Sbjct  145  NWFKIEAVGD--RGYKLVFCPTVCDSSSEAICKYVGIYHDDD-GTRRLALGGQPFVVFFS  201

Query  279  KTS  271
            K +
Sbjct  202  KKN  204



>ref|XP_006478132.1| PREDICTED: 21 kDa seed protein-like [Citrus sinensis]
Length=223

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 60/203 (30%), Positives = 97/203 (48%), Gaps = 27/203 (13%)
 Frame = -3

Query  834  NPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPS  655
            N +  L T+ VP      P++D +G+ ++    Y I S  WGAG G V L       CP 
Sbjct  19   NSLLVLGTSSVP-----EPLLDVNGNKVESTLQYYIVSAIWGAGGGGVSLHGGRNGYCPL  73

Query  654  DVISWLYAD-----PVVITPADPKATDVIESTFLSFKFNVVTNF--LCSGNLYWGV-QHD  499
            DVI  L +D      + ++P +  +T V EST L+ +F+V+ +    C+    W V  +D
Sbjct  74   DVIQ-LPSDMQNGIKLTLSPYN-NSTIVRESTDLNLRFSVLLSGRDCCNEQPLWKVDNYD  131

Query  498  SGTGQDFVRSDEF-----VENQSDRFKIERLEAIIPTYIITYCPSGTDKCYY----VGRE  346
            + +G+ F+ +         E   + FK+E++     TY I +CPS  + C      VGR 
Sbjct  132  AASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRS  191

Query  345  YDQSIKSTRLALSD---FPFVLL  286
            ++  ++   L   D   FP VL+
Sbjct  192  FEDGVRRLVLVRDDEPAFPVVLI  214



>ref|XP_006441467.1| hypothetical protein CICLE_v10022124mg [Citrus clementina]
 gb|ESR54707.1| hypothetical protein CICLE_v10022124mg [Citrus clementina]
Length=223

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 60/203 (30%), Positives = 97/203 (48%), Gaps = 27/203 (13%)
 Frame = -3

Query  834  NPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPS  655
            N +  L T+ VP      P++D +G+ ++    Y I S  WGAG G V L       CP 
Sbjct  19   NSLLVLGTSSVP-----EPLLDVNGNKVESTLQYYIVSAIWGAGGGGVSLHGGRNGYCPL  73

Query  654  DVISWLYAD-----PVVITPADPKATDVIESTFLSFKFNVVTNF--LCSGNLYWGV-QHD  499
            DVI  L +D      + ++P +  +T V EST L+ +F+V+ +    C+    W V  +D
Sbjct  74   DVIQ-LPSDTQNGIKLTLSPYN-NSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYD  131

Query  498  SGTGQDFVRSDEF-----VENQSDRFKIERLEAIIPTYIITYCPSGTDKCYY----VGRE  346
            + +G+ F+ +         E   + FK+E++     TY I +CPS  + C      VGR 
Sbjct  132  AASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRS  191

Query  345  YDQSIKSTRLALSD---FPFVLL  286
            ++  ++   L   D   FP VL+
Sbjct  192  FEDGVRRLVLVRDDEPAFPVVLI  214



>emb|CAN63617.1| hypothetical protein VITISV_041430 [Vitis vinifera]
Length=220

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 85/183 (46%), Gaps = 20/183 (11%)
 Frame = -3

Query  801  PIASSGAP--VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWL---  637
            P+A+  AP  V+D++G  LQ    Y I S+    G G + L       CP DV+      
Sbjct  21   PVAAEAAPDPVLDTEGKKLQSEVDYYILSVIRRRGGGGLTLASTGNKTCPLDVVQEQNEV  80

Query  636  -YADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEF  460
                 ++ +P +PK   +  ST  + +F+  T  +C  +  W +++D  +GQ F  +  +
Sbjct  81   SNGLTLMFSPVNPKKGVIRVSTDHNIEFSAAT--ICVQSTVWKLEYDESSGQWFFTTG-W  137

Query  459  VENQ------SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSD  304
            VE        S++FKIE+ E       + +CP+  D C  V  +    I+     LALSD
Sbjct  138  VEGNLGRGTLSNQFKIEKYE---DDNNLVFCPTVCDFCKPVCGDIGIYIQDGYRHLALSD  194

Query  303  FPF  295
             PF
Sbjct  195  VPF  197



>dbj|BAA05474.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=125

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 63/125 (50%), Gaps = 13/125 (10%)
 Frame = -3

Query  627  PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFV-----RSD  466
            P+  TP +PK   + EST L+ KF+  +  +C     W +   D  TG+ F+       +
Sbjct  5    PLTFTPVNPKKGVIRESTDLNIKFSAAS--ICVQTTLWKLDDFDETTGKYFITIGGNEGN  62

Query  465  EFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFV  292
               E  S+ FKIE+ E     Y + YCP+  + C  + ++    I+    RLALSD PF 
Sbjct  63   PGRETISNWFKIEKFER---DYKLVYCPTVCNFCKVICKDVGIFIQDGIRRLALSDVPFK  119

Query  291  LLFKK  277
            ++FKK
Sbjct  120  VMFKK  124



>ref|XP_006347377.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=210

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 84/190 (44%), Gaps = 22/190 (12%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSE-TKCPSDVISWL----Y  634
            I SS +PV+D +GD +Q G  Y I  +  G G G      +   + CP D++        
Sbjct  27   ILSSSSPVLDINGDKVQAGPNYFILPVIRGKGGGLYPSNVKQHNSTCPRDIVQETDEVQQ  86

Query  633  ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEFV  457
              PVV T  D K   V  ST ++ +F   T  +C+    W +  +D    Q FV +    
Sbjct  87   GLPVVFTRLDAKKGVVRVSTDVNVRFYTPT--ICARETIWKLGAYDDKLKQYFVVTGGVE  144

Query  456  ENQSDR-----FKIERLEAIIPTYIITYCPSGTD----KCYYVGREYDQSIKSTRLALSD  304
             N   +     FKIE+  +    Y   +CPS  +     C  VG      ++   LALSD
Sbjct  145  GNPGPQTVGNWFKIEKFGS---DYKFVFCPSVCEFYKVICKDVGVFMKDGVRF--LALSD  199

Query  303  FPFVLLFKKT  274
             PF ++FKKT
Sbjct  200  TPFKVMFKKT  209



>ref|XP_009406658.1| PREDICTED: miraculin-like [Musa acuminata subsp. malaccensis]
Length=200

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 92/205 (45%), Gaps = 19/205 (9%)
 Frame = -3

Query  855  HPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWR  676
             PTR  L+ I  + +A    AS+  PV D+DG+ LQ G  Y I       G G + LE R
Sbjct  2    KPTRFVLSAIFLVFSALALPASADEPVRDTDGNVLQRGVDYYIRPTVTDIGGG-LTLEAR  60

Query  675  SETKCPSDV-ISWLYAD---PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV  508
            + + CP  V ++ L AD   P+  +P D     V  ST  +  F+  T   C  +  W +
Sbjct  61   NGS-CPLSVALASLPADNGLPLQFSPEDDDDDTVELSTDTNVIFSAFTT--CLQSTVWKL  117

Query  507  QHDSGTGQDF-----VRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE-  346
            + D G G+ +     V  +   E  S+ FKIE  + +   Y + +CP+  D C  V    
Sbjct  118  ELDEGEGRYYVVIGGVAGNPGKETLSNWFKIESYQGV---YKLVFCPTVCDYCRPVCGSL  174

Query  345  --YDQSIKSTRLALSDFPFVLLFKK  277
              Y+Q  +       D PF   FK+
Sbjct  175  GVYEQGGRQWLGIRDDTPFPFEFKR  199



>sp|P09943.1|IDE3_ERYCA RecName: Full=Trypsin inhibitor DE-3 [Erythrina caffra]
 pdb|1TIE|A Chain A, Crystal Structure Of A Kunitz-Type Trypsin Inhibitor 
From Erythrina Caffra Seeds
Length=172

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 71/172 (41%), Gaps = 10/172 (6%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYADPVVITPADP-  601
            ++D +G+ +Q GG Y +    W  G G V+L    E  CP  V+      P  ++   P 
Sbjct  2    LLDGNGEVVQNGGTYYLLPQVWAQGGG-VQLAKTGEETCPLTVVQ----SPNELSDGKPI  56

Query  600  KATDVIESTFLSFKFNVVTNFL----CSGNLYWGVQHDSGTGQDFVRSDEFVENQSDRFK  433
            +    + S F+     V   F     C+ + +W V  D   G     S++        FK
Sbjct  57   RIESRLRSAFIPDDDKVRIGFAYAPKCAPSPWWTVVEDEQEGLSVKLSEDESTQFDYPFK  116

Query  432  IERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTRLALSDFPFVLLFKK  277
             E++   + +Y + YC    +KC  +G   DQ      +   D+P  ++ KK
Sbjct  117  FEQVSDQLHSYKLLYCEGKHEKCASIGINRDQKGYRRLVVTEDYPLTVVLKK  168



>gb|ACS92509.1| Kunitz-type protease inhibitor KPI-D2.3 [Populus trichocarpa]
 gb|ACS92510.1| Kunitz-type protease inhibitor KPI-D2 [Populus trichocarpa x 
Populus deltoides]
Length=215

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 85/182 (47%), Gaps = 22/182 (12%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVI----SWLYADPVVITP  610
            V+D+DG+ L+ G  Y I  +  G G G      R ET CP DV+          P+  TP
Sbjct  33   VLDTDGEKLRAGTEYYILPVFRGRGGGLTMASTRDET-CPLDVVQDPLEISKGLPLTFTP  91

Query  609  ADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDF------VRSDEFVENQ  448
             +PK   +  ST L+ KF+  +  +C  +  W +Q    +   +      V  +  +E  
Sbjct  92   VNPKKGVIRVSTDLNIKFSASS--ICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIETI  149

Query  447  SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE-----YDQSIKSTRLALSDFPFVLLF  283
            ++ FKIE+       Y + +CP+  D C  + R+     +D  +++  L+ +  PF++ F
Sbjct  150  TNWFKIEKAG---DDYKLVFCPTVCD-CGALCRDVGIYIHDNGVRTLSLSDALQPFLVNF  205

Query  282  KK  277
            KK
Sbjct  206  KK  207



>ref|XP_002305032.2| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92483.1| Kunitz-type protease inhibitor KPI-D2.2 [Populus trichocarpa]
 gb|ADW95386.1| Kunitz-type trypsin inhibitor [Populus nigra]
 gb|EEE85543.2| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=215

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 85/182 (47%), Gaps = 22/182 (12%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVI----SWLYADPVVITP  610
            V+D+DG+ L+ G  Y I  +  G G G      R ET CP DV+          P+  TP
Sbjct  33   VLDTDGEKLRAGTEYYILPVFRGRGGGLTMASTRDET-CPLDVVQDPLEISKGLPLTFTP  91

Query  609  ADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDF------VRSDEFVENQ  448
             +PK   +  ST L+ KF+  +  +C  +  W +Q    +   +      V  +  +E  
Sbjct  92   VNPKKGVIRVSTDLNIKFSASS--ICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIETI  149

Query  447  SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE-----YDQSIKSTRLALSDFPFVLLF  283
            ++ FKIE+       Y + +CP+  D C  + R+     +D  +++  L+ +  PF++ F
Sbjct  150  TNWFKIEKAG---DDYKLVFCPTVCD-CGALCRDVGIYIHDNGVRTLSLSDALQPFLVNF  205

Query  282  KK  277
            KK
Sbjct  206  KK  207



>gb|AAV41234.1| putative 21 kDa trypsin inhibitor [Theobroma microcarpum]
Length=221

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 88/188 (47%), Gaps = 17/188 (9%)
 Frame = -3

Query  792  SSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADP  625
            ++ +PV+D DGD L+ G  Y + S  WGAG G + L   +   CP  V+          P
Sbjct  26   AANSPVLDIDGDELRTGVQYYVVSALWGAGGGGLALGRATGQSCPEIVVQRRSDLDDGTP  85

Query  624  VVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQ-----DFVRSDE  463
            V+ + AD K   V  ST ++ +F  + + LC+ +  W +  +D+  G+     D V+ D 
Sbjct  86   VIFSNADSKDGVVRVSTDINIEFVPIRDRLCTTSTVWKLDNYDNSAGKWWVTTDGVKGDP  145

Query  462  FVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYY----VGREYDQSIKSTRLALSDFPF  295
                 S  FKIE    I   Y   +CPS  D C      +G+  D      RLALSD  +
Sbjct  146  GASTMSSWFKIEPAGGI--GYKFRFCPSVCDSCTKLCSDIGKHSDDD-GQIRLALSDSGW  202

Query  294  VLLFKKTS  271
              +FKK S
Sbjct  203  PWIFKKAS  210



>ref|XP_010416116.1| PREDICTED: miraculin-like [Camelina sativa]
Length=208

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 97/206 (47%), Gaps = 22/206 (11%)
 Frame = -3

Query  837  LNPIHRLRTADVPIASSGA--PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK  664
            +NP   L  A   + ++ A   V+D DG+ +   G Y +  +  G G G + L  R    
Sbjct  1    MNPTLCLVLALTAVLATNAYGAVLDIDGNII-FRGSYYVLPVIRGRGGG-LTLSGRGGEL  58

Query  663  CPSDVISWLY----ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHD  499
            CP D++         +PV  +   P+   V ES  L+ + +V    +C  + YW V + D
Sbjct  59   CPLDIVQESQELDEGNPVKFSNWRPRVAFVPESQDLNIQTDVEAT-ICFQSTYWRVGEFD  117

Query  498  SGTGQDFV----RSDEFVENQSDRF-KIERLEAIIPTYIITYCPS----GTDKCYYVGRE  346
                Q F+    + + F ++ S  F KIE+  +    Y   +CPS    G  KC  VG  
Sbjct  118  EERKQYFIVAGLKPEGFGQDSSKSFFKIEK--SGDDAYKFVFCPSTCDSGCPKCSDVGI-  174

Query  345  YDQSIKSTRLALSDFPFVLLFKKTSL  268
            ++  +   RLALSD PF+++FKK ++
Sbjct  175  FEDELGVRRLALSDEPFLVMFKKANV  200



>gb|AFR54471.1| miraculin-like protein 2 [Citrus japonica]
Length=223

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 60/203 (30%), Positives = 96/203 (47%), Gaps = 27/203 (13%)
 Frame = -3

Query  834  NPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPS  655
            N +  L T+ VP      P++D +G+ ++    Y I S  WGAG G V L       CP 
Sbjct  19   NSLLVLGTSSVP-----EPLLDVNGNKVESTLQYYIVSAIWGAGGGGVSLHGGRNGYCPL  73

Query  654  DVISWLYAD-----PVVITPADPKATDVIESTFLSFKFNVVTNF--LCSGNLYWGV-QHD  499
            DVI  L +D      + ++P +  +T V EST L+ +F+V+ +    C+    W V  +D
Sbjct  74   DVIQ-LPSDTQNGIKLTLSPYN-NSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYD  131

Query  498  SGTGQDFVRSDEF-----VENQSDRFKIERLEAIIPTYIITYCPSGTDKCYY----VGRE  346
            + +G+ F+ +         E   + FK+E++     TY I +CPS    C      VGR 
Sbjct  132  AASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCKSCVKLCNNVGRS  191

Query  345  YDQSIKSTRLALSD---FPFVLL  286
            ++  ++   L   D   FP VL+
Sbjct  192  FEDGVRRLVLVRDDEPAFPVVLI  214



>ref|XP_010428237.1| PREDICTED: miraculin-like [Camelina sativa]
Length=208

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 96/206 (47%), Gaps = 22/206 (11%)
 Frame = -3

Query  837  LNPIHRLRTADVPIASSGA--PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK  664
            +NP      A   + ++ A   V+D DG+ +   G Y +  +  G G G + L  R    
Sbjct  1    MNPTRCFVLALTAVLATNAYGAVLDIDGNII-FRGSYYVLPVIRGRGGG-LTLSGRGGEL  58

Query  663  CPSDVISWLY----ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHD  499
            CP D++         +PV  +   P+   V ES  L+ K +V    +C  + YW V + D
Sbjct  59   CPLDIVQESQEVDEGNPVKFSNWRPRVAFVPESQDLNIKTDVEAT-ICFQSTYWRVGEFD  117

Query  498  SGTGQDFV----RSDEFVENQSDRF-KIERLEAIIPTYIITYCPSGTD----KCYYVGRE  346
                Q F+    + + F ++ S  F KIE+  +    Y   +CPS  D    KC  VG  
Sbjct  118  EERKQYFIVAGLKPEGFGQDSSKSFFKIEK--SGDDAYKFVFCPSTCDSDCPKCSDVGIF  175

Query  345  YDQSIKSTRLALSDFPFVLLFKKTSL  268
             D+ +   RLALSD PF+++FKK ++
Sbjct  176  VDE-LGVRRLALSDDPFLVMFKKANV  200



>sp|P68171.1|IDE3_ERYLA RecName: Full=Trypsin inhibitor DE-3 [Erythrina latissima]
Length=172

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 71/172 (41%), Gaps = 10/172 (6%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYADPVVITPADP-  601
            ++D +G+ +Q GG Y +    W  G G V+L    E  CP  V+      P  ++   P 
Sbjct  2    LLDGNGEVVQNGGTYYLLPQVWAQGGG-VQLAKTGEETCPLTVVQ----SPNELSDGKPI  56

Query  600  KATDVIESTFLSFKFNVVTNFL----CSGNLYWGVQHDSGTGQDFVRSDEFVENQSDRFK  433
            +    + STF+     V   F     C+ + +W V  D   G     S++        FK
Sbjct  57   RIESRLRSTFIPDDDEVRIGFAYAPKCAPSPWWTVVEDEQEGLSVKLSEDESTQFDYPFK  116

Query  432  IERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTRLALSDFPFVLLFKK  277
             E++   + +Y + YC    +KC  +G   DQ      +   D P  ++ KK
Sbjct  117  FEQVSDKLHSYKLLYCEGKHEKCASIGINRDQKGYRRLVVTEDNPLTVVLKK  168



>emb|CDY68006.1| BnaA02g35870D [Brassica napus]
Length=205

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 91/202 (45%), Gaps = 23/202 (11%)
 Frame = -3

Query  837  LNPIH----RLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSE  670
            +NP+      L    V  AS G PV+D +GD +  G  Y +  I +G   G + L  R  
Sbjct  1    MNPMFYFLLALTAVLVVTASPGEPVLDINGDIIFDGSYYVLPRI-FGPAGGGLTLSPRGG  59

Query  669  TKCPSDVISWLYAD-----PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQ  505
              CP   I   Y++     PV  +    K   V EST L+ + +V    +C  + YW V 
Sbjct  60   NNCPL-YIGQEYSEVKRGIPVRFSDWRTKVAFVPESTNLNIEMDVKAT-ICVQSTYWYVP  117

Query  504  HDSGTGQDFVRSDEFV----ENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQ  337
                   D V    F+    +  +D F+I+++E  I  Y I +C +G D C  VG   D+
Sbjct  118  -----APDMVFEAAFIAAGPKPSNDFFQIKKIEDSIGGYKIVFCFNGED-CVDVGIFVDK  171

Query  336  SIKSTRLALSDFPFVLLFKKTS  271
                 RLAL+  PF ++F + S
Sbjct  172  H-GVRRLALASTPFEVVFVRAS  192



>gb|ACO40078.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=180

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 79/172 (46%), Gaps = 21/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITSI WGA  G+V     +   CP DVI +    L   PV  +
Sbjct  14   PVLDIQGEELKAGTEYIITSIFWGARGGDVSA---TNKTCPDDVIKYSSDRLQGLPVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA  +   +  ST L+ KF++     C  +  W +Q  S +  Q FV       +  ++ 
Sbjct  71   PASSEDDVIRVSTDLNIKFSI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNPGIDT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+       Y +  CP     C  + R+   Y ++     L+LSD
Sbjct  129  LTNWFKIEKAGI---GYKLVSCPEDICHCGVLCRDIGIYRENNGRKILSLSD  177



>ref|XP_010041215.1| PREDICTED: miraculin-like [Eucalyptus grandis]
 gb|KCW44534.1| hypothetical protein EUGRSUZ_L01961 [Eucalyptus grandis]
Length=203

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 87/187 (47%), Gaps = 19/187 (10%)
 Frame = -3

Query  801  PIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----  634
            P  ++ +PV+D+DG  LQ G  Y+I  +  G G G      RS   CP  V+        
Sbjct  23   PSNAASSPVLDTDGHKLQTGVNYHILPVLRGRGGGLTLGASRS-GNCPLAVVQEQQELSD  81

Query  633  ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEFV  457
              P   +P D ++T +  ST L+  F+  T  +C  +  W +   D    Q FV S   +
Sbjct  82   GLPAKFSPVDGRST-IRLSTDLNVWFDAAT--ICVQSTVWRLAAFDEEVKQYFVESGGVL  138

Query  456  -----ENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI--KSTRLALSDFP  298
                 E  S+ FKIE+++     Y   +CP+  D C  + R+    +   + RLALSD P
Sbjct  139  GNPGRETVSNWFKIEKMDE---DYNFRFCPTVCDTCKVICRDVGIYVDGATRRLALSDEP  195

Query  297  FVLLFKK  277
            F + FKK
Sbjct  196  FRVKFKK  202



>ref|XP_006347379.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=204

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 80/182 (44%), Gaps = 13/182 (7%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY---ADPVVITP  610
            P++D +G  L+    Y +  +    G   + LE     KC   V+  +Y      V + P
Sbjct  27   PILDINGKILRTHTTYFVVPVNHKYGG--ISLETTGNEKCQLGVVQEIYDVHGGSVALLP  84

Query  609  ADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQ-HDSGTGQDFVRSDEFVENQSDRFK  433
             +PK   +  ST L+      T+     +  W ++ +DS TG+ F++ D  VE   D   
Sbjct  85   LNPKEGVIRVSTDLNIAI-FSTHGCGDQSTVWQLETYDSKTGKYFIK-DGGVEGNPDPKT  142

Query  432  IE---RLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFKKTSL  268
            I    ++E     Y   YCPS   KC  + ++    +K+   RLALS+ P V  FKK   
Sbjct  143  IRNWFKIEKYGHGYKFVYCPSVCSKCKVICKDVGVYMKNGQRRLALSNVPLVFNFKKEEF  202

Query  267  AS  262
             S
Sbjct  203  TS  204



>ref|XP_009149240.1| PREDICTED: miraculin [Brassica rapa]
Length=192

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 81/179 (45%), Gaps = 23/179 (13%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVIT  613
            PV D DG  L  G  Y I  +  G G G    +  ++T CP  VI   Y      PV  +
Sbjct  25   PVTDIDGGRLTSGTKYYILPVLRGRGGGLTMSKPENKT-CPKSVIQDPYEVSKGLPVEFS  83

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVENQS----  445
            P+D  +  +  ST L+FKF       C+ +++    +D  T Q FV +     N      
Sbjct  84   PSD-NSRIIRVSTDLNFKF-------CAASVWNLDNYDETTNQWFVTACGVAGNPGQATV  135

Query  444  -DRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIK--STRLALSDFPFVLLFKK  277
             + FKIE+ E     Y I +CP+  + C  + R+    ++    RL LSD P  ++FKK
Sbjct  136  DNWFKIEKYED---DYKIVFCPTVCNFCKVMCRDVGVFVQDGKRRLVLSDVPLKVMFKK  191



>dbj|BAE79511.1| miraculin-like protein 2 [Citrus jambhiri]
Length=223

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 96/203 (47%), Gaps = 27/203 (13%)
 Frame = -3

Query  834  NPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPS  655
            N +  L T+ VP      P++D +G+ ++    Y I S  WGAG G V L       CP 
Sbjct  19   NSLLVLGTSSVP-----EPLLDVNGNKVESTLQYYIVSAIWGAGGGGVSLHGGRNGYCPL  73

Query  654  DVISWLYAD-----PVVITPADPKATDVIESTFLSFKFNVVTNF--LCSGNLYWGV-QHD  499
            DVI  L +D      + ++P +  +T V ES  L+ +F+V+ +    C+    W V  +D
Sbjct  74   DVIQ-LPSDTQNGIKLTLSPYN-NSTIVRESADLNLRFSVLLSGRDYCNEQPLWKVDNYD  131

Query  498  SGTGQDFVRSDEF-----VENQSDRFKIERLEAIIPTYIITYCPSGTDKCYY----VGRE  346
            + +G+ F+ +         E   + FK+E++     TY I +CPS  + C      VGR 
Sbjct  132  AASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRS  191

Query  345  YDQSIKSTRLALSD---FPFVLL  286
            ++  ++   L   D   FP VL+
Sbjct  192  FEDGVRRLVLVRDDEPAFPVVLI  214



>ref|XP_011072079.1| PREDICTED: miraculin [Sesamum indicum]
Length=206

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 87/184 (47%), Gaps = 15/184 (8%)
 Frame = -3

Query  795  ASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----AD  628
            A   APV+D+D + ++ G  Y I  +  G G G       +ET CP DV+          
Sbjct  26   AEEPAPVLDTDRNLVRAGVDYYILPVIRGRGGGLTLASTGNET-CPLDVVQEQLEVRNGL  84

Query  627  PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEFVEN  451
            P+   P +PK   V  ST  + KF+  T  +C  +  W +  +D+ TG+ F+ +   VE 
Sbjct  85   PLTFRPVNPKKGVVRVSTDQNIKFSGAT--ICVQSTVWKLDNYDASTGKYFITTGG-VEG  141

Query  450  QSDRFKIE---RLEAIIPTYIITYCPSGTDKCYYVGREYDQSIK--STRLALS-DFPFVL  289
            +  R  I    ++E     Y + +CP+  + C  + ++    ++    RLAL+ D PF +
Sbjct  142  KPGRETISNWFKIETYGDDYKLVFCPTVCNYCKVICKDVGIFMQDGKRRLALTEDAPFRV  201

Query  288  LFKK  277
            + KK
Sbjct  202  MLKK  205



>gb|ACO40080.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=180

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 78/172 (45%), Gaps = 21/172 (12%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISW----LYADPVVIT  613
            PV+D  G+ L+ G  Y ITSI WGA  G+V     +   CP DVI +    L   PV  +
Sbjct  14   PVLDIQGEELKAGTEYIITSIFWGARGGDVS---ATNKTCPDDVIKYSSDRLQGLPVTFS  70

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTG-QDFV-----RSDEFVEN  451
            PA  +   +  ST L+ KF++     C  +  W +Q  S    Q FV       +  ++ 
Sbjct  71   PASSEDDVIRVSTDLNIKFSI--KKACDHSSVWKIQKSSNLEVQWFVTTGGEEGNPGIDT  128

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE---YDQSIKSTRLALSD  304
             ++ FKIE+       Y +  CP     C  + R+   Y ++     L+LSD
Sbjct  129  LTNWFKIEKAGI---GYKLVSCPEDICHCGVLCRDIGIYRENNGRKILSLSD  177



>sp|P81366.1|IDE3_ERYVA RecName: Full=Trypsin inhibitor DE-3; AltName: Full=ETIA [Erythrina 
variegata]
 gb|AAB24756.1| ETIa=Kunitz-type trypsin inhibitor [Erythrina variegata, var. 
Orientalis, seeds, Peptide, 172 aa]
 prf||1903155A trypsin inhibitor ET1a
Length=172

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 70/172 (41%), Gaps = 10/172 (6%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYADPVVITPADP-  601
            ++D +G+ +Q GG Y +    W  G G V+L    E  CP  V+      P  ++   P 
Sbjct  2    LLDGNGEVVQNGGTYYLLPQVWAQGGG-VQLAKTGEETCPLTVVQ----SPNELSNGKPI  56

Query  600  KATDVIESTFLSFKFNVVTNFL----CSGNLYWGVQHDSGTGQDFVRSDEFVENQSDRFK  433
            +    + S F+     V   F     C+ + +W V  D   G     S++        FK
Sbjct  57   RIESRLRSAFIPDDDKVRIGFAYAPKCAPSPWWTVLEDEQEGLSVKLSEDESTQFDYPFK  116

Query  432  IERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTRLALSDFPFVLLFKK  277
             E++   + +Y + YC    +KC  +G   DQ      +   D P  ++ KK
Sbjct  117  FEQVSDKLHSYKLLYCEGKHEKCASIGINRDQKGYRRLVVTEDNPLTVVLKK  168



>ref|NP_565061.1| kunitz trypsin inhibitor 1 [Arabidopsis thaliana]
 gb|AAL91212.1| putative trypsin inhibitor [Arabidopsis thaliana]
 gb|AAO00908.1| putative trypsin inhibitor [Arabidopsis thaliana]
 dbj|BAF02103.1| putative trypsin inhibitor [Arabidopsis thaliana]
 gb|AEE35435.1| kunitz trypsin inhibitor 1 [Arabidopsis thaliana]
Length=215

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 95/210 (45%), Gaps = 22/210 (10%)
 Frame = -3

Query  849  TRATLNPIHRLRTADVPIASSGA--PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWR  676
            T  T+NP   L  A   + +S A   VVD DG+A+     Y +  +  G G G + L  R
Sbjct  4    TTKTMNPKFYLVLALTAVLASNAYGAVVDIDGNAM-FHESYYVLPVIRGRGGG-LTLAGR  61

Query  675  SETKCPSDVISWL----YADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV  508
                CP D++          PV  +    K   V ES  L+ + +V    +C  + YW V
Sbjct  62   GGQPCPYDIVQESSEVDEGIPVKFSNWRLKVAFVPESQNLNIETDVGAT-ICIQSTYWRV  120

Query  507  -QHDSGTGQDFV----RSDEFVENQ-SDRFKIERLEAIIPTYIITYCP----SGTDKCYY  358
             + D    Q FV    + + F ++     FKIE+       Y   +CP    SG  KC  
Sbjct  121  GEFDHERKQYFVVAGPKPEGFGQDSLKSFFKIEKSGE--DAYKFVFCPRTCDSGNPKCSD  178

Query  357  VGREYDQSIKSTRLALSDFPFVLLFKKTSL  268
            VG   D+ +   RLALSD PF+++FKK ++
Sbjct  179  VGIFIDE-LGVRRLALSDKPFLVMFKKANV  207



>emb|CDX83886.1| BnaC08g17590D [Brassica napus]
Length=195

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 86/196 (44%), Gaps = 31/196 (16%)
 Frame = -3

Query  825  HRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVI  646
            HR  T +  +     PV D  G  L+ G  Y I  +  G G G    +  ++T CP  VI
Sbjct  17   HRGATTEAAVE----PVTDIYGQRLRAGTKYYILPVVRGRGGGLTMSKAENKT-CPKSVI  71

Query  645  SWLY----ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQD  481
               +      P+  +P+D K+  +  ST L+FKF        S    W + + D  T Q 
Sbjct  72   QERFEVSNGMPLTFSPSD-KSKVIRVSTDLNFKF--------SATSIWNLDNVDEKTNQW  122

Query  480  FVRSDEFVENQSDR------FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--  325
            F+ +   VE    R      FKI++ E     Y I +CPS  D C  + R+    ++   
Sbjct  123  FIGTCG-VEGNPGRTTVGNWFKIDKYE---DHYKILFCPSVCDICRVMCRDVGVFVQDGI  178

Query  324  TRLALSDFPFVLLFKK  277
             RL LSD P  ++FK+
Sbjct  179  RRLVLSDVPLKVMFKR  194



>gb|AAV41232.1| putative 21 kDa trypsin inhibitor [Theobroma grandiflorum]
Length=206

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 81/163 (50%), Gaps = 12/163 (7%)
 Frame = -3

Query  792  SSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVIS----WLYADP  625
            ++ +PV+D+DGD LQVG  Y + S  WGAG G + L       CP  V+      +   P
Sbjct  26   AANSPVLDTDGDDLQVGVQYYVVSSIWGAGGGGLDLGRAIGQSCPEIVVQRQSDLVLGTP  85

Query  624  VVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDE-----  463
            V+ + AD K   V  ST ++ +F  + + LCS +  W +  +D+  G+ +V +D      
Sbjct  86   VIFSNADSKDGVVRVSTDINIEFVPIRDRLCSTSTVWKLDNYDNSAGKWWVTTDGGEGGC  145

Query  462  FVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQS  334
                 + RFKIE++  I   Y +  CPS  + C  +  +  +S
Sbjct  146  GRSRLTSRFKIEKVGRI--GYKLRLCPSVCESCITLSSDIGKS  186



>gb|AAN15685.1| putative trypsin inhibitor [Arabidopsis thaliana]
Length=215

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 95/210 (45%), Gaps = 22/210 (10%)
 Frame = -3

Query  849  TRATLNPIHRLRTADVPIASSGA--PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWR  676
            T  T+NP   L  A   + +S A   VVD DG+A+     Y +  +  G G G + L  R
Sbjct  4    TTKTMNPKFYLVLALTAVLASNAYGAVVDIDGNAM-FHESYYVLPVIRGRGGG-LTLAGR  61

Query  675  SETKCPSDVISWL----YADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV  508
                CP D++          PV  +    K   V ES  L+ + +V    +C  + YW V
Sbjct  62   GGQPCPYDIVQESSEVDEGIPVKFSNWRLKVAFVPESQNLNIETDVGAT-ICIQSTYWRV  120

Query  507  -QHDSGTGQDFV----RSDEFVENQ-SDRFKIERLEAIIPTYIITYCP----SGTDKCYY  358
             + D    Q FV    + + F ++     FKIE+       Y   +CP    SG  KC  
Sbjct  121  GEFDHERRQYFVVAGPKPEGFGQDSLKSFFKIEKSGE--DAYKFVFCPRTCDSGNPKCSD  178

Query  357  VGREYDQSIKSTRLALSDFPFVLLFKKTSL  268
            VG   D+ +   RLALSD PF+++FKK ++
Sbjct  179  VGIFIDE-LGVRRLALSDKPFLVMFKKANV  207



>emb|CAC19831.1| hypothetical protein [Avicennia marina]
Length=202

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 76/161 (47%), Gaps = 15/161 (9%)
 Frame = -3

Query  858  PHPTRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEW  679
            PH   +    I  + +  +  A++   V+D +G+ LQ G  Y + S  WGAG G V L  
Sbjct  5    PHFLFSLCLIIFSICSNSLLCAAAEEAVLDIEGNELQAGSKYYMVSAIWGAGGGGVTLRL  64

Query  678  RSETKCP-------SDVISWLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNL  520
                +CP       SD+ + L   PV   PA+ + T V  ST L+ KF V  +  C+ + 
Sbjct  65   TGNDRCPVTVGQEGSDLRNGL---PVSFQPANSEETVVRVSTQLNIKFEV--SVPCANST  119

Query  519  YWGV-QHDSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTY  400
             W V + D+ T   F++ +   E   D F+IE++  +   Y
Sbjct  120  VWRVGRLDAWTRTSFIQIEG--EPGFDWFEIEKVSELANIY  158



>gb|AEK26927.1| Kunitz-type trypsin inhibitor B4 [Populus nigra]
Length=211

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 87/202 (43%), Gaps = 24/202 (12%)
 Frame = -3

Query  828  IHRLRTADVPIASSGA---PVVDSDGDALQVG-GVYNITSITWGAGAGEVKLEWRSETKC  661
            +  L    +P  ++GA   PV+D  G  L+ G   Y+I  +  G G G +         C
Sbjct  15   LFALAAKPLPRVAAGAAPEPVLDIAGKVLRTGTNYYDILPVERGRGGG-ITFAITGHKSC  73

Query  660  PSDVISWLYAD----PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQ-HDS  496
            P DV+   Y D    P+   PA+ K   +  ST L+ KF    +  C+    W V+ +D 
Sbjct  74   PVDVMLEDYEDSDGLPLQFIPANRKKGVIRLSTDLNIKFPGPAS--CAATAVWKVEKYDK  131

Query  495  GTGQDF-----VRSDEFVENQSDRFKIERLEAIIPTYIITYCPS-GTDKCYYVGRE---Y  343
             T Q F     V  +   E   + FKIE+       Y + +CP+   D C  + ++   Y
Sbjct  132  LTSQMFISTSGVEGNPGPETVDNWFKIEKYGN---DYKLVFCPTVCNDHCKVLCKDIGIY  188

Query  342  DQSIKSTRLALSDFPFVLLFKK  277
                   RLALSD P  + FKK
Sbjct  189  VDKEGFKRLALSDVPLKVKFKK  210



>gb|AAV41231.1| putative 21 kDa trypsin inhibitor [Theobroma cacao]
Length=221

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 88/188 (47%), Gaps = 17/188 (9%)
 Frame = -3

Query  792  SSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWL----YADP  625
            ++ +P++D+DGD LQ G  Y + S   GAG G + LE      CP  V+          P
Sbjct  26   AANSPLLDTDGDELQTGVQYYVLSSISGAGGGGLALEGVQVQSCPEIVVQRRSELDNGTP  85

Query  624  VVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQ-----DFVRSDE  463
            V+ + AD K   V  ST ++ +F  + + LCS +  W +  +D+  G+     D V+ + 
Sbjct  86   VIFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWLATDGVKGET  145

Query  462  FVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYY----VGREYDQSIKSTRLALSDFPF  295
                    FKIE+  + +  Y   +CPS  D C      +GR  D      RLA SD  +
Sbjct  146  GPNTLCSWFKIEK--SGVLGYKFRFCPSACDSCTTLCSDIGRHSDDD-GQIRLAFSDNGW  202

Query  294  VLLFKKTS  271
              +FKK S
Sbjct  203  AWMFKKAS  210



>ref|XP_006441465.1| hypothetical protein CICLE_v10022129mg [Citrus clementina]
 gb|ESR54705.1| hypothetical protein CICLE_v10022129mg [Citrus clementina]
Length=223

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 95/203 (47%), Gaps = 27/203 (13%)
 Frame = -3

Query  834  NPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPS  655
            N +  L T+ VP      P++D  G+ ++    Y I S  WGAG G V L       CP 
Sbjct  19   NSLLVLGTSSVP-----EPLLDVHGNKVESTLKYYIVSAIWGAGGGGVSLHGGRNGYCPL  73

Query  654  DVISWLYAD-----PVVITPADPKATDVIESTFLSFKFNVVTNF--LCSGNLYWGV-QHD  499
            DVI  L +D      + ++P +  +T V EST L+ +F+V+ +    C+    W V  +D
Sbjct  74   DVIQ-LPSDMQNGIELTLSPYN-NSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYD  131

Query  498  SGTGQDFVRSDEF-----VENQSDRFKIERLEAIIPTYIITYCPSGTDKCYY----VGRE  346
            + +G+ F+ +         E   + FK+E++      Y I +CPS  + C      VGR 
Sbjct  132  AASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGIYKIVHCPSVCESCVKLCNNVGRS  191

Query  345  YDQSIKSTRLALSD---FPFVLL  286
            ++  ++   L   D   FP VL+
Sbjct  192  FEDGVRRLVLVRDDEPAFPVVLI  214



>ref|XP_009127987.1| PREDICTED: alpha-amylase/subtilisin inhibitor-like [Brassica 
rapa]
Length=204

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 61/199 (31%), Positives = 91/199 (46%), Gaps = 18/199 (9%)
 Frame = -3

Query  837  LNPIH----RLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSE  670
            +NP+      L    V  AS G PV+D +GD +  G  Y +  I     AG + L  R  
Sbjct  1    MNPMFYFLLALTAVLVVTASPGEPVLDINGDIIFDGSYYVLPRIF--GPAGGLTLSPRGG  58

Query  669  TKCPSDVISWLYAD-----PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQ  505
              CP   I   Y++     PV  +    K   V EST L+ + +V    +C  + YW V 
Sbjct  59   NNCPL-YIGQEYSEVKRGIPVRFSDWRTKVAFVPESTNLNIEMDVKAT-ICVQSTYWYVP  116

Query  504  H-DSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIK  328
              D   G  F+ +    +  +D F+I+++E  I  Y I +C +G D C  VG   D+   
Sbjct  117  APDMVFGAAFIAAGP--KPSNDFFQIKKIEDSIGGYKIVFCFNGED-CVDVGIFVDKH-G  172

Query  327  STRLALSDFPFVLLFKKTS  271
              RLAL+  PF ++F + S
Sbjct  173  VRRLALASTPFEVVFVRAS  191



>emb|CDY19181.1| BnaC05g13820D [Brassica napus]
Length=192

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 81/179 (45%), Gaps = 23/179 (13%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVIT  613
            PV D DG  L  G  Y I  +  G G G    +  ++T CP  VI   Y      P+  +
Sbjct  25   PVTDIDGGRLTSGTKYYILPVLRGRGGGLTMSKPENKT-CPKSVIQDQYEISQGLPLEFS  83

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVENQS----  445
            P+D  +  +  ST L+FKF       C+ +++    +D  T Q FV +     N      
Sbjct  84   PSD-NSRIIRVSTDLNFKF-------CAASVWNLDNYDEKTNQWFVTACGVEGNPGQATV  135

Query  444  -DRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFKK  277
             + FKIE+ E     Y I +CP+  + C  + R+    ++    RL LSD P  ++FKK
Sbjct  136  DNWFKIEKYE---DDYKIVFCPTVCNFCKVMCRDVGVFVQDGMRRLVLSDVPLKVMFKK  191



>emb|CDY30911.1| BnaC09g14950D [Brassica napus]
Length=197

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 84/200 (42%), Gaps = 14/200 (7%)
 Frame = -3

Query  837  LNPIHRLRTADVPIAS---SGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSET  667
            +NP+    T    +A+   +G PV+DS G  +  G  Y I  I +GA  G + L  R + 
Sbjct  1    MNPMFYFLTLTAVLAATANAGGPVLDSKGHFIFSGSYYVIPRI-FGAAGGGLTLVPRGDK  59

Query  666  KCP----SDVISWLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHD  499
            +CP     + +      PV  +    +   V+ES  L+   +         N +W    D
Sbjct  60   QCPLYVGHETLEVKMGIPVKFSNWMSRVGFVLESENLNIMMDAKATTCAQSNYWWVAPSD  119

Query  498  SGTGQDFVRSDEFVENQSD----RFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI  331
                  F+ +    + + D     F+I++    +  Y I YCP G D C  VG   D++ 
Sbjct  120  KDRKTWFIAAGPKPKTKEDSSMTSFQIKKTGDSLKGYKIVYCPKGKD-CINVGIVKDKN-  177

Query  330  KSTRLALSDFPFVLLFKKTS  271
               RL LS   F ++F K +
Sbjct  178  GVRRLVLSSKLFPVVFVKAT  197



>gb|AIT42216.1| Kunitz-type inhibitor D, partial [Solanum tuberosum]
Length=203

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 80/184 (43%), Gaps = 26/184 (14%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLE---WRSETKCPSDVISWL----YADPVV  619
            + D +G+ L     Y I S  WGAG G V+L     + +  CP+ V+           V 
Sbjct  20   IRDIEGNPLNKNSRYFIVSAIWGAGGGGVRLANLGNQGQNDCPTSVVQSRNDLDNGIAVY  79

Query  618  ITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQ---------HDSGTGQDFVRSD  466
            ITP DPK   + E + ++ KF  + +  CS  + W V          +   TG+  + S 
Sbjct  80   ITPHDPKYDIISEMSTVNIKF-YLDSPTCSHFIMWMVDDFPKPVDQLYTISTGEQLINS-  137

Query  465  EFVENQSDRFKIERLEAIIPTYIITYCPSGTD-KCYYVGREYDQSIKSTRLALSDFPFVL  289
                N ++RF+I+ L     TY + +CP G    C  VG   +      RL L++     
Sbjct  138  ---VNLNNRFQIKSLGG--STYKLVFCPYGEKFTCQNVGIADENGY--NRLVLTENAKAF  190

Query  288  LFKK  277
            +FKK
Sbjct  191  VFKK  194



>ref|XP_010471385.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=208

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/206 (28%), Positives = 95/206 (46%), Gaps = 22/206 (11%)
 Frame = -3

Query  837  LNPIHRLRTADVPIASSGA--PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK  664
            +NP      A   + ++ A   V+D DG+ +   G Y +  +  G G G + L  R    
Sbjct  1    MNPTFCFVLALTAVLATNAYGAVLDIDGNII-FRGSYYVLPVIRGRGGG-LTLSGRGGEL  58

Query  663  CPSDVISWLY----ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHD  499
            CP D++         +PV  +   P+   V ES  L+ + +V    +C  + YW V + D
Sbjct  59   CPLDIVQESQEVDEGNPVKFSNWRPRVAFVPESQDLNIQTDVEAT-ICFQSTYWRVGEFD  117

Query  498  SGTGQDFV----RSDEFVENQSDRF-KIERLEAIIPTYIITYCPS----GTDKCYYVGRE  346
                Q F+    + + F ++ S  F KIE+  +    Y   +CPS    G  KC  +G  
Sbjct  118  EERKQYFIVAGLKPEGFRQDSSKSFFKIEK--SGDDAYKFVFCPSTCDSGCPKCSDIGI-  174

Query  345  YDQSIKSTRLALSDFPFVLLFKKTSL  268
            ++  +   RLAL D PF+++FKK ++
Sbjct  175  FEDELGVRRLALRDEPFLVMFKKANV  200



>gb|AFL91234.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=161

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 76/169 (45%), Gaps = 20/169 (12%)
 Frame = -3

Query  744  GGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVITPADPKATDVIES  577
            G  Y I  +  G G G      R+E+ CP DV+   +      P+  TP DPK   + ES
Sbjct  1    GTEYYILPVFRGRGGGVTLAPTRNES-CPLDVVQEGFELDNGLPLTFTPVDPKKGVIRES  59

Query  576  TFLSFKFNVVTNFLCSG----NLYWGVQHDSGTGQDFVRSDEFVENQSDRFKIERLEAII  409
            T L+  F+  +  + S       Y G +  SG G       E + N    FKIE+ E   
Sbjct  60   TDLNIIFSASSICIQSNVWMLEEYEGQRIISGRGTSGNPGGETISNW---FKIEKYEN--  114

Query  408  PTYIITYCPSGTDKCYYV----GREYDQSIKSTRLALSDFPFVLLFKKT  274
              Y + YCP+  D C  V    G  + ++  S RLA+SD PF + F+K 
Sbjct  115  -DYKLVYCPTVCDLCRPVCGDIGVVFAEN-GSRRLAISDVPFKIKFRKA  161



>emb|CDP20822.1| unnamed protein product [Coffea canephora]
Length=204

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 82/180 (46%), Gaps = 17/180 (9%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVITP  610
            V D DG  + VG  Y I  +  G G G       +ET CP DVI   +      P+  TP
Sbjct  30   VRDIDGKEVIVGAHYYILPVIRGRGGGLTLGSADNET-CPLDVIQEQFEVKRGLPLTFTP  88

Query  609  ADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRS-----DEFVENQS  445
             +     V  ST L+ KF   T  +C  +  W ++ D+   Q  + S     +   E  S
Sbjct  89   VNTTKGVVPVSTDLNIKFFAAT--ICVQSTVWKLEFDADISQYVIVSGGIEGNPGRETIS  146

Query  444  DRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFKKTS  271
            + FKIE+ +     Y + YCP+  + C  + R+    +++   RLALSD PF ++ KK  
Sbjct  147  NWFKIEKYDQ---DYKLVYCPTVCNFCKVICRDVGIFVQNGRRRLALSDVPFRVVVKKAE  203



>ref|XP_009770904.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=223

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 77/178 (43%), Gaps = 23/178 (13%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK------CPSDVISWLY----A  631
            PV D+ G+ L     Y +     GAG G V  +  + T+      CP  V+         
Sbjct  33   PVRDNQGEILTSDSRYFMLP---GAGGGGVTRDLGNGTETSSSFVCPFQVVQSRKDLDPG  89

Query  630  DPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVE-  454
             PV + P + + T + EST L+ KF +   F C+ NL W V+   GT   F  S   VE 
Sbjct  90   MPVFLKPLNNQVTKITESTSLNIKFYLNPTFACADNLVWMVEGFPGTQSPFFLSTNGVEG  149

Query  453  ---NQSDRFKIERLEAIIPT---YIITYCPSGTDKCYYVGREYDQSIKSTRLALSDFP  298
                 +  F+I++     PT   Y + +CP G   C  +G E     +  RLAL+  P
Sbjct  150  DPLQMTSWFQIKKFND-HPTDYSYKLVFCPWGESFCSDIGIEVVD--RQRRLALTLSP  204



>emb|CDX96746.1| BnaA08g22890D [Brassica napus]
Length=195

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 86/196 (44%), Gaps = 31/196 (16%)
 Frame = -3

Query  825  HRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVI  646
            HR  T +  +     PV D  G  L+ G  Y I  +  G G G    +  ++T CP  VI
Sbjct  17   HRGATTEAAVE----PVTDIYGQRLRTGTKYYILPVFRGRGGGLTMSKAENKT-CPRSVI  71

Query  645  SWLY----ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQD  481
               +      P+  +P+D K+  +  ST L+FKF        S    W + + D  T Q 
Sbjct  72   QERFEVSNGLPLTFSPSD-KSKVIRVSTDLNFKF--------SATSIWNLDNVDEKTNQW  122

Query  480  FVRSDEFVENQSDR------FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--  325
            F+ +   VE    R      FKI++ E     Y I +CPS  D C  + R+    ++   
Sbjct  123  FIGTCG-VEGNPGRTTVGNWFKIDKYE---DHYKIVFCPSVCDICKVMCRDVGVFVQDGI  178

Query  324  TRLALSDFPFVLLFKK  277
             RL LSD P  ++FK+
Sbjct  179  RRLVLSDVPLKVMFKR  194



>emb|CDY26209.1| BnaA06g12080D [Brassica napus]
Length=192

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 81/179 (45%), Gaps = 23/179 (13%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVIT  613
            PV D DG  L  G  Y I  +  G G G    +  ++T CP  VI   Y      P+  +
Sbjct  25   PVTDIDGGRLTSGTKYYILPVLRGRGGGLTMSKPENKT-CPKSVIQDQYEVSKGLPLEFS  83

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVENQS----  445
            P+D  +  +  ST L+FKF       C+ +++    +D  T Q FV +     N      
Sbjct  84   PSD-NSRIIRVSTDLNFKF-------CAASVWNLDNYDEMTNQWFVTACGVAGNPGQATV  135

Query  444  -DRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFKK  277
             + FKIE+ +     Y I +CP+  + C  + R+    ++    RL LSD P  ++FKK
Sbjct  136  DNWFKIEKYQ---DDYKIVFCPTVCNFCKVMCRDVGVFVQDGMRRLVLSDVPLKVMFKK  191



>gb|KCW48670.1| hypothetical protein EUGRSUZ_K02326 [Eucalyptus grandis]
Length=203

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 86/187 (46%), Gaps = 19/187 (10%)
 Frame = -3

Query  801  PIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----  634
            P  ++ +PV+D+DG  LQ G  Y+I  +  G G G      RS   CP  V+        
Sbjct  23   PSNAASSPVLDTDGHELQTGVNYHILPVLRGRGGGLTLGASRS-GNCPLAVVQEQQELSD  81

Query  633  ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEFV  457
              P   +P D  +T +  ST L+  F+  T  +C  +  W +   D    Q FV S   +
Sbjct  82   GLPAKFSPVDGNST-IRLSTDLNVWFDAAT--ICVQSTVWRLAAFDEEVKQYFVESGGVL  138

Query  456  -----ENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKST--RLALSDFP  298
                 E  S+ FKIE+++     Y   +CP+  D C  + R+    +  +  RLALSD P
Sbjct  139  GNPGRETVSNWFKIEKVDE---DYNFRFCPTVCDTCRVICRDVGIYVDGSTRRLALSDEP  195

Query  297  FVLLFKK  277
            F + F+K
Sbjct  196  FRVKFRK  202



>ref|XP_009401850.1| PREDICTED: miraculin-like [Musa acuminata subsp. malaccensis]
Length=203

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 82/185 (44%), Gaps = 22/185 (12%)
 Frame = -3

Query  783  APVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCP-------SDVISWLYADP  625
            A V D+D  +L+ G  Y +  +  G G G + L  RS   CP       S+V   L   P
Sbjct  22   ASVRDTDRRSLRPGHEYYVLPLIRGHGGG-LSLAARSNDTCPLAVAQESSEVSDGL---P  77

Query  624  VVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFV-----RSDEF  460
            +  +P +PK   V  ST L+  F   T  +C  +  W +     TG+ +V     + D  
Sbjct  78   LTFSPVNPKDKYVKMSTDLNVWFAAET--ICVQSTVWRLGDAEATGRRYVVTGGLKGDPG  135

Query  459  VENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTR--LALSDFPFVLL  286
            +   S+ FKIER       Y + +CPS    C  V  +    ++  +  L LSD PF ++
Sbjct  136  LATVSNWFKIERYGE--SDYKLVHCPSVCRFCKVVCGDVGVFVEGGKRWLGLSDEPFPVM  193

Query  285  FKKTS  271
            FK  +
Sbjct  194  FKNAA  198



>ref|XP_010537532.1| PREDICTED: miraculin [Tarenaya hassleriana]
Length=202

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 93/205 (45%), Gaps = 20/205 (10%)
 Frame = -3

Query  852  PTRATL-NPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWR  676
            PT A L + +       V I ++  PV D  G  ++ G  Y I  +  G G G       
Sbjct  4    PTMAQLLSLLVTFTVVSVAIDAASEPVRDIRGKPVRAGLDYYILPVVRGRGGGLTMASAG  63

Query  675  SETKCPSDVISWLY----ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV  508
            ++T CP  V+   +      P+  +P+D K+  V  ST  + KF+  T  +C  +  W +
Sbjct  64   NKT-CPMSVVQDKFEVSPGFPLTFSPSD-KSRIVGISTDQNVKFSAAT--ICVQSTVWKL  119

Query  507  QH-DSGTGQDFV-----RSDEFVENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE  346
            +  D  T Q FV       +   E  S+ FKIE+L      Y + +CP+  + C  + R+
Sbjct  120  ESFDETTKQWFVTTGGVEGNPGRETISNWFKIEKLGN---DYKLVFCPTVCNFCKVICRD  176

Query  345  YDQSIK--STRLALSDFPFVLLFKK  277
                ++    RLALSD P  ++FK+
Sbjct  177  IGVFVQDGKRRLALSDVPLKVMFKR  201



>ref|XP_010037029.1| PREDICTED: miraculin-like [Eucalyptus grandis]
Length=262

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 86/187 (46%), Gaps = 19/187 (10%)
 Frame = -3

Query  801  PIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----  634
            P  ++ +PV+D+DG  LQ G  Y+I  +  G G G      RS   CP  V+        
Sbjct  82   PSNAASSPVLDTDGHELQTGVNYHILPVLRGRGGGLTLGASRS-GNCPLAVVQEQQELSD  140

Query  633  ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEFV  457
              P   +P D  +T +  ST L+  F+  T  +C  +  W +   D    Q FV S   +
Sbjct  141  GLPAKFSPVDGNST-IRLSTDLNVWFDAAT--ICVQSTVWRLAAFDEEVKQYFVESGGVL  197

Query  456  -----ENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKST--RLALSDFP  298
                 E  S+ FKIE+++     Y   +CP+  D C  + R+    +  +  RLALSD P
Sbjct  198  GNPGRETVSNWFKIEKVDE---DYNFRFCPTVCDTCRVICRDVGIYVDGSTRRLALSDEP  254

Query  297  FVLLFKK  277
            F + F+K
Sbjct  255  FRVKFRK  261



>gb|AIT42166.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=220

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 70/162 (43%), Gaps = 13/162 (8%)
 Frame = -3

Query  849  TRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL--EWR  676
            T  + NPI+  R + VP      PV+D++G  L     Y I S  WGA  G+V L     
Sbjct  21   TFTSQNPINLPRESPVP-----KPVLDTNGKKLNPNSSYRIISTFWGALGGDVYLGKSPN  75

Query  675  SETKCPSDVISWLYADPVVITPAD--PKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH  502
            S+  CP  V  +        TP    P +T++ E   L+ +FN+ T  LC     W V +
Sbjct  76   SDAPCPDGVFRYNSHVGPNGTPVRFIPLSTNIFEDQLLNIQFNIPTVKLCVSYTIWKVGN  135

Query  501  DSGTGQDFVRSDEFVENQSDR--FKIERLEAIIPTYIITYCP  382
             +   +  +        Q+D   FKI +   +   Y + YCP
Sbjct  136  LNAHLRTMLLETGGTIGQADSSYFKIVKSSKL--GYNLLYCP  175



>ref|XP_010683194.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=208

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 51/191 (27%), Positives = 83/191 (43%), Gaps = 17/191 (9%)
 Frame = -3

Query  801  PIASSGA--PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD  628
            P+ S+ A   V+D +G  LQ    Y I  +  G G G       +   CP   ++   ++
Sbjct  20   PLTSTAANIAVLDINGRPLQARSNYYILPVIRGRGGGLRMTPKNATQLCPLAYVAQEGSE  79

Query  627  -----PVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDE  463
                 P+   P +PK   +  ST L+F F+  T  +C  +  W +  D  TG+ +V    
Sbjct  80   LANGLPLKFYPVNPKDKTISLSTDLNFVFDAAT--ICVQSTQWRLAFDEVTGRRYVGFGG  137

Query  462  FVENQ-----SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI-KSTR--LALS  307
             + N      S+ FKIE+ E     Y I +CP   + C     E    + K  R  L ++
Sbjct  138  EIGNPGGNTVSNWFKIEKAETGKYDYKIVFCPGVCNFCKVACGEIGVFVEKDGRRLLGIN  197

Query  306  DFPFVLLFKKT  274
            + P +++FKK 
Sbjct  198  NQPLLVMFKKA  208



>ref|XP_011035401.1| PREDICTED: miraculin-like [Populus euphratica]
Length=215

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/182 (26%), Positives = 85/182 (47%), Gaps = 22/182 (12%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVI----SWLYADPVVITP  610
            V+D+DG+ L+ G  Y I  +  G G G + +    +  CP DV+          P+  TP
Sbjct  33   VLDTDGEKLRAGTEYYILPVFRGRGGG-LTMASTGDEACPLDVVQDPLEISKGLPLTFTP  91

Query  609  ADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDF------VRSDEFVENQ  448
             +PK   +  ST L+ KF+  +  +C  +  W +Q    +   +      V  +  +E  
Sbjct  92   VNPKKGVIRVSTDLNIKFSASS--ICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGIETI  149

Query  447  SDRFKIERLEAIIPTYIITYCPSGTDKCYYVGRE-----YDQSIKSTRLALSDFPFVLLF  283
            ++ FKIE+       Y + +CP+  D C  + R+     +D  +++  L+ +  PF++ F
Sbjct  150  TNWFKIEKAG---DDYKLVFCPTVCD-CGALCRDIGIYIHDNGVRTLSLSDALQPFLVNF  205

Query  282  KK  277
            KK
Sbjct  206  KK  207



>ref|XP_007210537.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
 gb|EMJ11736.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
Length=202

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 73/162 (45%), Gaps = 16/162 (10%)
 Frame = -3

Query  783  APVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVI  616
            +PV+D  G  L+ G  Y I  +  G G G       + T CP DV+   +      P+  
Sbjct  28   SPVLDITGKKLRTGTDYYILPVIRGRGGGLTLASTSNTTSCPLDVVQEQHEVSNGLPLTF  87

Query  615  TPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEFVEN----  451
            +P +PK   V  ST  + KF+  T  +C  +  W + + D  TGQ FV S     N    
Sbjct  88   SPVNPKKGVVRVSTDHNIKFSAAT--ICVQSTMWKLDKFDEQTGQWFVTSGGVEGNPGRQ  145

Query  450  -QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIK  328
              S+ FKIE+ +     Y + +CP+  + C  V  E+   +K
Sbjct  146  TTSNWFKIEKYDE---DYKLVFCPTVCNFC-KVASEWQCPVK  183



>ref|XP_006360287.1| PREDICTED: 21 kDa seed protein-like [Solanum tuberosum]
Length=217

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 79/184 (43%), Gaps = 26/184 (14%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLE---WRSETKCPSDVISWL----YADPVV  619
            + D +G+ L     Y I S  WGAG G V+L     + +  CP+ V+           V 
Sbjct  34   IRDIEGNPLNKNSRYFIVSAIWGAGGGGVRLANLGNQGQNDCPTSVVQSRNDLDNGVAVY  93

Query  618  ITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQ---------HDSGTGQDFVRSD  466
            ITP DPK   + E + ++ KF  + +  CS    W V          +   TG+  + S 
Sbjct  94   ITPRDPKYDIISEMSTVNIKF-YLDSPTCSHFTMWMVDNFPKPTDQLYTISTGEQLIDS-  151

Query  465  EFVENQSDRFKIERLEAIIPTYIITYCPSGTD-KCYYVGREYDQSIKSTRLALSDFPFVL  289
                N ++RF+I+ L     TY + +CP G    C  VG   +      RL L++     
Sbjct  152  ---MNLNNRFQIKSLGG--STYKLVFCPHGEKFTCQNVGIADENGY--NRLVLTENAKAF  204

Query  288  LFKK  277
            +FKK
Sbjct  205  VFKK  208



>gb|AEK31202.1| miraculin-like protein 2 [Murraya koenigii]
Length=173

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 75/152 (49%), Gaps = 15/152 (10%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD-----PVVI  616
            P+VD  G+ ++    Y I S  WGAG G V L       CP DVI  L +D      + +
Sbjct  3    PLVDVYGNKVESTLEYYIVSAIWGAGGGGVSLHGGRNGYCPLDVIQ-LSSDMENGIRLTL  61

Query  615  TPADPKATDVIESTFLSFKFNVVTNF--LCSGNLYWGV-QHDSGTGQDFVRSDEF-----  460
            TP D  +T V EST L+ +F+V+ +    C+    W V  +D+ +G+ F+ +        
Sbjct  62   TPYD-NSTIVRESTDLNLRFSVLLSGREYCNEQPLWKVDNYDASSGKWFITTGGLDGHPG  120

Query  459  VENQSDRFKIERLEAIIPTYIITYCPSGTDKC  364
             E   + FK E+L  ++  Y I +CPS  + C
Sbjct  121  AETLLNWFKFEKLGTLLSAYKIVHCPSVCESC  152



>ref|XP_010042449.1| PREDICTED: miraculin-like [Eucalyptus grandis]
Length=262

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 86/187 (46%), Gaps = 19/187 (10%)
 Frame = -3

Query  801  PIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----  634
            P  ++ +PV+D+DG  LQ G  Y+I  +  G G G      RS   CP  V+        
Sbjct  82   PSNAASSPVLDTDGHELQTGVNYHILPVLRGRGGGLTLGASRS-GNCPLAVVQEQQELSD  140

Query  633  ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEFV  457
              P   +P D  +T +  ST L+  F+  T  +C  +  W +   D    Q F+ S   +
Sbjct  141  GLPAKFSPVDGNST-IRLSTDLNVWFDAAT--ICVQSTVWRLAAFDEEVKQYFIESGGVL  197

Query  456  -----ENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKST--RLALSDFP  298
                 E  S+ FKIE+++     Y   +CP+  D C  + R+    +  +  RLALSD P
Sbjct  198  GNPGRETVSNWFKIEKVDE---DYNFRFCPTVCDTCRVICRDVGIYVDGSTRRLALSDEP  254

Query  297  FVLLFKK  277
            F + F+K
Sbjct  255  FRVKFRK  261



>ref|XP_003620184.1| Pathogen-inducible trypsin-inhibitor-like protein [Medicago truncatula]
 gb|AES76402.1| Kunitz type trypsin inhibitor / miraculin [Medicago truncatula]
Length=204

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 83/185 (45%), Gaps = 12/185 (6%)
 Frame = -3

Query  798  IASSGAPVVDSDGDALQVGGVYNI---TSITWGAGAGEVKLEWRSETKCPSDVI--SWLY  634
            ++SS   VVD  G  L+    YN+      T       + L       CP DVI  S   
Sbjct  20   LSSSLEHVVDITGKNLRANAYYNVLLSMPYTNSRSPEGLGLSNNIGQPCPLDVIVVSRYQ  79

Query  633  ADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVE  454
            + P+  TP + K   +  S+ L+  F   ++      ++   + D+  G+ FV +D F+ 
Sbjct  80   SLPIRFTPLNLKKGVIRVSSDLNIMFRSNSSCPYHTTVWKLDRFDASKGKSFVTTDGFIG  139

Query  453  NQ-----SDRFKIER-LEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTRLALSDFPFV  292
            N      S+ FKIE+ +E     Y    CPS   +C  VG   D++  + RLALSD P+ 
Sbjct  140  NPGPQSISNWFKIEKYVEGYKLVYCPIVCPSCKHECKNVGLFEDEN-GNKRLALSDVPYQ  198

Query  291  LLFKK  277
            + F K
Sbjct  199  VKFVK  203



>emb|CDO98552.1| unnamed protein product [Coffea canephora]
Length=205

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 85/181 (47%), Gaps = 18/181 (10%)
 Frame = -3

Query  780  PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVI--SWLYAD--PVVIT  613
            PV+D  G  L+ G  Y I             L   + T CP +VI  ++ + D  P++ +
Sbjct  31   PVLDVAGKLLRAGVNYYILPAIIIGNDIGGGLTLANGT-CPPEVIQDNYEFTDGIPLIFS  89

Query  612  PADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFV-----RSDEFVEN  451
            P DPK   V  S+  + KF+  +   C+ +  W +   D+ TG+ FV       +   + 
Sbjct  90   PLDPKKGIVRVSSDTNVKFSSTSK--CAQSSVWKLSELDALTGKYFVGIGGVEGNPGPKT  147

Query  450  QSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFKK  277
             S  FKIE  +    +Y + +CPS    C  + ++     ++   RLALSD PF ++FK+
Sbjct  148  LSSWFKIETFDR---SYKLKFCPSVCKFCKVICKDIGIVFQNGKRRLALSDDPFKVIFKR  204

Query  276  T  274
            T
Sbjct  205  T  205



>sp|P13087.3|MIRA_SYNDU RecName: Full=Miraculin; Short=MIR; Flags: Precursor [Synsepalum 
dulcificum]
 dbj|BAA07603.1| miraculin precursor [Synsepalum dulcificum]
 dbj|BAH84844.1| miraculin [Synsepalum dulcificum]
Length=220

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 82/192 (43%), Gaps = 24/192 (13%)
 Frame = -3

Query  792  SSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK-----CPSDVISWL---  637
            S+  PV+D DG+ L+ G  Y I  +    G G   L   + T      CP  V+      
Sbjct  31   SAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGG---LTVSATTPNGTFVCPPRVVQTRKEV  87

Query  636  -YADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDF-----  478
             +  P+   P +PK   V  ST L+  F+       + +  W + ++D  TGQ F     
Sbjct  88   DHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGG  147

Query  477  VRSDEFVENQSDRFKIERLEAIIPTYIITYCP----SGTDKCYYVGREYDQSIKSTRLAL  310
            V+ +   E  S  FKIE        Y + +CP    S   KC  VG   DQ  +  RLAL
Sbjct  148  VKGNPGPETISSWFKIEEFCG-SGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRR-RLAL  205

Query  309  SDFPFVLLFKKT  274
            SD PF   F KT
Sbjct  206  SDKPFAFEFNKT  217



>gb|AFL91228.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 81/180 (45%), Gaps = 20/180 (11%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVITP  610
            V D DG+ +  G  Y I     G G G      R+E+ CP DV+   +      P+  TP
Sbjct  4    VRDIDGNLVXXGXEYYILPXFRGRGGGVTLAPTRNES-CPLDVVQEGFELDDGLPLTFTP  62

Query  609  ADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSG----TGQDFVRSDEFVENQSD  442
             DPK   + EST L+  F+  +  +C  +  W ++   G    +G+     +   E  S+
Sbjct  63   VDPKKGVIRESTDLNIIFSASS--ICIQSNVWMLEEYEGQRIISGRG-TAGNPGGETISN  119

Query  441  RFKIERLEAIIPTYIITYCPSGTDKCYYV----GREYDQSIKSTRLALSDFPFVLLFKKT  274
             FKIE+ E     Y + YCP+  D C  V    G  + ++  S  L + D PF + F+K 
Sbjct  120  WFKIEKYEN---GYKLVYCPTVCDLCRPVCGDIGVVFAEN-GSRXLXIXDVPFKIKFRKA  175



>emb|CDY45152.1| BnaA09g14400D [Brassica napus]
Length=197

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 83/200 (42%), Gaps = 14/200 (7%)
 Frame = -3

Query  837  LNPIHRLRTADVPIAS---SGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSET  667
            +NP+    T    +A+   +G PV+DS G  +  G  Y I  I +GA  G + L  R + 
Sbjct  1    MNPMFYFLTLTAVLAATANAGGPVLDSKGHHIFSGSYYVIPRI-FGAAGGGLTLVPRGDK  59

Query  666  KCP----SDVISWLYADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHD  499
            +CP     + +      PV  +    +   V ES  L+   +         N +W    D
Sbjct  60   QCPLYVGHETLEVKMGIPVKFSSWMSRVGFVPESENLNIMMDAKATTCSQSNYWWVAPSD  119

Query  498  SGTGQDFVRSDEFVENQSD----RFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSI  331
                  F+ +    + + D     F+I++    +  Y I YCP G D C  VG   D++ 
Sbjct  120  KDRKTWFIAAGPKPKTKEDSSMTSFQIKKTGDSLKGYKIVYCPKGKD-CINVGIVKDKN-  177

Query  330  KSTRLALSDFPFVLLFKKTS  271
               RL LS   F ++F K +
Sbjct  178  GVRRLVLSSKLFPVVFVKAT  197



>emb|CDY11118.1| BnaC06g23700D [Brassica napus]
Length=201

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 83/179 (46%), Gaps = 17/179 (9%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWL----YADPVVITP  610
            V+D DGD +   G Y +  +  G G G V L+ R    CP D++          PV  + 
Sbjct  23   VLDIDGDII-FRGSYYVLPVIRGRGGG-VTLQGRGGELCPYDIVQESSEVDEGIPVKFSN  80

Query  609  ADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEFVENQSDRFK  433
              P+   V ES  L+ + +V    +C  + YW V + D    + FV +    ++    F+
Sbjct  81   WRPRVAFVPESQDLNIEMDVEVT-ICIQSTYWRVGEFDEERKEYFVVAGR-QDSPKSFFQ  138

Query  432  IERLEAIIPTYIITYCP----SGTDKCYYVGREYDQSIKSTRLALSDFPFVLLFKKTSL  268
            IE+       Y   +CP    SG  +C  VG   D+ I   RLALS  PF+++FKK ++
Sbjct  139  IEKSGD---DYKFVFCPPACDSGRPRCRNVGIFVDE-IGVRRLALSSEPFLVMFKKANV  193



>gb|AAG52121.1|AC010556_3 putative trypsin inhibitor; 19671-20297 [Arabidopsis thaliana]
Length=208

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 93/206 (45%), Gaps = 22/206 (11%)
 Frame = -3

Query  837  LNPIHRLRTADVPIASSGA--PVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETK  664
            +NP   L  A   + +S A   VVD DG+A+     Y +  +  G G G + L  R    
Sbjct  1    MNPKFYLVLALTAVLASNAYGAVVDIDGNAM-FHESYYVLPVIRGRGGG-LTLAGRGGQP  58

Query  663  CPSDVISWL----YADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHD  499
            CP D++          PV  +    K   V ES  L+ + +V    +C  + YW V + D
Sbjct  59   CPYDIVQESSEVDEGIPVKFSNWRLKVAFVPESQNLNIETDVGAT-ICIQSTYWRVGEFD  117

Query  498  SGTGQDFV----RSDEFVENQ-SDRFKIERLEAIIPTYIITYCP----SGTDKCYYVGRE  346
                Q FV    + + F ++     FKIE+       Y   +CP    SG  KC  VG  
Sbjct  118  HERKQYFVVAGPKPEGFGQDSLKSFFKIEKSGE--DAYKFVFCPRTCDSGNPKCSDVGIF  175

Query  345  YDQSIKSTRLALSDFPFVLLFKKTSL  268
             D+ +   RLALSD PF+++FKK ++
Sbjct  176  IDE-LGVRRLALSDKPFLVMFKKANV  200



>ref|XP_009128561.1| PREDICTED: 21 kDa seed protein-like [Brassica rapa]
Length=212

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 51/192 (27%), Positives = 84/192 (44%), Gaps = 11/192 (6%)
 Frame = -3

Query  819  LRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCP---SDV  649
            L T     AS G PV+D +GD +  G  Y +  + +G   G + L  R +  CP     +
Sbjct  11   LTTVLAVTASPGQPVLDINGDIISDGSYY-VIPLNYGTKGGGLTLTPRGDNLCPLFIGQI  69

Query  648  ISWL-YADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVR  472
            IS +    PV  +    K   V +S  L+ + +V   F      +W    +S   + FV 
Sbjct  70   ISEVNRGIPVKFSNWRSKVQFVPQSENLNIEMDVKAKFCVRSTYWWVTAAESHFRKLFVT  129

Query  471  SD---EFVENQSDR-FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTRLALSD  304
            +    E  E+ S   F+I++   ++  Y + +C S  + C  VG   D+     RLAL  
Sbjct  130  AGPKPELGEDTSKSFFQIKKTGVLVNIYTVAFC-SKDNGCSDVGIFMDEH-GIRRLALGS  187

Query  303  FPFVLLFKKTSL  268
             P  ++F K ++
Sbjct  188  MPLPVMFMKATV  199



>gb|AFL91229.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=164

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 80/172 (47%), Gaps = 20/172 (12%)
 Frame = -3

Query  753  LQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVITPADPKATDV  586
            ++ G  Y    +  G G G      R+E+ CP DV+   +      P+  TP DPK   +
Sbjct  1    VRSGXEYYXLPVFXGRGGGVTLAPTRNES-CPLDVVQEGFELDDGLPLTFTPVDPKKGVI  59

Query  585  IESTFLSFKFNVVTNFLCSGNLYWGVQHDSG----TGQDFVRSDEFVENQSDRFKIERLE  418
             EST L+  F+  +  +C  +  W ++   G    +G+     +   E  S+ FKIE+ E
Sbjct  60   RESTDLNIIFSASS--ICIQSNVWMLEEYEGQRIISGRG-TAGNPGGETISNWFKIEKYE  116

Query  417  AIIPTYIITYCPSGTDKCYYV----GREYDQSIKSTRLALSDFPFVLLFKKT  274
                 Y + YCP+  D C  V    G  + ++  S RLA+SD PF + F+K 
Sbjct  117  N---GYKLVYCPTVCDLCRPVCGDIGVVFAEN-GSRRLAISDVPFKIKFRKA  164



>gb|AIT42155.1| Kunitz-type inhibitor A, partial [Solanum tuberosum]
Length=219

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/160 (27%), Positives = 68/160 (43%), Gaps = 9/160 (6%)
 Frame = -3

Query  849  TRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL--EWR  676
            T  + NPI+    + VP      PV+D++G  L     Y I S  WGA  G+V L     
Sbjct  20   TFTSQNPINLPSESPVP-----KPVLDTNGKKLNPNSSYRIISTFWGALGGDVYLGKSPN  74

Query  675  SETKCPSDVISWLYADPVVITPAD--PKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH  502
            S+  CP  V  +        TP    P +T++ E   L+ +FN+ T  LC     W V +
Sbjct  75   SDAPCPDGVFRYNSDVGPNGTPVRFIPLSTNIFEDQLLNIQFNIPTVKLCVSYTIWKVGN  134

Query  501  DSGTGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCP  382
             +   +  +        Q+D    + +++    Y + YCP
Sbjct  135  LNAHLKTMLLETGGTLGQTDSSYFKNVKSSKLGYNLLYCP  174



>ref|XP_010428240.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=210

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/200 (28%), Positives = 90/200 (45%), Gaps = 22/200 (11%)
 Frame = -3

Query  828  IHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDV  649
            +  L T      ++  PV+D+DGD +  GG Y +  +  G G G + L  R +  CP D+
Sbjct  9    LFALTTVLAATIANAQPVLDTDGDII-FGGSYYVLPVIRGQGGG-LTLAGRGDQPCPLDI  66

Query  648  ISWL----YADPVVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQHDSG----  493
            +          PV  +    K   V ES  L+ +  V    +C  + YW V  ++     
Sbjct  67   VQESSEVDEGIPVKFSNWRSKVGFVPESANLNIETEVAAT-ICVQSAYWWVDENAKFRVT  125

Query  492  TGQDFVRSDEFV-ENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKSTRL  316
             G    + DE V E+    F+I+ +      Y   +CP+G   C  VG   D++    RL
Sbjct  126  AGP---KPDELVKESYLSFFQIQNVYDHF--YQFAFCPTGPKSCSDVGVFVDEN-GVRRL  179

Query  315  ALS----DFPFVLLFKKTSL  268
            AL+    + PF+++FKK ++
Sbjct  180  ALTKRADNTPFLVMFKKANV  199



>ref|XP_010693983.1| PREDICTED: factor Xa inhibitor BuXI-like [Beta vulgaris subsp. 
vulgaris]
Length=198

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 82/181 (45%), Gaps = 26/181 (14%)
 Frame = -3

Query  783  APVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY--------AD  628
            A ++D+DGDAL+ GG Y I   + G G G         T CP      LY        + 
Sbjct  24   AVILDTDGDALRNGGQYYIIPRSLGFGGGLTLNSKAGNTPCP------LYITRENDETSP  77

Query  627  PVVITPADPKATDVIESTF-LSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRS--DEFV  457
             + +T A P    +I S+  +S  FN + N +C   L+W V  D  TGQ +V +      
Sbjct  78   GIAVTIASPARIGIITSSLPISIVFNDIPN-ICMQPLWWQVIPDGTTGQSYVATGGSGIP  136

Query  456  ENQSDRFKIERLEAIIPTYIITYCPSGTDKCYYVG-REYDQSIKSTRLALSDFPFVLLFK  280
             N ++ F IE +E  I  Y I     G+D+   VG  E D  +  T    +D P  ++F+
Sbjct  137  FNPTETFSIEPIEGNI--YKIRNG-VGSDQARDVGFFENDGLLGIT----NDIPLPVVFR  189

Query  279  K  277
            K
Sbjct  190  K  190



>gb|AAL60248.1|AF459083_1 putative Kunitz-type tuber invertase inhibitor precursor [Solanum 
tuberosum]
Length=207

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 74/158 (47%), Gaps = 21/158 (13%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWL-------YADPVV  619
            V D DG+ L++G  Y I +   G GA  V L+     +CP+ V+  +          PV+
Sbjct  42   VYDQDGNPLRIGERYIIKNPLLGGGA--VYLDNIGNLQCPNAVLQHMSIPQFLGKGTPVM  99

Query  618  -ITPADPKATDVIE-STFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVENQS  445
             +  ++    DV+   T +  KF V T+ LC     W V H     +  V +   V N++
Sbjct  100  FVRKSESDYGDVVRVMTGVYIKFFVKTSKLCVDETVWKVNH-----EQLVVTGGNVGNEN  154

Query  444  DRFKIERLEAII----PTYIITYCPSGTDKCYYVGREY  343
            D FKI++ + +I      Y + +CPS   +C  +GR +
Sbjct  155  DIFKIKKTDLVIRGMKNVYKLLHCPSHL-QCKNIGRNF  191



>ref|XP_007036748.1| 21 kDa seed protein, putative [Theobroma cacao]
 gb|EOY21249.1| 21 kDa seed protein, putative [Theobroma cacao]
Length=219

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 83/190 (44%), Gaps = 18/190 (9%)
 Frame = -3

Query  792  SSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWL----YADP  625
            ++  PV+D+DG+ L+ G  Y + S  W AG G + L       CP  V+       Y  P
Sbjct  26   ATNKPVLDTDGEELRTGVEYYVVSALWAAGGGGLALGRSRNQSCPDIVVQRRSELDYGIP  85

Query  624  VVITPADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQDFVRSDEFVENQ  448
            V+ +P  P    +  ST L  +F  + + LC     W +  +D  TG+ +V +     + 
Sbjct  86   VIFSPVKPNDVFIRVSTDLIIEFVPLRDSLCLTTAVWKLDDYDQSTGKWWVIAGRVAGDA  145

Query  447  S-----DRFKIERLEAIIPTYIITYCPSGTDKCYY----VGREYDQSIKSTRLALSDFPF  295
                  + FKIE+       Y  TYCPS  D C      +GR  D      RL LSD  +
Sbjct  146  GPHTFPNWFKIEKNGVF--GYKFTYCPSVCDSCTTLCSDIGRYEDNG--QIRLGLSDQGW  201

Query  294  VLLFKKTSLA  265
              +F K + A
Sbjct  202  PFVFTKATRA  211



>gb|AAL85640.1| trypsin inhibitor [Herrania albiflora]
 gb|AAL85641.1| trypsin inhibitor [Herrania sp. 'Columbia']
Length=154

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 71/148 (48%), Gaps = 12/148 (8%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVITP  610
            V+D+DGD LQ G  Y + S  WGAG G + L   S+  CP  V+          PV+ + 
Sbjct  1    VLDTDGDELQTGVEYYVVSAIWGAGGGGLALGRASDQSCPEIVVQRRSDLDDGTPVIFSN  60

Query  609  ADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQ-----DFVRSDEFVENQ  448
            AD +   V  ST L+ +F  + + LCS +  W +  +D+  G+     D V+ +      
Sbjct  61   ADSEDDVVRVSTDLNIEFVPIRDRLCSTSTVWKLDDYDNSAGKWWVTTDGVKGEPGARTL  120

Query  447  SDRFKIERLEAIIPTYIITYCPSGTDKC  364
            +  FKIE   A+   Y   +CPS  D C
Sbjct  121  TSWFKIESAGAL--GYKFRFCPSVCDSC  146



>gb|AFL91230.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=159

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 75/158 (47%), Gaps = 20/158 (13%)
 Frame = -3

Query  711  GAGAGEVKLEWRSETKCPSDVISWLY----ADPVVITPADPKATDVIESTFLSFKFNVVT  544
            G G G      R+E+ CP DV+   +      P+  TP DPK   + EST L+  F+  +
Sbjct  10   GRGGGVTLAPTRNES-CPLDVVQEGFELDDGLPLTFTPVDPKKGVIRESTDLNIIFSASS  68

Query  543  NFLCSGNLYWGVQHDSG----TGQDFVRSDEFVENQSDRFKIERLEAIIPTYIITYCPSG  376
              +C  +  W ++   G    +G+     +   E  S+ FKIE+ E     Y + YCP+ 
Sbjct  69   --ICIQSNVWMLEEYEGQRIISGRG-TAGNPGGETISNWFKIEKYEN---GYKLVYCPTV  122

Query  375  TDKCYYV----GREYDQSIKSTRLALSDFPFVLLFKKT  274
             D C  V    G  + ++  S RLA+SD PF + F+K 
Sbjct  123  CDLCRPVCGDIGVVFAEN-GSRRLAISDVPFKIKFRKA  159



>gb|AAL85656.1| trypsin inhibitor [Theobroma microcarpum]
Length=154

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 70/148 (47%), Gaps = 12/148 (8%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWL----YADPVVITP  610
            V+D+DGD L+ G  Y++ S  WGAG   + L   +   CP  V+       Y  PV+ + 
Sbjct  1    VLDTDGDELRAGVQYHVVSSIWGAGGSGLALGRATGQSCPEIVVQRRSDLDYGTPVIFSN  60

Query  609  ADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGV-QHDSGTGQ-----DFVRSDEFVENQ  448
            AD K   V  ST ++ +F  +    CS +  W V  +D+  G+     D VR +      
Sbjct  61   ADSKDGVVRVSTDINIEFVPIRGRPCSTSAVWKVDNYDNSAGKWWVTTDGVRGEPGFNTL  120

Query  447  SDRFKIERLEAIIPTYIITYCPSGTDKC  364
            +  F IE+   I  +Y  ++CPS  D C
Sbjct  121  TSWFMIEKAGVI--SYKFSFCPSVCDSC  146



>dbj|BAA82843.1| miraculin homologue [Solanum melongena]
Length=160

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/166 (29%), Positives = 75/166 (45%), Gaps = 19/166 (11%)
 Frame = -3

Query  762  GDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLYAD-----PVVITPADPK  598
            G  L+ G  Y I  +  G G G + ++      CP D +     +     P+  TP +PK
Sbjct  1    GKILRTGIDYYILPVVRGRGGG-LTMDSIGNKTCPLDAVVQEQEEVKQGLPLTFTPFNPK  59

Query  597  ATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFV-----RSDEFVENQSDRF  436
               + EST L+  F+   N +C     W + + D  TG+ F+     + +   E  S+ F
Sbjct  60   KGVIRESTDLNIIFS--ANSICVQTTQWKLDNFDETTGKYFITLGGNQGNPGRETISNWF  117

Query  435  KIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSD  304
            KIE+ E     Y + YCP+  D C  + ++    I+    RLALSD
Sbjct  118  KIEKFER---DYKLVYCPTVCDFCKVICKDIGIFIQDGVRRLALSD  160



>ref|XP_009110379.1| PREDICTED: miraculin-like [Brassica rapa]
Length=195

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 80/180 (44%), Gaps = 27/180 (15%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWLY----ADPVVITP  610
            V D  G  L+ G  Y I  +  G G G    +  ++T CP  VI   +      P+  +P
Sbjct  29   VTDIYGQRLRTGTKYYILPVVRGRGGGLTMSKAENKT-CPKSVIQERFEVSNGMPLTFSP  87

Query  609  ADPKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH-DSGTGQDFVRSDEFVENQSDR--  439
            +D K+  +  ST L+FKF        S    W + + D  T Q F+ +   VE    R  
Sbjct  88   SD-KSKVIRVSTDLNFKF--------SATSVWNLDNVDEKTNQWFIGTCG-VEGNPGRTT  137

Query  438  ----FKIERLEAIIPTYIITYCPSGTDKCYYVGREYDQSIKS--TRLALSDFPFVLLFKK  277
                FKI++ E     Y I +CPS  D C  + R+    ++    RL LSD P  ++FK+
Sbjct  138  VGNWFKIDKYE---DHYKIVFCPSVCDICRVMCRDVGVFVQDGIRRLVLSDVPLKVMFKR  194



>gb|AIT42159.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=220

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 70/162 (43%), Gaps = 13/162 (8%)
 Frame = -3

Query  849  TRATLNPIHRLRTADVPIASSGAPVVDSDGDALQVGGVYNITSITWGAGAGEVKL--EWR  676
            T  + NPI+    + VP+     PV+D++G  L     Y I S  WGA  G+V L     
Sbjct  21   TFTSQNPINLPSESPVPM-----PVLDTNGKKLNPNSSYRIISTFWGALGGDVYLGKSPN  75

Query  675  SETKCPSDVISWLYADPVVITPAD--PKATDVIESTFLSFKFNVVTNFLCSGNLYWGVQH  502
            S+  CP  V  +        TP    P +T++ E   L+ +FN+ T  LC     W V +
Sbjct  76   SDAPCPDGVFRYNSDVGPSGTPVRFIPLSTNIFEDQLLNIQFNIPTVKLCVSYTIWKVGN  135

Query  501  DSGTGQDFVRSDEFVENQSDR--FKIERLEAIIPTYIITYCP  382
             +   +  +        Q+D   FKI +   +   Y + YCP
Sbjct  136  LNAHLRTMLLETGGTIGQADSSYFKIVKSSKL--GYNLLYCP  175



>gb|AAL60247.1|AF459082_1 putative Kunitz-type tuber invertase inhibitor precursor [Solanum 
tuberosum]
Length=186

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 69/146 (47%), Gaps = 20/146 (14%)
 Frame = -3

Query  777  VVDSDGDALQVGGVYNITSITWGAGAGEVKLEWRSETKCPSDVISWL-------YADPVV  619
            V D DG+ L++G  Y I +   G GA  V L+     +CP+ V+  +          PV+
Sbjct  42   VYDQDGNPLRIGERYIIKNPLLGGGA--VYLDNIGNLQCPNAVLQHMSIPQFLGKGTPVM  99

Query  618  -ITPADPKATDVIE-STFLSFKFNVVTNFLCSGNLYWGVQHDSGTGQDFVRSDEFVENQS  445
             +  ++    DV+   T +  KF V T+ LC     W V H     +  V +   V N++
Sbjct  100  FVRKSESDYGDVVRVMTGVYIKFFVKTSKLCVDETVWKVNH-----EQLVVTGGNVGNEN  154

Query  444  DRFKIERLEAIIP----TYIITYCPS  379
            D FKI++ + +IP     Y + +CPS
Sbjct  155  DIFKIKKTDLVIPGMKNVYKLLHCPS  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2070268854280