BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15408_g1_i1 len=1945 path=[1997:0-1393 19:1394-1944]

Length=1945
                                                                      Score     E

ref|XP_009762581.1|  PREDICTED: subtilisin-like protease isoform X1     845   0.0      
ref|XP_009762584.1|  PREDICTED: subtilisin-like protease isoform X4     844   0.0      
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease                838   0.0      
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           835   0.0      
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease                825   0.0      
ref|XP_002320086.2|  subtilase family protein                           811   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011035007.1|  PREDICTED: subtilisin-like protease                796   0.0      
ref|XP_002511772.1|  Xylem serine proteinase 1 precursor, putative      780   0.0      Ricinus communis
emb|CDP08910.1|  unnamed protein product                                764   0.0      
ref|XP_011091250.1|  PREDICTED: subtilisin-like protease                762   0.0      
gb|KDP28707.1|  hypothetical protein JCGZ_14478                         757   0.0      
ref|XP_010255581.1|  PREDICTED: subtilisin-like protease                754   0.0      
ref|XP_007220042.1|  hypothetical protein PRUPE_ppa027143mg             749   0.0      
ref|XP_008232840.1|  PREDICTED: subtilisin-like protease                749   0.0      
gb|KHN13887.1|  Subtilisin-like protease                                745   0.0      
ref|XP_003551824.2|  PREDICTED: subtilisin-like protease-like           747   0.0      
ref|XP_007139243.1|  hypothetical protein PHAVU_008G013300g             744   0.0      
ref|XP_002272965.1|  PREDICTED: subtilisin-like protease                743   0.0      Vitis vinifera
gb|KHN13888.1|  Subtilisin-like protease                                740   0.0      
ref|XP_006574858.1|  PREDICTED: subtilisin-like protease-like iso...    739   0.0      
gb|KHN04600.1|  Subtilisin-like protease                                737   0.0      
gb|KHN27220.1|  Subtilisin-like protease                                738   0.0      
ref|XP_003528890.1|  PREDICTED: subtilisin-like protease-like iso...    737   0.0      
ref|XP_006490976.1|  PREDICTED: subtilisin-like protease-like           737   0.0      
ref|XP_010056250.1|  PREDICTED: subtilisin-like protease                736   0.0      
ref|XP_004308418.1|  PREDICTED: subtilisin-like protease-like           733   0.0      
ref|XP_006576383.1|  PREDICTED: subtilisin-like protease-like iso...    733   0.0      
ref|XP_004492670.1|  PREDICTED: subtilisin-like protease-like           733   0.0      
ref|XP_002272791.1|  PREDICTED: subtilisin-like protease                731   0.0      Vitis vinifera
ref|XP_006583358.1|  PREDICTED: subtilisin-like protease-like iso...    730   0.0      
ref|XP_002272999.1|  PREDICTED: subtilisin-like protease                730   0.0      Vitis vinifera
ref|XP_009375850.1|  PREDICTED: subtilisin-like protease                728   0.0      
gb|KCW72879.1|  hypothetical protein EUGRSUZ_E01327                     726   0.0      
ref|XP_010661611.1|  PREDICTED: subtilisin-like protease                728   0.0      
gb|AES80028.2|  subtilisin-like serine protease                         724   0.0      
ref|XP_010661613.1|  PREDICTED: subtilisin-like protease                724   0.0      
ref|XP_003623810.1|  Subtilisin-like protease                           724   0.0      
ref|XP_010692334.1|  PREDICTED: subtilisin-like protease                722   0.0      
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g             714   0.0      
ref|XP_007051968.1|  Subtilase family protein                           712   0.0      
ref|XP_007051971.1|  Subtilase family protein                           712   0.0      
ref|XP_010919194.1|  PREDICTED: subtilisin-like protease isoform X1     707   0.0      
emb|CAN81090.1|  hypothetical protein VITISV_040910                     719   0.0      Vitis vinifera
ref|XP_010919195.1|  PREDICTED: subtilisin-like protease isoform X2     707   0.0      
ref|XP_009411443.1|  PREDICTED: subtilisin-like protease                706   0.0      
ref|XP_008454762.1|  PREDICTED: subtilisin-like protease                705   0.0      
ref|XP_002272824.2|  PREDICTED: subtilisin-like protease                704   0.0      Vitis vinifera
ref|XP_004140440.1|  PREDICTED: subtilisin-like protease-like           702   0.0      
ref|XP_008780373.1|  PREDICTED: subtilisin-like protease                699   0.0      
ref|XP_007051969.1|  Subtilase family protein isoform 1                 697   0.0      
ref|XP_006857965.1|  hypothetical protein AMTR_s00069p00175260          697   0.0      
ref|XP_008454764.1|  PREDICTED: subtilisin-like protease                686   0.0      
emb|CAN62248.1|  hypothetical protein VITISV_022540                     707   0.0      Vitis vinifera
emb|CBI38832.3|  unnamed protein product                                693   0.0      
ref|XP_004140477.1|  PREDICTED: subtilisin-like protease-like           676   0.0      
gb|KHN04108.1|  Subtilisin-like protease                                674   0.0      
ref|XP_004171629.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    674   0.0      
ref|XP_010540256.1|  PREDICTED: subtilisin-like protease                671   0.0      
ref|XP_009119746.1|  PREDICTED: subtilisin-like protease                666   0.0      
emb|CDY15145.1|  BnaC05g00240D                                          666   0.0      
gb|KHG02130.1|  Subtilisin-like protease                                657   0.0      
ref|XP_006306838.1|  hypothetical protein CARUB_v10008379mg             654   0.0      
gb|KFK42556.1|  hypothetical protein AALP_AA1G010500                    652   0.0      
ref|XP_006418467.1|  hypothetical protein EUTSA_v10006878mg             645   0.0      
gb|AAF76468.1|AC020622_2  Contains similarity to p69d gene from L...    644   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007051967.1|  Subtilase family protein                           644   0.0      
ref|XP_010474817.1|  PREDICTED: subtilisin-like protease                644   0.0      
ref|NP_563639.2|  subtilisin-like serine protease SBT1.1                643   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479641.1|  PREDICTED: subtilisin-like protease                644   0.0      
emb|CDX90065.1|  BnaA10g00170D                                          640   0.0      
ref|XP_010457066.1|  PREDICTED: subtilisin-like protease isoform X1     640   0.0      
ref|XP_010692332.1|  PREDICTED: subtilisin-like protease                638   0.0      
ref|XP_002892038.1|  predicted protein                                  637   0.0      
ref|XP_002966443.1|  hypothetical protein SELMODRAFT_143697             595   0.0      
ref|XP_002982080.1|  hypothetical protein SELMODRAFT_233912             593   0.0      
ref|XP_007051970.1|  Subtilase family protein isoform 2                 584   0.0      
ref|XP_001757585.1|  predicted protein                                  583   0.0      
ref|XP_010322825.1|  PREDICTED: subtilisin-like protease                583   0.0      
gb|KHN15704.1|  Subtilisin-like protease                                577   0.0      
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like           579   0.0      
gb|ABR18065.1|  unknown                                                 577   0.0      Picea sitchensis
ref|XP_002994398.1|  hypothetical protein SELMODRAFT_236958             575   0.0      
ref|XP_002272769.1|  PREDICTED: subtilisin-like protease                576   0.0      Vitis vinifera
ref|XP_003595292.1|  Subtilisin-like protease                           575   0.0      
ref|XP_010047469.1|  PREDICTED: subtilisin-like protease                574   0.0      
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease                573   0.0      
ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like           573   0.0      
ref|XP_010090170.1|  Subtilisin-like protease                           572   0.0      
ref|XP_004507999.1|  PREDICTED: subtilisin-like protease-like           572   0.0      
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease                573   0.0      
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1     572   0.0      
ref|XP_011030007.1|  PREDICTED: subtilisin-like protease                571   0.0      
ref|XP_010029506.1|  PREDICTED: subtilisin-like protease                570   0.0      
ref|XP_003627323.1|  Cucumisin-like serine protease subtilisin-li...    570   0.0      
ref|XP_004488082.1|  PREDICTED: subtilisin-like protease-like           569   0.0      
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease                569   0.0      
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease                568   0.0      Vitis vinifera
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like           568   0.0      
ref|XP_010442681.1|  PREDICTED: subtilisin-like protease                568   0.0      
ref|XP_007152373.1|  hypothetical protein PHAVU_004G124600g             568   0.0      
gb|KFK26784.1|  hypothetical protein AALP_AA8G293000                    567   0.0      
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like           567   0.0      
emb|CAN81091.1|  hypothetical protein VITISV_040911                     554   0.0      Vitis vinifera
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease-like           567   0.0      
ref|XP_002318860.1|  hypothetical protein POPTR_0012s14140g             566   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006849717.1|  hypothetical protein AMTR_s00024p00243520          566   0.0      
ref|XP_007135377.1|  hypothetical protein PHAVU_010G124400g             566   0.0      
ref|XP_003536496.1|  PREDICTED: subtilisin-like protease-like           566   0.0      
ref|XP_010482516.1|  PREDICTED: subtilisin-like protease isoform X1     565   0.0      
ref|XP_004141727.1|  PREDICTED: subtilisin-like protease-like           565   0.0      
ref|XP_004155899.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    565   0.0      
ref|XP_002885025.1|  hypothetical protein ARALYDRAFT_478841             565   0.0      
emb|CDX82491.1|  BnaA03g33300D                                          565   0.0      
ref|NP_568765.1|  subtilase 1.3                                         565   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273831.1|  PREDICTED: subtilisin-like protease                565   0.0      
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg             564   0.0      
ref|XP_009343496.1|  PREDICTED: subtilisin-like protease                565   0.0      
gb|KCW56428.1|  hypothetical protein EUGRSUZ_I02156                     568   0.0      
ref|XP_004510506.1|  PREDICTED: subtilisin-like protease-like iso...    564   0.0      
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease                563   0.0      
ref|XP_008354210.1|  PREDICTED: subtilisin-like protease                564   0.0      
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative      563   0.0      Ricinus communis
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease                563   0.0      
ref|XP_007143339.1|  hypothetical protein PHAVU_007G064100g             563   0.0      
gb|KHN31561.1|  Subtilisin-like protease                                559   0.0      
ref|XP_010111996.1|  Subtilisin-like protease                           565   0.0      
ref|XP_008242250.1|  PREDICTED: subtilisin-like protease                563   0.0      
ref|XP_009391730.1|  PREDICTED: subtilisin-like protease                563   0.0      
ref|XP_008392153.1|  PREDICTED: subtilisin-like protease                564   0.0      
ref|XP_006828664.1|  hypothetical protein AMTR_s00129p00121180          564   0.0      
ref|XP_009135372.1|  PREDICTED: subtilisin-like protease                563   0.0      
ref|XP_010443674.1|  PREDICTED: subtilisin-like protease isoform X2     563   0.0      
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    563   0.0      
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease                562   0.0      
ref|XP_010443668.1|  PREDICTED: subtilisin-like protease isoform X1     563   0.0      
ref|XP_010917483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    563   0.0      
ref|XP_004305780.1|  PREDICTED: subtilisin-like protease-like           562   0.0      
ref|XP_002864127.1|  subtilase family protein                           561   0.0      
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease                561   0.0      
gb|KHN10472.1|  Subtilisin-like protease                                560   0.0      
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                561   0.0      
emb|CAN75240.1|  hypothetical protein VITISV_014207                     555   0.0      Vitis vinifera
ref|XP_009348638.1|  PREDICTED: subtilisin-like protease                564   0.0      
ref|XP_006396129.1|  hypothetical protein EUTSA_v10002410mg             561   0.0      
ref|XP_004144036.1|  PREDICTED: subtilisin-like protease-like           561   0.0      
ref|NP_565330.1|  Subtilase-like protein                                560   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease                560   0.0      
ref|XP_009102354.1|  PREDICTED: subtilisin-like protease                560   0.0      
ref|XP_010541995.1|  PREDICTED: subtilisin-like protease                560   0.0      
ref|XP_006369092.1|  subtilase family protein                           560   0.0      
ref|XP_003541310.1|  PREDICTED: subtilisin-like protease-like           560   0.0      
ref|XP_003528733.1|  PREDICTED: subtilisin-like protease-like           560   0.0      
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg             560   0.0      
gb|KFK39884.1|  hypothetical protein AALP_AA3G301200                    559   0.0      
gb|ACN40199.1|  unknown                                                 559   0.0      Picea sitchensis
emb|CDX97560.1|  BnaA05g25190D                                          560   0.0      
ref|XP_010089708.1|  Subtilisin-like protease                           560   0.0      
ref|XP_010488783.1|  PREDICTED: subtilisin-like protease                558   0.0      
ref|XP_010693651.1|  PREDICTED: subtilisin-like protease                560   0.0      
ref|XP_007024651.1|  Subtilase family protein                           559   0.0      
ref|XP_006587373.1|  PREDICTED: subtilisin-like protease-like           559   0.0      
ref|XP_010049348.1|  PREDICTED: subtilisin-like protease                559   0.0      
ref|XP_010666857.1|  PREDICTED: subtilisin-like protease                559   0.0      
ref|XP_008782639.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    559   0.0      
ref|XP_009146389.1|  PREDICTED: subtilisin-like protease                559   0.0      
ref|XP_003549134.1|  PREDICTED: subtilisin-like protease-like           559   0.0      
gb|KFK38784.1|  hypothetical protein AALP_AA3G160100                    558   0.0      
emb|CDX98438.1|  BnaC05g39370D                                          558   0.0      
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                    558   0.0      
ref|XP_009782030.1|  PREDICTED: subtilisin-like protease                558   0.0      
ref|XP_002885806.1|  predicted protein                                  557   0.0      
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease                558   0.0      
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg            558   0.0      
ref|XP_006280041.1|  hypothetical protein CARUB_v10025918mg             558   0.0      
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease                558   0.0      
ref|XP_010685295.1|  PREDICTED: subtilisin-like protease                558   0.0      
ref|XP_007204263.1|  hypothetical protein PRUPE_ppa001798mg             557   0.0      
ref|XP_010519206.1|  PREDICTED: subtilisin-like protease isoform X1     557   0.0      
ref|XP_006465816.1|  PREDICTED: subtilisin-like protease-like           557   0.0      
ref|XP_006426785.1|  hypothetical protein CICLE_v10024934mg             557   0.0      
gb|ABR17987.1|  unknown                                                 557   0.0      Picea sitchensis
gb|AES92191.2|  subtilisin-like serine protease                         556   0.0      
ref|XP_003609994.1|  Subtilisin-like protease                           556   0.0      
ref|NP_569048.1|  subtilisin-like protease                              556   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007217030.1|  hypothetical protein PRUPE_ppa001661mg             557   0.0      
ref|XP_006401917.1|  hypothetical protein EUTSA_v10012740mg             556   0.0      
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864             556   0.0      
ref|XP_010042589.1|  PREDICTED: subtilisin-like protease                556   0.0      
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease                556   0.0      
ref|XP_009107228.1|  PREDICTED: subtilisin-like protease                556   0.0      
ref|XP_003632775.1|  PREDICTED: subtilisin-like protease                556   0.0      
emb|CDY00497.1|  BnaA10g07760D                                          556   0.0      
ref|XP_008780099.1|  PREDICTED: subtilisin-like protease                557   0.0      
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease                558   0.0      
ref|XP_009788688.1|  PREDICTED: subtilisin-like protease                556   0.0      
ref|XP_002270958.1|  PREDICTED: subtilisin-like protease                556   0.0      Vitis vinifera
ref|XP_010552189.1|  PREDICTED: subtilisin-like protease                556   0.0      
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like           555   0.0      
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease                555   0.0      
gb|EYU25847.1|  hypothetical protein MIMGU_mgv1a001711mg                555   0.0      
gb|KDO64998.1|  hypothetical protein CISIN_1g045236mg                   549   0.0      
ref|XP_011041660.1|  PREDICTED: subtilisin-like protease                555   0.0      
ref|XP_011048615.1|  PREDICTED: subtilisin-like protease                555   0.0      
ref|XP_010051409.1|  PREDICTED: subtilisin-like protease                555   0.0      
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                554   0.0      
gb|AAM60964.1|  subtilisin-like serine protease                         554   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease                554   0.0      
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg             554   0.0      
ref|XP_009596091.1|  PREDICTED: subtilisin-like protease                554   0.0      
ref|XP_006383545.1|  hypothetical protein POPTR_0005s18880g             554   0.0      
ref|XP_010261833.1|  PREDICTED: subtilisin-like protease                554   0.0      
ref|XP_008792868.1|  PREDICTED: subtilisin-like protease                553   0.0      
ref|XP_010109072.1|  Subtilisin-like protease                           554   0.0      
emb|CDP20511.1|  unnamed protein product                                554   0.0      
ref|XP_002321861.2|  subtilase family protein                           554   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011072593.1|  PREDICTED: subtilisin-like protease                554   0.0      
emb|CDX99895.1|  BnaC09g28100D                                          554   0.0      
ref|XP_004141706.1|  PREDICTED: subtilisin-like protease-like           553   0.0      
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease                555   0.0      
ref|XP_006407103.1|  hypothetical protein EUTSA_v10020111mg             554   0.0      
emb|CAN75239.1|  hypothetical protein VITISV_014205                     553   0.0      Vitis vinifera
ref|XP_007154575.1|  hypothetical protein PHAVU_003G130300g             553   0.0      
ref|XP_006381615.1|  subtilase family protein                           553   0.0      
gb|KDP33922.1|  hypothetical protein JCGZ_07493                         553   0.0      
ref|XP_003608462.1|  Subtilisin-like protease                           552   0.0      
ref|XP_009610930.1|  PREDICTED: subtilisin-like protease                553   0.0      
ref|XP_009359724.1|  PREDICTED: subtilisin-like protease                552   0.0      
gb|KCW53526.1|  hypothetical protein EUGRSUZ_J02805                     553   0.0      
gb|ABF70004.1|  subtilisin-like serine proteinase, putative             552   0.0      Musa acuminata [banana]
ref|XP_004243704.1|  PREDICTED: subtilisin-like protease                552   0.0      
gb|KCW81959.1|  hypothetical protein EUGRSUZ_C03325                     555   0.0      
ref|XP_008388846.1|  PREDICTED: subtilisin-like protease                552   0.0      
ref|XP_010272631.1|  PREDICTED: subtilisin-like protease                553   0.0      
ref|XP_010070634.1|  PREDICTED: subtilisin-like protease                552   0.0      
ref|XP_010937330.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    552   0.0      
ref|NP_566483.1|  Subtilase family protein                              552   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease                552   0.0      
ref|XP_004287641.1|  PREDICTED: subtilisin-like protease-like           551   0.0      
ref|XP_006362066.1|  PREDICTED: subtilisin-like protease-like           551   0.0      
ref|XP_010501809.1|  PREDICTED: subtilisin-like protease                551   0.0      
ref|XP_002510884.1|  Cucumisin precursor, putative                      551   0.0      Ricinus communis
gb|AAM10321.1|  AT5g67360/K8K14_8                                       551   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008337844.1|  PREDICTED: subtilisin-like protease                551   0.0      
ref|XP_010542387.1|  PREDICTED: subtilisin-like protease                551   0.0      
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease                551   0.0      
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease                551   0.0      
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g             551   0.0      
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...    551   0.0      
ref|XP_010487224.1|  PREDICTED: subtilisin-like protease                551   0.0      
ref|NP_001234282.1|  SBT1 protein precursor                             550   0.0      
dbj|BAJ93208.1|  predicted protein                                      551   0.0      
ref|XP_009337216.1|  PREDICTED: subtilisin-like protease                550   0.0      
gb|KHN12975.1|  Subtilisin-like protease                                550   0.0      
gb|AAK25839.1|AF360129_1  putative subtilisin serine protease           551   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006342387.1|  PREDICTED: subtilisin-like protease-like           550   0.0      
dbj|BAJ87876.1|  predicted protein                                      551   0.0      
ref|XP_010070627.1|  PREDICTED: subtilisin-like protease                550   0.0      
emb|CAA59963.1|  subtilisin-like protease                               549   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010033727.1|  PREDICTED: subtilisin-like protease                552   0.0      
ref|XP_009403290.1|  PREDICTED: subtilisin-like protease                550   0.0      
ref|XP_001755716.1|  predicted protein                                  548   0.0      
ref|XP_003538797.2|  PREDICTED: subtilisin-like protease-like           550   0.0      
ref|XP_010465317.1|  PREDICTED: subtilisin-like protease isoform X1     550   0.0      
emb|CDP05276.1|  unnamed protein product                                550   0.0      
gb|AFW73751.1|  putative subtilase family protein                       550   0.0      
gb|KDO73903.1|  hypothetical protein CISIN_1g004261mg                   549   0.0      
ref|XP_007038510.1|  Subtilase 1.3                                      549   0.0      
emb|CDO97802.1|  unnamed protein product                                550   0.0      
ref|XP_010261834.1|  PREDICTED: subtilisin-like protease                548   0.0      
ref|XP_006452813.1|  hypothetical protein CICLE_v10007510mg             549   0.0      
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease                548   0.0      
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease                548   0.0      
ref|XP_006298945.1|  hypothetical protein CARUB_v10015070mg             548   0.0      
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease                548   0.0      
ref|XP_004308141.1|  PREDICTED: subtilisin-like protease-like           548   0.0      
ref|XP_006421788.1|  hypothetical protein CICLE_v10004381mg             548   0.0      
ref|XP_006490276.1|  PREDICTED: subtilisin-like protease-like           548   0.0      
gb|EYU25500.1|  hypothetical protein MIMGU_mgv1a001697mg                548   0.0      
ref|XP_007024750.1|  Subtilase family protein isoform 1                 547   0.0      
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease                547   0.0      
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg                547   0.0      
ref|NP_001234288.1|  SBT2 protein precursor                             547   0.0      
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like           546   0.0      
ref|XP_002533167.1|  Xylem serine proteinase 1 precursor, putative      546   0.0      
ref|XP_004954115.1|  PREDICTED: subtilisin-like protease-like           547   0.0      
ref|XP_007012625.1|  Subtilase family protein                           545   0.0      
ref|XP_011078099.1|  PREDICTED: subtilisin-like protease                545   0.0      
ref|XP_004235537.1|  PREDICTED: subtilisin-like protease                546   0.0      
ref|XP_009357900.1|  PREDICTED: subtilisin-like protease isoform X2     546   0.0      
emb|CDY12840.1|  BnaC07g15930D                                          545   0.0      
ref|XP_006856781.1|  hypothetical protein AMTR_s00055p00107870          545   0.0      
ref|XP_011072681.1|  PREDICTED: subtilisin-like protease                546   0.0      
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             545   0.0      
ref|XP_011036534.1|  PREDICTED: subtilisin-like protease                545   0.0      
ref|XP_007047459.1|  Subtilase family protein                           545   0.0      
ref|XP_009613725.1|  PREDICTED: subtilisin-like protease                545   0.0      
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease                545   0.0      
gb|EYU28325.1|  hypothetical protein MIMGU_mgv1a001748mg                544   0.0      
ref|XP_009357899.1|  PREDICTED: subtilisin-like protease isoform X1     545   0.0      
ref|NP_001048301.1|  Os02g0779200                                       545   0.0      
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease                544   0.0      
gb|KHG16003.1|  Subtilisin-like protease                                544   1e-180   
ref|XP_009803919.1|  PREDICTED: subtilisin-like protease                544   1e-180   
ref|XP_006369129.1|  subtilase family protein                           544   2e-180   
emb|CDP03800.1|  unnamed protein product                                544   2e-180   
ref|XP_009615143.1|  PREDICTED: subtilisin-like protease                543   2e-180   
ref|XP_007155854.1|  hypothetical protein PHAVU_003G237300g             544   2e-180   
gb|AIX97848.1|  SBT1.5                                                  543   3e-180   
ref|XP_006426684.1|  hypothetical protein CICLE_v10024936mg             543   3e-180   
ref|XP_006841997.1|  hypothetical protein AMTR_s00144p00078130          543   3e-180   
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g             543   3e-180   
ref|XP_009112378.1|  PREDICTED: subtilisin-like protease                538   3e-180   
ref|XP_009401756.1|  PREDICTED: subtilisin-like protease                543   3e-180   
ref|XP_011076276.1|  PREDICTED: subtilisin-like protease                543   4e-180   
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           543   5e-180   
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease                542   5e-180   
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...    542   6e-180   
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease                542   6e-180   
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease                543   6e-180   
gb|AGN03879.1|  senescence-associated subtilisin protease               543   6e-180   
ref|XP_010917484.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    542   7e-180   
emb|CDY57437.1|  BnaAnng14520D                                          542   7e-180   
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like           542   7e-180   
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg             541   7e-180   
ref|XP_006486757.1|  PREDICTED: subtilisin-like protease-like           542   7e-180   
ref|XP_004509085.1|  PREDICTED: subtilisin-like protease-like           541   7e-180   
ref|XP_006465903.1|  PREDICTED: subtilisin-like protease-like           542   8e-180   
ref|XP_002454656.1|  hypothetical protein SORBIDRAFT_04g034980          542   9e-180   
emb|CDY18042.1|  BnaC07g04280D                                          541   9e-180   
ref|XP_011046353.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    542   1e-179   
ref|XP_011035735.1|  PREDICTED: subtilisin-like protease                542   1e-179   
ref|XP_009103426.1|  PREDICTED: subtilisin-like protease                541   1e-179   
ref|XP_006841679.1|  hypothetical protein AMTR_s00003p00245290          541   1e-179   
ref|XP_003597117.1|  Subtilisin-like protease                           541   1e-179   
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g             541   2e-179   
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease                541   2e-179   
ref|XP_009112375.1|  PREDICTED: subtilisin-like protease isoform X2     540   3e-179   
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease                541   3e-179   
ref|XP_006422621.1|  hypothetical protein CICLE_v10027859mg             541   3e-179   
gb|KDP22364.1|  hypothetical protein JCGZ_26195                         541   3e-179   
ref|XP_003523991.1|  PREDICTED: subtilisin-like protease-like           540   4e-179   
ref|XP_006857985.1|  hypothetical protein AMTR_s00069p00181050          541   4e-179   
ref|XP_010246830.1|  PREDICTED: subtilisin-like protease                540   5e-179   
ref|XP_009112374.1|  PREDICTED: subtilisin-like protease isoform X1     540   5e-179   
ref|XP_010240288.1|  PREDICTED: subtilisin-like protease                540   5e-179   
ref|XP_004496644.1|  PREDICTED: subtilisin-like protease-like           540   5e-179   
dbj|BAH20348.1|  AT3G14067                                              533   7e-179   
ref|XP_004981675.1|  PREDICTED: subtilisin-like protease-like           539   8e-179   
gb|EPS65938.1|  hypothetical protein M569_08836                         538   8e-179   
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease                539   9e-179   
emb|CDY63302.1|  BnaCnng41810D                                          538   1e-178   
ref|XP_009112373.1|  PREDICTED: subtilisin-like protease                539   1e-178   
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease                538   1e-178   
ref|XP_010087293.1|  Subtilisin-like protease                           538   2e-178   
gb|AAL32016.1|AF436834_1  AT3g14240/MLN21_2                             532   2e-178   
ref|XP_002460273.1|  hypothetical protein SORBIDRAFT_02g025810          538   2e-178   
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease-like           538   2e-178   
gb|EYU37942.1|  hypothetical protein MIMGU_mgv1a001727mg                538   3e-178   
ref|XP_004245414.1|  PREDICTED: subtilisin-like protease                538   3e-178   
ref|XP_003627424.1|  Subtilisin-like serine protease                    538   3e-178   
ref|XP_010277120.1|  PREDICTED: subtilisin-like protease                538   3e-178   
ref|XP_009790650.1|  PREDICTED: subtilisin-like protease SDD1 iso...    535   4e-178   
ref|XP_010919193.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    538   4e-178   
ref|XP_008457681.1|  PREDICTED: subtilisin-like protease                537   5e-178   
ref|XP_006426043.1|  hypothetical protein CICLE_v10024951mg             537   5e-178   
ref|XP_010090327.1|  Subtilisin-like protease                           538   5e-178   
dbj|BAJ87780.1|  predicted protein                                      538   5e-178   
ref|XP_009790649.1|  PREDICTED: subtilisin-like protease SDD1 iso...    535   5e-178   
ref|XP_002284101.1|  PREDICTED: subtilisin-like protease                537   6e-178   
gb|AES62637.2|  subtilisin-like serine protease                         537   6e-178   
ref|XP_010547540.1|  PREDICTED: subtilisin-like protease                537   6e-178   
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease                537   7e-178   
ref|XP_004147036.1|  PREDICTED: subtilisin-like protease-like           536   1e-177   
gb|KDO79000.1|  hypothetical protein CISIN_1g004301mg                   536   1e-177   
ref|XP_009789180.1|  PREDICTED: subtilisin-like protease                537   1e-177   
ref|XP_010262465.1|  PREDICTED: subtilisin-like protease SDD1           536   1e-177   
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease                536   1e-177   
ref|XP_011088593.1|  PREDICTED: subtilisin-like protease                536   2e-177   
ref|XP_008784364.1|  PREDICTED: subtilisin-like protease                537   2e-177   
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease                536   2e-177   
ref|XP_009146419.1|  PREDICTED: subtilisin-like protease                536   2e-177   
ref|XP_006466502.1|  PREDICTED: subtilisin-like protease-like           535   2e-177   
ref|XP_003547873.1|  PREDICTED: subtilisin-like protease-like           536   2e-177   
ref|XP_010105478.1|  Subtilisin-like protease                           535   3e-177   
gb|KDP32042.1|  hypothetical protein JCGZ_12503                         534   3e-177   
ref|XP_003592386.1|  Subtilisin-like protease                           537   3e-177   
ref|XP_009590434.1|  PREDICTED: subtilisin-like protease SDD1           535   4e-177   
ref|XP_004496643.1|  PREDICTED: subtilisin-like protease-like           535   4e-177   
ref|XP_009790648.1|  PREDICTED: subtilisin-like protease SDD1 iso...    535   5e-177   
ref|XP_002305511.2|  hypothetical protein POPTR_0004s17960g             535   5e-177   
ref|XP_011001974.1|  PREDICTED: subtilisin-like protease                535   7e-177   
ref|XP_003605881.1|  Subtilisin-like protease                           534   7e-177   
ref|XP_003520892.1|  PREDICTED: subtilisin-like protease-like           534   7e-177   
ref|XP_004292169.1|  PREDICTED: subtilisin-like protease-like           534   8e-177   
ref|XP_002533857.1|  Cucumisin precursor, putative                      533   9e-177   
ref|XP_011001975.1|  PREDICTED: subtilisin-like protease                534   1e-176   
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease                534   1e-176   
ref|XP_004158378.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    534   1e-176   
ref|XP_003547763.1|  PREDICTED: subtilisin-like protease-like           534   1e-176   
ref|NP_001130775.1|  uncharacterized protein LOC100191879 precursor     533   1e-176   
ref|XP_004167070.1|  PREDICTED: subtilisin-like protease-like           533   1e-176   
ref|XP_004141887.1|  PREDICTED: subtilisin-like protease-like           533   2e-176   
gb|AFS34694.1|  subtilisin-like serine protease                         534   2e-176   
ref|XP_006583162.1|  PREDICTED: subtilisin-like protease-like iso...    535   2e-176   
ref|XP_011093838.1|  PREDICTED: subtilisin-like protease                532   2e-176   
ref|XP_009770992.1|  PREDICTED: subtilisin-like protease                533   2e-176   
gb|ACF79126.1|  unknown                                                 533   2e-176   
ref|XP_006362686.1|  PREDICTED: subtilisin-like protease-like           533   3e-176   
ref|XP_003553808.1|  PREDICTED: subtilisin-like protease-like           533   3e-176   
emb|CDY33400.1|  BnaA07g04390D                                          532   3e-176   
ref|XP_009767539.1|  PREDICTED: subtilisin-like protease                532   3e-176   
gb|EPS61757.1|  hypothetical protein M569_13035                         532   3e-176   
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg             533   4e-176   
ref|XP_010679580.1|  PREDICTED: subtilisin-like protease                532   4e-176   
ref|XP_011099335.1|  PREDICTED: subtilisin-like protease                532   4e-176   
dbj|BAE98521.1|  putative subtilisin-like serine proteinase             532   5e-176   
gb|KDP26457.1|  hypothetical protein JCGZ_17615                         530   5e-176   
ref|XP_010266807.1|  PREDICTED: subtilisin-like protease                532   5e-176   
emb|CDY67452.1|  BnaCnng55020D                                          531   5e-176   
gb|KEH30495.1|  subtilisin-like serine protease                         532   5e-176   
ref|XP_003533787.1|  PREDICTED: subtilisin-like protease-like           532   6e-176   
ref|XP_007041871.1|  Subtilisin-like serine protease 2                  532   6e-176   
ref|XP_010050438.1|  PREDICTED: subtilisin-like protease                531   6e-176   
ref|XP_004148149.1|  PREDICTED: subtilisin-like protease-like           532   6e-176   
ref|XP_007160895.1|  hypothetical protein PHAVU_001G026100g             532   7e-176   
gb|KHN45156.1|  Subtilisin-like protease                                530   8e-176   
ref|XP_006298979.1|  hypothetical protein CARUB_v10015104mg             532   9e-176   
ref|XP_003632376.1|  PREDICTED: subtilisin-like protease                532   1e-175   
ref|XP_008792869.1|  PREDICTED: subtilisin-like protease                532   1e-175   
ref|XP_007137352.1|  hypothetical protein PHAVU_009G120000g             531   1e-175   
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease                531   1e-175   
ref|XP_009370534.1|  PREDICTED: subtilisin-like protease SDD1           531   1e-175   
ref|XP_003525925.1|  PREDICTED: subtilisin-like protease-like           531   1e-175   
ref|NP_566473.2|  Subtilase family protein                              531   1e-175   
ref|XP_002526537.1|  Cucumisin precursor, putative                      531   2e-175   
ref|XP_010685229.1|  PREDICTED: subtilisin-like protease                531   2e-175   
ref|XP_006433609.1|  hypothetical protein CICLE_v10000363mg             531   2e-175   
gb|EPS74243.1|  subtilase family protein                                530   2e-175   
dbj|BAJ88858.1|  predicted protein                                      531   2e-175   
ref|XP_004242535.1|  PREDICTED: subtilisin-like protease SDD1           531   2e-175   
ref|XP_007226995.1|  hypothetical protein PRUPE_ppa001756mg             530   2e-175   
emb|CDY29697.1|  BnaA04g17300D                                          530   2e-175   
gb|KGN57311.1|  hypothetical protein Csa_3G178520                       532   2e-175   
gb|EEC83669.1|  hypothetical protein OsI_29445                          528   2e-175   
ref|XP_008236002.1|  PREDICTED: subtilisin-like protease                530   3e-175   
ref|XP_003570496.1|  PREDICTED: subtilisin-like protease                531   3e-175   
ref|XP_003625390.1|  Subtilisin-like protease                           535   3e-175   
ref|XP_002463844.1|  hypothetical protein SORBIDRAFT_01g007310          530   4e-175   
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like           530   4e-175   
ref|XP_008439131.1|  PREDICTED: subtilisin-like protease                531   4e-175   
ref|XP_010105479.1|  Subtilisin-like protease                           530   4e-175   
ref|XP_010914489.1|  PREDICTED: subtilisin-like protease                530   6e-175   
ref|XP_006472275.1|  PREDICTED: subtilisin-like protease-like           529   6e-175   
ref|XP_008356216.1|  PREDICTED: subtilisin-like protease SDD1           529   7e-175   
ref|XP_006352831.1|  PREDICTED: subtilisin-like protease SDD1-like      529   7e-175   
gb|KFK38761.1|  hypothetical protein AALP_AA3G157200                    529   7e-175   
ref|XP_004973598.1|  PREDICTED: subtilisin-like protease-like           530   1e-174   
ref|XP_008792659.1|  PREDICTED: subtilisin-like protease                529   1e-174   
ref|XP_006342910.1|  PREDICTED: subtilisin-like protease-like           529   1e-174   
ref|XP_002510119.1|  Xylem serine proteinase 1 precursor, putative      528   1e-174   
ref|XP_003523496.1|  PREDICTED: subtilisin-like protease-like           528   2e-174   
emb|CDP02570.1|  unnamed protein product                                528   2e-174   
ref|XP_004505786.1|  PREDICTED: subtilisin-like protease-like           528   2e-174   
ref|NP_001151463.1|  LOC100285096 precursor                             528   2e-174   
ref|XP_011092912.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    528   2e-174   
ref|XP_009628999.1|  PREDICTED: subtilisin-like protease                528   3e-174   
ref|XP_003559080.1|  PREDICTED: subtilisin-like protease                528   3e-174   
ref|XP_007136744.1|  hypothetical protein PHAVU_009G070500g             528   3e-174   
gb|EYU25025.1|  hypothetical protein MIMGU_mgv1a001588mg                528   3e-174   
ref|NP_001061952.1|  Os08g0452100                                       528   3e-174   
gb|ACB87529.1|  subtilisin protease                                     520   4e-174   
gb|AES81608.2|  subtilisin-like serine protease                         531   4e-174   
ref|XP_010652423.1|  PREDICTED: subtilisin-like protease SDD1           527   4e-174   
ref|XP_010068435.1|  PREDICTED: subtilisin-like protease SDD1           527   4e-174   
ref|XP_006412166.1|  hypothetical protein EUTSA_v10026999mg             527   5e-174   
ref|XP_002885009.1|  subtilase family protein                           527   5e-174   
ref|XP_011080122.1|  PREDICTED: subtilisin-like protease SDD1           527   5e-174   
ref|XP_004290953.1|  PREDICTED: subtilisin-like protease-like           527   6e-174   
gb|EYU40429.1|  hypothetical protein MIMGU_mgv1a001733mg                526   6e-174   
emb|CDY39093.1|  BnaA01g29630D                                          527   6e-174   
gb|ACN27710.1|  unknown                                                 524   7e-174   
ref|XP_004510560.1|  PREDICTED: subtilisin-like protease-like           527   7e-174   
gb|EPS61652.1|  hypothetical protein M569_13143                         525   8e-174   
ref|XP_010932346.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    528   8e-174   
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease                526   8e-174   
ref|XP_004493834.1|  PREDICTED: subtilisin-like protease SDD1-like      526   9e-174   
emb|CDY18651.1|  BnaA09g07440D                                          526   1e-173   
ref|XP_008377749.1|  PREDICTED: subtilisin-like protease                526   1e-173   
ref|XP_011069783.1|  PREDICTED: subtilisin-like protease                526   1e-173   
tpg|DAA51518.1|  TPA: putative subtilase family protein                 526   1e-173   
ref|XP_004512211.1|  PREDICTED: subtilisin-like protease-like           526   2e-173   
ref|XP_009350566.1|  PREDICTED: subtilisin-like protease                526   2e-173   
ref|XP_007199629.1|  hypothetical protein PRUPE_ppa001754mg             526   2e-173   
ref|XP_006359680.1|  PREDICTED: subtilisin-like protease-like           525   2e-173   
ref|NP_001051353.1|  Os03g0761500                                       525   2e-173   
ref|XP_009335230.1|  PREDICTED: subtilisin-like protease SDD1           525   2e-173   
ref|XP_004231026.1|  PREDICTED: subtilisin-like protease                525   2e-173   
ref|NP_001050634.1|  Os03g0605300                                       525   3e-173   
gb|KEH35793.1|  subtilisin-like serine protease                         524   4e-173   
ref|XP_008444575.1|  PREDICTED: subtilisin-like protease                525   5e-173   



>ref|XP_009762581.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
 ref|XP_009762582.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana sylvestris]
 ref|XP_009762583.1| PREDICTED: subtilisin-like protease isoform X3 [Nicotiana sylvestris]
Length=769

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/585 (72%), Positives = 483/585 (83%), Gaps = 4/585 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GAR F KGYE+  GKINET +Y+SPRDS+GHGTHTASTAAG+LV  A+  GL +G 
Sbjct  189   KKIIGARIFSKGYEAAAGKINETEDYRSPRDSQGHGTHTASTAAGNLVMGANLFGLGKGL  248

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             AGGM Y +RIA YKACY  GCSS D+LAA+DQAV DGVD+LSLSLGG  PKPFY DNIAI
Sbjct  249   AGGMSYGSRIAVYKACYIQGCSSSDILAAIDQAVIDGVDVLSLSLGGF-PKPFYADNIAI  307

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA Q GVFV  SAGNSGPL+SSV N APWIMTVAASSLDR FP  V+LG+GRVF+G 
Sbjct  308   AAFGAVQHGVFVSCSAGNSGPLSSSVGNAAPWIMTVAASSLDRSFPTTVKLGDGRVFKGA  367

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLY GK   Q LPLVYGRTAGG+GAEFC++G+LSSRLVKG+IVVCE+G +ARAEKG +VK
Sbjct  368   SLYQGKPTKQ-LPLVYGRTAGGEGAEFCTNGTLSSRLVKGKIVVCEKGLNARAEKGEQVK  426

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGAGMI++NR+ EGEE+YADPH LP T+LG SAGIA+K YINS+K+ATASIKF+GTVY
Sbjct  427   IAGGAGMIMVNRDEEGEELYADPHVLPGTSLGASAGIAIKSYINSTKTATASIKFEGTVY  486

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GNRAP++AAFSSRGPSA  P+IIKPDVTAPGV+ILAAWPPNI P+ML++D RSV FNILS
Sbjct  487   GNRAPIVAAFSSRGPSAAGPDIIKPDVTAPGVDILAAWPPNISPSMLKSDKRSVLFNILS  546

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSGLAALLKSVH DWSPAAIKSALMTT+YTLD  ++PI D+VS   ISATPF
Sbjct  547   GTSMSCPHVSGLAALLKSVHRDWSPAAIKSALMTTAYTLDKERTPIADAVSETSISATPF  606

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
               GSGHVDPE+A++PGLIYDIST+DY  Y+CSLNYNS+QI+LLLRK   CP+H    PGD
Sbjct  607   GIGSGHVDPEKASNPGLIYDISTEDYLRYICSLNYNSSQIALLLRKNYTCPSHVLKSPGD  666

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSFAV+FDS S N   TF R+ TNVG P S Y V V  P GVSV VKPK+LKF K G
Sbjct  667   LNYPSFAVLFDSKSRNLIQTFKRSVTNVGNPMSTYVVQVNTPSGVSVTVKPKILKFQKKG  726

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             Q L Y +  VA RGK  S G  +FGSLVW S    VRSPIA+ WQ
Sbjct  727   QKLRYKMRVVA-RGK-RSAGDSTFGSLVWFSRTHIVRSPIAITWQ  769



>ref|XP_009762584.1| PREDICTED: subtilisin-like protease isoform X4 [Nicotiana sylvestris]
 ref|XP_009762585.1| PREDICTED: subtilisin-like protease isoform X4 [Nicotiana sylvestris]
Length=767

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/585 (72%), Positives = 483/585 (83%), Gaps = 4/585 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GAR F KGYE+  GKINET +Y+SPRDS+GHGTHTASTAAG+LV  A+  GL +G 
Sbjct  187   KKIIGARIFSKGYEAAAGKINETEDYRSPRDSQGHGTHTASTAAGNLVMGANLFGLGKGL  246

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             AGGM Y +RIA YKACY  GCSS D+LAA+DQAV DGVD+LSLSLGG  PKPFY DNIAI
Sbjct  247   AGGMSYGSRIAVYKACYIQGCSSSDILAAIDQAVIDGVDVLSLSLGGF-PKPFYADNIAI  305

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA Q GVFV  SAGNSGPL+SSV N APWIMTVAASSLDR FP  V+LG+GRVF+G 
Sbjct  306   AAFGAVQHGVFVSCSAGNSGPLSSSVGNAAPWIMTVAASSLDRSFPTTVKLGDGRVFKGA  365

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLY GK   Q LPLVYGRTAGG+GAEFC++G+LSSRLVKG+IVVCE+G +ARAEKG +VK
Sbjct  366   SLYQGKPTKQ-LPLVYGRTAGGEGAEFCTNGTLSSRLVKGKIVVCEKGLNARAEKGEQVK  424

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGAGMI++NR+ EGEE+YADPH LP T+LG SAGIA+K YINS+K+ATASIKF+GTVY
Sbjct  425   IAGGAGMIMVNRDEEGEELYADPHVLPGTSLGASAGIAIKSYINSTKTATASIKFEGTVY  484

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GNRAP++AAFSSRGPSA  P+IIKPDVTAPGV+ILAAWPPNI P+ML++D RSV FNILS
Sbjct  485   GNRAPIVAAFSSRGPSAAGPDIIKPDVTAPGVDILAAWPPNISPSMLKSDKRSVLFNILS  544

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSGLAALLKSVH DWSPAAIKSALMTT+YTLD  ++PI D+VS   ISATPF
Sbjct  545   GTSMSCPHVSGLAALLKSVHRDWSPAAIKSALMTTAYTLDKERTPIADAVSETSISATPF  604

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
               GSGHVDPE+A++PGLIYDIST+DY  Y+CSLNYNS+QI+LLLRK   CP+H    PGD
Sbjct  605   GIGSGHVDPEKASNPGLIYDISTEDYLRYICSLNYNSSQIALLLRKNYTCPSHVLKSPGD  664

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSFAV+FDS S N   TF R+ TNVG P S Y V V  P GVSV VKPK+LKF K G
Sbjct  665   LNYPSFAVLFDSKSRNLIQTFKRSVTNVGNPMSTYVVQVNTPSGVSVTVKPKILKFQKKG  724

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             Q L Y +  VA RGK  S G  +FGSLVW S    VRSPIA+ WQ
Sbjct  725   QKLRYKMRVVA-RGK-RSAGDSTFGSLVWFSRTHIVRSPIAITWQ  767



>ref|XP_009611962.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 ref|XP_009611971.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=767

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/585 (72%), Positives = 486/585 (83%), Gaps = 4/585 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GAR F KGYE+  GKINET +Y SPRDS+GHGTHTASTAAG+LV  A+  GL +G 
Sbjct  187   KKIIGARMFSKGYEAAAGKINETEDYISPRDSQGHGTHTASTAAGNLVMGANLFGLGKGL  246

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             AGGM Y +RIA YKACY  GCSS D+LAA+DQAV DGVD+LSLSLGG  PKPFY DNIAI
Sbjct  247   AGGMSYGSRIAVYKACYIQGCSSSDILAAIDQAVIDGVDVLSLSLGGF-PKPFYADNIAI  305

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA Q GVFV  SAGNSGPL SSV N APWIMTVAASSLDR FP  V+LG+G VF+G 
Sbjct  306   AAFGAVQHGVFVSCSAGNSGPLNSSVGNPAPWIMTVAASSLDRSFPTTVKLGDGHVFKGA  365

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SL+ GK   Q LPLVYG+TAGG+GAEFC++G+LSSRLVKG+IVVC++G +ARAEKG +VK
Sbjct  366   SLFQGKPTKQ-LPLVYGKTAGGEGAEFCTNGTLSSRLVKGKIVVCDKGINARAEKGEQVK  424

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGAGMI++NR+ EGEE++ADPH LP T+LG SAGIA+K YINS+K+ATASIKF+GTVY
Sbjct  425   IAGGAGMIMVNRDEEGEELFADPHVLPGTSLGASAGIAIKSYINSTKTATASIKFEGTVY  484

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             G+RAP++AAFSSRGPSA  P+IIKPDVTAPGV+ILAAWPPNI P+ML++D RSV+FNILS
Sbjct  485   GSRAPIVAAFSSRGPSAAGPDIIKPDVTAPGVDILAAWPPNISPSMLKSDKRSVQFNILS  544

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSGLAALLKSVH DWSPAAIKSALMTT+YTLD +++PI D+VS   +SATPF
Sbjct  545   GTSMSCPHVSGLAALLKSVHRDWSPAAIKSALMTTAYTLDKKRTPIADAVSETSLSATPF  604

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
             A GSGHVDPE+A++PGLIYDIST+DY +Y+CSLNYNS+QI+LLLRK   CP+H    PGD
Sbjct  605   AIGSGHVDPEKASNPGLIYDISTEDYLHYICSLNYNSSQIALLLRKNYTCPSHAIQSPGD  664

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSFAV+FDS S N   TF R+ATNVG P S Y V V  P GVSV VKPK+LKF K G
Sbjct  665   LNYPSFAVLFDSKSRNLIQTFKRSATNVGNPMSTYVVQVNAPSGVSVTVKPKILKFEKKG  724

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             Q L Y + FVA RGK  S G  +FGSLVW S    VRSPIA+ WQ
Sbjct  725   QKLRYKMRFVA-RGK-RSAGDSTFGSLVWFSKIHIVRSPIAITWQ  767



>ref|XP_006339499.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=765

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/585 (72%), Positives = 483/585 (83%), Gaps = 4/585 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K++GAR F KGYE+  GKINE  +Y+SPRDS+GHGTHTASTAAG+LV  A+  GLA+G 
Sbjct  185   RKIIGARIFPKGYEAAAGKINEKEDYRSPRDSQGHGTHTASTAAGNLVNGANLFGLAKGL  244

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             AGGM Y +RIA YKAC+ LGCSS DVLAA+DQAV DGVD+LSLSLGGL PKPFY DNIAI
Sbjct  245   AGGMSYGSRIAVYKACFMLGCSSSDVLAAIDQAVIDGVDVLSLSLGGL-PKPFYVDNIAI  303

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA Q GVFV  SAGNSGPL SSV N APWIMTVAASSLDR FP  V+LG+G VF+G 
Sbjct  304   AAFGAVQHGVFVSCSAGNSGPLNSSVGNAAPWIMTVAASSLDRSFPTTVKLGDGHVFKGA  363

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLY+GK   Q LPLVYGRTAGG+GA FC++G+LSSRLVKG+IVVCE+G +ARAEKG +VK
Sbjct  364   SLYTGKPTMQ-LPLVYGRTAGGEGARFCTNGTLSSRLVKGKIVVCEKGINARAEKGEQVK  422

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGAGMI++NR  EG+E+YAD H LPAT+LG SAGIA+KKYIN +K+ATASIK +GTVY
Sbjct  423   IAGGAGMIMVNRVDEGDELYADAHVLPATSLGASAGIAIKKYINLTKTATASIKLKGTVY  482

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GNRAP++AAFSSRGPSA  P+IIKPDVTAPGV+ILAAWPPNI P+ML++D RSV+FNILS
Sbjct  483   GNRAPIVAAFSSRGPSAAGPDIIKPDVTAPGVDILAAWPPNISPSMLKSDKRSVQFNILS  542

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSGLAALLKSVH DWSPAAIKSALMTT+YTLD  ++PI D+VS   ISATPF
Sbjct  543   GTSMSCPHVSGLAALLKSVHRDWSPAAIKSALMTTAYTLDKERTPIADAVSETSISATPF  602

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
              FGSGHVDPERA+ PGLIYDIST+DY +Y+CSLNYNS+QI+LLLR+   CP+H     GD
Sbjct  603   VFGSGHVDPERASDPGLIYDISTEDYLHYICSLNYNSSQIALLLRENYTCPSHSFQSLGD  662

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSFAV+FDS++ +   TF RT TNVG P S Y+V V  P GVSV VKPK+LKF K G
Sbjct  663   LNYPSFAVLFDSNNQHLIQTFKRTVTNVGTPRSTYSVQVKTPYGVSVTVKPKILKFQKKG  722

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             Q L Y V FV  RGK  S G  +FGSL W S    VRSPIAV WQ
Sbjct  723   QKLRYKVRFVT-RGK-RSPGDSTFGSLTWISRTHIVRSPIAVTWQ  765



>ref|XP_004229864.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 ref|XP_010326049.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 ref|XP_010326050.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=764

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/585 (71%), Positives = 483/585 (83%), Gaps = 4/585 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K++GAR F KGYE+  GKINE  +Y+S RDS+GHGTHTASTAAG+LV  A+  GLA+G 
Sbjct  184   RKIIGARIFPKGYEAAAGKINEKEDYRSARDSQGHGTHTASTAAGNLVNGANLFGLAKGL  243

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             AGGM Y +RIA YKAC+ LGCSS DVLAA+DQAV DGVD+LSLSLGGL PKPFY DNIAI
Sbjct  244   AGGMSYGSRIAVYKACFMLGCSSSDVLAAIDQAVIDGVDVLSLSLGGL-PKPFYIDNIAI  302

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA Q GVFV  SAGNSGPL+S+V N APWIMTVAASSLDR FP +V+LGNG VF+G 
Sbjct  303   AAFGAVQHGVFVSCSAGNSGPLSSTVGNAAPWIMTVAASSLDRSFPTIVKLGNGHVFKGA  362

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLY GK   Q LPLVYGRTAGG+GA+FC++ +LSSRLVKG+IVVCE+G + RAEKG +VK
Sbjct  363   SLYVGKPTMQ-LPLVYGRTAGGEGAQFCTNETLSSRLVKGKIVVCEKGINGRAEKGEQVK  421

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGAGMI++NR  EG+E+YAD H LPAT+LG SAGIA+KKYIN +K+ATASIKF+GTVY
Sbjct  422   LAGGAGMIMVNRVEEGDELYADAHVLPATSLGASAGIAIKKYINLTKTATASIKFEGTVY  481

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GNRAPV+AAFSSRGPSA  P+IIKPDVTAPGV+ILAAWPPNI P+ML++D RSV+FNILS
Sbjct  482   GNRAPVVAAFSSRGPSAAGPDIIKPDVTAPGVDILAAWPPNISPSMLKSDKRSVQFNILS  541

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSGLAALLKSVH DWSPAAIKSALMTT+YTLD +++PI D+VS   +SATPF
Sbjct  542   GTSMSCPHVSGLAALLKSVHRDWSPAAIKSALMTTAYTLDKKRTPIADAVSETSLSATPF  601

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
              FGSGHVDPERA+ PGLIYDIST+DY +Y+CSLNYNS+QI+LLLR+   CP+H     G+
Sbjct  602   VFGSGHVDPERASDPGLIYDISTEDYLHYICSLNYNSSQIALLLRENYTCPSHSFQSLGN  661

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSF+V+FDS++ +   TF RT TNVG P S Y V V  P GVSV VKPK+LKF+K G
Sbjct  662   LNYPSFSVLFDSNNQHLIQTFKRTVTNVGTPRSTYIVQVKTPYGVSVTVKPKILKFHKKG  721

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             Q L Y V FV  +GK  S    +FGSL W S    VRSPIAV WQ
Sbjct  722   QKLRYKVRFVT-KGK-RSPADSTFGSLTWISRTHIVRSPIAVTWQ  764



>ref|XP_002320086.2| subtilase family protein [Populus trichocarpa]
 gb|EEE98401.2| subtilase family protein [Populus trichocarpa]
Length=769

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/585 (69%), Positives = 479/585 (82%), Gaps = 3/585 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR F+KGYESIVG+INET++Y+SPRDS+GHGTHTA+TAAG+LV +ASF GLA GS
Sbjct  188   KKLIGARAFFKGYESIVGRINETIDYRSPRDSQGHGTHTAATAAGNLVDEASFYGLANGS  247

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GMKYTARIAAYK C+T GC++ D+LAA+DQAV DGVD+LSLSLGG   KPFY+D++AI
Sbjct  248   AAGMKYTARIAAYKVCWTSGCTNTDLLAAIDQAVADGVDVLSLSLGGSA-KPFYSDSVAI  306

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGA QKGVFV  SAGNSGP  SSV N APWIMTVAAS  DRRFP  V+LGNG+ F G 
Sbjct  307   ASFGAIQKGVFVSCSAGNSGPSISSVDNNAPWIMTVAASYTDRRFPTTVKLGNGQTFEGA  366

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLY+GKA  Q LPLVY  TAGG+GAE+C  GSL  +LVKG++VVC+RG + RAEKG +VK
Sbjct  367   SLYTGKATAQ-LPLVYAGTAGGEGAEYCIIGSLKKKLVKGKMVVCKRGMNGRAEKGEQVK  425

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GG GM+LIN ET GEE++AD HFLPAT+LG SAGIAVK+Y+NS+K ATASI F+GTVY
Sbjct  426   LAGGTGMLLINTETGGEELFADAHFLPATSLGASAGIAVKEYMNSTKRATASIAFKGTVY  485

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GN AP++AAFSSRGPS+V P++IKPDVTAPGVNILAAWPP   PT+L++D RSV FN++S
Sbjct  486   GNPAPMLAAFSSRGPSSVGPDVIKPDVTAPGVNILAAWPPMTSPTLLKSDKRSVLFNVIS  545

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSGLAALLKSVH  WSPAAIKSALMTT+Y  D+R SPI D+ S+N  SATPF
Sbjct  546   GTSMSCPHVSGLAALLKSVHKTWSPAAIKSALMTTAYVTDNRGSPIADAGSSNSASATPF  605

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
             AFGSGHVDPE A+ PGLIYDI+ +DY NY CSLNY S+QI+ + R+   CP +   QPGD
Sbjct  606   AFGSGHVDPESASDPGLIYDITIEDYLNYFCSLNYTSSQIAQVSRRNVTCPDNKALQPGD  665

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSFAV F+ ++ N+   + RT TNVG P S YAV V EP+GVSVI++PK L F K+G
Sbjct  666   LNYPSFAVNFEGNARNNRVKYKRTLTNVGTPWSTYAVKVEEPNGVSVILEPKSLSFEKLG  725

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             Q LSY V+FV+ RGK    G  SFGSLVW S  ++VRSPIAV WQ
Sbjct  726   QKLSYNVTFVSSRGK-GREGSSSFGSLVWLSGKYSVRSPIAVTWQ  769



>ref|XP_011035007.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=769

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/585 (68%), Positives = 474/585 (81%), Gaps = 3/585 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR F+KGYESI G+INETV+Y+SPRDS+GHGTHTA+TAAG+LV  ASF GLA GS
Sbjct  188   KKLIGARAFFKGYESIAGRINETVDYRSPRDSQGHGTHTAATAAGNLVDKASFYGLANGS  247

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GMKYTARIAAYK C+T GC++ D+LAA+DQAV DGVD+LSLSLGG   KPFY+D++AI
Sbjct  248   AAGMKYTARIAAYKVCWTSGCTNTDLLAAMDQAVADGVDVLSLSLGGSA-KPFYSDSVAI  306

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGA QKGVFV  SAGNSGP  SSV N APWIMTVAAS  DRRFP  V+LGNG+ F G 
Sbjct  307   ASFGAIQKGVFVSCSAGNSGPSISSVDNNAPWIMTVAASYTDRRFPTTVKLGNGQSFEGA  366

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLY+GKA  Q LPLV+  TAGG+GAE+C  GSL  +LVKG++VVC+RG S RA+KG +VK
Sbjct  367   SLYTGKATAQ-LPLVHAGTAGGEGAEYCITGSLKRKLVKGKMVVCKRGMSGRAQKGEQVK  425

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GG GM+LIN ET GEE++AD H LPAT+LG SAG+AVK Y+NS+K ATASI F+GTVY
Sbjct  426   LAGGTGMLLINTETGGEELFADAHVLPATSLGASAGMAVKGYMNSTKRATASIAFKGTVY  485

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GN AP++AAFSSRGPS+V P++IKPDVTAPG+NILAAWPP   PT+L++D RSV FN++S
Sbjct  486   GNPAPMLAAFSSRGPSSVGPDVIKPDVTAPGMNILAAWPPMTSPTLLKSDKRSVLFNVIS  545

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSGLAALLKSVH  WSPAAIKSALMTT+Y  D+R SPI D+ S+N  SATPF
Sbjct  546   GTSMSCPHVSGLAALLKSVHKKWSPAAIKSALMTTAYATDNRGSPIADAGSSNSASATPF  605

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
             AFGSGHVDPERA+ PGLIYDI+ +DY NY CSL+Y S+QI+ + R+   CP +   QPGD
Sbjct  606   AFGSGHVDPERASDPGLIYDITIEDYLNYFCSLDYTSSQIAQVSRRNVTCPDNKALQPGD  665

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSFAV F+ ++ N+   + RT TNVG P S YAV V EP+GVSVI++PK L F K+G
Sbjct  666   LNYPSFAVNFEGNARNNRVKYKRTLTNVGTPSSTYAVKVEEPNGVSVILEPKSLSFEKLG  725

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             Q LSY V+FV+  GK    G  S GSLVW S  ++VRSPIAV WQ
Sbjct  726   QKLSYNVTFVSSGGK-GREGSSSIGSLVWLSGKYSVRSPIAVTWQ  769



>ref|XP_002511772.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF50441.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=744

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/585 (67%), Positives = 464/585 (79%), Gaps = 3/585 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GA+ F+KGYES+VG+INETV+Y+SPRD++GHGTHTASTAAG+LV  ASF GLA GS
Sbjct  163   KKIIGAKAFFKGYESLVGRINETVDYRSPRDAQGHGTHTASTAAGNLVDKASFFGLANGS  222

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GMKYTARIA YK C++LGC++ D+LAA+DQAV DGVD+LSLSLGG   K FY+DN+AI
Sbjct  223   AAGMKYTARIAVYKVCWSLGCTNTDLLAALDQAVADGVDVLSLSLGGTA-KSFYSDNVAI  281

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGATQ GVFV  SAGNSGP TS+V NTAPWIMTVAAS  DR FP  V+LGNG++F G 
Sbjct  282   ASFGATQNGVFVSCSAGNSGPSTSTVDNTAPWIMTVAASYTDRSFPTTVKLGNGQIFTGV  341

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLYSG+A  Q L +VYG TAG   A++C+ GSL  +LVKG+IVVCERG + R  KG +VK
Sbjct  342   SLYSGRATKQ-LQIVYGTTAGHITAKYCTSGSLKKQLVKGKIVVCERGITGRTAKGEQVK  400

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGAGM+LIN E +GEE++ADPH LPA  LG SAG A+K YINS+K  TASI F+GT Y
Sbjct  401   LAGGAGMLLINSEGQGEELFADPHILPACTLGASAGKAIKMYINSTKRPTASISFKGTTY  460

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GN AP +AAFSSRGPSAV PE+IKPDVTAPGVNILAAWPP   P+ML+ D RSV FN+LS
Sbjct  461   GNPAPAVAAFSSRGPSAVGPEVIKPDVTAPGVNILAAWPPMTSPSMLKRDKRSVLFNVLS  520

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSGLAALLKSVH DWSPAAIKSALMTT+Y LD++  PI D  + N  SATPF
Sbjct  521   GTSMSCPHVSGLAALLKSVHRDWSPAAIKSALMTTAYVLDNKNLPIADLGANNSASATPF  580

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
             AFGSGHVDPE A+ PGLIYDI+T+DY NYLCSLNY S Q+  + R++ +CP +   QPGD
Sbjct  581   AFGSGHVDPESASDPGLIYDITTEDYLNYLCSLNYTSAQVFQVSRRRFSCPNNTIIQPGD  640

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSFAV F  ++ N S TF RT TNVG P   YAV V EP+GVS +V PK+L+F   G
Sbjct  641   LNYPSFAVNFAGNAQNISKTFKRTVTNVGTPSCTYAVQVQEPNGVSTVVNPKILRFRNSG  700

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             + LSY V+F+  + +  S   HSFGSLVW S  + V+SPIAV W+
Sbjct  701   EKLSYKVTFIGLKER-DSRESHSFGSLVWVSGKYKVKSPIAVTWR  744



>emb|CDP08910.1| unnamed protein product [Coffea canephora]
Length=727

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/586 (66%), Positives = 463/586 (79%), Gaps = 20/586 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR F K YE++VG+INETV+Y+SPRDSEGHGTHTASTAAG++VK+A+F GLA+GS
Sbjct  161   KKLIGARVFSKAYEALVGRINETVDYRSPRDSEGHGTHTASTAAGNIVKNANFFGLAKGS  220

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM+YT+RIAAYKACY LGC+S D+LAA+DQAV DGVDILSLSLGG  P+P+Y DN+AI
Sbjct  221   ASGMRYTSRIAAYKACYPLGCASSDILAAIDQAVSDGVDILSLSLGGS-PRPYYADNMAI  279

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA   GVFV SSAGN+GP +S+V NTAPW+MTVAA+ +DR FP+ V+LG+G+VF G 
Sbjct  280   AAFGAIANGVFVSSSAGNAGPRSSTVGNTAPWMMTVAANYMDRSFPSGVKLGDGQVFMGA  339

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLY GKA  Q LPLVYG TAG +GA+FC +GSLS +LV+G+IVVC+RG ++R EKG +VK
Sbjct  340   SLYYGKATKQ-LPLVYGETAGAQGAQFCINGSLSPKLVRGKIVVCDRGINSRVEKGEQVK  398

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGAGMI++N ET  EE +ADPH LPAT LG  A I++K+Y+NS++ ATASI+F GT Y
Sbjct  399   MAGGAGMIIVNTETGREERFADPHILPATMLGAQAAISIKRYMNSTRKATASIEFYGTAY  458

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GN APVMAAFSSRGPSAV P+IIKPDVTAPGV+ILAAWPPNI PT L++D RSV+FN +S
Sbjct  459   GNPAPVMAAFSSRGPSAVGPDIIKPDVTAPGVDILAAWPPNISPTRLKSDKRSVKFNFIS  518

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSG+AALLKSVH DWSPAAIKSALMTT+ TLD+  +PI+D+ S +   ATPF
Sbjct  519   GTSMSCPHVSGIAALLKSVHKDWSPAAIKSALMTTACTLDTGMAPISDAASGSSKFATPF  578

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHH-HQPG  1437
             AFGSGHVDPERAA PGL+YDIST DY NYLCSLNYNS+Q++L  R    CP      QP 
Sbjct  579   AFGSGHVDPERAADPGLVYDISTLDYLNYLCSLNYNSSQVALFSRNNFTCPDEAAILQPE  638

Query  1438  DLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKM  1617
              +                  T+ RT TNVGIP +VYA  VM+P+GVSVIV+P VL F  +
Sbjct  639   SIT----------------ATYKRTVTNVGIPVTVYAARVMQPNGVSVIVEPNVLHFQGI  682

Query  1618  GQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             GQ LSY VS     G+  S   +SFGS+VW S   TV SPIAV WQ
Sbjct  683   GQKLSYKVSVTTLEGRNLS-DSYSFGSVVWISEKHTVTSPIAVTWQ  727



>ref|XP_011091250.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=775

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/583 (66%), Positives = 457/583 (78%), Gaps = 3/583 (1%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGSA  183
             KL+GA  F+KGYE+I G+INET++Y+SPRDS+GHGTHTASTA G+LV+ ASFLGLA+G A
Sbjct  194   KLIGAGAFFKGYEAIAGRINETLDYRSPRDSQGHGTHTASTAGGNLVEGASFLGLAKGPA  253

Query  184   GGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAIA  363
              GM+YTARIAAYKACY LGC+S D+LAA++Q V DGVD+LSLSLGG   KP+Y DN+AIA
Sbjct  254   AGMRYTARIAAYKACYQLGCASSDILAAIEQGVNDGVDVLSLSLGGAS-KPYYNDNLAIA  312

Query  364   AFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGES  543
             +FGA Q GVFV  SAGNSGP  S+VSN APWIMTVAAS +DR F   V+LG+ RVF G S
Sbjct  313   SFGAIQNGVFVSFSAGNSGPRDSTVSNVAPWIMTVAASYMDRGFSTKVQLGDRRVFSGAS  372

Query  544   LYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVKR  723
             LYSGK   + LPLVYG TAG   A+FCS  SLS RLVKG+IV+C+RG + R  KG EVK 
Sbjct  373   LYSGKPT-KSLPLVYGETAGRGAAKFCSSSSLSPRLVKGKIVICDRGINGRVAKGEEVKM  431

Query  724   SGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVYG  903
             +GGAGMIL N E +GEE+ ADPH  PAT+LG  A  AVK Y N S +ATA+I+F+GTVY 
Sbjct  432   AGGAGMILANDENQGEELLADPHIFPATSLGAVAANAVKMYSNFSSNATATIEFKGTVYS  491

Query  904   NRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILSG  1083
             N APVMAAFSSRGPS + P+IIKPD+TAPGVNILAAWPPNI P+ L++D R V FNI+SG
Sbjct  492   NPAPVMAAFSSRGPSVIGPDIIKPDITAPGVNILAAWPPNISPSELKSDRRRVRFNIVSG  551

Query  1084  TSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPFA  1263
             TSMSCPH+SGLAALLKS+H DWSPAAIKSALMTT+YT DS  SPI D+ STN   ATPFA
Sbjct  552   TSMSCPHISGLAALLKSLHKDWSPAAIKSALMTTAYTHDSHNSPIFDAASTNSKIATPFA  611

Query  1264  FGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGDL  1443
             FGSGHVDPE+A+ PGLIYDIST+DY +YLCSLNYNS+Q++L       C      Q  DL
Sbjct  612   FGSGHVDPEKASDPGLIYDISTEDYLSYLCSLNYNSSQMALFAGGNFTCSPGSDLQSSDL  671

Query  1444  NYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMGQ  1623
             NYPSFAV+  S++ N + T+ RT TNVG P S YAV V EP+GVS+IV+PKVLKF K+G+
Sbjct  672   NYPSFAVLLSSNARNITVTYKRTVTNVGTPVSTYAVKVTEPEGVSIIVEPKVLKFRKLGE  731

Query  1624  NLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              LSY V F +     AS    SFG+LVW S  ++VRSPIAV W
Sbjct  732   KLSYRVRFTSIAEGTAS-ANFSFGTLVWASKKYSVRSPIAVTW  773



>gb|KDP28707.1| hypothetical protein JCGZ_14478 [Jatropha curcas]
Length=739

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/585 (64%), Positives = 459/585 (78%), Gaps = 3/585 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K++GAR F+KGYES+VG+INETV+Y+SPRDS+GHGTHTASTA G+L+ +ASF GLA G+
Sbjct  158   RKIIGARAFFKGYESVVGRINETVDYRSPRDSQGHGTHTASTAGGNLIYNASFFGLANGA  217

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GMKYTARIA YK C+ LGC++ D+LAA+DQAV DGVD+LSLSLGG   KPFY DN+AI
Sbjct  218   AAGMKYTARIAVYKVCWPLGCTNTDLLAAIDQAVNDGVDVLSLSLGGTA-KPFYADNVAI  276

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGATQ GVFV  SAGNSGP  S+V NTAPWIMTVAAS  DR FP  V+LGNG+ F G 
Sbjct  277   ASFGATQNGVFVSCSAGNSGPSRSTVDNTAPWIMTVAASYTDRSFPTTVKLGNGQTFVGS  336

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLYSGK+  Q L + YG TAG + A++C  GSL   LVKG+IV+CERG   R  KG +VK
Sbjct  337   SLYSGKSTKQ-LVIAYGETAGSQSAKYCVRGSLKKTLVKGKIVICERGMIGRTAKGEQVK  395

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGAGMI++N E +GEE +ADPH LPAT+LG SAG A+K Y+NS++  TASI F+GT Y
Sbjct  396   LAGGAGMIIVNTENQGEEFFADPHILPATSLGASAGKAIKFYVNSTRQPTASISFRGTTY  455

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GN APVMAAFSSRGPSAV P++IKPDVTAPGVNILAAW P   P++L++D RSV FNI+S
Sbjct  456   GNPAPVMAAFSSRGPSAVGPDVIKPDVTAPGVNILAAWSPVSSPSLLKSDKRSVMFNIIS  515

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSGLAALLKSVH DWSPAAIKSA+MT++Y +D+R +P+ D  + N  SATPF
Sbjct  516   GTSMSCPHVSGLAALLKSVHKDWSPAAIKSAIMTSAYVVDNRNAPVADFGANNSASATPF  575

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
               GSGHVDPE+AA PGLIY+I+T+DY NYLCSL+Y S QI+ + R++ +CP +   QPG 
Sbjct  576   VLGSGHVDPEKAADPGLIYNITTEDYLNYLCSLSYTSAQITQVSRRRFSCPNNTILQPGH  635

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSFAV F+ ++ N + T  R  TNVG     Y V V EP+GVS+I++PK+L F K+ 
Sbjct  636   LNYPSFAVNFEGNAQNITRTHKRRVTNVGPSLITYVVQVEEPNGVSIIIEPKILSFRKLR  695

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             + LSY V+FV+  G   +   HSFGSLVW S  + VRSPIA+ WQ
Sbjct  696   EELSYNVTFVS-LGVRDTRESHSFGSLVWVSGKYKVRSPIAISWQ  739



>ref|XP_010255581.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=775

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/590 (63%), Positives = 460/590 (78%), Gaps = 11/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR F+KGYE++ G++NETV+Y+S RDS+GHGTHTASTAAG  V DAS  G+A+GS
Sbjct  192   KKLIGARAFFKGYEAVAGRVNETVDYRSARDSQGHGTHTASTAAGAFVDDASLFGMAKGS  251

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM Y+ARIAAYK C+  GC   D+LAAVDQAV DGVD+LSLS+G    +P+Y+D IAI
Sbjct  252   ASGMMYSARIAAYKVCWLTGCVGSDILAAVDQAVADGVDVLSLSMGSFS-RPYYSDIIAI  310

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGA Q G+FV  SAGNSGP  S+V+N APWIMTVAAS LDR FP  V+LGNG  F+G 
Sbjct  311   ASFGAVQHGIFVSCSAGNSGPSESTVANVAPWIMTVAASYLDRSFPTTVKLGNGLAFKGA  370

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLYSGK  +  LPLVYG ++G KG E+C  GSLS  +V+G+IVVCER   +R  KG +VK
Sbjct  371   SLYSGKPTSM-LPLVYGDSSGSKGVEYCIDGSLSPDIVRGKIVVCERRLGSRTGKGEQVK  429

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGAGM+L+N E +GEE++ADPH LPAT+LG  A  A+K Y++S K  TASI F+GTVY
Sbjct  430   LAGGAGMLLVNAEDQGEELFADPHLLPATSLGAKAAKAIKDYVSSDKKPTASIDFEGTVY  489

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             G  APV AAFSSRGP+ ++P++IKPDVTAPG+NILAAWPP + PT L++D RSVEFNI+S
Sbjct  490   GYPAPVTAAFSSRGPNPIAPDVIKPDVTAPGMNILAAWPPTVSPTRLKSDKRSVEFNIIS  549

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS----  1248
             GTSMSCPHVSGLAALLKSVH DWSP+AIKSALMTT+Y L+++ +PI D+ +    S    
Sbjct  550   GTSMSCPHVSGLAALLKSVHRDWSPSAIKSALMTTAYMLNNKFTPIKDAAAGGGSSSSSD  609

Query  1249  -ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHH  1425
              ATPFAFGSGHV+PERA+ PGLIYDI T+DY NYLCSLNY S+Q++L+ R+   CP    
Sbjct  610   LATPFAFGSGHVNPERASDPGLIYDIGTEDYLNYLCSLNYTSSQMALVARRSFTCPL---  666

Query  1426  HQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLK  1605
              QPGDLNYPSFA++FD+ + N + T+ RT TNVG P + Y V V EP+GVSV V+PKVLK
Sbjct  667   -QPGDLNYPSFALLFDNGAQNITLTYKRTVTNVGAPRARYVVVVKEPEGVSVRVEPKVLK  725

Query  1606  FNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             FNK+GQ LSY V+FVA  G+  +   +SFGSLVW    + V SPIAV WQ
Sbjct  726   FNKLGQKLSYKVTFVAAVGRKTTSNAYSFGSLVWLFDKYAVTSPIAVTWQ  775



>ref|XP_007220042.1| hypothetical protein PRUPE_ppa027143mg [Prunus persica]
 gb|EMJ21241.1| hypothetical protein PRUPE_ppa027143mg [Prunus persica]
Length=765

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/586 (66%), Positives = 460/586 (78%), Gaps = 6/586 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR F +GYE+IVG++NETV+Y+SPRDS GHGTHTASTAAG+ V  AS  GLA+GS
Sbjct  183   KKLIGARAFVQGYEAIVGRVNETVDYRSPRDSNGHGTHTASTAAGNFVNQASLFGLAKGS  242

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GMKYTARIAAYKAC+TLGC++ DV+AA++ AV DGVDILSLSLGG+  KP+Y DNIAI
Sbjct  243   ASGMKYTARIAAYKACWTLGCANSDVMAAIESAVADGVDILSLSLGGVS-KPYYKDNIAI  301

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGA Q GV V  SAGNSGP  SSVSN APWIMTVAAS  DR FP  V+LG+G++F G 
Sbjct  302   ASFGAIQHGVSVSCSAGNSGPSRSSVSNAAPWIMTVAASYSDRSFPTAVKLGDGQIFEGS  361

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLYSGK   Q LPLVY RTAG +GAE+C  GSL  +LVKG+IVVCE G  ++   G +VK
Sbjct  362   SLYSGKKTKQ-LPLVYNRTAGSQGAEYCFEGSLVKKLVKGKIVVCEGGIYSQTGVGEKVK  420

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
             ++GGAGM+L+N E EGEE+ AD H LPAT+LG SA  A++KY+ S+K  +A I FQGTVY
Sbjct  421   KAGGAGMLLLNSEDEGEELLADAHILPATSLGASAAKAIRKYVGSAKKPSALIVFQGTVY  480

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GN APVMAAFSSRGP++  P++IKPDVTAPGV+ILAAWPPNI P+MLE+DNRSV FNI+S
Sbjct  481   GNTAPVMAAFSSRGPNSAGPDVIKPDVTAPGVDILAAWPPNISPSMLESDNRSVLFNIIS  540

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTN-PISATP  1257
             GTSMSCPHVSGLA+LLKSVH DWSPAAIKSALMTT+YTL+++ +PI D  ST+   SATP
Sbjct  541   GTSMSCPHVSGLASLLKSVHRDWSPAAIKSALMTTAYTLNNKGAPIADIGSTSTSKSATP  600

Query  1258  FAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS-ACPTHHHHQP  1434
             FAFGSGHVDPE AA PGL+YDI+ +DY  YLCSL+YNS+QI+L     +  CP +   QP
Sbjct  601   FAFGSGHVDPENAADPGLVYDITAEDYLFYLCSLSYNSSQIALFSSGVNFTCPKNAVLQP  660

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNK  1614
             GDLNYPSF+V+F   + N S T+ RT  NVG   S YAV V EP GVSV V+P+ L+F K
Sbjct  661   GDLNYPSFSVLFSKDARNMSVTYKRTVKNVGKIPSTYAVQVKEPTGVSVTVEPRSLRFKK  720

Query  1615  MGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             MG+ LSY VSFVA  G   +    SFG+L W S  + V SPIAV W
Sbjct  721   MGEKLSYKVSFVALGGPTLT--NSSFGTLTWVSGKYRVGSPIAVTW  764



>ref|XP_008232840.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008232841.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=765

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/586 (66%), Positives = 459/586 (78%), Gaps = 6/586 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR F +GYE+IVG++NETV+Y+SPRDS GHGTHTASTAAG+ V  AS  GLA+GS
Sbjct  183   KKLIGARAFVQGYEAIVGRVNETVDYRSPRDSNGHGTHTASTAAGNFVNQASLFGLAKGS  242

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GMKYTARIAAYKAC+T GC++ DV+AA+D AV DGVDILSLSLGG+  KP+Y DNIAI
Sbjct  243   ASGMKYTARIAAYKACWTSGCANSDVMAAIDSAVADGVDILSLSLGGVS-KPYYKDNIAI  301

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGA Q GV V  SAGNSGP  SSVSN APWIMTVAAS  DR FP  V+LG+G++F G 
Sbjct  302   ASFGAIQHGVSVSCSAGNSGPSRSSVSNAAPWIMTVAASYSDRSFPTAVKLGDGQIFEGS  361

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLYSGK   ++LPLVY RTAG +GAE+C  GSL  +LVKG+IVVCE G  +R E G +VK
Sbjct  362   SLYSGKKT-KRLPLVYNRTAGSQGAEYCFEGSLVKKLVKGKIVVCEEGIYSRTEVGDKVK  420

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
             ++GGAGM+L+N E EGEE+ AD H LPAT+LG SA  A++KY+ S+K  +A I FQGTVY
Sbjct  421   KAGGAGMLLLNSEDEGEELLADAHILPATSLGASAAKAIRKYVGSAKKPSALIVFQGTVY  480

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GN APVMAA SSRGP++  P++IKPDVTAPGV+ILAAWPPNI P+MLE+DNRSV FNI+S
Sbjct  481   GNTAPVMAALSSRGPNSAGPDVIKPDVTAPGVDILAAWPPNISPSMLESDNRSVLFNIIS  540

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTN-PISATP  1257
             GTSMSCPHVSGLA+LLKSVH DWSPAAIKSALMTT+YTL+++ +PI D  ST+   SATP
Sbjct  541   GTSMSCPHVSGLASLLKSVHRDWSPAAIKSALMTTAYTLNNKGAPIADIGSTSTSKSATP  600

Query  1258  FAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS-ACPTHHHHQP  1434
             FAFGSGHVDPE AA PGL+YDI+ +DY  YLCSL+YNS+QI+L     +  CP +   QP
Sbjct  601   FAFGSGHVDPENAADPGLVYDITAEDYLFYLCSLSYNSSQIALFSSGVNFTCPKNAVLQP  660

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNK  1614
             GDLNYPSF+V+F   + N S T+ RT  NVG   S YAV V EP GVSV V+P+ L F K
Sbjct  661   GDLNYPSFSVLFSKDARNMSVTYKRTVKNVGKIPSTYAVQVKEPTGVSVTVEPRSLGFKK  720

Query  1615  MGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             MG+ LSY VSFVA  G   +    SFG+L W S  + V SPIAV W
Sbjct  721   MGEKLSYKVSFVALGGPALTNS--SFGTLTWVSGKYRVGSPIAVTW  764



>gb|KHN13887.1| Subtilisin-like protease [Glycine soja]
Length=687

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/586 (65%), Positives = 452/586 (77%), Gaps = 4/586 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GART++KGYE + GK+NETV Y SPRDSEGHGTHTASTAAG++VK+A+  G A G+
Sbjct  105   KKLIGARTYFKGYEKVFGKLNETVSYLSPRDSEGHGTHTASTAAGNVVKNANLYGQAGGT  164

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM+YT+RIA YK C+  GC++ D+LAAVDQAV DGVD+LSLSLG   PKPFY D IA+
Sbjct  165   ASGMRYTSRIAVYKVCWPKGCANSDILAAVDQAVSDGVDVLSLSLGSD-PKPFYDDLIAV  223

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGAT+KGVFV  SAGN GP  S+VSN APWIMTVAASS DR FP  V LGNG+ F+G 
Sbjct  224   ASFGATKKGVFVACSAGNKGPSPSTVSNGAPWIMTVAASSTDRSFPTEVMLGNGKFFKGT  283

Query  541   SLYSGKAVNQKLPLVYGRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLY G   NQ LPLV+G++AG K  A+ CS GSL  +LV G+IVVCERG + R E G  V
Sbjct  284   SLYQGNLTNQ-LPLVFGKSAGTKKEAQHCSEGSLDPKLVHGKIVVCERGKNGRTEMGEVV  342

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTV  897
             K +GGAGMI++N E +GEE+YAD H LPAT+LG S G  ++ YI S K  TASI F GT 
Sbjct  343   KVAGGAGMIVLNAENQGEEIYADLHILPATSLGASEGKTIETYIQSDKKPTASISFMGTK  402

Query  898   YGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNIL  1077
             +G+ APVM AFSSRGPS V P++IKPDVTAPGVNILAAWPP   P+ +  D R V FNIL
Sbjct  403   FGDPAPVMGAFSSRGPSIVGPDVIKPDVTAPGVNILAAWPPKTSPSFIMNDKREVLFNIL  462

Query  1078  SGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATP  1257
              GTSMSCPHVSG+AALLKS+H DWSPAAIKSALMTT+YTL+++ +PI+D  S N   ATP
Sbjct  463   WGTSMSCPHVSGIAALLKSLHKDWSPAAIKSALMTTAYTLNNKGAPISDMASDNKAFATP  522

Query  1258  FAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPG  1437
             FAFGSGHV+P  A  PGL+YDI T+DY NYLCSLNY S+QI+LL R K AC      Q G
Sbjct  523   FAFGSGHVNPVSAFDPGLVYDIGTEDYLNYLCSLNYTSSQIALLSRGKFACSKKAVLQAG  582

Query  1438  DLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKM  1617
             DLNYPSFAV+FD S+ N++ T+TR  TNVG P+S YAV V +PDGVSV V+P+VLKF K+
Sbjct  583   DLNYPSFAVLFDRSALNANVTYTRVVTNVGKPQSAYAVKVKQPDGVSVTVEPRVLKFEKV  642

Query  1618  GQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             GQ LSY V+F+A  GK    G  SFGSL+W S  + VRSPIA+ W+
Sbjct  643   GQKLSYKVTFLA-VGKARVAGTSSFGSLIWVSGRYQVRSPIALTWK  687



>ref|XP_003551824.2| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=767

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/587 (65%), Positives = 452/587 (77%), Gaps = 5/587 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KKL+GART+YKGYE   GK INETV+Y SPRDSEGHGTHTASTAAG +VK+A+  G ARG
Sbjct  184   KKLIGARTYYKGYEKFFGKKINETVDYLSPRDSEGHGTHTASTAAGRVVKNANLFGQARG  243

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
             +A GM+YT+RIA YK C+  GC++ D+LAAVDQAV DGVD+LSLSLG   PKPFY D IA
Sbjct  244   TASGMRYTSRIAVYKVCWPKGCANSDILAAVDQAVSDGVDVLSLSLGSD-PKPFYDDLIA  302

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             +A+FGAT+KGVFV  SAGN GP  S+VSN APWIMTVAASS DR FP  V LGNG+ F+G
Sbjct  303   VASFGATKKGVFVACSAGNKGPSPSTVSNGAPWIMTVAASSTDRSFPTEVMLGNGKFFKG  362

Query  538   ESLYSGKAVNQKLPLVYGRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLY G   NQ LPLV+G++AG K  A+ CS GSL  +LV G+IVVCERG + R E G  
Sbjct  363   TSLYQGNLTNQ-LPLVFGKSAGTKKEAQHCSEGSLDPKLVHGKIVVCERGKNGRTEMGEV  421

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GGAGMI++N E +GEE+YAD H LPAT+LG S G  ++ YI S K  TASI F GT
Sbjct  422   VKVAGGAGMIVLNAENQGEEIYADLHILPATSLGASEGKTIETYIQSDKKPTASISFMGT  481

Query  895   VYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
              +G+ APVM AFSSRGPS V P++IKPDVTAPGVNILAAWPP   P+ +  D R V FNI
Sbjct  482   KFGDPAPVMGAFSSRGPSIVGPDVIKPDVTAPGVNILAAWPPKTSPSFIMNDKREVLFNI  541

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISAT  1254
             L GTSMSCPHVSG+AALLKS+H DWSPAAIKSALMTT+YTL+++ +PI+D  S N   AT
Sbjct  542   LWGTSMSCPHVSGIAALLKSLHKDWSPAAIKSALMTTAYTLNNKGAPISDMASDNKAFAT  601

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQP  1434
             PFAFGSGHV+P  A  PGL+YDI T+DY NYLCSLNY S+QI+LL R K AC      Q 
Sbjct  602   PFAFGSGHVNPVSAFDPGLVYDIGTEDYLNYLCSLNYTSSQIALLSRGKFACSKKAVLQA  661

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNK  1614
             GDLNYPSFAV+FD S+ N++ T+TR  TNVG P+S YAV V +PDGVSV V+P+VLKF K
Sbjct  662   GDLNYPSFAVLFDRSALNANVTYTRVVTNVGKPQSAYAVKVKQPDGVSVTVEPRVLKFEK  721

Query  1615  MGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             +GQ LSY V+F+A  GK    G  SFGSL+W S  + VRSPIA+ W+
Sbjct  722   VGQKLSYKVTFLAV-GKARVAGTSSFGSLIWVSGRYQVRSPIALTWK  767



>ref|XP_007139243.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 ref|XP_007139244.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 gb|ESW11237.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
 gb|ESW11238.1| hypothetical protein PHAVU_008G013300g [Phaseolus vulgaris]
Length=770

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/587 (65%), Positives = 461/587 (79%), Gaps = 5/587 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVG-KINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KKL+GAR+++KGYE   G KINETV+Y SPRDS+GHGTHTASTAAG++VK+A+FLG A+G
Sbjct  187   KKLIGARSYFKGYEKYFGRKINETVDYLSPRDSQGHGTHTASTAAGNVVKNANFLGQAKG  246

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
             +A GM+YT+RIAAYK C++ GC++ DVLAA+DQAV DGVD+LSLSLG + PKPFY+D+IA
Sbjct  247   TATGMRYTSRIAAYKVCWSSGCTNSDVLAAMDQAVSDGVDVLSLSLGSI-PKPFYSDSIA  305

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             IA+FGAT+KG+ V  SAGNSGP  S+V N APWIMTVAASS DR FP  V+LGNG+ F+G
Sbjct  306   IASFGATEKGILVACSAGNSGPFPSTVGNGAPWIMTVAASSTDRTFPTKVKLGNGQSFKG  365

Query  538   ESLYSGKAVNQKLPLVYGRTAGG-KGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLY GK   Q L LVYG++AG  K A++C  GSL  +LV G+IV CE+G + R EKG E
Sbjct  366   SSLYQGKKTKQ-LSLVYGKSAGTTKEAQYCIGGSLDPKLVHGKIVACEKGINGRTEKGEE  424

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GGAGMIL+N E +GEE++ADPH LPAT+LG SA   V+ Y  S+K  TASI F GT
Sbjct  425   VKVAGGAGMILLNNEYQGEELFADPHILPATSLGASASEIVRSYSQSAKKPTASISFMGT  484

Query  895   VYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
              +G+ APVMAAFSSRGPS V P++IKPDVTAPGVNILAAWPP I P+ L++D R V FNI
Sbjct  485   RFGDPAPVMAAFSSRGPSLVGPDVIKPDVTAPGVNILAAWPPKISPSFLKSDKRKVLFNI  544

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISAT  1254
             LSGTSMSCPHVSG+AALLKS+H DWSPAAIKSALMTTSYTL+++ +PI+D  S N   AT
Sbjct  545   LSGTSMSCPHVSGIAALLKSLHKDWSPAAIKSALMTTSYTLNNKGAPISDMASNNSSLAT  604

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQP  1434
             PF FGSGHV+P  A+ PGL+YDIST+DY NY CS+NY S+QI+LL R+K  C      Q 
Sbjct  605   PFVFGSGHVNPVSASDPGLVYDISTKDYLNYFCSINYTSSQIALLSRRKFVCSKKAVLQA  664

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNK  1614
             GDLNYPSFAV+F  S+ N+S T+ R  TNVG  +S YAV V +P+GVSV V+P+ LKF K
Sbjct  665   GDLNYPSFAVLFGRSAFNASVTYMRVVTNVGKSKSSYAVKVEQPNGVSVSVEPRKLKFEK  724

Query  1615  MGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             +GQ LSY V+F A  G    GG  SFGSL+W S  + VRSPIA+ WQ
Sbjct  725   LGQKLSYNVTFFATGGPKV-GGTSSFGSLIWVSDRYKVRSPIAITWQ  770



>ref|XP_002272965.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
 ref|XP_010661615.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=767

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/587 (65%), Positives = 462/587 (79%), Gaps = 6/587 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR F+KGYE+  G+INETV+Y+S RDS+GHGTHTASTAAGD+V  AS  G+A+GS
Sbjct  185   KKLIGARAFFKGYEARAGRINETVDYRSARDSQGHGTHTASTAAGDMVAGASIFGMAKGS  244

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM YT+RIAAYK CY  GC++ D+LAA+DQAV DGVDILSLSLGG   +P+Y+D++AI
Sbjct  245   ASGMMYTSRIAAYKVCYIQGCANSDILAAIDQAVSDGVDILSLSLGGAS-RPYYSDSLAI  303

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGA Q GV V  SAGNSGP +S+VSN+APWIMT+AASSLDR FP +V+LGNG  + G 
Sbjct  304   ASFGAVQNGVLVSCSAGNSGPSSSTVSNSAPWIMTIAASSLDRSFPTIVKLGNGETYHGA  363

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLYSGK  + KL L YG TAG +GAE+C+ G+LS  L+KG+IVVC+RG + R +KG +V+
Sbjct  364   SLYSGKPTH-KLLLAYGETAGSQGAEYCTMGTLSPDLIKGKIVVCQRGINGRVQKGEQVR  422

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGAGM+L+N E +GEE+ AD H LPAT+LG SA  ++ KY  SS++ TASI FQGTVY
Sbjct  423   MAGGAGMLLLNTEDQGEELIADAHILPATSLGASAAKSIIKYA-SSRNPTASIVFQGTVY  481

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GN APVMAAFSSRGP++  P +IKPDVTAPGVNILA+WPP + PT L  DNRSV FNI+S
Sbjct  482   GNPAPVMAAFSSRGPASEGPYVIKPDVTAPGVNILASWPPTVSPTRLNTDNRSVLFNIVS  541

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSGLAALLK+VH DWSPAAIKSALMTT+YTLD++++ I+D + +    ATPF
Sbjct  542   GTSMSCPHVSGLAALLKAVHKDWSPAAIKSALMTTAYTLDNKRASISD-MGSGGSPATPF  600

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS-ACPTHH-HHQP  1434
             A GSGHV+PE+A+ PGLIYDI+T DY N+LCSLNY S+QI+L+ R  S  CP    H QP
Sbjct  601   ACGSGHVNPEKASDPGLIYDITTDDYLNHLCSLNYTSSQIALVSRGISFTCPNDTLHLQP  660

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNK  1614
             GDLNYPS AV+F+ ++ N+S T+ RT TNVG P S Y   V EPDGVSV+V+P VLKF K
Sbjct  661   GDLNYPSLAVLFNGNAQNNSATYKRTVTNVGQPTSTYVAQVQEPDGVSVMVEPSVLKFRK  720

Query  1615  MGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
               Q LSY VSFVA     AS    SFGSLVW S    VRSPIA+ WQ
Sbjct  721   FNQRLSYKVSFVAMGAASASVPSSSFGSLVWVSKKHRVRSPIAITWQ  767



>gb|KHN13888.1| Subtilisin-like protease [Glycine soja]
Length=738

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/588 (65%), Positives = 460/588 (78%), Gaps = 7/588 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KKL+GART+YKGYE   GK INETV+Y SPRDSEGHGTHTASTAAG +VK+A+  G ARG
Sbjct  155   KKLIGARTYYKGYEKFFGKKINETVDYLSPRDSEGHGTHTASTAAGRVVKNANLFGQARG  214

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
             +A GM+YT+RIA YK C++ GC++ DVLAA+DQAV DGVD+LSLSLG + PKPFY+D+IA
Sbjct  215   TASGMRYTSRIAVYKVCWSSGCTNADVLAAMDQAVSDGVDVLSLSLGSI-PKPFYSDSIA  273

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             IA+FGAT+KGVFV  SAGNSGP  S+V N APWI TVAASS DR FP  V+LGNG+ F G
Sbjct  274   IASFGATKKGVFVACSAGNSGPFPSTVGNGAPWITTVAASSTDRSFPTKVKLGNGKTFEG  333

Query  538   ESLYSGKAVNQKLPLVYGRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLY GK  NQ LPLVYG++AG K  A++C  GSL  +LV G+IV CERG + R EKG E
Sbjct  334   SSLYQGKKTNQ-LPLVYGKSAGAKKEAQYCIGGSLDPKLVHGKIVACERGINGRTEKGEE  392

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GGAGMIL+N E +GEE++ADPH LPAT+LG SA   ++ Y  S K  TASI F GT
Sbjct  393   VKVAGGAGMILLNNEYQGEELFADPHILPATSLGASASKTIRSYSQSVKKPTASISFMGT  452

Query  895   VYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
              +G+ APVMAAFSSRGPS V P++IKPDVTAPGVNILAAWP  I P+ L +D R V FNI
Sbjct  453   RFGDPAPVMAAFSSRGPSLVGPDVIKPDVTAPGVNILAAWPSKISPSFLMSDKRKVLFNI  512

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISAT  1254
             LSGTSMSCPHVSG+AALLKS H DWSPAAIKSALMTT+YTL+++ +PI+D  S N   AT
Sbjct  513   LSGTSMSCPHVSGIAALLKSFHKDWSPAAIKSALMTTAYTLNNKGAPISDMASDNSPFAT  572

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQP  1434
             PFAFGSGHV+P  A+ PGL+YDIST+DY NYLCS+NY S+QI+LL R K  C      Q 
Sbjct  573   PFAFGSGHVNPVNASDPGLVYDISTKDYLNYLCSINYTSSQIALLSRGKFVCSKKTLLQA  632

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNK  1614
             G+LNYPSF+V+F  S+SN+S T+ R  TNVG P+S YAV + +P+GVSV V+P+ LKF K
Sbjct  633   GNLNYPSFSVLFGRSASNASVTYRRVVTNVGNPQSAYAVKLEQPNGVSVTVEPRKLKFEK  692

Query  1615  MGQNLSYTVSFVAQRG-KIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             +GQ LSY V+F++  G ++A  G  SFGSLVW S  + VRSP+AV W+
Sbjct  693   VGQKLSYKVTFLSIGGARVA--GTSSFGSLVWVSGKYKVRSPMAVTWK  738



>ref|XP_006574858.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006574859.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=772

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/587 (64%), Positives = 457/587 (78%), Gaps = 5/587 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KKLVGAR +YKGYE   GK INETV+Y SPRDS+GHGTHTAST+AG++VK+A+F G ARG
Sbjct  189   KKLVGARAYYKGYEIFFGKKINETVDYLSPRDSQGHGTHTASTSAGNVVKNANFFGQARG  248

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
             +A GM+YT+RIA YK C++ GC++ DVLAA+DQAV DGVD+LSLSLG + PKPFY+D+IA
Sbjct  249   TACGMRYTSRIAVYKVCWSSGCTNADVLAAMDQAVSDGVDVLSLSLGSI-PKPFYSDSIA  307

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             IA++GA +KGV V  SAGNSGP  S+V N APWIMTVAASS DR FP  V+LGNG+ F+G
Sbjct  308   IASYGAIKKGVLVACSAGNSGPFPSTVGNGAPWIMTVAASSTDRSFPTKVKLGNGKTFKG  367

Query  538   ESLYSGKAVNQKLPLVYGRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLY GK  NQ LPLVYG++AG K  A++C  GSL  +LV G+IV CERG + R EKG E
Sbjct  368   SSLYQGKKTNQ-LPLVYGKSAGAKKEAQYCIGGSLDPKLVHGKIVACERGINGRTEKGEE  426

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GGAGMIL+N E +GEE++ADPH LPAT+LG SA   ++ Y  S K  TASI F GT
Sbjct  427   VKVAGGAGMILLNNEYQGEELFADPHILPATSLGASASKTIRSYSQSVKKPTASISFMGT  486

Query  895   VYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
              +G+ APVMAAFSSRGPS V P++IKPDVTAPGVNILAAWP  I P+ L +D R V FNI
Sbjct  487   RFGDPAPVMAAFSSRGPSLVGPDVIKPDVTAPGVNILAAWPTKISPSFLMSDKRKVLFNI  546

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISAT  1254
             LSGTSMSCPHVSG+AALLKS+H DWSPAAIKSALMTT+YTL+++ +PI+D  S N   AT
Sbjct  547   LSGTSMSCPHVSGIAALLKSLHKDWSPAAIKSALMTTAYTLNNKGAPISDMASNNSPLAT  606

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQP  1434
             PFAFGSGHV+P  A+ PGL+YDIST+DY NYLCS+NY S+QI+LL R K  C      Q 
Sbjct  607   PFAFGSGHVNPVSASDPGLVYDISTKDYLNYLCSINYTSSQIALLSRGKFVCSKKAVLQA  666

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNK  1614
             GDLNYPSFAV+   S+ N S T+ R  TNVG P+S YAV + +P+GVSV V+P+ LKF K
Sbjct  667   GDLNYPSFAVLLGKSALNVSVTYRRVVTNVGKPQSAYAVKLEQPNGVSVTVEPRKLKFEK  726

Query  1615  MGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             +GQ LSY V+F++  G   +G   SFGSL+W S  + VRSP+AV WQ
Sbjct  727   VGQKLSYKVTFLSIGGARVAGTS-SFGSLIWVSGRYQVRSPMAVTWQ  772



>gb|KHN04600.1| Subtilisin-like protease [Glycine soja]
Length=734

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/586 (63%), Positives = 456/586 (78%), Gaps = 4/586 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKLVGAR F +GYE   G+INET++Y+S RD++GHGTHTASTAAG++V +AS  GLARGS
Sbjct  152   KKLVGARVFLQGYEKFAGRINETLDYRSARDAQGHGTHTASTAAGNMVSNASLFGLARGS  211

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM+YT+RIAAYK C+ LGC++ D+LAA+DQAV DGVD+LSLSLGG+  KP+Y D+IAI
Sbjct  212   ASGMRYTSRIAAYKVCWRLGCANSDILAAIDQAVADGVDVLSLSLGGIA-KPYYNDSIAI  270

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGATQKGVFV  SAGNSGP +S+  N APWIMTVAAS  DR FP  V+LGNG+VF+G 
Sbjct  271   ASFGATQKGVFVSCSAGNSGPSSSTAGNVAPWIMTVAASYTDRSFPTKVKLGNGKVFKGS  330

Query  541   SLYSGKAVNQKLPLVYGRTAGG-KGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLY GK  N  LPLVYG ++   + A++C+ GSL  + VKG+IV CERG ++R  KG EV
Sbjct  331   SLYKGKQTNL-LPLVYGNSSKAQRTAQYCTKGSLDPKFVKGKIVACERGINSRTGKGEEV  389

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTV  897
             K +GGAGMIL+N E +GEE++ADPH LPAT+LG SA   ++ YI+S+K+ T SI F GT 
Sbjct  390   KMAGGAGMILLNSENQGEELFADPHVLPATSLGSSASKTIRSYIHSAKAPTVSISFLGTT  449

Query  898   YGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNIL  1077
             YG+ APVMAAFSSRGPSAV P++IKPDVTAPGVNILAAWPP   P+ML++D RSV FNI+
Sbjct  450   YGDPAPVMAAFSSRGPSAVGPDVIKPDVTAPGVNILAAWPPTTSPSMLKSDKRSVLFNIV  509

Query  1078  SGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATP  1257
             SGTSMSCPHVSG+A L+KSVH DWSPAAIKSALMTT+ T +++ +PI D+ S N   A P
Sbjct  510   SGTSMSCPHVSGIATLIKSVHKDWSPAAIKSALMTTASTSNNKGAPIADNGSNNSAFADP  569

Query  1258  FAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPG  1437
             FAFGSGHV+PERA+ PGL+YDI+T+DY NYLCSL Y S+QI++L +    C        G
Sbjct  570   FAFGSGHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQIAILSKGNFKCAKKSALHAG  629

Query  1438  DLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKM  1617
             DLNYPSFAV+F +S+ N+S  + R  TNVG P S YAV V EP GVSV V+P+ + F K+
Sbjct  630   DLNYPSFAVLFGTSARNASVAYKRVVTNVGKPSSSYAVKVEEPKGVSVSVEPRNISFRKI  689

Query  1618  GQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             G  LSY V+FV+  G+ A  G  SFGSL W S  +TVRSPIAV WQ
Sbjct  690   GDKLSYKVTFVSY-GRTAIAGSSSFGSLTWVSDKYTVRSPIAVTWQ  734



>gb|KHN27220.1| Subtilisin-like protease [Glycine soja]
Length=741

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/587 (64%), Positives = 456/587 (78%), Gaps = 5/587 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KKLVGAR +YKGYE   GK INETV+Y SPRDS+GHGTHTAST+AG++VK+A+F G ARG
Sbjct  158   KKLVGARAYYKGYEIFFGKKINETVDYLSPRDSQGHGTHTASTSAGNVVKNANFFGQARG  217

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
             +A GM+YT+RIA YK C++ GC++ DVLAA+DQAV DGVD+LSLSLG + PKPFY+D+IA
Sbjct  218   TACGMRYTSRIAVYKVCWSSGCTNADVLAAMDQAVSDGVDVLSLSLGSI-PKPFYSDSIA  276

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             IA++GA +KGV V  SAGNSGP  S+V N APWIMTVAASS DR FP  V+LGNG+ F+G
Sbjct  277   IASYGAIKKGVLVACSAGNSGPFPSTVGNGAPWIMTVAASSTDRSFPTKVKLGNGKTFKG  336

Query  538   ESLYSGKAVNQKLPLVYGRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLY GK  NQ LPLVYG++AG K  A++C  GSL  +LV G+IV CERG + R EKG E
Sbjct  337   SSLYQGKKTNQ-LPLVYGKSAGAKKEAQYCIGGSLDPKLVHGKIVACERGINGRTEKGEE  395

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GGAGMIL+N E +GEE++ADPH LPAT+LG SA   ++ Y  S K  TASI F GT
Sbjct  396   VKVAGGAGMILLNNEYQGEELFADPHILPATSLGASASKTIRSYSQSVKKPTASISFMGT  455

Query  895   VYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
              +G+ APVMAAFSSRGPS V P++IKPDVTAPGVNILAAWP  I P+ L +D R V FNI
Sbjct  456   RFGDPAPVMAAFSSRGPSLVGPDVIKPDVTAPGVNILAAWPTKISPSFLMSDKRKVLFNI  515

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISAT  1254
             LSGTSMSCPHVSG+AALLKS+H DWSPAAIKSALMTT+YTL+++ +PI+D  S N   AT
Sbjct  516   LSGTSMSCPHVSGIAALLKSLHKDWSPAAIKSALMTTAYTLNNKGAPISDMASNNSPLAT  575

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQP  1434
             PFAFGSGHV+P  A+ PGL+YDIST+DY NYLCS+NY S+QI+LL R K  C      Q 
Sbjct  576   PFAFGSGHVNPVSASDPGLVYDISTKDYLNYLCSINYTSSQIALLSRGKFVCSKKAVLQA  635

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNK  1614
             GDLNYPSFAV+   S+ N S T+ R  TNVG P+S YAV + +P+GVSV V+P+ L F K
Sbjct  636   GDLNYPSFAVLLGKSALNVSVTYRRVVTNVGKPQSAYAVKLEQPNGVSVTVEPRKLNFEK  695

Query  1615  MGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             +GQ LSY V+F++  G   +G   SFGSL+W S  + VRSP+AV WQ
Sbjct  696   VGQKLSYKVTFLSIGGARVAGTS-SFGSLIWVSGRYQVRSPMAVTWQ  741



>ref|XP_003528890.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=763

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/586 (63%), Positives = 456/586 (78%), Gaps = 4/586 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKLVGAR F +GYE   G+INET++Y+S RD++GHGTHTASTAAG++V +AS  GLARGS
Sbjct  181   KKLVGARVFLQGYEKFAGRINETLDYRSARDAQGHGTHTASTAAGNMVSNASLFGLARGS  240

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM+YT+RIAAYK C+ LGC++ D+LAA+DQAV DGVD+LSLSLGG+  KP+Y D+IAI
Sbjct  241   ASGMRYTSRIAAYKVCWRLGCANSDILAAIDQAVADGVDVLSLSLGGIA-KPYYNDSIAI  299

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGATQKGVFV  SAGNSGP +S+  N APWIMTVAAS  DR FP  V+LGNG+VF+G 
Sbjct  300   ASFGATQKGVFVSCSAGNSGPSSSTAGNVAPWIMTVAASYTDRSFPTKVKLGNGKVFKGS  359

Query  541   SLYSGKAVNQKLPLVYGRTAGG-KGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLY GK  N  LPLVYG ++   + A++C+ GSL  + VKG+IV CERG ++R  KG EV
Sbjct  360   SLYKGKQTNL-LPLVYGNSSKAQRTAQYCTKGSLDPKFVKGKIVACERGINSRTGKGEEV  418

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTV  897
             K +GGAGMIL+N E +GEE++ADPH LPAT+LG SA   ++ YI+S+K+ T SI F GT 
Sbjct  419   KMAGGAGMILLNSENQGEELFADPHVLPATSLGSSASKTIRSYIHSAKAPTVSISFLGTT  478

Query  898   YGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNIL  1077
             YG+ APVMAAFSSRGPSAV P++IKPDVTAPGVNILAAWPP   P+ML++D RSV FNI+
Sbjct  479   YGDPAPVMAAFSSRGPSAVGPDVIKPDVTAPGVNILAAWPPTTSPSMLKSDKRSVLFNIV  538

Query  1078  SGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATP  1257
             SGTSMSCPHVSG+A L+KSVH DWSPAAIKSALMTT+ T +++ +PI D+ S N   A P
Sbjct  539   SGTSMSCPHVSGIATLIKSVHKDWSPAAIKSALMTTASTSNNKGAPIADNGSNNSAFADP  598

Query  1258  FAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPG  1437
             FAFGSGHV+PERA+ PGL+YDI+T+DY NYLCSL Y S+QI++L +    C        G
Sbjct  599   FAFGSGHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQIAILSKGNFKCAKKSALHAG  658

Query  1438  DLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKM  1617
             DLNYPSFAV+F +S+ N+S  + R  TNVG P S YAV V EP GVSV V+P+ + F K+
Sbjct  659   DLNYPSFAVLFGTSARNASVAYKRVVTNVGKPSSSYAVKVEEPKGVSVSVEPRNISFRKI  718

Query  1618  GQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             G  LSY V+FV+  G+ A  G  SFGSL W S  +TVRSPIAV WQ
Sbjct  719   GDKLSYKVTFVSY-GRTAIAGSSSFGSLTWVSDKYTVRSPIAVTWQ  763



>ref|XP_006490976.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
 gb|KDO85943.1| hypothetical protein CISIN_1g004242mg [Citrus sinensis]
Length=766

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/586 (64%), Positives = 454/586 (77%), Gaps = 9/586 (2%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGSA  183
             KL+GAR F+KGYES+VG+INETV+Y+SPRD++GHGTHTASTAAG++V +A+  GLARG A
Sbjct  188   KLIGARAFFKGYESVVGRINETVDYRSPRDAQGHGTHTASTAAGNIVANANLFGLARGKA  247

Query  184   GGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAIA  363
              GM+YT+RIAAYKAC++LGCSS D+LAA+D+AV DGVD+LSLSLGG   +P+Y D +AIA
Sbjct  248   AGMRYTSRIAAYKACWSLGCSSSDILAAIDKAVADGVDVLSLSLGGSS-RPYYRDTVAIA  306

Query  364   AFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGES  543
             +FGATQ GVFV  SAGNSGP  S+V NTAPWIMTVAAS  DR FPA+V+LGNG  F G S
Sbjct  307   SFGATQSGVFVSCSAGNSGPSISTVDNTAPWIMTVAASYTDRSFPAIVKLGNGHSFEGSS  366

Query  544   LYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVKR  723
             LYSGK   Q LPLV+G+TAG  GAE+C +GSL+ +LVKG+IV+C+RG ++R  KG +VK 
Sbjct  367   LYSGKGSKQ-LPLVFGKTAGVSGAEYCINGSLNRKLVKGKIVICQRGLNSRTGKGEQVKL  425

Query  724   SGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVYG  903
             +GGAGM+L+N + EGEE+ AD H LPA  LG SAG AVKKY+NS+K  TASI F+GTV+G
Sbjct  426   AGGAGMLLLNSDKEGEELIADAHVLPAATLGASAGKAVKKYVNSTKRPTASIVFKGTVFG  485

Query  904   NRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILSG  1083
             N APV+A+FSSRGPS V  ++IKPDVTAPGVNILAAWP    P+ML++D+R V FNI+SG
Sbjct  486   NPAPVIASFSSRGPSLVGHDVIKPDVTAPGVNILAAWPATTSPSMLKSDDRRVLFNIISG  545

Query  1084  TSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITD--SVSTNPISATP  1257
             TSMSCPHVSGLAALLKSVH DWS AAIKSALMTT+YTL++R SPI D    S  P+ AT 
Sbjct  546   TSMSCPHVSGLAALLKSVHEDWSTAAIKSALMTTAYTLNNRNSPIADVGGSSDTPL-ATA  604

Query  1258  FAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPG  1437
             FAFGSGHVDPE A+ PGLIYDI+T+DY +YLCSLNY S Q++L       CP      PG
Sbjct  605   FAFGSGHVDPESASDPGLIYDIATEDYLDYLCSLNYTSLQLALFAGGNFTCPNPSAFHPG  664

Query  1438  DLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKM  1617
              LNYPSFAV F  +  N S  + R+ TNVG     YAV V EP+GV V + P +L F K+
Sbjct  665   KLNYPSFAVNFKGNVKNMSLEYERSVTNVGTSYCTYAVKVEEPNGVLVTITPPILSFQKI  724

Query  1618  GQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             G+ LSY V+FV+ RG        SFGSL W S  + V+SPIAV WQ
Sbjct  725   GEILSYKVTFVSLRG----ASNESFGSLTWVSGKYAVKSPIAVTWQ  766



>ref|XP_010056250.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=757

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/585 (65%), Positives = 458/585 (78%), Gaps = 6/585 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F+KGYES+VGKINET EY+SPRD +GHG+HTASTAAG+ VK AS  GLA GS
Sbjct  179   RKLIGARAFFKGYESVVGKINETTEYRSPRDRQGHGSHTASTAAGNCVKGASLFGLALGS  238

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GMK TARIA YK C+ LGC++ D+LAA+D+A  DGVD+LSLSLGGL  +PFYTDNIA+
Sbjct  239   ATGMKNTARIAVYKVCWRLGCANSDILAAMDRATLDGVDVLSLSLGGLA-RPFYTDNIAV  297

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+F A Q+G+FV  SAGNSGP  S+VSN APWIMTVAAS +DR FP  V+LG G+ F G 
Sbjct  298   ASFSAIQRGIFVACSAGNSGPSPSTVSNAAPWIMTVAASYIDRSFPTKVKLGGGQTFEGS  357

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLYSGK   Q LPLVY  TAGGKGAE+C+ G+L  +LV G+IV+C+RG + R +KG +VK
Sbjct  358   SLYSGKPTEQ-LPLVYRETAGGKGAEYCTAGTLDPKLVNGKIVLCDRGLNGRTDKGQQVK  416

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGA MI++N E +GEE  AD H LPAT++G SA  A+K+++NSS + TASI FQGTV+
Sbjct  417   LAGGAAMIMLNTEDQGEETLADAHILPATSVGASAAKAIKQHLNSSDNPTASISFQGTVF  476

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             G RAPVMAAFSSRGPS V PE+IKPDVTAPGVNILAAW P   P++L +DNRSV FNI+S
Sbjct  477   GYRAPVMAAFSSRGPSLVDPEVIKPDVTAPGVNILAAWTPVAAPSLLTSDNRSVLFNIIS  536

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPH+SGLAALLKSVH DWSPAAIKSALMTTSYT+D+R++PI+D +S+   +ATPF
Sbjct  537   GTSMSCPHISGLAALLKSVHKDWSPAAIKSALMTTSYTVDNRRAPISD-ISSGFKAATPF  595

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
             AFGSGHVDPE A++PGLIYDIST DY N+LCSL YNS+QI+L  +    CP   H  PGD
Sbjct  596   AFGSGHVDPEWASNPGLIYDISTVDYLNHLCSLKYNSSQIALFAKTSYTCPRSAH--PGD  653

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSFAV+F S + N+S T  RTATNVG P S Y V V EPDGVSVIVKP+ L F K+G
Sbjct  654   LNYPSFAVLFKSGARNASITHKRTATNVGCPVSRYQVLVDEPDGVSVIVKPRNLVFGKLG  713

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             +  SY V+FV+  G   S      GS+ W S  + VRSP+A  W 
Sbjct  714   EKQSYRVTFVSLGGSSVSSNSSF-GSITWFSGRYIVRSPVAATWN  757



>ref|XP_004308418.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=743

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/587 (65%), Positives = 448/587 (76%), Gaps = 10/587 (2%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGSA  183
             KL+GAR+F +GYE+IVG +NETV+Y+SPRDSEGHGTHTASTA G++VK AS  GLA+GSA
Sbjct  162   KLIGARSFLQGYEAIVGTVNETVDYRSPRDSEGHGTHTASTAGGNVVKQASLFGLAKGSA  221

Query  184   GGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAIA  363
              GM+Y++RIAAYKAC+ LGCS+ DV+AA+D AV DGVDILSLSLGGL  +P++ D+IAIA
Sbjct  222   SGMRYSSRIAAYKACWPLGCSNSDVMAAIDSAVSDGVDILSLSLGGLS-RPYFRDSIAIA  280

Query  364   AFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGES  543
             +FGA Q GV V  SAGNSGP  SSVSNTAPWI+TVAAS  DR FP +V+LGNG+ F G S
Sbjct  281   SFGAVQHGVSVSFSAGNSGPFRSSVSNTAPWILTVAASYTDRSFPVLVKLGNGQTFEGSS  340

Query  544   LYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVKR  723
             LYSGK   Q LPLVY RTAGG+GAE C  GSL   LVKG+IV CERG  +R E G EVK+
Sbjct  341   LYSGKKTKQ-LPLVYNRTAGGQGAEHCVDGSLDINLVKGKIVACERGTHSRTEIGEEVKK  399

Query  724   SGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVYG  903
             +GGAGM+L+N E EGEE+ AD H LPAT+LG  A  AV++Y  ++K  TA + FQGTVYG
Sbjct  400   AGGAGMLLLNNEAEGEELLADAHILPATSLGAIASKAVREYAGAAKKPTAMLVFQGTVYG  459

Query  904   NRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILSG  1083
               APVMAAFSSRGPS+V P++IKPDVTAPGVNILAAWP    PT L++D R V FN++SG
Sbjct  460   RTAPVMAAFSSRGPSSVGPDVIKPDVTAPGVNILAAWPAKTSPTRLKSDKRKVVFNMVSG  519

Query  1084  TSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPFA  1263
             TSMSCPHVSGLAAL+KSVH DWSPAAIKSALMTT+YTL+++ SPI+D  S N   A PFA
Sbjct  520   TSMSCPHVSGLAALIKSVHKDWSPAAIKSALMTTAYTLNNKGSPISDFGSNNSQPANPFA  579

Query  1264  FGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS--ACPTHHH-HQP  1434
             FGSGH DPE AA PGLIYDI+T DY  YLCSLNY S QI+L     S   CP++    QP
Sbjct  580   FGSGHADPESAADPGLIYDITTNDYLLYLCSLNYTSPQIALFSSGISNFTCPSNSTVLQP  639

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVG-IPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             G+LNYPS +V+F       S T+TRT TNVG I  S YAV V  P GVSV V+P+ L F 
Sbjct  640   GNLNYPSLSVVFRRDGRKMSATYTRTVTNVGAINPSTYAVQVEAPIGVSVTVEPRKLVFK  699

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             KMG+ LSY VSFV       S    SFGSLVW S  + VRSPIAVIW
Sbjct  700   KMGEKLSYKVSFVGMSATTNS----SFGSLVWVSEKYRVRSPIAVIW  742



>ref|XP_006576383.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006576384.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=766

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/587 (64%), Positives = 460/587 (78%), Gaps = 5/587 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKLVGAR F +GYE   G+INET++Y+S RD++GHGTHTASTAAG++V +ASF GLA GS
Sbjct  183   KKLVGARVFLQGYEKSAGRINETLDYRSARDAQGHGTHTASTAAGNMVSNASFFGLAGGS  242

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM+YT+RIAAYK C+ LGC++ D+LAA+DQAV DGVD+LSLSLGG+  KP+Y D+IAI
Sbjct  243   ASGMRYTSRIAAYKVCWRLGCANSDILAAIDQAVADGVDVLSLSLGGIA-KPYYNDSIAI  301

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGATQKGVFV  SAGNSGP +S+  N APWIMTVAAS  DR FP  V+LGNG+VF+G 
Sbjct  302   ASFGATQKGVFVSCSAGNSGPSSSTAGNVAPWIMTVAASYTDRSFPTQVKLGNGKVFKGS  361

Query  541   SLYSGKAVNQKLPLVYGRTA-GGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLY GK  +Q LPLVY  ++   + A++C+ GSL  +LVKG+IV CERG ++R  KG EV
Sbjct  362   SLYKGKKTSQ-LPLVYRNSSRAQRTAQYCTKGSLDPKLVKGKIVACERGINSRTGKGEEV  420

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYI-NSSKSATASIKFQGT  894
             K +GGAGMIL+N E +GEE++ADPH LPAT+LG SA   ++ YI +S+K+ TASI F GT
Sbjct  421   KMAGGAGMILLNSENQGEELFADPHVLPATSLGSSASKTIRSYIFHSAKAPTASISFLGT  480

Query  895   VYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
              YG+ APVMAAFSSRGPS+V P++IKPDVTAPGVNILAAWPP   P+ML++D RSV FNI
Sbjct  481   TYGDTAPVMAAFSSRGPSSVGPDVIKPDVTAPGVNILAAWPPTTSPSMLKSDKRSVLFNI  540

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISAT  1254
             +SGTSMSCPHVSG+AAL+KSVH DWSPAAIKSALMTT+ T +++ +PI+D+ S N   A 
Sbjct  541   VSGTSMSCPHVSGIAALIKSVHKDWSPAAIKSALMTTASTSNNKGAPISDNGSNNSAFAD  600

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQP  1434
             PFAFGSGHV+PERA+ PGL+YDI+T+DY NYLCSL Y S+QI++L +    C        
Sbjct  601   PFAFGSGHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQIAILSKGNFKCAKKSALHA  660

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNK  1614
             G LNYPSFAV+FD+S+ N+S T+ R  TNVG P S YAV V EP GVSV V+P+ + F K
Sbjct  661   GGLNYPSFAVLFDTSARNASVTYKRVVTNVGNPSSSYAVKVEEPKGVSVTVEPRNIGFRK  720

Query  1615  MGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             +G  LSY VSFV+  G+ A  G  SFGSL W S  + VRSPIAV WQ
Sbjct  721   IGDKLSYKVSFVSY-GRTAVAGSSSFGSLTWVSGKYAVRSPIAVTWQ  766



>ref|XP_004492670.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=785

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/589 (63%), Positives = 457/589 (78%), Gaps = 8/589 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR ++KGYE  +GKINET +Y SPRDS+GHGTHTASTAAGD+VK+AS  GLARGS
Sbjct  201   KKLIGARAYFKGYEKFIGKINETTDYLSPRDSQGHGTHTASTAAGDIVKNASIFGLARGS  260

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM++T+RIAAYK C+  GC++ DVLAA+DQAV DGV++LSLSLG + PKPFY D+IAI
Sbjct  261   ASGMRHTSRIAAYKVCWPSGCANSDVLAAMDQAVSDGVNVLSLSLGSI-PKPFYNDSIAI  319

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGAT+ GVFV  SAGNSGP  S+V N APWIMTVAAS  DR FP  V+LGN + F G 
Sbjct  320   ASFGATKNGVFVSCSAGNSGPFASTVGNGAPWIMTVAASYTDRTFPTKVKLGNSKTFEGT  379

Query  541   SLYSGK-AVNQKLPLVYGRTAGGK-GAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SLY GK   +Q LPLVYG+TAG K  A FC+ GSL ++LV G+IVVCERG ++R EKG +
Sbjct  380   SLYQGKNQTSQLLPLVYGKTAGRKREAMFCTKGSLDTKLVHGKIVVCERGINSRTEKGEQ  439

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK+SGG GM+L+N E +GEE+ +DPH LPAT+LG SAG  ++ YINS K  TASI F GT
Sbjct  440   VKKSGGLGMLLLNSENQGEELLSDPHILPATSLGASAGKIIRNYINSVKKPTASISFIGT  499

Query  895   VYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
              Y   AP+MAAFSSRGPS V  ++IKPDVTAPGVNILAAWP    P+++++D R V FNI
Sbjct  500   RYNEPAPIMAAFSSRGPSIVGQDVIKPDVTAPGVNILAAWPSKTSPSLVKSDKRRVLFNI  559

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITD-SVSTNPISA  1251
             +SGTSMSCPHVSG+AAL+KSVH DWSPAAIKS+LMTT+YTL++R +PI+D + + N  SA
Sbjct  560   VSGTSMSCPHVSGIAALIKSVHKDWSPAAIKSSLMTTAYTLNNRNAPISDLAPNNNSASA  619

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
              PFAFGSGHVDPE A+ PGL+YDIST DY NY CSLN+ S+QI++L + K  C +    Q
Sbjct  620   NPFAFGSGHVDPESASDPGLVYDISTNDYLNYFCSLNFTSSQIAILSKSKFNC-SMKQVQ  678

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
              GDLNYPSF+VIF  +  ++S T+ R  TNVG  ESVY V V +P+GV V V+P+ LKF+
Sbjct  679   VGDLNYPSFSVIFSRTGKSASVTYKRVVTNVGKSESVYEVKVEQPNGVVVSVEPRKLKFD  738

Query  1612  KMGQNLSYTVSFVA-QRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             K+GQ L Y V+F    +G++   G  SFGSL+W S  + VRSPIAV WQ
Sbjct  739   KLGQKLRYKVTFFGIGKGRVI--GSSSFGSLIWVSDKYKVRSPIAVTWQ  785



>ref|XP_002272791.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=767

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/584 (63%), Positives = 458/584 (78%), Gaps = 5/584 (1%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGSA  183
             KL+GAR +YKGYE+  GKI+ETV+++S RDS+GHGTHTASTAAG ++  AS  G+A+G A
Sbjct  189   KLIGARAYYKGYEAAAGKIDETVDFRSARDSQGHGTHTASTAAGQMIDGASLFGMAKGVA  248

Query  184   GGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAIA  363
              GM  TARIA YKACY+ GC+S D+LAA+DQAV DGVD+LSLS+GG   KP+YTD +AIA
Sbjct  249   AGMSSTARIAEYKACYSRGCASSDILAAIDQAVSDGVDVLSLSIGGSS-KPYYTDVLAIA  307

Query  364   AFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGES  543
             + GA Q GVFV ++AGNSGP +S+V N APW+MTVAAS++DR FPA+V LGNG+ F GES
Sbjct  308   SLGAVQHGVFVAAAAGNSGPSSSTVVNAAPWMMTVAASTMDRSFPAIVNLGNGQTFEGES  367

Query  544   LYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVKR  723
             LYSGK+  Q LPLVYG +AG   A++CS G+LS  LVKG+IVVCERG +   EKG EV++
Sbjct  368   LYSGKSTEQ-LPLVYGESAGRAIAKYCSSGTLSPALVKGKIVVCERGINGGVEKGQEVEK  426

Query  724   SGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVYG  903
             +GGAGM+L+N  ++GEE+  DPH LPA+ALG SA I+++ Y  SS + TASI F+GTV+G
Sbjct  427   AGGAGMLLLNTASQGEEIRVDPHVLPASALGASASISIRNY-TSSGNPTASIVFKGTVFG  485

Query  904   NRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILSG  1083
               APVMA+FSSRGP+   P +IKPDVTAPGVNILAAWPP + P+ +++DNRSV FN++SG
Sbjct  486   KPAPVMASFSSRGPALKEPYVIKPDVTAPGVNILAAWPPTVSPSKIKSDNRSVLFNVISG  545

Query  1084  TSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPFA  1263
             TSMSCPHV GLAA+LK  H +WSPAAIKSALMTT+YTLD++K+PI+D    +P SATPFA
Sbjct  546   TSMSCPHVGGLAAILKEAHKEWSPAAIKSALMTTAYTLDNKKAPISDMRPNSP-SATPFA  604

Query  1264  FGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGDL  1443
             +GSGHVDPE+A+ PGLIYDI+  DY  YLCSLNY+S+Q++ + R   +CPT+   Q GDL
Sbjct  605   YGSGHVDPEKASKPGLIYDITYVDYLYYLCSLNYSSSQMATISRGNFSCPTYTVLQTGDL  664

Query  1444  NYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMGQ  1623
             NYPSFAV+F  +S N+S    RT TNVG P + Y   V EP+GV +IVKPKVLKF + GQ
Sbjct  665   NYPSFAVLFKRNSENNSAICKRTVTNVGYPRTAYVAQVHEPEGVPIIVKPKVLKFRRAGQ  724

Query  1624  NLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
              LSY V F A  GK ++    SFGSLVW S  +TVRSPIAV W+
Sbjct  725   KLSYEVRF-ADSGKKSNSSDPSFGSLVWVSIKYTVRSPIAVTWK  767



>ref|XP_006583358.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=734

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/582 (63%), Positives = 452/582 (78%), Gaps = 4/582 (1%)
 Frame = +1

Query  13    GARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGSAGGM  192
             GAR F +GYE   G+INET++Y+S RD++GHGTHTASTAAG++V +AS  GLARGSA GM
Sbjct  156   GARVFLQGYEKFAGRINETLDYRSARDAQGHGTHTASTAAGNMVSNASLFGLARGSASGM  215

Query  193   KYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAIAAFG  372
             +YT+RIAAYK C+ LGC++ D+LAA+DQAV DGVD+LSLSLGG+  KP+Y D+IAIA+FG
Sbjct  216   RYTSRIAAYKVCWRLGCANSDILAAIDQAVADGVDVLSLSLGGIA-KPYYNDSIAIASFG  274

Query  373   ATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGESLYS  552
             ATQKGVFV  SAGNSGP +S+  N APWIMTVAAS  DR FP  V+LGNG+VF+G SLY 
Sbjct  275   ATQKGVFVSCSAGNSGPSSSTAGNVAPWIMTVAASYTDRSFPTKVKLGNGKVFKGSSLYK  334

Query  553   GKAVNQKLPLVYGRTAGG-KGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVKRSG  729
             GK  N  LPLVYG ++   + A++C+ GSL  + VKG+IV CERG ++R  KG EVK +G
Sbjct  335   GKQTNL-LPLVYGNSSKAQRTAQYCTKGSLDPKFVKGKIVACERGINSRTGKGEEVKMAG  393

Query  730   GAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVYGNR  909
             GAGMIL+N E +GEE++ADPH LPAT+LG SA   ++ YI+S+K+ T SI F GT YG+ 
Sbjct  394   GAGMILLNSENQGEELFADPHVLPATSLGSSASKTIRSYIHSAKAPTVSISFLGTTYGDP  453

Query  910   APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILSGTS  1089
             APVMAAFSSRGPSAV P++IKPDVTAPGVNILAAWPP   P+ML++D RSV FNI+SGTS
Sbjct  454   APVMAAFSSRGPSAVGPDVIKPDVTAPGVNILAAWPPTTSPSMLKSDKRSVLFNIVSGTS  513

Query  1090  MSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPFAFG  1269
             MSCPHVSG+A L+KSVH DWSPAAIKSALMTT+ T +++ +PI D+ S N   A PFAFG
Sbjct  514   MSCPHVSGIATLIKSVHKDWSPAAIKSALMTTASTSNNKGAPIADNGSNNSAFADPFAFG  573

Query  1270  SGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGDLNY  1449
             SGHV+PERA+ PGL+YDI+T+DY NYLCSL Y S+QI++L +    C        GDLNY
Sbjct  574   SGHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQIAILSKGNFKCAKKSALHAGDLNY  633

Query  1450  PSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMGQNL  1629
             PSFAV+F +S+ N+S  + R  TNVG P S YAV V EP GVSV V+P+ + F K+G  L
Sbjct  634   PSFAVLFGTSARNASVAYKRVVTNVGKPSSSYAVKVEEPKGVSVSVEPRNISFRKIGDKL  693

Query  1630  SYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             SY V+FV+  G+ A  G  SFGSL W S  +TVRSPIAV WQ
Sbjct  694   SYKVTFVSY-GRTAIAGSSSFGSLTWVSDKYTVRSPIAVTWQ  734



>ref|XP_002272999.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
 ref|XP_010661616.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=768

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/587 (65%), Positives = 463/587 (79%), Gaps = 7/587 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR F+KGYE+I G+INE V++KS RDS GHGTHTASTAAG+++  AS  G  +G 
Sbjct  187   KKLIGARVFFKGYEAIRGRINELVDFKSARDSLGHGTHTASTAAGNVIPGASLFGRGKGF  246

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM+YT+RIAAYKACY  GC++ D+LAA+DQAV DGVD+LSLS+GG   KP++ D+IAI
Sbjct  247   ARGMRYTSRIAAYKACYAGGCANSDILAAIDQAVSDGVDVLSLSVGGDS-KPYHIDSIAI  305

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGA Q GVFV  SAGNSGP +S+V+N+APWIMTVAASSLDR FP +V+LGNG  F G 
Sbjct  306   ASFGAVQNGVFVSCSAGNSGPSSSTVANSAPWIMTVAASSLDRSFPTIVKLGNGETFHGA  365

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLYSGKA  Q L L YG TAG  G  +C  G+LS  LVKG+IVVC+RG ++R  KG +VK
Sbjct  366   SLYSGKATKQLL-LAYGETAGRVGVNYCIGGTLSPNLVKGKIVVCKRGVNSRVVKGEQVK  424

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGAGMIL+N E +GEE+ ADPH LPA +LG SAG ++  Y+NS  S TASI F+GT Y
Sbjct  425   MAGGAGMILLNTEAQGEELVADPHVLPAISLGASAGKSIINYVNSGNS-TASIVFRGTAY  483

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GN APVMAAFSSRGP++  P +IKPDVTAPGVNILAAWPP + PT L++DNRSV F++LS
Sbjct  484   GNPAPVMAAFSSRGPASEGPYVIKPDVTAPGVNILAAWPPTVSPTGLKSDNRSVLFDVLS  543

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSGLAALLKSVH DWSPAAIKSALMTT+YTLD+++SPI+D   +   SATPF
Sbjct  544   GTSMSCPHVSGLAALLKSVHKDWSPAAIKSALMTTAYTLDNKRSPISD-FGSGGSSATPF  602

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS-ACPTHH-HHQP  1434
             A+GSGHV+PE+A+ PGLIYDI+T+DY NYLCSLNY S+QI+ + R+ S  CP    H QP
Sbjct  603   AYGSGHVNPEKASKPGLIYDITTEDYLNYLCSLNYTSSQIARVSRRISFTCPNDSVHLQP  662

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNK  1614
             GDLNYPSFAV+F+ ++  +  T+ R+ TNVG P + Y   V EP+GVSV+VKP VLKF +
Sbjct  663   GDLNYPSFAVLFNGNAQKNRATYKRSVTNVGYPTTTYVAQVQEPEGVSVMVKPNVLKFKE  722

Query  1615  MGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             + Q LSY VSFVA R K ++    SFGSLVW S  + VRSPIAV WQ
Sbjct  723   LNQKLSYKVSFVASR-KTSTSSSWSFGSLVWVSRKYRVRSPIAVTWQ  768



>ref|XP_009375850.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/586 (64%), Positives = 449/586 (77%), Gaps = 6/586 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKLVGAR  +KGYE I+G+INET EY+SPRDS GHGTHTAST+AG+LV  AS  GLA+GS
Sbjct  182   KKLVGARALFKGYEGIIGRINETEEYRSPRDSRGHGTHTASTSAGNLVSQASLFGLAKGS  241

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GMK TARIAAYKAC+  GC++ DV+AA+D AV DGVDILSLSLGG   +PFY DNIAI
Sbjct  242   ASGMKRTARIAAYKACWQFGCANSDVMAAIDSAVADGVDILSLSLGGTS-RPFYRDNIAI  300

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
               FGA + GV V  SAGNSGP  SSVSN APWIMTVAAS  DRRFP +V+LGNG++F G 
Sbjct  301   TTFGAVRNGVSVSCSAGNSGPSASSVSNGAPWIMTVAASYTDRRFPTVVKLGNGQIFIGT  360

Query  541   SLYSGKAVNQKLPLVYGRTAGGK-GAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLYSG+   Q LPLVY RTAG   GAEFC  G+L  +LVKG+IVVCE G    A  G +V
Sbjct  361   SLYSGEKTKQ-LPLVYNRTAGNSLGAEFCFEGALVKKLVKGKIVVCESGLYMPAGTGEKV  419

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTV  897
             K++GGAG++L+N + EGEE+ ADPH LPA +LG SA  A+++Y+ SSK  +AS+ FQG+V
Sbjct  420   KKAGGAGLLLLNSDAEGEELIADPHILPAASLGSSAAKAIRQYVMSSKKPSASLVFQGSV  479

Query  898   YGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNIL  1077
             YGN APVMAAFSSRGPS+  P++IKPDVTAPGVNILAAWPP   P+ML++D RSV FNI+
Sbjct  480   YGNTAPVMAAFSSRGPSSAGPDVIKPDVTAPGVNILAAWPPKPSPSMLKSDKRSVPFNII  539

Query  1078  SGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATP  1257
             SGTSMSCPHVSGLA+LLKS H +WSPA IKSALMTT+YT+++++SPI+D  S +   A+P
Sbjct  540   SGTSMSCPHVSGLASLLKSEHNNWSPAEIKSALMTTAYTINNKRSPISDVGSNSSQPASP  599

Query  1258  FAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS-ACPTHHHHQP  1434
             FAFGSGHVDPE AA PGL+YDI+T+DY  YLCSLNYNS+QI+L     +  CP     Q 
Sbjct  600   FAFGSGHVDPESAADPGLVYDITTEDYLLYLCSLNYNSSQIALFSNGVNFTCPGTSVVQS  659

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNK  1614
             GDLNYPSF+VIFD     +S T+ RT  NVG   S YAV V EP GVSV V+PK L+F K
Sbjct  660   GDLNYPSFSVIFDQDRRKTSVTYKRTVKNVGSIPSTYAVQVKEPAGVSVSVEPKTLRFKK  719

Query  1615  MGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             MG+ +SY V FVA  G  A+    SFGSL   +  + VRSPIAV+W
Sbjct  720   MGEKMSYKVRFVALGG--ATSTNSSFGSLTLVAEKYRVRSPIAVLW  763



>gb|KCW72879.1| hypothetical protein EUGRSUZ_E01327, partial [Eucalyptus grandis]
Length=710

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/550 (67%), Positives = 442/550 (80%), Gaps = 5/550 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F+KGYES+VGKINET EY+SPRD +GHG+HTASTAAG+ VK AS  GLA GS
Sbjct  145   RKLIGARAFFKGYESVVGKINETTEYRSPRDRQGHGSHTASTAAGNCVKGASLFGLALGS  204

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GMK TARIA YK C+ LGC++ D+LAA+D+A  DGVD+LSLSLGGL  +PFYTDNIA+
Sbjct  205   ATGMKNTARIAVYKVCWRLGCANSDILAAMDRATLDGVDVLSLSLGGLA-RPFYTDNIAV  263

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+F A Q+G+FV  SAGNSGP  S+VSN APWIMTVAAS +DR FP  V+LG G+ F G 
Sbjct  264   ASFSAIQRGIFVACSAGNSGPSPSTVSNAAPWIMTVAASYIDRSFPTKVKLGGGQTFEGS  323

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLYSGK   Q LPLVY  TAGGKGAE+C+ G+L  +LV G+IV+C+RG + R +KG +VK
Sbjct  324   SLYSGKPTEQ-LPLVYRETAGGKGAEYCTAGTLDPKLVNGKIVLCDRGLNGRTDKGQQVK  382

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGA MI++N E +GEE  AD H LPAT++G SA  A+K+++NSS + TASI FQGTV+
Sbjct  383   LAGGAAMIMLNTEDQGEETLADAHILPATSVGASAAKAIKQHLNSSDNPTASISFQGTVF  442

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             G RAPVMAAFSSRGPS V PE+IKPDVTAPGVNILAAW P   P++L +DNRSV FNI+S
Sbjct  443   GYRAPVMAAFSSRGPSLVDPEVIKPDVTAPGVNILAAWTPVAAPSLLTSDNRSVLFNIIS  502

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPH+SGLAALLKSVH DWSPAAIKSALMTTSYT+D+R++PI+D +S+   +ATPF
Sbjct  503   GTSMSCPHISGLAALLKSVHKDWSPAAIKSALMTTSYTVDNRRAPISD-ISSGFKAATPF  561

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
             AFGSGHVDPE A++PGLIYDIST DY N+LCSL YNS+QI+L  +    CP   H  PGD
Sbjct  562   AFGSGHVDPEWASNPGLIYDISTVDYLNHLCSLKYNSSQIALFAKTSYTCPRSAH--PGD  619

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSFAV+F S + N+S T  RTATNVG P S Y V V EPDGVSVIVKP+ L F K+G
Sbjct  620   LNYPSFAVLFKSGARNASITHKRTATNVGCPVSRYQVLVDEPDGVSVIVKPRNLVFGKLG  679

Query  1621  QNLSYTVSFV  1650
             +  SY V+FV
Sbjct  680   EKQSYRVTFV  689



>ref|XP_010661611.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
 ref|XP_010661612.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=768

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/585 (63%), Positives = 469/585 (80%), Gaps = 5/585 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR +YKGYE+  GKI+ETV+++S RDS+GHGTHTASTAAG ++  AS  G+A+G 
Sbjct  189   KKLIGARAYYKGYEATAGKIDETVDFRSARDSQGHGTHTASTAAGHMIDGASSFGMAKGV  248

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM  TARIAAYKACY  GC++ D+LAA+DQAV DGVD+LSLS+GG   +P+YTD +AI
Sbjct  249   AAGMSCTARIAAYKACYAGGCATSDILAAIDQAVSDGVDVLSLSIGGSS-QPYYTDVLAI  307

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+ GA Q G+FV ++AGNSGP +S+V NTAPW+MTVAAS++DR F A+V LGNG  F GE
Sbjct  308   ASLGAVQHGIFVAAAAGNSGPSSSTVINTAPWMMTVAASTMDRSFTAIVNLGNGETFDGE  367

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLYSG +  Q L LVY ++AGG GA++C+ G+LS  LVKG+IVVCERG +   E G EV+
Sbjct  368   SLYSGTSTEQ-LSLVYDQSAGGAGAKYCTSGTLSPDLVKGKIVVCERGINREVEMGQEVE  426

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
             ++GGAGM+L+N E++GEE+  DPH LPA++LG SA  +++ YI SS++ TASI F GT +
Sbjct  427   KAGGAGMLLLNTESQGEEIRVDPHVLPASSLGASAAKSIRNYI-SSENPTASIVFNGTTF  485

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GN+APV+A+FSSRGP+   P +IKPDVTAPGVNILAAWPP + P+  ++DNRSV FN++S
Sbjct  486   GNQAPVIASFSSRGPAHTEPYVIKPDVTAPGVNILAAWPPTVSPSKTKSDNRSVLFNVIS  545

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTS+SCPHVSGLAA++K  H DWSPAAIKSALMT++YTLD++K+PI+D+ S +P +ATPF
Sbjct  546   GTSISCPHVSGLAAIIKGAHQDWSPAAIKSALMTSAYTLDNKKAPISDTGSESP-TATPF  604

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
             A+GSGHVDPERA++PGL+YDIS +DY  YLCSL Y+S+Q++ + R   +CPT    Q GD
Sbjct  605   AYGSGHVDPERASNPGLVYDISYEDYLYYLCSLKYSSSQMATISRGNFSCPTDTDLQTGD  664

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSFAV+FD +S N+S T+ RT TNVG   + Y V   EP+GVSVIV+PKVLKF + G
Sbjct  665   LNYPSFAVLFDGNSHNNSATYKRTVTNVGYATTTYVVQAHEPEGVSVIVEPKVLKFKQNG  724

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             Q LSYTVSFV Q G+ +S  G SFGSLVW S+ ++VRSPIAV WQ
Sbjct  725   QKLSYTVSFV-QLGQKSSSSGTSFGSLVWGSSRYSVRSPIAVTWQ  768



>gb|AES80028.2| subtilisin-like serine protease [Medicago truncatula]
Length=774

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/587 (62%), Positives = 450/587 (77%), Gaps = 6/587 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR +++GYE  +GKINET +Y+S RDS+GHGTHTAST AG++VK+A+  GLARGS
Sbjct  192   KKLIGARYYFRGYEKFIGKINETTDYRSARDSQGHGTHTASTTAGNVVKNANIFGLARGS  251

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM+YT+RIAAYK C+  GC++ DVLAA+DQAV DGVD+LSLSLG + PKPFY D+IAI
Sbjct  252   ASGMRYTSRIAAYKVCWLSGCANSDVLAAMDQAVSDGVDVLSLSLGSI-PKPFYNDSIAI  310

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGAT+ GVFV  SAGNSGP  S+V N APWIMTVAAS +DR FP  V+LGN + F G 
Sbjct  311   ASFGATKNGVFVSCSAGNSGPFASTVGNGAPWIMTVAASYIDRTFPTKVKLGNSKNFEGT  370

Query  541   SLYSGK-AVNQKLPLVYGRTAGGK-GAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SLY GK   NQ+ PLVYG+TAG K  A FC+  SL  +LV G+IVVCERG + R EKG+E
Sbjct  371   SLYQGKNEPNQQFPLVYGKTAGKKREAVFCTKNSLDKKLVFGKIVVCERGINGRTEKGAE  430

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK SGG GMIL+N   +GEE+ +DPH LPAT+LG SAG A++ Y+N++K  TASI F GT
Sbjct  431   VKNSGGYGMILLNSANQGEELLSDPHILPATSLGASAGKAIRIYLNTTKKPTASISFLGT  490

Query  895   VYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
              YGN AP++AAFSSRGP+ ++ +IIKPDVTAPGVNILAAWP    P+M+++D R V FNI
Sbjct  491   RYGNIAPIVAAFSSRGPNIIAQDIIKPDVTAPGVNILAAWPSKTSPSMIKSDKRRVLFNI  550

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISAT  1254
             +SGTSMSCPHVSG+AAL+KSVH DWSPA IKS+LMTT+YTL++RK PI+D    N   A 
Sbjct  551   VSGTSMSCPHVSGVAALIKSVHKDWSPAMIKSSLMTTAYTLNNRKLPISDLALNNSAPAN  610

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQP  1434
             PFAFGSGHV+PE A+ PGL+YDI+T+DY NY CSLN+ S++I++L +    C      Q 
Sbjct  611   PFAFGSGHVNPESASDPGLVYDINTKDYLNYFCSLNFTSSEITILTKTNFKCSKKPVFQV  670

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNK  1614
             GDLNYPSF+V+F  ++ N   T+ R  TNVG  +S Y V V+EP GV V V+P+ LKF K
Sbjct  671   GDLNYPSFSVLFSKTTHNV--TYKRVVTNVGKSQSAYVVEVLEPHGVIVNVEPRKLKFEK  728

Query  1615  MGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
              GQ LSY V+F+A  GK    G  SFGS++W S  + VRSPIAV WQ
Sbjct  729   FGQKLSYKVTFLAV-GKARVTGSSSFGSIIWVSGKYKVRSPIAVTWQ  774



>ref|XP_010661613.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=767

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/585 (63%), Positives = 461/585 (79%), Gaps = 5/585 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR +YKGYE+  GKI+ETV+++S RDS GHGTHTASTAAG ++  AS  G+A+G 
Sbjct  188   RKLIGARAYYKGYEAAAGKIDETVDFRSARDSHGHGTHTASTAAGHMIDGASIFGMAKGV  247

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM  T RIAAYKACY  GC+S D+LAA+DQAV DGVDILSLS+GG   +P+Y D +AI
Sbjct  248   AAGMSCTGRIAAYKACYARGCASSDILAAIDQAVSDGVDILSLSIGGSS-QPYYADVLAI  306

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+ GA Q GVFV ++AGNSGP +S+V N APW+MTVAAS++DR FPA+V LGNG  F GE
Sbjct  307   ASLGAVQHGVFVAAAAGNSGPSSSTVVNAAPWMMTVAASTMDRSFPAIVNLGNGETFDGE  366

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLYSG +  Q L LVYG +AGG  A++CS G+LSS LVKG+IVVCERG +   EKG EV+
Sbjct  367   SLYSGTSTEQ-LSLVYGESAGGARAKYCSSGTLSSALVKGKIVVCERGINRGVEKGQEVE  425

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
             ++GGAGM+L+N  ++GEE+  DPH LPA++LG SA  +++ YI SS + TASI F GTV+
Sbjct  426   KAGGAGMLLLNTASQGEEIRVDPHVLPASSLGASASKSIRNYI-SSGNPTASIVFNGTVF  484

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             G  APVMA+FSSRGP+ + P +IKPDVTAPGVNILAAWPP +GP+ +++DNRSV FN++S
Sbjct  485   GKPAPVMASFSSRGPALLEPYVIKPDVTAPGVNILAAWPPTVGPSGIKSDNRSVLFNVIS  544

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSGLAA++K  H DWSPAAIKSALMTT+YTLD++K+PI+D+ S +P SATPF
Sbjct  545   GTSMSCPHVSGLAAIIKGAHQDWSPAAIKSALMTTAYTLDNKKAPISDTGSESP-SATPF  603

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
             A GSGHVDPE+A++PGLIYDI  +DY  YLCSL Y+S++++ L R   +CPT    Q GD
Sbjct  604   AHGSGHVDPEKASNPGLIYDIGYEDYLYYLCSLKYSSSEMATLSRGNFSCPTDTDLQTGD  663

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSFAV+FD  S N+S T+ RT TN+G P + Y     EP+GVSVIV+PKVLKFN+ G
Sbjct  664   LNYPSFAVLFDGDSHNNSATYKRTVTNIGYPTTTYVAQAHEPEGVSVIVEPKVLKFNQKG  723

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             Q LSY VSFV    + +S    SFGSLVW S+ ++VRSPIAV WQ
Sbjct  724   QKLSYKVSFVDSG-EKSSSSDSSFGSLVWVSSRYSVRSPIAVTWQ  767



>ref|XP_003623810.1| Subtilisin-like protease [Medicago truncatula]
Length=786

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/587 (62%), Positives = 450/587 (77%), Gaps = 6/587 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR +++GYE  +GKINET +Y+S RDS+GHGTHTAST AG++VK+A+  GLARGS
Sbjct  204   KKLIGARYYFRGYEKFIGKINETTDYRSARDSQGHGTHTASTTAGNVVKNANIFGLARGS  263

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM+YT+RIAAYK C+  GC++ DVLAA+DQAV DGVD+LSLSLG + PKPFY D+IAI
Sbjct  264   ASGMRYTSRIAAYKVCWLSGCANSDVLAAMDQAVSDGVDVLSLSLGSI-PKPFYNDSIAI  322

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGAT+ GVFV  SAGNSGP  S+V N APWIMTVAAS +DR FP  V+LGN + F G 
Sbjct  323   ASFGATKNGVFVSCSAGNSGPFASTVGNGAPWIMTVAASYIDRTFPTKVKLGNSKNFEGT  382

Query  541   SLYSGK-AVNQKLPLVYGRTAGGK-GAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SLY GK   NQ+ PLVYG+TAG K  A FC+  SL  +LV G+IVVCERG + R EKG+E
Sbjct  383   SLYQGKNEPNQQFPLVYGKTAGKKREAVFCTKNSLDKKLVFGKIVVCERGINGRTEKGAE  442

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK SGG GMIL+N   +GEE+ +DPH LPAT+LG SAG A++ Y+N++K  TASI F GT
Sbjct  443   VKNSGGYGMILLNSANQGEELLSDPHILPATSLGASAGKAIRIYLNTTKKPTASISFLGT  502

Query  895   VYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
              YGN AP++AAFSSRGP+ ++ +IIKPDVTAPGVNILAAWP    P+M+++D R V FNI
Sbjct  503   RYGNIAPIVAAFSSRGPNIIAQDIIKPDVTAPGVNILAAWPSKTSPSMIKSDKRRVLFNI  562

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISAT  1254
             +SGTSMSCPHVSG+AAL+KSVH DWSPA IKS+LMTT+YTL++RK PI+D    N   A 
Sbjct  563   VSGTSMSCPHVSGVAALIKSVHKDWSPAMIKSSLMTTAYTLNNRKLPISDLALNNSAPAN  622

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQP  1434
             PFAFGSGHV+PE A+ PGL+YDI+T+DY NY CSLN+ S++I++L +    C      Q 
Sbjct  623   PFAFGSGHVNPESASDPGLVYDINTKDYLNYFCSLNFTSSEITILTKTNFKCSKKPVFQV  682

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNK  1614
             GDLNYPSF+V+F  ++ N   T+ R  TNVG  +S Y V V+EP GV V V+P+ LKF K
Sbjct  683   GDLNYPSFSVLFSKTTHNV--TYKRVVTNVGKSQSAYVVEVLEPHGVIVNVEPRKLKFEK  740

Query  1615  MGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
              GQ LSY V+F+A  GK    G  SFGS++W S  + VRSPIAV WQ
Sbjct  741   FGQKLSYKVTFLAV-GKARVTGSSSFGSIIWVSGKYKVRSPIAVTWQ  786



>ref|XP_010692334.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=777

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/591 (62%), Positives = 458/591 (77%), Gaps = 7/591 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GA+ F+KGYE+I G+IN T E++S RDS GHGTHTASTAAG+ +  AS  G+A+G 
Sbjct  188   KKLIGAKAFFKGYEAINGRINGTDEFRSARDSNGHGTHTASTAAGNAIPGASLFGMAKGI  247

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM++T+RIAAYK C+  GC+S D+LAA+DQAV DGVD+LSLSLGGL P+P+Y D++AI
Sbjct  248   ASGMRFTSRIAAYKVCWGRGCASSDILAAIDQAVADGVDVLSLSLGGL-PRPYYQDSMAI  306

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA QKGVF   SAGNSGP+ S+V N APW+MTVAAS +DR FP  V+L NG+ F G 
Sbjct  307   AAFGAMQKGVFFSCSAGNSGPIPSTVGNMAPWMMTVAASYVDRVFPTKVKLSNGKTFTGS  366

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLYS     ++LPLVY  TAGGK AEFC +GSLSS LVKG+IV+C+RG++ R EKG  VK
Sbjct  367   SLYSVAKKTKQLPLVYKETAGGKRAEFCINGSLSSSLVKGKIVLCDRGSNGRTEKGFVVK  426

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGAGMIL+N  T+GEE++AD H LPAT +G SA  A+K+Y   +K++TASI F GT Y
Sbjct  427   SAGGAGMILLNSPTQGEELFADSHVLPATTVGASAAKAIKEYYILNKNSTASISFYGTRY  486

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             G RAPV+AAFSSRGPS V P +IKPD+TAPGVNILAAWPP I PT L+ DNR V+FNI+S
Sbjct  487   GARAPVVAAFSSRGPSLVDPYVIKPDITAPGVNILAAWPPTISPTELKNDNRRVQFNIVS  546

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDS-VSTNPISATP  1257
             GTSMSCPH+SG+AAL+KSVH DWSPAAIKSA+MT++YT D++   I+D+ VS +   ATP
Sbjct  547   GTSMSCPHLSGIAALVKSVHKDWSPAAIKSAIMTSAYTHDNKGHLISDAYVSKSTKFATP  606

Query  1258  FAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHH---H  1428
             FAFGSGHVDPERA+ PGL+YDIS +DY +YLCS+NY + Q+++L RKK +CP+       
Sbjct  607   FAFGSGHVDPERASDPGLVYDISGEDYLHYLCSINYTNAQLTILARKKYSCPSEKQGKSL  666

Query  1429  QPGDLNYPSFAVIFDssss-nssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLK  1605
             QPGDLNYP+FAV+FD+     ++ T+ RT TNVG P+  Y V V++P  V + VKPKVL 
Sbjct  667   QPGDLNYPAFAVVFDAFQRGKTTLTYKRTVTNVGTPKISYKVFVIKPKNVKINVKPKVLT  726

Query  1606  FNKMGQNLSYTVSFVAQRGKIASGGGHS-FGSLVWKSTNFTVRSPIAVIWQ  1755
             F K+G+  SY+VSF      I S  G S FGSL+W   +++VRSPIAV WQ
Sbjct  727   FKKLGEKQSYSVSFTGSGANITSRSGVSLFGSLMWMGAHYSVRSPIAVTWQ  777



>ref|XP_007134944.1| hypothetical protein PHAVU_010G088700g [Phaseolus vulgaris]
 gb|ESW06938.1| hypothetical protein PHAVU_010G088700g [Phaseolus vulgaris]
Length=764

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/586 (62%), Positives = 447/586 (76%), Gaps = 4/586 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKLVGAR F +GYE   G+INET++Y+S RD++GHG+HTASTAAG+ V +ASF GLA GS
Sbjct  182   KKLVGARVFLQGYEKFAGRINETLDYRSARDAQGHGSHTASTAAGNTVNNASFFGLASGS  241

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM+YT+RIAAYK C+ LGC++ D+LAA+D+AV DGVD+LSLSLGG+  KP+Y D+IAI
Sbjct  242   ATGMRYTSRIAAYKVCWRLGCANSDILAAIDKAVADGVDVLSLSLGGIA-KPYYNDSIAI  300

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGATQKGVFV  SAGNSGP +S+V N APWIMTVAAS  DR FP  V+LGNG+ F+G 
Sbjct  301   ASFGATQKGVFVSCSAGNSGPSSSTVGNVAPWIMTVAASYTDRSFPTQVKLGNGKFFKGS  360

Query  541   SLYSGKAVNQKLPLVYGRTAGG-KGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLY GK  NQ LPLVYG ++   + A++C+ GSL  + VKG+IV CERG ++R  KG EV
Sbjct  361   SLYKGKQTNQ-LPLVYGNSSKAQRTAQYCTKGSLDPKFVKGKIVACERGINSRTGKGEEV  419

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTV  897
             K +GGAGMIL+N E +GEE++ADPH LP T+LG SA   ++ YI+S K+ TASI F GT 
Sbjct  420   KMAGGAGMILLNSENQGEELFADPHVLPGTSLGASASKIIRSYIHSEKAPTASISFLGTA  479

Query  898   YGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNIL  1077
             YG+ APVMAAFSSRGPSAV  ++IKPDVTAPGVNILAAWPP   P+ML++D RS  +NI+
Sbjct  480   YGDPAPVMAAFSSRGPSAVGGDVIKPDVTAPGVNILAAWPPTTSPSMLKSDKRSALYNIV  539

Query  1078  SGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATP  1257
             SGTSMSCPHVSG+AAL+KSVH  WSPAAIKSALMTT+   +++ S I D  S N   A P
Sbjct  540   SGTSMSCPHVSGIAALIKSVHKGWSPAAIKSALMTTASISNNKGSAIADYGSKNSAFADP  599

Query  1258  FAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPG  1437
             FAFGSGHV+PERA+ PGL+YDI+T+DY NYLCSL Y S+QI+LL +    C      + G
Sbjct  600   FAFGSGHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQIALLSKGNFKCAKKSALRAG  659

Query  1438  DLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKM  1617
             DLNYPSFAV+F +S+ N+S  + R  TNVG P+  YAV V EP GVSV V+P  + F K 
Sbjct  660   DLNYPSFAVLFGTSALNASVRYKRIVTNVGNPKISYAVKVEEPKGVSVRVEPTNISFRKT  719

Query  1618  GQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             G+ LSY VSFV+      S G  SFGS+ W S  + VRSPIAV WQ
Sbjct  720   GEKLSYKVSFVSNENTTVS-GSSSFGSITWVSGKYAVRSPIAVTWQ  764



>ref|XP_007051968.1| Subtilase family protein [Theobroma cacao]
 gb|EOX96125.1| Subtilase family protein [Theobroma cacao]
Length=773

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/585 (63%), Positives = 452/585 (77%), Gaps = 5/585 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR F++GYE+  G INET +Y+S RD+EGHGTHTASTAAG+LV++A   GLA GS
Sbjct  192   KKLIGARAFFQGYEAAAGLINETTDYRSARDAEGHGTHTASTAAGNLVENAGIFGLANGS  251

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             AGG +YT+RIAAYK C++ GC S D+LAA+DQA+ DGVD+LSLSLGG   KP+ +D IAI
Sbjct  252   AGGTRYTSRIAAYKVCWSEGCVSSDILAAIDQAILDGVDVLSLSLGGSA-KPYDSDKIAI  310

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A +KG+FV  S GNSGP +S+VSNTAPWIMTVAAS LDR+F   V+LG+G+ F G 
Sbjct  311   GAFQAIKKGIFVSCSGGNSGPSSSTVSNTAPWIMTVAASYLDRKFSTTVKLGDGQTFEGS  370

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLY GKA  Q LPLVYGRTAG   A FC  GSL  +LVKG+IVVC+RG ++RAEKG +VK
Sbjct  371   SLYVGKATKQ-LPLVYGRTAGDATAVFCIDGSLKRKLVKGKIVVCQRGITSRAEKGEQVK  429

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGAGM+L+N E EGEE++AD H LPATALG  AG A+KKY+NS+   TASI F+GTVY
Sbjct  430   LAGGAGMLLVNTENEGEELFADAHILPATALGALAGKAIKKYLNSTTKPTASITFKGTVY  489

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GN AP+MAAFSSRGP+ V P++IKPDVTAPG+NILAAWPP + PT LE+D RSV FN++S
Sbjct  490   GNPAPMMAAFSSRGPNDVGPDLIKPDVTAPGMNILAAWPPLLSPTQLESDKRSVLFNVVS  549

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSG+AAL+KSVH DWSPAAIKSALMTT+Y LD+    I D  S+NP  ATPF
Sbjct  550   GTSMSCPHVSGIAALIKSVHKDWSPAAIKSALMTTAYVLDNTHGGILDVASSNPTVATPF  609

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
             AFGSGHVDPE+A+ PGLIYDI+ +DY NYLCSL Y+++QI+L   +   CP +   QP D
Sbjct  610   AFGSGHVDPEKASDPGLIYDITPEDYLNYLCSLKYSASQIALFAGQGFTCPKNPTMQPED  669

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNY SFAV F  +S +++ TFTRT T+VGIP   + V   EP+GVS+ ++P++LKF K G
Sbjct  670   LNYASFAVNFKPNSKSNTITFTRTVTHVGIPNVTFVVQRNEPNGVSMTIEPEILKFGKPG  729

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVW-KSTNFTVRSPIAVIW  1752
             Q LSY ++F  ++G        SFG + W     + VRSPIAV W
Sbjct  730   QKLSYKITFTQKKGTTPR--EPSFGFIDWVYLQKYHVRSPIAVTW  772



>ref|XP_007051971.1| Subtilase family protein [Theobroma cacao]
 gb|EOX96128.1| Subtilase family protein [Theobroma cacao]
Length=768

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/585 (63%), Positives = 450/585 (77%), Gaps = 8/585 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GA+ F+KGYE+I GKINET ++KS RDS GHGTHTASTAAG  V++AS  GLA GS
Sbjct  192   RKLIGAKFFFKGYEAIGGKINETEDFKSARDSNGHGTHTASTAAGSFVENASLFGLANGS  251

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A G++YT+RIA YKAC+   C++ DVLAA++QA+ DGVD+LSLSLG  + +P+Y D +A+
Sbjct  252   AAGLRYTSRIAVYKACWAT-CTTPDVLAAMEQAILDGVDVLSLSLGAAV-QPYYRDLLAL  309

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+F A   G+FV  SAGN GP  S+V NTAPWIMTV ASS+DR FP +V+LGNG+ F G 
Sbjct  310   ASFWAIANGIFVSFSAGNEGPSKSTVKNTAPWIMTVGASSVDRSFPTIVKLGNGQTFEGS  369

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SL  GK   +KLPLVYG+TAGG+GA++C  GSL+ +LV+G++VVC+RG +ARAEKG  VK
Sbjct  370   SLSVGKG-TEKLPLVYGKTAGGQGAQYCIAGSLNRKLVQGKMVVCQRGKNARAEKGEVVK  428

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGAGM+LIN E EGEE+ AD H LPAT+LG SAG A+KKY+NS+KS TASI F+GT Y
Sbjct  429   MAGGAGMLLINTEREGEELLADSHVLPATSLGASAGNALKKYMNSTKSPTASIAFKGTTY  488

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GNRAP+ AA SSRGP+ V  ++IKPDVTAPGVNILAAWP    P  L++D R V FNIL+
Sbjct  489   GNRAPIAAALSSRGPNLVGLDVIKPDVTAPGVNILAAWPAITSPNELKSDKRRVLFNILT  548

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSG+AALLKS H DWSPAAIKSALMTT+Y  D++ SPI D   ++  SATPF
Sbjct  549   GTSMSCPHVSGIAALLKSRHKDWSPAAIKSALMTTAYVTDNKGSPILDVAFSS--SATPF  606

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
             A GSGHVDPERA+ PGLIYDIS +DY  YLCSL YN++QISL +   + CP H   QPGD
Sbjct  607   ALGSGHVDPERASDPGLIYDISPKDYIYYLCSLKYNASQISLFVDNFT-CPKHAIMQPGD  665

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSFAV F SS++ +  T+ RT TNVG P+S Y V V EP GVSVIVKP++L F  +G
Sbjct  666   LNYPSFAVNFKSSAAENV-TYKRTVTNVGTPKSTYKVLVEEPKGVSVIVKPEILTFKMLG  724

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             + LSY V+F+  + +       SFGSLVW S  + VRSPIA  W 
Sbjct  725   KKLSYKVTFIGLK-RTKPVAASSFGSLVWVSGKYRVRSPIAASWM  768



>ref|XP_010919194.1| PREDICTED: subtilisin-like protease isoform X1 [Elaeis guineensis]
Length=774

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/585 (62%), Positives = 438/585 (75%), Gaps = 9/585 (2%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGSA  183
             KL+GAR ++KGYE+I G INET E++S RDSEGHGTHTASTA GD+V  AS  G A+GSA
Sbjct  198   KLIGARAYWKGYEAIAGPINETREFRSARDSEGHGTHTASTAGGDIVAGASLFGSAKGSA  257

Query  184   GGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAIA  363
              GM+YTARIAAYKAC+  GC+  DVLAAVDQAV DGVD+LSLSLGG   +PFY+D++A+A
Sbjct  258   TGMRYTARIAAYKACWKSGCADSDVLAAVDQAVADGVDVLSLSLGGGSQRPFYSDSVAVA  317

Query  364   AFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGES  543
             AFGA QKGVFV  SAGNSGP  ++V+NTAPWIMTVAAS LDR FP  V+LG+GR  +G S
Sbjct  318   AFGAIQKGVFVSCSAGNSGPYEATVTNTAPWIMTVAASYLDRSFPTEVKLGDGRTLKGAS  377

Query  544   LYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVKR  723
             LYSG+   + LP+VY +TAG + A +C  GSLS +LVKG+IV+CERG   R +KG EVK 
Sbjct  378   LYSGRP-TKLLPIVYDKTAGRQSARYCGPGSLSPKLVKGKIVLCERGIVGRTQKGEEVKL  436

Query  724   SGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVYG  903
             +GGAGM+L+N + +GEE++AD H LPA+ LG +A  A+K YI SSK   A I F GT YG
Sbjct  437   AGGAGMLLVNSQEQGEELFADLHVLPASTLGAAAAKAIKSYITSSKRPMAMITFLGTAYG  496

Query  904   NRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILSG  1083
               AP+M AFSSRGPS V P+IIKPDVTAPG+ ILAAWPP+  P+++E+D R   FNI+SG
Sbjct  497   QPAPMMTAFSSRGPSLVVPDIIKPDVTAPGMGILAAWPPSTSPSLVESDTRRTNFNIISG  556

Query  1084  TSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPFA  1263
             TSMSCPHVSGLAALLK VH DWSPAAIKSALMTT+ TL+++   + D  S  P  ATPFA
Sbjct  557   TSMSCPHVSGLAALLKGVHRDWSPAAIKSALMTTASTLNNKNGSVVDVSSGQP--ATPFA  614

Query  1264  FGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH-HHQPGD  1440
             FGSGHVDPERA++PGL+YDIS +DY +YLCSLNY S Q++ L RK  +CP +       D
Sbjct  615   FGSGHVDPERASNPGLVYDISPKDYLDYLCSLNYTSAQLATLARKNYSCPNNRILGNIRD  674

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSF+V+FD  S N + T TR  TNVG     Y V V EP GV++ V PK L F ++G
Sbjct  675   LNYPSFSVLFDRGSPNFTVTQTRIVTNVGQARCRYTVKVHEPKGVTMNVDPKELDFVELG  734

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             Q LSY VSF+  RG        SFG LVW    ++VRSP+AV WQ
Sbjct  735   QKLSYKVSFLGLRGT-----DTSFGELVWVCGEYSVRSPVAVTWQ  774



>emb|CAN81090.1| hypothetical protein VITISV_040910 [Vitis vinifera]
Length=1109

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/573 (65%), Positives = 453/573 (79%), Gaps = 6/573 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR F+KGYE+  G+INETV+Y+S RDS+GHGTHTASTAAGD+V  AS  G+A+GS
Sbjct  174   KKLIGARAFFKGYEARAGRINETVDYRSARDSQGHGTHTASTAAGDMVAGASIFGMAKGS  233

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM YT+RIAAYK CY  GC++ D+LAA+DQA  DGVDILSLSLGG   +P+Y+D++AI
Sbjct  234   ASGMMYTSRIAAYKVCYIQGCANSDILAAIDQAXSDGVDILSLSLGGAS-RPYYSDSLAI  292

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGA Q GV V  SAGNSGP +S+VSN+APWIMT+AASSLDR FP +V+LGNG  + G 
Sbjct  293   ASFGAVQNGVLVSCSAGNSGPSSSTVSNSAPWIMTIAASSLDRSFPTIVKLGNGETYHGA  352

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLYSGK  + KL L YG TAG +GAE+C+ G+LS  L+KG+IVVC+RG + R +KG +V+
Sbjct  353   SLYSGKPTH-KLLLAYGETAGSQGAEYCTMGTLSPDLIKGKIVVCQRGINGRVQKGEQVR  411

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGAGM+L+N E +GEE+ AD H LPAT+LG SA  ++ KY  SS++ TASI FQGTVY
Sbjct  412   MAGGAGMLLLNTEDQGEELIADAHILPATSLGASAAKSIIKYA-SSRNPTASIVFQGTVY  470

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GN APVMAAFSSRGP++  P +IKPDVTAPGVNILA WPP + PT L  DNRSV FNI+S
Sbjct  471   GNPAPVMAAFSSRGPASEGPYVIKPDVTAPGVNILAXWPPTVSPTRLNTDNRSVLFNIVS  530

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSGLAALLK+VH DWSPAAIKSALMTT+YTLD++++ I+D + +    ATPF
Sbjct  531   GTSMSCPHVSGLAALLKAVHKDWSPAAIKSALMTTAYTLDNKRASISD-MGSGGSPATPF  589

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS-ACPTHH-HHQP  1434
             A GSGHV+PE+A++PG+IYDI+T+DY N+LCSLNY S+QI+L+ R  S  CP    H QP
Sbjct  590   ACGSGHVNPEKASNPGIIYDITTEDYLNHLCSLNYTSSQIALVSRGISFTCPNDTLHLQP  649

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNK  1614
             GDLNYPS AV+F+ ++ N+S T+ RT TNVG P S Y   V EPDGVSV+V+P VLKF K
Sbjct  650   GDLNYPSLAVLFNGNAQNNSATYKRTVTNVGQPTSTYVAQVQEPDGVSVMVEPSVLKFRK  709

Query  1615  MGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKS  1713
               Q LSY VSFVA     AS    SFGSLVW S
Sbjct  710   FNQRLSYKVSFVAMGAASASVPSSSFGSLVWVS  742



>ref|XP_010919195.1| PREDICTED: subtilisin-like protease isoform X2 [Elaeis guineensis]
Length=767

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/585 (62%), Positives = 438/585 (75%), Gaps = 9/585 (2%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGSA  183
             KL+GAR ++KGYE+I G INET E++S RDSEGHGTHTASTA GD+V  AS  G A+GSA
Sbjct  191   KLIGARAYWKGYEAIAGPINETREFRSARDSEGHGTHTASTAGGDIVAGASLFGSAKGSA  250

Query  184   GGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAIA  363
              GM+YTARIAAYKAC+  GC+  DVLAAVDQAV DGVD+LSLSLGG   +PFY+D++A+A
Sbjct  251   TGMRYTARIAAYKACWKSGCADSDVLAAVDQAVADGVDVLSLSLGGGSQRPFYSDSVAVA  310

Query  364   AFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGES  543
             AFGA QKGVFV  SAGNSGP  ++V+NTAPWIMTVAAS LDR FP  V+LG+GR  +G S
Sbjct  311   AFGAIQKGVFVSCSAGNSGPYEATVTNTAPWIMTVAASYLDRSFPTEVKLGDGRTLKGAS  370

Query  544   LYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVKR  723
             LYSG+   + LP+VY +TAG + A +C  GSLS +LVKG+IV+CERG   R +KG EVK 
Sbjct  371   LYSGRP-TKLLPIVYDKTAGRQSARYCGPGSLSPKLVKGKIVLCERGIVGRTQKGEEVKL  429

Query  724   SGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVYG  903
             +GGAGM+L+N + +GEE++AD H LPA+ LG +A  A+K YI SSK   A I F GT YG
Sbjct  430   AGGAGMLLVNSQEQGEELFADLHVLPASTLGAAAAKAIKSYITSSKRPMAMITFLGTAYG  489

Query  904   NRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILSG  1083
               AP+M AFSSRGPS V P+IIKPDVTAPG+ ILAAWPP+  P+++E+D R   FNI+SG
Sbjct  490   QPAPMMTAFSSRGPSLVVPDIIKPDVTAPGMGILAAWPPSTSPSLVESDTRRTNFNIISG  549

Query  1084  TSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPFA  1263
             TSMSCPHVSGLAALLK VH DWSPAAIKSALMTT+ TL+++   + D  S  P  ATPFA
Sbjct  550   TSMSCPHVSGLAALLKGVHRDWSPAAIKSALMTTASTLNNKNGSVVDVSSGQP--ATPFA  607

Query  1264  FGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH-HHQPGD  1440
             FGSGHVDPERA++PGL+YDIS +DY +YLCSLNY S Q++ L RK  +CP +       D
Sbjct  608   FGSGHVDPERASNPGLVYDISPKDYLDYLCSLNYTSAQLATLARKNYSCPNNRILGNIRD  667

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSF+V+FD  S N + T TR  TNVG     Y V V EP GV++ V PK L F ++G
Sbjct  668   LNYPSFSVLFDRGSPNFTVTQTRIVTNVGQARCRYTVKVHEPKGVTMNVDPKELDFVELG  727

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             Q LSY VSF+  RG        SFG LVW    ++VRSP+AV WQ
Sbjct  728   QKLSYKVSFLGLRGT-----DTSFGELVWVCGEYSVRSPVAVTWQ  767



>ref|XP_009411443.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=765

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/585 (61%), Positives = 446/585 (76%), Gaps = 9/585 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGAR F+KGYE++  +INET EY+S RDS+GHGTHTASTAAG++V  AS LG A+GS
Sbjct  190   RKLVGARAFWKGYEAVGSRINETSEYRSARDSQGHGTHTASTAAGNIVAGASLLGNAKGS  249

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM+YTAR+AAYK C+  GC+S D+LAAVD+AV DGVD+LSLSLGG   + +Y+D++AI
Sbjct  250   AKGMRYTARVAAYKGCWNSGCASSDILAAVDRAVADGVDVLSLSLGGGS-REYYSDSVAI  308

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA +KGVF+  SAGNSGP  S+VSNTAPWIMTVAAS LDRR+P  V+LGNGR F G 
Sbjct  309   AAFGAVRKGVFISCSAGNSGPYESTVSNTAPWIMTVAASYLDRRYPTSVKLGNGRTFEGA  368

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLY+GK   + +P+VYG TAGG+GA FC   SLSS+ V G++V+C+RG  +R EKG +VK
Sbjct  369   SLYAGKP-TELVPIVYGDTAGGRGARFCIARSLSSKRVMGKMVLCDRGLISRTEKGEQVK  427

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GG  M+L+N E +GEE++AD H LPA++LG +A  A+K YI SSK+ TA I F+GTVY
Sbjct  428   LAGGVAMLLLNSEEQGEELFADLHVLPASSLGAAATTAIKSYIASSKTPTAMITFEGTVY  487

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             G  AP+MAAFSSRGPS V P+IIKPDVTAPGV ILAAWPP++ P+++++D R V FNI+S
Sbjct  488   GKTAPMMAAFSSRGPSLVGPDIIKPDVTAPGVAILAAWPPSVSPSLVDSDQRRVNFNIIS  547

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSGLAALLKS+H DWSPAAI+SALMTT++++DS+ + I D VST  + ATPF
Sbjct  548   GTSMSCPHVSGLAALLKSLHPDWSPAAIRSALMTTAFSVDSQNASIID-VSTG-LPATPF  605

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
               GSGHVDPE+A+ PGLIYDI+  DY NYLCSL Y   Q++    KK  CP +   +  D
Sbjct  606   VLGSGHVDPEKASKPGLIYDIAPDDYLNYLCSLKYTPQQLATFAGKKYNCPKNKIIRARD  665

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSF+V+FDS    ++ T TRT TNVG     Y V+V EP GV + VKPKVL FNK+G
Sbjct  666   LNYPSFSVLFDSGRKKATLTHTRTVTNVGQAPCGYTVNVREPQGVRITVKPKVLTFNKVG  725

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             Q + Y V+F         G G +FG L W   + T+RSP+ V WQ
Sbjct  726   QKMRYMVTF-----STVGGHGSAFGELAWVGDDATIRSPVTVTWQ  765



>ref|XP_008454762.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=764

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/588 (63%), Positives = 436/588 (74%), Gaps = 6/588 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GA  + KGYE+IVG++NET  ++SPRDS+GHGTHTASTAAG +V +ASF     G 
Sbjct  180   KKLIGASAYIKGYEAIVGRLNETGTFRSPRDSDGHGTHTASTAAGSIVDNASFYNQGMGV  239

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM++T+RI AYK C+ LGC++ D+LAA+D AV DGVD+LSLSLGG     FY DNIAI
Sbjct  240   ASGMRFTSRIVAYKVCWPLGCANADILAAMDSAVADGVDVLSLSLGGGSSS-FYKDNIAI  298

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA QKGVFV  SAGNSGP  S+V N APWIMTVAAS  DR FP  V+LGNG+VF G 
Sbjct  299   AAFGAIQKGVFVSCSAGNSGPSPSTVGNAAPWIMTVAASYTDRTFPTTVKLGNGQVFEGS  358

Query  541   SLYSGKAVNQKLPLVYGRTAG-GKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLY GK++N+ LPLVY  TAG G+    C  GSL   +VKG+IV+CERG  +R EKG +V
Sbjct  359   SLYYGKSINE-LPLVYNNTAGDGQETNVCIAGSLDPSMVKGKIVICERGTISRTEKGEQV  417

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKS-ATASIKFQGT  894
             K +GG GMILIN + EGEE++ADPH LPAT LG SAG A+  YI SSK+ A ASI F+GT
Sbjct  418   KLAGGTGMILINTQFEGEELFADPHVLPATTLGASAGKAILDYIASSKTQAKASIVFEGT  477

Query  895   VYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
              YG++AP +AAFSSRGPS V P++IKPDVTAPGVNILAAWPP + P+ L +D R V FNI
Sbjct  478   KYGSQAPRVAAFSSRGPSLVGPDVIKPDVTAPGVNILAAWPPIVSPSELASDTRRVMFNI  537

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISAT  1254
             +SGTSMSCPHVSGLAALLKS H DWSPAAIKSALMTT+Y  DS+ S I+D    N   AT
Sbjct  538   ISGTSMSCPHVSGLAALLKSAHNDWSPAAIKSALMTTAYVTDSKMSLISDVGQANGEPAT  597

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHH-HQ  1431
             PF FGSGHVDPE+A+ PGLIYDI+ QDY NYLCSL YNS+QI+L+ R    C +     +
Sbjct  598   PFTFGSGHVDPEKASDPGLIYDITPQDYINYLCSLKYNSSQIALVSRGNLTCSSKRTVVK  657

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PGDLNYPSF+V     +   S T  RT TNVGI  S Y V +  P GV+VIVKP+ L F 
Sbjct  658   PGDLNYPSFSVFMKKKAKKVSITLKRTVTNVGITRSDYTVKINNPKGVTVIVKPEKLSFG  717

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
              +G+ LSY VSFV+  GK A     SFGSLVW S  + VRSPI V WQ
Sbjct  718   SLGEQLSYKVSFVSLGGKEAL-DKFSFGSLVWISGKYAVRSPIVVTWQ  764



>ref|XP_002272824.2| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=778

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/590 (62%), Positives = 449/590 (76%), Gaps = 9/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GA+ F++GYES   KINET +++SPRDS GHGTHTAS AAG++V  AS  G+ +G 
Sbjct  188   KKLIGAKAFFQGYESKRKKINETEDFRSPRDSLGHGTHTASIAAGNVVPGASLFGMGKGF  247

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM Y++RIA YKACY LGC + DVLAA+DQAV DGVD+LSLSLGG   +P+Y+D +AI
Sbjct  248   ASGMMYSSRIAVYKACYALGCFASDVLAAIDQAVSDGVDVLSLSLGGPS-RPYYSDPVAI  306

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+ GA QKGV V   AGNSGP   SV N+APW+MTVAASS+DR F  +V+LGNG +F G 
Sbjct  307   ASLGAVQKGVVVAFPAGNSGPSDLSVFNSAPWMMTVAASSMDRSFSTIVKLGNGEIFHGA  366

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAE-----K  705
             SLYSGK+  Q+L LVY  TAG +GA+ C+ G+LS  LVKG+IVVC+RGN +  E     K
Sbjct  367   SLYSGKS-TQQLLLVYNETAGEEGAQLCNGGTLSPDLVKGKIVVCDRGNDSPVERGNAGK  425

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VK +GGAGM+L+N + +GEE+ ADPH LPAT+LG SA  +++KY+ +S +ATASI F
Sbjct  426   GEVVKMAGGAGMLLLNTDEQGEELIADPHILPATSLGASAANSIRKYL-TSGNATASIFF  484

Query  886   QGTVYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             +GT YGN AP +AAFSSRGP+ V   +IKPDVTAPGVNILAAWPP + P+ L++D RSV 
Sbjct  485   KGTAYGNPAPAVAAFSSRGPAFVEAYVIKPDVTAPGVNILAAWPPTVSPSGLQSDKRSVT  544

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FN+LSGTSMSCPHVSG+AALLKSVH DWSPAAIKSALMTT+YT +++ +PI D       
Sbjct  545   FNVLSGTSMSCPHVSGIAALLKSVHKDWSPAAIKSALMTTAYTQNNKWAPILDLGFNGSE  604

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHH  1425
             SA PFA+GSGHVDP RA++PGLIYDI+ +DY NYLCSL Y   Q++L+ R+   CP    
Sbjct  605   SANPFAYGSGHVDPMRASNPGLIYDITHEDYLNYLCSLKYTPEQMALVSRESFTCPNDTV  664

Query  1426  HQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLK  1605
              QPGDLNYPSFAV+FDS   N+S T+ RT TNVG+P S Y V V EP+GVSV V+P VLK
Sbjct  665   LQPGDLNYPSFAVVFDSDVLNNSATYRRTVTNVGLPCSTYVVRVQEPEGVSVRVEPNVLK  724

Query  1606  FNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             F  + Q LSY VSFVA+R + +S G   FGSL W    +TVRSPIAV WQ
Sbjct  725   FRHLNQKLSYRVSFVAER-ESSSSGEAVFGSLSWVFWKYTVRSPIAVTWQ  773



>ref|XP_004140440.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004167887.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=766

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/588 (63%), Positives = 435/588 (74%), Gaps = 6/588 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GA  + KGYE+IVG++NET  ++SPRDS GHGTHTASTAAG +V +ASF     G 
Sbjct  182   KKLIGASFYIKGYEAIVGRLNETGIFRSPRDSNGHGTHTASTAAGSIVNNASFFNQGMGV  241

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A G+++T+RI AYK C+ LGC++ D+LAA+D AV DGVD+LSLSLGG     FY DNIAI
Sbjct  242   ASGIRFTSRIVAYKVCWPLGCANADILAAMDSAVADGVDVLSLSLGGGSSS-FYKDNIAI  300

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA +KGVFV  SAGNSGP  S+V N APWIMTVAAS  DR FP  V+LGNG+VF G 
Sbjct  301   AAFGAIEKGVFVSCSAGNSGPSPSTVGNAAPWIMTVAASYTDRTFPTTVKLGNGQVFEGS  360

Query  541   SLYSGKAVNQKLPLVYGRTAG-GKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLY GK++N+ LPLVY  TAG G+   FC  GSL   +VKG+IVVCERG  +R EKG +V
Sbjct  361   SLYYGKSINE-LPLVYNNTAGDGQETNFCIAGSLDPSMVKGKIVVCERGQISRTEKGEQV  419

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKS-ATASIKFQGT  894
             K +GGAGMILIN E EGEE++ADPH LPAT LG  AG A+  Y  SSK+ A A I F+GT
Sbjct  420   KLAGGAGMILINTEFEGEELFADPHILPATTLGALAGKAILDYTASSKTQAKALIVFEGT  479

Query  895   VYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
              YG++AP +AAFSSRGPS V P++IKPDVTAPGVNILAAWPP + P+ LE+D R V FNI
Sbjct  480   KYGSQAPRVAAFSSRGPSLVGPDVIKPDVTAPGVNILAAWPPIVSPSELESDTRRVLFNI  539

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISAT  1254
             +SGTSMSCPHVSGLAALLKS H DWSPAAIKSALMTT+Y  D++ S I+D    N   AT
Sbjct  540   ISGTSMSCPHVSGLAALLKSAHNDWSPAAIKSALMTTAYITDNKMSLISDVGQANGEPAT  599

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHH-HQ  1431
             PF FGSGHVDPE+A+ PGLIYDI+ QDY NYLCSL YNSTQI+L+ R    C +     +
Sbjct  600   PFTFGSGHVDPEKASDPGLIYDITPQDYINYLCSLKYNSTQIALVSRGNFTCSSKRTVVK  659

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PGDLNYPSF+V     +   S T  RT TNVGI  S Y V +  P G++VIVKP+ L F 
Sbjct  660   PGDLNYPSFSVFMKKKAKKVSITLKRTVTNVGISRSDYTVKINNPKGITVIVKPEKLSFG  719

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
              +G+ LSY V FV+  GK A     SFGSLVW S  + VRSPIAV WQ
Sbjct  720   SLGEQLSYQVRFVSLGGKEAL-DTFSFGSLVWISGKYAVRSPIAVTWQ  766



>ref|XP_008780373.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=765

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/585 (62%), Positives = 440/585 (75%), Gaps = 10/585 (2%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGSA  183
             +L+GAR F+KGYE++ G INET E++S RDSEGHGTHTASTA GD+V  AS  G A+GSA
Sbjct  190   RLIGARAFWKGYEALAGPINETREFRSARDSEGHGTHTASTAGGDIVAGASLFGNAKGSA  249

Query  184   GGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAIA  363
              GM+YTARIAAYKAC+  GC+  DVLAAVD+AV DGVD+LSLSLGG   +PFY+D+IAIA
Sbjct  250   KGMRYTARIAAYKACWNSGCADSDVLAAVDRAVADGVDVLSLSLGGGY-RPFYSDSIAIA  308

Query  364   AFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGES  543
             AFGA QKGVFV  SAGNSGP  ++V+NTAPW++TVAA+ LDR FP  V+LG+GR F+G S
Sbjct  309   AFGAIQKGVFVSCSAGNSGPYEATVTNTAPWVITVAANYLDRSFPTAVKLGDGRTFKGAS  368

Query  544   LYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVKR  723
             LYSG    + LP+ Y +TAGG+ A +C  GSLS +LVKG+IVVCERG   R +KG +VK 
Sbjct  369   LYSGSP-TKLLPIAYDKTAGGRSARYCGPGSLSPKLVKGKIVVCERGLVGRTQKGEQVKL  427

Query  724   SGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVYG  903
             +GGAGM+L++ + +GEE++AD H LPA++LG +A  A+K YI SSK   A I F GT YG
Sbjct  428   AGGAGMLLVSSQEQGEELFADLHVLPASSLGAAAAKAIKTYITSSKRPMAMITFLGTSYG  487

Query  904   NRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILSG  1083
               AP+M AFSSRGPS V P+IIKPDVTAPG+ ILAAWPP + P+++E+D R   FNI+SG
Sbjct  488   QPAPMMTAFSSRGPSLVGPDIIKPDVTAPGMGILAAWPPIVSPSLVESDTRRANFNIISG  547

Query  1084  TSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPFA  1263
             TSMSCPHVSGLAALLK+VH DWSPAAIKSALMTT+YTL+S+   I D  S  P  ATPF 
Sbjct  548   TSMSCPHVSGLAALLKAVHQDWSPAAIKSALMTTAYTLNSKNGYIVDVSSGLP--ATPFV  605

Query  1264  FGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH-HHQPGD  1440
             FGSGHV+PERA++PGL+YDIS +DY +YLCSLNY S Q++ L RK   CP +       D
Sbjct  606   FGSGHVNPERASNPGLVYDISPKDYLDYLCSLNYTSPQLATLARKNYRCPKNRILRNIRD  665

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSF+V+F+S S  S+ T  RT TNVG     Y V V EP GV++ V PK L F +MG
Sbjct  666   LNYPSFSVLFESGSPYSTVTQPRTVTNVGQARCRYTVKVREPKGVTINVDPKELAFVEMG  725

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             Q LSY VSF+       SG   SFG LVW    F+VRSP+AV WQ
Sbjct  726   QKLSYKVSFLG-----LSGSNSSFGELVWVCGEFSVRSPVAVTWQ  765



>ref|XP_007051969.1| Subtilase family protein isoform 1 [Theobroma cacao]
 gb|EOX96126.1| Subtilase family protein isoform 1 [Theobroma cacao]
Length=773

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/585 (62%), Positives = 443/585 (76%), Gaps = 8/585 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GA+ F+ GYE+ VG+INET ++KS RDS GHGTHTASTAAG LV++AS  GLA GS
Sbjct  192   RKLIGAKFFFNGYEATVGRINETEDFKSARDSNGHGTHTASTAAGSLVENASLFGLANGS  251

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A G++YT+RIA YKAC+++ CS  DVLAA++QA+ DGVD+LSLSLG    +P+Y D +A+
Sbjct  252   AAGLRYTSRIAVYKACWSI-CSIPDVLAAMEQAILDGVDVLSLSLGTAA-RPYYRDYMAL  309

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+F A   G+FV  SAGN GP  S+VSNTAPWIMTV AS LDR FP +V+LGNG+ F G 
Sbjct  310   ASFQAIANGIFVSCSAGNYGPSKSTVSNTAPWIMTVGASYLDRSFPTIVKLGNGQTFEGS  369

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLY GK   Q LPLVYG+TAGG+GAE C  GSL+  LV+G++VVC+RG +AR E G  VK
Sbjct  370   SLYVGKGTKQ-LPLVYGKTAGGQGAEHCIAGSLNRDLVQGKMVVCQRGENARTENGEVVK  428

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGAGM+LIN E +GEE+ AD H LPA++LG SAG A+KKY+NS+KS TASI F+GT Y
Sbjct  429   MAGGAGMLLINTENDGEELLADSHVLPASSLGDSAGKAIKKYMNSTKSPTASIVFKGTTY  488

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GNRAP +AAFSSRGP+ V  ++IKPDVTAPGV+ILAAWP    P+ L++D R V FNI+S
Sbjct  489   GNRAPTLAAFSSRGPNLVGLDVIKPDVTAPGVDILAAWPAITSPSELKSDKRRVLFNIIS  548

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSG+AALLKS H DWSPAAIKSALMTT+Y  D++ +PI D  S +  SATPF
Sbjct  549   GTSMSCPHVSGIAALLKSKHKDWSPAAIKSALMTTAYVADNKGTPILDVASGS--SATPF  606

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
               GSGH DPERA+ PGLIYDIS +DY  YLCSL Y  +QIS  +   + CP     QPGD
Sbjct  607   GLGSGHADPERASDPGLIYDISPKDYIYYLCSLKYTDSQISGFVYNFT-CPKDAIMQPGD  665

Query  1441  LNYPSFAVIFDssssns-sHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKM  1617
             LNYPSF V F SS++ + + T+ RT TNVG P+S Y V V EP+GVSV+V PKVL FN +
Sbjct  666   LNYPSFVVNFKSSAAENITLTYHRTVTNVGTPKSTYDVLVEEPEGVSVVVTPKVLTFNML  725

Query  1618  GQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             G+ LSY V+F   + +       SFGSLVW S N+ VRSPIA  W
Sbjct  726   GEKLSYKVTFTGLK-RTKPVAASSFGSLVWVSGNYRVRSPIAASW  769



>ref|XP_006857965.1| hypothetical protein AMTR_s00069p00175260 [Amborella trichopoda]
 gb|ERN19432.1| hypothetical protein AMTR_s00069p00175260 [Amborella trichopoda]
Length=770

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/584 (60%), Positives = 442/584 (76%), Gaps = 8/584 (1%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGSA  183
             KLVGAR ++KGYE+   KIN+T EY+S RDSEGHGTHTASTA G+ + +A+ LG A+GSA
Sbjct  193   KLVGARAYFKGYEANGAKINDTSEYRSARDSEGHGTHTASTAGGNFIANANVLGNAKGSA  252

Query  184   GGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAIA  363
              GM+YTARIA YK C+  GC+S D++AA+DQAV DGVD++SLSLG   P+P+Y+D IAI 
Sbjct  253   AGMRYTARIAVYKVCWGGGCASSDIIAAIDQAVADGVDVISLSLGSG-PRPYYSDPIAIG  311

Query  364   AFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGES  543
             AFGA +KGVF+  SAGNSGP  SSVSN APW+MTV AS LDR FP  + LG+GR F+G S
Sbjct  312   AFGAIRKGVFITCSAGNSGPSESSVSNAAPWLMTVGASYLDRTFPTSIRLGDGRTFKGSS  371

Query  544   LYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVKR  723
             LYSG    + LPLVY  TAG +G+E+C+ GSLS +LV G+IVVCERG ++R +KG +VK 
Sbjct  372   LYSGPPT-KSLPLVYADTAGDQGSEYCTDGSLSKKLVTGKIVVCERGMNSRVQKGEQVKI  430

Query  724   SGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVYG  903
             + GAGM+L+N + +GEE+ AD H LPA+A+G S   A+K Y+ ++K   A I F+GT+YG
Sbjct  431   NKGAGMLLLNTQEQGEELVADAHVLPASAVGASVAQAIKTYMKTTKQPKAQIVFEGTMYG  490

Query  904   NRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILSG  1083
             + AP+MAAFSSRGPSAV  +IIKPD+TAPG+NILAAWP ++GP+ L +D R V+FNI+SG
Sbjct  491   SVAPIMAAFSSRGPSAVGTDIIKPDITAPGMNILAAWPLSVGPSGLPSDKRRVKFNIISG  550

Query  1084  TSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPFA  1263
             TSMSCPHVSGLAALLKSVH DWSPAAIKSALMTT+YT D++  PITD        ATPFA
Sbjct  551   TSMSCPHVSGLAALLKSVHNDWSPAAIKSALMTTAYTFDNKGKPITD--MGKKAQATPFA  608

Query  1264  FGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGDL  1443
             FGSGHV+PERA +PGL+YDIST DY NYLCSLNY+S+Q++++  +   CPT     PGDL
Sbjct  609   FGSGHVNPERATNPGLVYDISTDDYLNYLCSLNYSSSQMAIMAGQSYTCPTQKALLPGDL  668

Query  1444  NYPSFAVIF-DssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             NYPSF++ F +   +NSS T++R  TNVG   S Y   V+ P+GV V V P VL F K G
Sbjct  669   NYPSFSLDFSNGGFNNSSVTYSRVVTNVGTQGSKYEARVVAPEGVVVKVDPLVLAFGKKG  728

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             +  SY V+F+    K     G SFG LVW S  ++VRSPIAV+W
Sbjct  729   EKNSYKVTFMVVSSKTK---GASFGELVWVSNGYSVRSPIAVLW  769



>ref|XP_008454764.1| PREDICTED: subtilisin-like protease [Cucumis melo]
 ref|XP_008454765.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=768

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/588 (62%), Positives = 430/588 (73%), Gaps = 7/588 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GARTF + YE+ VG++N T  ++S RDS+GHGTHTASTAAG+ V  ASF     G 
Sbjct  185   KKLIGARTFIQAYEAAVGRLNATGTFRSARDSDGHGTHTASTAAGNFVNRASFYNQGMGV  244

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM++T+RIAAYK C+  GC+S D+LAA+D AV DGVD+LS+SLGG      Y+D IAI
Sbjct  245   ATGMRFTSRIAAYKVCWPEGCASADILAAMDHAVADGVDVLSISLGGGS-SIIYSDQIAI  303

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA QKGVFV  SAGNSGP  S+V N APW+MTVAAS  DR FP  V LGNG VF G 
Sbjct  304   AAFGAIQKGVFVSCSAGNSGPFISTVGNVAPWVMTVAASYTDRTFPTTVRLGNGMVFEGS  363

Query  541   SLYSGKAVNQKLPLVYGRTAG-GKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLY GK + +  PLVY  TAG G+   FC+ GSL   +VKG+I VCERG ++R EKG +V
Sbjct  364   SLYFGKNLKET-PLVYNNTAGDGRETNFCTPGSLDPTMVKGKIAVCERGTNSRTEKGEQV  422

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSK-SATASIKFQGT  894
             K +GGAGMILIN   EGE++ AD H LPAT++G SAG ++  YI SSK  A ASI F+GT
Sbjct  423   KLAGGAGMILINTILEGEDLLADSHVLPATSVGVSAGKSILNYIASSKRQAKASIMFKGT  482

Query  895   VYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
              YG+RAP +AAFSSRGPS   P +IKPD+TAPGVNILAAWPP + P+ LE+D R V FNI
Sbjct  483   KYGSRAPRVAAFSSRGPSFYKPYVIKPDITAPGVNILAAWPPIVSPSELESDKRRVLFNI  542

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISAT  1254
             +SGTSMSCPHVSGLAALLKSVH DWSPAAIKSALMTT+Y  D++   I+D    +   A 
Sbjct  543   ISGTSMSCPHVSGLAALLKSVHKDWSPAAIKSALMTTAYVTDNKNHLISDVGRASGGPAD  602

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH-HHQ  1431
             PFAFGSGHVDPE+A+ PGL+YDI+ QDY  YLCSL YNSTQI+L+ R K  C +     Q
Sbjct  603   PFAFGSGHVDPEKASDPGLVYDIAPQDYITYLCSLKYNSTQIALVSRGKFTCSSKRTFFQ  662

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PGDLNYPSF+V F     N + TF RT TNVGIP S Y V +  P G+ +IVKP+ L F 
Sbjct  663   PGDLNYPSFSV-FMKKGKNVNSTFKRTVTNVGIPRSDYTVRIYNPKGIRIIVKPEKLSFV  721

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             K+G+ LSY VSFVA  GK  S    SFGSLVW S  + VRSPIAV WQ
Sbjct  722   KLGEKLSYKVSFVA-LGKRKSLDDFSFGSLVWHSGTYVVRSPIAVTWQ  768



>emb|CAN62248.1| hypothetical protein VITISV_022540 [Vitis vinifera]
Length=1677

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/585 (63%), Positives = 458/585 (78%), Gaps = 5/585 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR +YKGYE+  GKI+ETV+++S RDS GHGTHTASTAAG ++  AS  G+A+G 
Sbjct  1098  RKLIGARAYYKGYEAAAGKIDETVDFRSARDSHGHGTHTASTAAGHMIDGASIFGMAKGV  1157

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM  T RIAAYKACY  GC+S D+LAA+DQAV DGVDILSLS+GG   +P+Y D +AI
Sbjct  1158  AAGMSCTGRIAAYKACYARGCASSDILAAIDQAVSDGVDILSLSIGGSS-QPYYADVLAI  1216

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+ GA Q GVFV ++AGNSGP +S+V N APW+MTVAAS++DR FPA+V LGNG  F GE
Sbjct  1217  ASLGAVQHGVFVAAAAGNSGPSSSTVVNAAPWMMTVAASTMDRSFPAIVNLGNGETFXGE  1276

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLYSG +  Q L LVYG +AGG  A++CS G+LS  LVKG+IVVCERG +   EKG EV+
Sbjct  1277  SLYSGTSTEQ-LSLVYGESAGGARAKYCSSGTLSXALVKGKIVVCERGINRGVEKGQEVE  1335

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
             ++GGAGM+L+N  ++GEE+  DPH LPA++LG SA  +++ YI SS + TASI F GTV+
Sbjct  1336  KAGGAGMLLLNTASQGEEIRVDPHVLPASSLGASASXSIRNYI-SSGNPTASIVFNGTVF  1394

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             G  APVMA+FSSRGP+ + P +IKPDVTAPGVNILAAWPP +GP+ +++DNRSV FN++S
Sbjct  1395  GKPAPVMASFSSRGPALLEPYVIKPDVTAPGVNILAAWPPTVGPSGIKSDNRSVLFNVIS  1454

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSGLAA++K  H DWSPAAIKSALMTT+YTLD++K+PI+D+ S +P SATPF
Sbjct  1455  GTSMSCPHVSGLAAIIKGAHQDWSPAAIKSALMTTAYTLDNKKAPISDTGSESP-SATPF  1513

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGD  1440
             A GSGHVDPE+A++PGLIYDI  +DY  YLCSL Y+S++++ L R   +CPT    Q GD
Sbjct  1514  AHGSGHVDPEKASNPGLIYDIGYEDYLYYLCSLKYSSSEMATLSRGNFSCPTDTDLQTGD  1573

Query  1441  LNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMG  1620
             LNYPSFAV+FD  S N+S T+ RT TN+G P + Y     EP+GVSVIV+PKVLKFN+ G
Sbjct  1574  LNYPSFAVLFDGDSHNNSATYKRTVTNIGYPTTTYVAQAHEPEGVSVIVEPKVLKFNQKG  1633

Query  1621  QNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             Q LSY VSFV    K +S      GSLVW S+ ++VRSPIAV WQ
Sbjct  1634  QKLSYKVSFVDSGEKSSSSDSSF-GSLVWVSSRYSVRSPIAVTWQ  1677



>emb|CBI38832.3| unnamed protein product [Vitis vinifera]
Length=1197

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/584 (60%), Positives = 443/584 (76%), Gaps = 22/584 (4%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGSA  183
             KL+GAR +YKGYE+  GKI+ETV+++S RDS+GHGTHTASTAAG ++  AS  G+A+G A
Sbjct  72    KLIGARAYYKGYEAAAGKIDETVDFRSARDSQGHGTHTASTAAGQMIDGASLFGMAKGVA  131

Query  184   GGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAIA  363
              GM  TARIA YKACY+ GC+S D+LAA+DQAV DGVD+LSLS+GG   KP+YTD +AIA
Sbjct  132   AGMSSTARIAEYKACYSRGCASSDILAAIDQAVSDGVDVLSLSIGGSS-KPYYTDVLAIA  190

Query  364   AFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGES  543
             + GA Q GVFV ++AGNSGP +S+V N APW+MTVAAS++DR FPA+V LGNG+ F GES
Sbjct  191   SLGAVQHGVFVAAAAGNSGPSSSTVVNAAPWMMTVAASTMDRSFPAIVNLGNGQTFEGES  250

Query  544   LYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVKR  723
             LYSGK+  Q LPLVYG +AG   A++CS G+LS  LVKG+IVVCERG +   EKG EV++
Sbjct  251   LYSGKSTEQ-LPLVYGESAGRAIAKYCSSGTLSPALVKGKIVVCERGINGGVEKGQEVEK  309

Query  724   SGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVYG  903
             +GGAGM+L+N  ++GEE+  DPH LPA+ALG SA I+++ Y  SS + TASI F+GTV+G
Sbjct  310   AGGAGMLLLNTASQGEEIRVDPHVLPASALGASASISIRNY-TSSGNPTASIVFKGTVFG  368

Query  904   NRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILSG  1083
               APVMA+FSSRGP+   P +IKPDVTAPGVNILAAWPP + P+ +++DNRSV FN++SG
Sbjct  369   KPAPVMASFSSRGPALKEPYVIKPDVTAPGVNILAAWPPTVSPSKIKSDNRSVLFNVISG  428

Query  1084  TSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPFA  1263
             TSMSCPHV GLAA+LK  H +WSPAAIKSALMTT+YTLD++K+PI+D    +P SATPFA
Sbjct  429   TSMSCPHVGGLAAILKEAHKEWSPAAIKSALMTTAYTLDNKKAPISDMRPNSP-SATPFA  487

Query  1264  FGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPGDL  1443
             +GSGHVDPE+A+ PGLIYDI+  DY  YLCSLNY+S+Q++ + R   +CPT+  +   + 
Sbjct  488   YGSGHVDPEKASKPGLIYDITYVDYLYYLCSLNYSSSQMATISRGNFSCPTYTRNSENN-  546

Query  1444  NYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKMGQ  1623
                             S    RT TNVG P + Y   V EP+GV +IVKPKVLKF + GQ
Sbjct  547   ----------------SAICKRTVTNVGYPRTAYVAQVHEPEGVPIIVKPKVLKFRRAGQ  590

Query  1624  NLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
              LSY V F A  GK ++    SFGSLVW S  +TVRSPIAV W+
Sbjct  591   KLSYEVRF-ADSGKKSNSSDPSFGSLVWVSIKYTVRSPIAVTWK  633


 Score =   213 bits (541),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 117/237 (49%), Positives = 140/237 (59%), Gaps = 49/237 (21%)
 Frame = +1

Query  1045  ADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITD  1224
             +D RSV FN+LSGTSMSCPHVSG+AALLKSVH DWSPAAIKSALMTT+YT +++ +PI D
Sbjct  1005  SDKRSVTFNVLSGTSMSCPHVSGIAALLKSVHKDWSPAAIKSALMTTAYTQNNKWAPILD  1064

Query  1225  SVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS  1404
                    SA PFA+GSGHVDP RA++PGLIYDI+ +DY NY  +     T +        
Sbjct  1065  LGFNGSESANPFAYGSGHVDPMRASNPGLIYDITHEDYLNYFATYRRTVTNV--------  1116

Query  1405  ACPTHHHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVI  1584
                                                     G+P S Y V V EP+GVSV 
Sbjct  1117  ----------------------------------------GLPCSTYVVRVQEPEGVSVR  1136

Query  1585  VKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             V+P VLKF  + Q LSY VSFVA+R + +S G   FGSL W    +TVRSPIAV WQ
Sbjct  1137  VEPNVLKFRHLNQKLSYRVSFVAER-ESSSSGEAVFGSLSWVFWKYTVRSPIAVTWQ  1192


 Score =   185 bits (470),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 121/155 (78%), Gaps = 1/155 (1%)
 Frame = +1

Query  1    KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
            KKL+GA+ F++GYES   KINET +++SPRDS GHGTHTAS AAG++V  AS  G+ +G 
Sbjct  831  KKLIGAKAFFQGYESKRKKINETEDFRSPRDSLGHGTHTASIAAGNVVPGASLFGMGKGF  890

Query  181  AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
            A GM Y++RIA YKACY LGC + DVLAA+DQAV DGVD+LSLSLGG   +P+Y+D +AI
Sbjct  891  ASGMMYSSRIAVYKACYALGCFASDVLAAIDQAVSDGVDVLSLSLGGPS-RPYYSDPVAI  949

Query  361  AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMT  465
            A+ GA QKGV V   AGNSGP   SV N+APW+MT
Sbjct  950  ASLGAVQKGVVVAFPAGNSGPSDLSVFNSAPWMMT  984



>ref|XP_004140477.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=739

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/588 (61%), Positives = 432/588 (73%), Gaps = 7/588 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GARTF + YE+ VG++N T  ++S RDS GHGTHTASTAAG+ +  ASF     G 
Sbjct  156   KKLIGARTFIQAYEAAVGRLNGTGIFRSARDSNGHGTHTASTAAGNFINRASFYNQGMGV  215

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM++T+RIA+YK C+  GC+S D+LAA+D AV DGVD+LS+SLGG      Y+D IAI
Sbjct  216   ATGMRFTSRIASYKVCWPEGCASADILAAMDHAVADGVDVLSISLGGGS-SIIYSDQIAI  274

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA QKGVFV  SAGNSGP  S+VSN APW+MTVAAS  DR FP  V LGNG+VF G 
Sbjct  275   AAFGAIQKGVFVSCSAGNSGPFISTVSNVAPWVMTVAASYTDRTFPTTVRLGNGKVFEGS  334

Query  541   SLYSGKAVNQKLPLVYGRTAG-GKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             S Y GK + +++PLVY  TAG G+   FC+ GSL   +V+G+IVVCERG ++R +KG +V
Sbjct  335   SSYFGKNL-KEVPLVYNNTAGDGQETNFCTAGSLDPTMVRGKIVVCERGTNSRTKKGEQV  393

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSK-SATASIKFQGT  894
             K +GGAGMILIN   EGE++ AD H LPAT++G SA  ++  YI SSK  A ASI F+GT
Sbjct  394   KLAGGAGMILINTILEGEDLLADSHVLPATSVGASAAKSILNYIASSKRQAKASIIFKGT  453

Query  895   VYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
              YG+RAP +AAFSSRGPS   P +IKPD+TAPGVNILAAWPP + P+ LE+D R V FNI
Sbjct  454   KYGSRAPRVAAFSSRGPSFFKPYVIKPDITAPGVNILAAWPPIVSPSELESDKRRVLFNI  513

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISAT  1254
             +SGTSMSCPHVSGLAAL+KSVH DWSPAAIKSALMTT+Y  D++K  I+D    +   A 
Sbjct  514   ISGTSMSCPHVSGLAALVKSVHKDWSPAAIKSALMTTAYVTDNKKHLISDVGRASGGPAD  573

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH-HHQ  1431
              FAFGSGHVDPE+A+HPGLIYDI+ QDY  YLCSL Y STQISL+ R K  C + +   Q
Sbjct  574   SFAFGSGHVDPEKASHPGLIYDIAPQDYITYLCSLKYTSTQISLVSRGKFTCSSKNTFSQ  633

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PGDLNYPSF+V F     N + TF RT TNVGIP S Y V +  P G+ +IVKP+ L F 
Sbjct  634   PGDLNYPSFSV-FMKKGKNVNSTFKRTVTNVGIPRSDYTVRINNPKGIRIIVKPEKLNFV  692

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             K+G+ LSY VSF A  GK  S    SFGSLVW S  + VRSPIAV WQ
Sbjct  693   KLGEKLSYKVSFYA-LGKRESLDEFSFGSLVWHSGTYAVRSPIAVTWQ  739



>gb|KHN04108.1| Subtilisin-like protease [Glycine soja]
Length=738

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/587 (60%), Positives = 437/587 (74%), Gaps = 33/587 (6%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKLVGAR F +GYE   G+INET++Y+S RD++GHGTHTASTAAG++V +ASF GLA GS
Sbjct  183   KKLVGARVFLQGYEKSAGRINETLDYRSARDAQGHGTHTASTAAGNMVSNASFFGLAGGS  242

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM+YT+RIAAYK C+ LGC++ D+LAA+DQAV DGVD+LSLSLGG+  KP+Y D+IAI
Sbjct  243   ASGMRYTSRIAAYKVCWRLGCANSDILAAIDQAVADGVDVLSLSLGGIA-KPYYNDSIAI  301

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGATQKGVFV  SAGNSGP +S+  N APWIMTVAAS  DR FP  V+LGNG+VF+G 
Sbjct  302   ASFGATQKGVFVSCSAGNSGPSSSTAGNVAPWIMTVAASYTDRSFPTQVKLGNGKVFKGS  361

Query  541   SLYSGKAVNQKLPLVYGRTA-GGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLY GK  +Q LPLVY  ++   + A++C+ GSL  +LVKG+IV CERG ++R  KG EV
Sbjct  362   SLYKGKKTSQ-LPLVYRNSSRAQRTAQYCTKGSLDPKLVKGKIVACERGINSRTGKGEEV  420

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYI-NSSKSATASIKFQGT  894
             K +GGAGMIL+N E +GEE++ADPH  PAT+LG SA   ++ YI +S+K+ TASI F GT
Sbjct  421   KMAGGAGMILLNSENQGEELFADPHVFPATSLGSSASKTIRSYIFHSAKAPTASISFLGT  480

Query  895   VYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
              YG+ APVMAAFSSRGPS+V P++IKPDVTAP                            
Sbjct  481   TYGDTAPVMAAFSSRGPSSVGPDVIKPDVTAP----------------------------  512

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISAT  1254
             +SGTSMSCPHVSG+AAL+KSVH DWSPAAIKSALMTT+ T +++ +PI+D+ S N   A 
Sbjct  513   VSGTSMSCPHVSGIAALIKSVHKDWSPAAIKSALMTTASTSNNKGAPISDNGSNNSAFAD  572

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQP  1434
             PFAFGSGHV+PERA+ PGL+YDI+T+DY NYLCSL Y S+QI++L +    C        
Sbjct  573   PFAFGSGHVNPERASDPGLVYDITTKDYLNYLCSLKYTSSQIAILSKGNFKCAKKSALHA  632

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNK  1614
             G LNYPSFAV+FD+S+ N+S T+ R  TNVG P S YAV V EP GVSVIV+P+ + F K
Sbjct  633   GGLNYPSFAVLFDTSTRNASVTYKRVVTNVGNPSSSYAVKVEEPKGVSVIVEPRNISFRK  692

Query  1615  MGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             +G  LSY VSFV+  G+ A  G  SFGSL W S  + VRSPIAV WQ
Sbjct  693   IGDKLSYKVSFVSY-GRTAVAGSSSFGSLTWVSGKYHVRSPIAVTWQ  738



>ref|XP_004171629.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease-like 
[Cucumis sativus]
Length=769

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/588 (61%), Positives = 433/588 (74%), Gaps = 7/588 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GARTF + YE+ VG++N T  ++S RDS GHGTHTASTAAG+ +  ASF     G 
Sbjct  186   KKLIGARTFIQAYEAAVGRLNGTGIFRSARDSNGHGTHTASTAAGNFINRASFYNQGMGV  245

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM++T+RIA+YK C+  GC+S D+LAA+D AV DGVD+LS+SLGG      Y+D IAI
Sbjct  246   ATGMRFTSRIASYKVCWPEGCASADILAAMDHAVADGVDVLSISLGGGS-SIIYSDQIAI  304

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA QKGVFV  SAGNSGP  S+VSN APW+MTVAAS  DR FP  V LGNG+VF G 
Sbjct  305   AAFGAIQKGVFVSCSAGNSGPFISTVSNVAPWVMTVAASYTDRTFPTTVRLGNGKVFEGS  364

Query  541   SLYSGKAVNQKLPLVYGRTAG-GKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             S Y GK + +++PLVY  TAG G+   FC+ GSL   +V+G+IVVCERG ++R +KG +V
Sbjct  365   SSYFGKNL-KEVPLVYNNTAGDGQETNFCTAGSLDPTMVRGKIVVCERGTNSRTKKGEQV  423

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSK-SATASIKFQGT  894
             K +GGAGMILIN   EGE++ AD H LPAT++G SA  ++  YI SSK  A ASI F+GT
Sbjct  424   KLAGGAGMILINTILEGEDLLADSHVLPATSVGASAAKSILNYIASSKRQAKASIIFKGT  483

Query  895   VYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
              YG+RAP +AAFSSRGPS ++  +IKPD+TAPGVNILAAWPP + P+ LE+D R V FNI
Sbjct  484   KYGSRAPRVAAFSSRGPSFLNHXVIKPDITAPGVNILAAWPPIVSPSELESDKRRVLFNI  543

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISAT  1254
             +SGTSMSCPHVSGLAAL+KSVH DWSPAAIKSALMTT+Y  D++K  I+D    +   A 
Sbjct  544   ISGTSMSCPHVSGLAALVKSVHKDWSPAAIKSALMTTAYVTDNKKHLISDVGRASGGPAD  603

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH-HHQ  1431
              FAFGSGHVDPE+A+HPGLIYDI+ QDY  YLCSL Y STQISL+ R K  C + +   Q
Sbjct  604   SFAFGSGHVDPEKASHPGLIYDIAPQDYITYLCSLKYTSTQISLVSRGKFTCSSKNTFSQ  663

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PGDLNYPSF+V F     N + TF RT TNVGIP S Y V +  P G+ +IVKP+ L F 
Sbjct  664   PGDLNYPSFSV-FMKKGKNVNSTFKRTVTNVGIPRSDYTVRINNPKGIRIIVKPEKLNFV  722

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             K+G+ LSY VSF A  GK  S    SFGSLVW S  + VRSPIAV WQ
Sbjct  723   KLGEKLSYKVSFYA-LGKRESLDEFSFGSLVWHSGTYAVRSPIAVTWQ  769



>ref|XP_010540256.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=768

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/586 (59%), Positives = 438/586 (75%), Gaps = 9/586 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR FY+GYESIVG+INET +++S RD++GHGTHTASTAAGD+V  ASF GLA+G 
Sbjct  191   KKLIGARAFYRGYESIVGRINETSDFRSARDAQGHGTHTASTAAGDIVPKASFYGLAKGF  250

Query  181   -AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
              A GM++++R+AAYKAC+ LGC+S DVLAA+D+A+ DGV+++SLSLGG   +PFY D IA
Sbjct  251   FAAGMRFSSRVAAYKACWQLGCASSDVLAAIDRAISDGVNVISLSLGGSS-RPFYVDPIA  309

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AFGA +K VFV  SAGNSGP  ++VSN APW+MTVAAS  DR FPA+VE+GNG++F G
Sbjct  310   IGAFGAMEKNVFVSCSAGNSGPSNNTVSNGAPWLMTVAASYTDRTFPAIVEIGNGKLFVG  369

Query  538   ESLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
              SLY GK + + LPL + RTAGG GAEFC   SL   LV+G+IV+C RG S R +KG EV
Sbjct  370   SSLYKGKII-KDLPLAFNRTAGGPGAEFCVRDSLKRELVEGKIVICLRGASGRTDKGQEV  428

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTV  897
             KR+GGA M+L+NR TEGEE+ AD H LPA +LGFSAG ++ KY+  + S++ASI+F+GT 
Sbjct  429   KRNGGAAMLLVNRITEGEELLADAHVLPAVSLGFSAGNSILKYLFIA-SSSASIRFKGTA  487

Query  898   YGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNIL  1077
             YG  AP++AAFSSRGPS   PEI+KPD++APG+NILA W P   P++L +D R V+FN++
Sbjct  488   YGATAPIVAAFSSRGPSVAGPEILKPDISAPGMNILAGWSPFSSPSLLSSDTRRVQFNVI  547

Query  1078  SGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATP  1257
             SGTSMSCPHVSGLAALL +VHGDWS A +KSALMTT+ T D+R  PI D  S     AT 
Sbjct  548   SGTSMSCPHVSGLAALLLAVHGDWSSAMVKSALMTTASTTDNRNRPIGDMGSGPTSPATA  607

Query  1258  FAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPG  1437
             FA G+GHVDP RAA PGL+YDI+  DY NYLCSLNY   +I+L  R    C      + G
Sbjct  608   FALGAGHVDPTRAADPGLVYDITAMDYLNYLCSLNYTMERIALFSRTNYTCTKGVALRSG  667

Query  1438  DLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKM  1617
             DLNYPSFAV F++   +   T+ RT TNVG     Y V V EP GV + V+P VL+F K+
Sbjct  668   DLNYPSFAVNFEAGDRSRL-TYKRTVTNVGSGACEYKVKVEEPRGVKLRVEPDVLRFQKL  726

Query  1618  GQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
              Q+LSY+V+F+++    AS    SFG+LVW   N++VRSPIA  W 
Sbjct  727   RQSLSYSVTFLSE----ASATSSSFGALVWICGNYSVRSPIAATWD  768



>ref|XP_009119746.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=768

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/592 (58%), Positives = 430/592 (73%), Gaps = 16/592 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GA  +YKGYESIVGKINET +++S RD++GHGTHTASTAAGD+V+ AS+ GLA+G 
Sbjct  186   KKIIGAGAYYKGYESIVGKINETTDFRSARDAQGHGTHTASTAAGDIVRKASYFGLAKGR  245

Query  181   -AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
              A GM++++RIAAYKAC+ LGC+S DVLAA+D+A+ DGVD++SLSLGG   +PFY D IA
Sbjct  246   FASGMRFSSRIAAYKACWALGCASTDVLAAIDRAILDGVDVISLSLGGSS-RPFYVDPIA  304

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             IAAFGA QK +FV  SAGNSGP  S+VSN APW+MTVAAS  DR FPA+V +G G+   G
Sbjct  305   IAAFGAMQKNIFVSCSAGNSGPAKSTVSNGAPWLMTVAASYTDRTFPAIVRIGTGKKIVG  364

Query  538   ESLYSGKAVNQKLPLVYGRTAGG-KGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLY GK   + L L +  TAGG  GAEFC   SL   LV+G+IV+C RG   R  KG E
Sbjct  365   SSLYKGKGF-ENLSLAFNTTAGGGSGAEFCVRNSLKRELVEGKIVICLRGAGGRTAKGEE  423

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKS----ATASIK  882
             VK++GG  M+L++R+TEGEE+ ADPH LPA ++G+S GI + KYI           ASI 
Sbjct  424   VKQNGGVAMLLVSRQTEGEELLADPHVLPAVSIGYSDGIVLLKYIAGGGGAANATVASIG  483

Query  883   FQGTVYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
             F+GT YG RAP++AAFSSRGPS   PEI+KPD++APG+NILA W P   P++L +D R V
Sbjct  484   FRGTEYGARAPIVAAFSSRGPSVAGPEIVKPDISAPGLNILAGWSPFSSPSLLRSDPRRV  543

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNI+SGTSM+CPHVSG+AAL+KSVHGDWSPA IKSAL+TT+ T D+R  PI D  +   
Sbjct  544   QFNIISGTSMACPHVSGIAALIKSVHGDWSPAMIKSALLTTASTTDNRNQPIGDMGAGPN  603

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
              +AT F FG+GHVD  RA  PGL+YD+ST DY NYLCSL+Y S +I L       CP   
Sbjct  604   SAATAFDFGAGHVDTTRAVDPGLVYDLSTVDYLNYLCSLSYTSERILLFSGTNYTCPP--  661

Query  1423  HHQPGDLNYPSFAV-IFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
                PGDLNYPSFAV + + +   +  ++ RT TNVG P   Y  HV EP GV V V+PKV
Sbjct  662   --TPGDLNYPSFAVNLANGAKMKTVRSYRRTVTNVGSPACEYMAHVEEPKGVEVRVEPKV  719

Query  1600  LKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             LKF K+ + LSYTV+FVA+  + +S    SFG+LVW S    VRSPIAV W+
Sbjct  720   LKFQKVRERLSYTVTFVAEASRDSSS---SFGALVWISDKHKVRSPIAVTWE  768



>emb|CDY15145.1| BnaC05g00240D [Brassica napus]
Length=768

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/592 (58%), Positives = 432/592 (73%), Gaps = 16/592 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GA  +YKGYESIVGKINET +++S RD++GHGTHTASTAAGD+V+ AS+ G+A+G 
Sbjct  186   KKIIGAGAYYKGYESIVGKINETTDFRSARDAQGHGTHTASTAAGDIVRKASYFGVAKGR  245

Query  181   -AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
              A GM++++RIAAYKAC+ LGC+S DVLAA+D+A+ DGVD++SLSLGG   +PFY D IA
Sbjct  246   FASGMRFSSRIAAYKACWALGCASTDVLAAIDRAILDGVDVISLSLGGSS-RPFYVDPIA  304

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             IAAFGA QK VFV  SAGNSGP  S+VSN APW+MTVAAS  DR FPA+V +G G+   G
Sbjct  305   IAAFGAMQKNVFVSCSAGNSGPAKSTVSNGAPWLMTVAASYTDRTFPAIVRIGTGKKIVG  364

Query  538   ESLYSGKAVNQKLPLVYGRTAGG-KGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLY G+   + L L +  TAGG  GAEFC   SL   LV+G+IV+C RG   R  KG E
Sbjct  365   SSLYKGRGF-ENLSLAFNTTAGGGSGAEFCVRNSLRRELVEGKIVICLRGAGGRTTKGEE  423

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYI----NSSKSATASIK  882
             VK++GG  M+L++R TEGEE+ ADPH LPA ++G+S G+ + KYI     ++ +  ASI 
Sbjct  424   VKQNGGVAMLLVSRVTEGEELLADPHVLPAVSIGYSDGVVLLKYIAGGGGTANATVASIG  483

Query  883   FQGTVYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
             F+GT YG RAP++AAFSSRGPS   PEI+KPD++APG+NILA W P   P++L +D R V
Sbjct  484   FRGTEYGARAPIVAAFSSRGPSVAGPEIVKPDISAPGLNILAGWSPFSSPSLLRSDQRRV  543

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNI+SGTSM+CPHVSG+AAL+KSVHGDWSPA IKSAL+TT+ T D+R  PI D  +   
Sbjct  544   QFNIISGTSMACPHVSGIAALIKSVHGDWSPAMIKSALLTTASTTDNRNQPIGDMGAGPN  603

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
              +AT F FG+GHVDP RA  PGL+YD+ST DY NYLCSL+Y S +I L       CP   
Sbjct  604   SAATAFDFGAGHVDPTRAVDPGLVYDLSTVDYLNYLCSLDYTSERILLFSGTNYTCPA--  661

Query  1423  HHQPGDLNYPSFAV-IFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
                PGDLNYPSFAV + + +   +  ++ RT TNVG P   Y  HV EP GV V V+PKV
Sbjct  662   --SPGDLNYPSFAVNLANGAKLKTVRSYRRTVTNVGSPACEYMAHVEEPKGVEVRVEPKV  719

Query  1600  LKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             LKF K+ + LSYTV+F A+  + +S    SFG+LVW S    VRSP+AV W+
Sbjct  720   LKFQKVRERLSYTVTFAAEASRNSSS---SFGALVWISDKHKVRSPLAVTWE  768



>gb|KHG02130.1| Subtilisin-like protease [Gossypium arboreum]
 gb|KHG03377.1| Subtilisin-like protease [Gossypium arboreum]
Length=775

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/587 (58%), Positives = 433/587 (74%), Gaps = 10/587 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR FY GY +  GKIN+T EYKS RD  GHGTHTASTA GD+V++A+  GLA G+
Sbjct  197   KKLIGARYFYGGYIAAGGKINDTEEYKSARDVSGHGTHTASTAGGDIVENANLFGLANGT  256

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPK-PFYTDNIA  357
             A GM+YTARIAAYK C+  GC+S+D+L A+ +A++DGVD+L+LSLG      P++ D + 
Sbjct  257   ATGMRYTARIAAYKVCWP-GCTSVDILTAMVKAIEDGVDVLTLSLGSESEAVPYWQDYLV  315

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             IA++ A + G+FV  SAGNSGP   +V NTAPWIMTVAAS++DR F A++ELG+G  F G
Sbjct  316   IASYLAFKSGIFVAFSAGNSGPDAYTVVNTAPWIMTVAASTMDRSFVAIIELGDGETFEG  375

Query  538   ESLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
              S Y+GKA+ + LP+VYG+TAG  GAE+C  GS+  +LVKG+IV+CE+G   R EKG  V
Sbjct  376   SSFYTGKAL-KGLPIVYGKTAGDLGAEYCLPGSIDPKLVKGKIVICEQGIVRRTEKGEAV  434

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTV  897
             K +GGAG+++++   EGE++ ++ H LP   LG  A  AV KY N++K+ TASI F+GT+
Sbjct  435   KSAGGAGILILS--PEGEDLASEVHVLPDIFLGAIASKAVIKYWNTTKAPTASIVFKGTM  492

Query  898   YGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNIL  1077
             YGN+AP +AAFSSRGP+ V P++IKPD+TAPGV+ILAAWP    P+ L++D R V FNI+
Sbjct  493   YGNQAPKVAAFSSRGPNLVGPDVIKPDITAPGVDILAAWPAETSPSRLKSDKRRVLFNII  552

Query  1078  SGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATP  1257
             SGTSMSCPHVSG+AAL+KS H DWSPAAIKSALMTT+YTLD++  PI D       SA P
Sbjct  553   SGTSMSCPHVSGIAALIKSKHKDWSPAAIKSALMTTAYTLDNKGKPIADLAFYT--SAAP  610

Query  1258  FAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQPG  1437
             FA GSGHVDP +A  PGLIY+I+ +DY +YLCSL+Y+ +Q+S+        PT    QPG
Sbjct  611   FAIGSGHVDPIKATDPGLIYNITAEDYISYLCSLHYSDSQVSMFEEGYQCTPTERRMQPG  670

Query  1438  DLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNKM  1617
             DLNYPSFAV F   + N + T+ RT TNVGIP+S Y V V  P GVSVIV PKVL F ++
Sbjct  671   DLNYPSFAVNFKQKARNVTFTYKRTVTNVGIPKSTYKVSVEVPKGVSVIVSPKVLSFTEL  730

Query  1618  GQNLSYTVSFVA-QRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
              + LSY VSF    R K  +G   SFGSLVW S N+ VRSPIAV W+
Sbjct  731   NEELSYEVSFTGLSRNKTVAGS--SFGSLVWVSGNYRVRSPIAVSWK  775



>ref|XP_006306838.1| hypothetical protein CARUB_v10008379mg [Capsella rubella]
 gb|EOA39736.1| hypothetical protein CARUB_v10008379mg [Capsella rubella]
Length=766

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/587 (58%), Positives = 427/587 (73%), Gaps = 10/587 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GA  FYKGYESIVGKINET +++S RD++GHGTHTASTAAGD+V+ AS+ G A+G 
Sbjct  186   KKIIGASAFYKGYESIVGKINETTDFRSARDAQGHGTHTASTAAGDMVRKASYFGQAKGL  245

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM++T+RIAAYKAC+ +GC++ DV+AA+D+A+ DGVD++SLSLGG   +PFY D IAI
Sbjct  246   ATGMRFTSRIAAYKACWAIGCANTDVIAAIDKAISDGVDVISLSLGGSS-RPFYVDPIAI  304

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA QK +FV  SAGNSGP  S+VSN APW+MTVAAS  DR FPA+V +GN +   G 
Sbjct  305   AGFGAMQKNIFVSCSAGNSGPSASTVSNGAPWLMTVAASYTDRTFPAIVRIGNRKKIVGS  364

Query  541   SLYSGKAVNQKLPLVYGRTAGG-KGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLY GK++ + L L +  TAGG +GAEFC   SL   LV+G+IV+C RG S R  KG EV
Sbjct  365   SLYKGKSL-KNLSLAFNTTAGGGRGAEFCIRDSLKRELVEGKIVICLRGASGRTAKGEEV  423

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTV  897
             KRSGGA M+L++ E EGEE+ ADPH LPA ++G S G  +  Y++ + +ATASI+F+GT 
Sbjct  424   KRSGGAAMLLVSTEAEGEELLADPHVLPAVSIGSSDGKTLLSYLSRAANATASIRFRGTT  483

Query  898   YGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNIL  1077
             YG  APV+AAFSSRGPS   PEI KPD+ APG+NILA W P  GP++L +D R V+FNI+
Sbjct  484   YGATAPVVAAFSSRGPSVAGPEISKPDIAAPGLNILAGWSPFSGPSLLRSDPRRVQFNII  543

Query  1078  SGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATP  1257
             SGTSM+CPHVSG+AAL+KSVHGDWSPA IKSA+MTT+   D+R  PI D  +    +AT 
Sbjct  544   SGTSMACPHVSGIAALIKSVHGDWSPAMIKSAIMTTARITDNRNRPIGDMGAGPVTAATA  603

Query  1258  FAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH-HHQP  1434
             FA G+GHVDP RA  PGL+YD ST DY NYLCSLNY S +I +    +  C T      P
Sbjct  604   FAIGAGHVDPTRAVDPGLVYDTSTVDYLNYLCSLNYTSERIFMFSGTRYTCRTDGVVLSP  663

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNK  1614
             GDLNYPS AV F      ++  + RT TNVG     Y  HV EP GV V V+PKVLKF K
Sbjct  664   GDLNYPSLAVNF--VDGATTARYKRTVTNVGSQTCEYMAHVEEPRGVKVSVEPKVLKFQK  721

Query  1615  MGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTN-FTVRSPIAVIW  1752
             + + LSYTV+FVAQ    +S    SFG+LVW   + + VRSPIAV W
Sbjct  722   VRERLSYTVTFVAQASSTSS---ASFGALVWICDDKYKVRSPIAVAW  765



>gb|KFK42556.1| hypothetical protein AALP_AA1G010500 [Arabis alpina]
Length=754

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/588 (57%), Positives = 432/588 (73%), Gaps = 11/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GA  F+KGYE+I+G+INET +++S RD++GHGTHTASTAAGD+V  A++ G A+G 
Sbjct  172   KKIIGAGAFFKGYEAIIGRINETTDFRSARDAQGHGTHTASTAAGDIVPKANYYGQAKGF  231

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM++T+RIAAYKAC+ LGC+S DVLAA+D+A+ D VD++SLSLGG   +PFY D IAI
Sbjct  232   ASGMRFTSRIAAYKACWALGCASSDVLAAIDRAISDRVDVISLSLGGSS-RPFYVDPIAI  290

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             + F A QK +FV  SAGNSGP  S+VSN APW+ TVAAS  DR FPA+V +  G+   G 
Sbjct  291   SGFQAMQKNIFVSCSAGNSGPTESTVSNGAPWLTTVAASYTDRTFPAIVRI-RGKNIVGS  349

Query  541   SLYSGKAVNQKLPLVYGRTAG-GKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLY GK   + +PLVY RTAG G  AE+C   SL+ +LV+G+IV+C RG + R  KG EV
Sbjct  350   SLYKGKGF-KNVPLVYNRTAGAGNFAEYCIANSLTRKLVEGKIVICIRGGNGRTAKGEEV  408

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYI--NSSKSATASIKFQG  891
             KR+GG  M+L++R TEGEE+ ADPH LPA ++GF+ G  + KY+   ++ +  ASI+F+G
Sbjct  409   KRNGGVAMLLVSRVTEGEELLADPHVLPAVSIGFTDGFNLLKYVATGAANTTVASIRFRG  468

Query  892   TVYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             TVYG  AP++AAFSSRGPS   PEI+KPD+TAPG+NILA W P   P++L +D R V FN
Sbjct  469   TVYGAPAPIVAAFSSRGPSLAGPEIVKPDITAPGLNILAGWSPLSSPSLLASDPRRVVFN  528

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSM+CPHVSG+AAL+KSVHGDWSPA IKSALMTT+  +++R  PI+D  +     A
Sbjct  529   IISGTSMACPHVSGIAALIKSVHGDWSPAMIKSALMTTASIINNRNQPISDMGAGPNSVA  588

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             T F FGSG+V+P RA  PGL+YD+ST DY NYLCSLNY + +I L    K  CP++    
Sbjct  589   TAFDFGSGNVEPNRAVDPGLVYDLSTVDYLNYLCSLNYTAERILLFSGTKYTCPSNVVLS  648

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PGDLNYPSFAV F    ++ +  + RT TNVG P   Y  HV+EP GV V V+PKVLKF 
Sbjct  649   PGDLNYPSFAVNF---VNDVTVRYKRTVTNVGSPTCEYVAHVVEPKGVKVKVEPKVLKFE  705

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             K+ ++LSYTV+FVA+  K  +    SFG+LVW    + VRSPIAV W 
Sbjct  706   KVRESLSYTVTFVAEASK--NSSSSSFGALVWICDEYKVRSPIAVTWD  751



>ref|XP_006418467.1| hypothetical protein EUTSA_v10006878mg [Eutrema salsugineum]
 gb|ESQ36820.1| hypothetical protein EUTSA_v10006878mg [Eutrema salsugineum]
Length=766

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/588 (58%), Positives = 428/588 (73%), Gaps = 12/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GA  +YKGYESIVGKINET +++S RD++GHGTHTASTAAG +V+ ASF G ARG+
Sbjct  186   KKIIGAAAYYKGYESIVGKINETTDFRSARDAQGHGTHTASTAAGGMVRKASFYGQARGA  245

Query  181   -AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
              A GM++++RIAAYKAC+TLGC++ DVLAAVD+A++DGVD++SLSLGG   +PFY D +A
Sbjct  246   FASGMRFSSRIAAYKACWTLGCANTDVLAAVDRAIRDGVDVISLSLGGSS-RPFYVDPVA  304

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             IA FGA QK +FV  SAGNSGP  S++SN APW+MTVAAS  DR FPA+V +G G+   G
Sbjct  305   IAGFGAMQKNIFVSCSAGNSGPSRSTLSNGAPWVMTVAASYTDRTFPAIVRIGTGKRLVG  364

Query  538   ESLYSGKAVNQKLPLVYGRTAG--GKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
              SL+ GK + + L LV+  TAG  G GA FC   SL   LV+G+IV+C RG   R  KG 
Sbjct  365   SSLHKGKTL-KNLSLVFNTTAGSPGGGAAFCVGNSLKRELVEGKIVICLRGAGGRTAKGE  423

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSAT-ASIKFQ  888
             EVKR+GG  M+L++RETEGEE+ ADPH LPA ++GFS G  + +Y+    +AT ASI+F+
Sbjct  424   EVKRNGGVAMLLVSRETEGEELLADPHVLPAVSIGFSDGKILLQYLAGGPNATVASIRFR  483

Query  889   GTVYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             GT YG  AP++AAFSSRGPS   PEI+KPD+TAPG+NILA W P   P++L +D R V+F
Sbjct  484   GTTYGATAPIVAAFSSRGPSVAGPEIVKPDITAPGLNILAGWSPFSSPSLLSSDPRRVKF  543

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NILSGTSM+CPHVSG+AAL+KSVH DWSPA I+SALMTT+ T D+R  PI D  + +  +
Sbjct  544   NILSGTSMACPHVSGIAALIKSVHADWSPAMIRSALMTTASTSDNRNQPIGDMGARDRSA  603

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             AT F FG+GHVDP RAA PGL+YD+ST DY NYLC+LNY   +I L       CP     
Sbjct  604   ATAFEFGAGHVDPTRAADPGLVYDLSTVDYLNYLCNLNYTRERILLFSGTDYTCPA--AT  661

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PGDLNYPSFAV   +    +   + RT TNVG     Y  H+ EP GV V V+PKVLKF
Sbjct  662   SPGDLNYPSFAV---NVVKGARLRYKRTVTNVGSRACEYIAHIEEPKGVKVRVEPKVLKF  718

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             +K+ + LSYTVSFVA+     S    SFG+LVW    + VRSPIA+ W
Sbjct  719   DKVREKLSYTVSFVAE-ASTNSSSTSSFGALVWICDQYKVRSPIALTW  765



>gb|AAF76468.1|AC020622_2 Contains similarity to p69d gene from Lycopersicon esculentum 
gb|Y17278 and contains a Peptidase S8 PF|00082 domain [Arabidopsis 
thaliana]
Length=756

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/588 (58%), Positives = 427/588 (73%), Gaps = 7/588 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GA  FYKGYESIVGKINET +++S RD++GHGTHTASTAAGD+V  A++ G A+G 
Sbjct  173   KKIIGASAFYKGYESIVGKINETTDFRSTRDAQGHGTHTASTAAGDIVPKANYFGQAKGL  232

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM++T+RIAAYKAC+ LGC+S DV+AA+D+A+ DGVD++SLSLGG   +PFY D IAI
Sbjct  233   ASGMRFTSRIAAYKACWALGCASTDVIAAIDRAILDGVDVISLSLGGSS-RPFYVDPIAI  291

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA QK +FV  SAGNSGP  S+VSN APW+MTVAAS  DR FPA+V +GN +   G 
Sbjct  292   AGFGAMQKNIFVSCSAGNSGPTASTVSNGAPWLMTVAASYTDRTFPAIVRIGNRKSLVGS  351

Query  541   SLYSGKAVNQKLPLVYGRTAGGK-GAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLY GK++ + LPL + RTAG + GA FC   SL   LV+G+IV+C RG S R  KG EV
Sbjct  352   SLYKGKSL-KNLPLAFNRTAGEESGAVFCIRDSLKRELVEGKIVICLRGASGRTAKGEEV  410

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTV  897
             KRSGGA M+L++ E EGEE+ ADPH LPA +LGFS G  +  Y+  + +ATAS++F+GT 
Sbjct  411   KRSGGAAMLLVSTEAEGEELLADPHVLPAVSLGFSDGKTLLNYLAGAANATASVRFRGTA  470

Query  898   YGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNIL  1077
             YG  AP++AAFSSRGPS   PEI KPD+ APG+NILA W P   P++L +D R V+FNI+
Sbjct  471   YGATAPMVAAFSSRGPSVAGPEIAKPDIAAPGLNILAGWSPFSSPSLLRSDPRRVQFNII  530

Query  1078  SGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDS-VSTNPISAT  1254
             SGTSM+CPH+SG+AAL+KSVHGDWSPA IKSA+MTT+   D+R  PI D   +    +AT
Sbjct  531   SGTSMACPHISGIAALIKSVHGDWSPAMIKSAIMTTARITDNRNRPIGDRGAAGAESAAT  590

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH-HHQ  1431
              FAFG+G+VDP RA  PGL+YD ST DY NYLCSLNY S +I L       C ++     
Sbjct  591   AFAFGAGNVDPTRAVDPGLVYDTSTVDYLNYLCSLNYTSERILLFSGTNYTCASNAVVLS  650

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PGDLNYPSFAV   + ++  +  + RT TNVG P   Y VHV EP GV V V+PKVLKF 
Sbjct  651   PGDLNYPSFAVNLVNGANLKTVRYKRTVTNVGSPTCEYMVHVEEPKGVKVRVEPKVLKFQ  710

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             K  + LSYTV++ A+  +  +    SFG LVW    + VRSPIAV W+
Sbjct  711   KARERLSYTVTYDAEASR--NSSSSSFGVLVWICDKYNVRSPIAVTWE  756



>ref|XP_007051967.1| Subtilase family protein [Theobroma cacao]
 gb|EOX96124.1| Subtilase family protein [Theobroma cacao]
Length=771

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/588 (58%), Positives = 429/588 (73%), Gaps = 7/588 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GAR F+KGYE+ +GK ++  +YKS RDS GHGTHTASTAAG+LV +AS  GLA G+
Sbjct  187   KKIIGARYFFKGYEATIGKFSKITDYKSARDSVGHGTHTASTAAGNLVDNASMFGLANGT  246

Query  181   AGGMKYTARIAAYKACYTLGCSS-IDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
             AGGM YT+R+A YK C+  G ++  D++A +DQA+ DGVD+LSLSLG  + KP+  D IA
Sbjct  247   AGGMGYTSRLAIYKVCWNDGAAAGSDIIAGIDQAISDGVDVLSLSLGSFISKPYNLDEIA  306

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I+ F A +KG+FV  + GNSGP +SSV+NTAPWIMTVAAS LDR+F   VELG+G+ F+G
Sbjct  307   ISTFQAVKKGIFVSCAGGNSGPSSSSVTNTAPWIMTVAASYLDRKFATTVELGDGQTFQG  366

Query  538   ESLYSGKAVNQKLPLVYGRTAGG-KGAEFCSHGSLSSRLVKGRIVVCERGN-SARAEKGS  711
              SLY G    Q LPLVYG TAGG K   FC+ GSL+   VKG+IVVC+     +R E+G 
Sbjct  367   SSLYVGNETKQ-LPLVYGETAGGNKNTIFCAEGSLNRERVKGKIVVCDSALIFSRFEQGE  425

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
             +VK +GGAGM+L+N E +GEE       LP ++LGFS   A+K+Y+ S+ + TASI F+G
Sbjct  426   QVKLAGGAGMLLLNDEKQGEERALVAQPLPDSSLGFSESKAIKEYLKSTTNPTASITFKG  485

Query  892   TVYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             T YG  AP+MAAFSSRGP+AV P++IKPDVTAPGVNILAAWP   GP+  ++D R V FN
Sbjct  486   TEYGKPAPMMAAFSSRGPNAVGPDLIKPDVTAPGVNILAAWPGLTGPSSFKSDERRVLFN  545

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I SGTSMSCPHVSG+AALLKSVH DWSPAAIKSALMTT+Y  D +   I D  S+N  +A
Sbjct  546   IASGTSMSCPHVSGIAALLKSVHNDWSPAAIKSALMTTAYVHDDKCGEIADVASSNYTAA  605

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TPFAFGSGHVDPE+A+ PGLIYDI+ +DY NYLCSL Y+++ I+    K   CP +   Q
Sbjct  606   TPFAFGSGHVDPEKASDPGLIYDITPEDYLNYLCSLKYSASDIAKFAGKDFTCPQNLTMQ  665

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PGDLNYPSFAV F  S  N++ TFTRT T+VGIP   Y V   EPDGVS+ V+P++LKF 
Sbjct  666   PGDLNYPSFAVNFKRSIDNNTVTFTRTVTHVGIPNVTYEVRGTEPDGVSITVEPEILKFE  725

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTN-FTVRSPIAVIW  1752
               GQ LSY ++F  + G +      SFG + W   + + VRSP+AV W
Sbjct  726   NPGQKLSYKITFTQRNGTVPR--KTSFGYIKWSYLDKYHVRSPVAVTW  771



>ref|XP_010474817.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=772

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/590 (57%), Positives = 428/590 (73%), Gaps = 10/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GA  FYKGYESIVGKINET +++S RD++GHGTHTASTAAGD+V  AS+ G  RG 
Sbjct  188   KKIIGASAFYKGYESIVGKINETSDFRSARDAQGHGTHTASTAAGDMVPKASYFGQGRGL  247

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM++T+RIAAYKAC+ LGC++ DV+AA+D+A+ DGVD++SLSLGG   +PFY D IAI
Sbjct  248   ATGMRFTSRIAAYKACWALGCANTDVIAAIDKAISDGVDVISLSLGGSS-RPFYVDPIAI  306

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA QK +FV  SAGNSGP+ S+VSN APW+MTVAAS  DR FPA+V++GN +   G 
Sbjct  307   AGFGAMQKNIFVSCSAGNSGPIASTVSNGAPWLMTVAASYTDRTFPAIVQIGNRKRIVGS  366

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGA---EFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             SLY GK++ + L L +  TAGG      E+C+  SL   LV+G+IV+C RG S R  KG 
Sbjct  367   SLYKGKSL-KNLSLAFNTTAGGGRRGGAEYCARDSLKRELVEGKIVICLRGASGRTAKGE  425

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
             EVKRSGGA M+L++ + EGEE+ ADPH LPA ++G S G  +  Y++ + +ATAS++F+G
Sbjct  426   EVKRSGGAAMLLVSTKAEGEELLADPHVLPAVSIGASDGKTLLSYLSGAANATASLRFRG  485

Query  892   TVYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             T YG  AP++AAFSSRGPS   PEI KPD+ APG+NILA W P  GP++L +D R V+FN
Sbjct  486   TAYGATAPIVAAFSSRGPSVAGPEISKPDIAAPGLNILAGWSPFSGPSLLRSDPRRVQFN  545

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSM+CPHVSG+AAL+KSVHGDWSPA IKSA+MTT+   D+R  PI D       +A
Sbjct  546   IISGTSMACPHVSGIAALIKSVHGDWSPAMIKSAIMTTARITDNRNRPIGDMGVGRDSAA  605

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHH--  1425
             T FA G+G V+P RA  PGL+YD ST DY NYLCSLNY S +I L    +  CPT H   
Sbjct  606   TAFALGAGQVEPTRAVDPGLVYDTSTVDYLNYLCSLNYTSERILLFSGTRYTCPTTHGVV  665

Query  1426  HQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLK  1605
               PGDLNYPSFAV F +  + ++  + RT TNVG P   Y  HV EP GV V V+ +VLK
Sbjct  666   LSPGDLNYPSFAVNFVNGGATTAR-YKRTVTNVGSPVCQYMAHVEEPRGVKVRVESQVLK  724

Query  1606  FNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             F K+ + L+YTV+FV++    +S    SFG+LVW    + VRSPIAV W+
Sbjct  725   FQKVRERLTYTVTFVSEASTNSS--SSSFGALVWICDKYKVRSPIAVTWE  772



>ref|NP_563639.2| subtilisin-like serine protease SBT1.1 [Arabidopsis thaliana]
 gb|AAO22659.1| putative subtilisin-like serine protease [Arabidopsis thaliana]
 gb|AEE27347.1| subtilisin-like serine protease SBT1.1 [Arabidopsis thaliana]
Length=774

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/588 (58%), Positives = 427/588 (73%), Gaps = 7/588 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GA  FYKGYESIVGKINET +++S RD++GHGTHTASTAAGD+V  A++ G A+G 
Sbjct  191   KKIIGASAFYKGYESIVGKINETTDFRSTRDAQGHGTHTASTAAGDIVPKANYFGQAKGL  250

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM++T+RIAAYKAC+ LGC+S DV+AA+D+A+ DGVD++SLSLGG   +PFY D IAI
Sbjct  251   ASGMRFTSRIAAYKACWALGCASTDVIAAIDRAILDGVDVISLSLGGSS-RPFYVDPIAI  309

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA QK +FV  SAGNSGP  S+VSN APW+MTVAAS  DR FPA+V +GN +   G 
Sbjct  310   AGFGAMQKNIFVSCSAGNSGPTASTVSNGAPWLMTVAASYTDRTFPAIVRIGNRKSLVGS  369

Query  541   SLYSGKAVNQKLPLVYGRTAGGK-GAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLY GK++ + LPL + RTAG + GA FC   SL   LV+G+IV+C RG S R  KG EV
Sbjct  370   SLYKGKSL-KNLPLAFNRTAGEESGAVFCIRDSLKRELVEGKIVICLRGASGRTAKGEEV  428

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTV  897
             KRSGGA M+L++ E EGEE+ ADPH LPA +LGFS G  +  Y+  + +ATAS++F+GT 
Sbjct  429   KRSGGAAMLLVSTEAEGEELLADPHVLPAVSLGFSDGKTLLNYLAGAANATASVRFRGTA  488

Query  898   YGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNIL  1077
             YG  AP++AAFSSRGPS   PEI KPD+ APG+NILA W P   P++L +D R V+FNI+
Sbjct  489   YGATAPMVAAFSSRGPSVAGPEIAKPDIAAPGLNILAGWSPFSSPSLLRSDPRRVQFNII  548

Query  1078  SGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDS-VSTNPISAT  1254
             SGTSM+CPH+SG+AAL+KSVHGDWSPA IKSA+MTT+   D+R  PI D   +    +AT
Sbjct  549   SGTSMACPHISGIAALIKSVHGDWSPAMIKSAIMTTARITDNRNRPIGDRGAAGAESAAT  608

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH-HHQ  1431
              FAFG+G+VDP RA  PGL+YD ST DY NYLCSLNY S +I L       C ++     
Sbjct  609   AFAFGAGNVDPTRAVDPGLVYDTSTVDYLNYLCSLNYTSERILLFSGTNYTCASNAVVLS  668

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PGDLNYPSFAV   + ++  +  + RT TNVG P   Y VHV EP GV V V+PKVLKF 
Sbjct  669   PGDLNYPSFAVNLVNGANLKTVRYKRTVTNVGSPTCEYMVHVEEPKGVKVRVEPKVLKFQ  728

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             K  + LSYTV++ A+  +  +    SFG LVW    + VRSPIAV W+
Sbjct  729   KARERLSYTVTYDAEASR--NSSSSSFGVLVWICDKYNVRSPIAVTWE  774



>ref|XP_010479641.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=799

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/590 (57%), Positives = 422/590 (72%), Gaps = 11/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GA  FYKGYESIVGKINET +++S RD++GHGTHTASTAAGD+V  AS+ G  RG 
Sbjct  216   KKIIGASAFYKGYESIVGKINETTDFRSARDAQGHGTHTASTAAGDMVPKASYFGQGRGL  275

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM++T+RIAAYKAC+ LGC++ DV+AA+D+A+ DGVD++SLSLGG   +PFY D IAI
Sbjct  276   ATGMRFTSRIAAYKACWALGCANTDVIAAIDKAISDGVDVISLSLGGSS-RPFYVDPIAI  334

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA QK +FV  SAGNSGP+ S+VSN APW+MTVAAS  DR FPA+V +GN +   G 
Sbjct  335   AGFGAMQKNIFVSCSAGNSGPIASTVSNGAPWLMTVAASYTDRTFPAIVLIGNRKRIVGS  394

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGA---EFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             SLY GK++ + L L +  TAGG      E+C   SL   LV+G+IV+C RG S R  KG 
Sbjct  395   SLYKGKSL-KNLSLAFNTTAGGGRRGGAEYCVRDSLKRELVEGKIVICLRGASGRTAKGE  453

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
             EVKRSGGA M+L++ E EGEE+ ADPH LPA ++G S G  +  Y++ + +ATAS++F+G
Sbjct  454   EVKRSGGAAMLLVSTEAEGEELLADPHVLPAVSIGASDGKTLLSYLSGAANATASLRFRG  513

Query  892   TVYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             T YG  AP++AAFSSRGPS   PEI KPD+ APG+NILA W P  GP++L +D R V+FN
Sbjct  514   TAYGATAPIVAAFSSRGPSVAGPEISKPDIAAPGLNILAGWSPFSGPSLLRSDPRRVQFN  573

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSM+CPHVSG+AAL+KSVHGDWSPA IKSA+MTT+   D+R  PI D       +A
Sbjct  574   IISGTSMACPHVSGIAALIKSVHGDWSPAMIKSAIMTTARITDNRNRPIGDMGVGRDSAA  633

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHH--  1425
             T FA G+G V+P RA  PGL+YD ST DY NYLCSLNY S +I L    +  CPT     
Sbjct  634   TAFALGAGQVEPTRAVDPGLVYDTSTVDYLNYLCSLNYTSERILLFSGTRYTCPTTGGVV  693

Query  1426  HQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLK  1605
               PGDLNYPSFAV F   +  ++  + R  TNVG P   Y  HV EP GV V V+P+VLK
Sbjct  694   LSPGDLNYPSFAVNF--VNGATTARYKRAVTNVGSPACEYMAHVEEPRGVKVRVEPQVLK  751

Query  1606  FNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             F K+ + LSYTV+FV +     +    SFG+LVW    + VRSPIAV W+
Sbjct  752   FQKVRERLSYTVTFVPEAS--TNSSSSSFGALVWICDKYKVRSPIAVTWE  799



>emb|CDX90065.1| BnaA10g00170D [Brassica napus]
Length=754

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/592 (57%), Positives = 424/592 (72%), Gaps = 30/592 (5%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GA  FYKGYESIVGKINET +++S RD++GHGTHTASTAAGD+V+ AS+ GLA+G 
Sbjct  186   KKIIGAGAFYKGYESIVGKINETTDFRSARDAQGHGTHTASTAAGDIVRKASYFGLAKGR  245

Query  181   -AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
              A GM++++RIAAYKAC+ LGC+S DVLAA+D+A+ DGVD++SLSLGG   +PFY D IA
Sbjct  246   FASGMRFSSRIAAYKACWALGCASTDVLAAIDRAILDGVDVISLSLGGSS-RPFYVDPIA  304

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             IAAFGA QK +FV  SAGNSGP  S+VSN APW+MTVAAS  DR FPA+V +G G+   G
Sbjct  305   IAAFGAMQKNIFVSCSAGNSGPAKSTVSNGAPWLMTVAASYTDRTFPAIVRIGTGKKIVG  364

Query  538   ESLYSGKAVNQKLPLVYGRTAGG-KGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLY GK   + L L +  TAGG  GAEFC   SL   LV+G+IV+C RG   R  KG E
Sbjct  365   SSLYKGKGF-ENLSLAFNTTAGGGSGAEFCVRNSLRRELVEGKIVICLRGAGGRTAKGEE  423

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYI----NSSKSATASIK  882
             VK++GG  M+L++R+TEGEE+ ADPH LPA ++G+S GI + KYI     ++ +  ASI 
Sbjct  424   VKQNGGVAMLLVSRQTEGEELLADPHVLPAVSIGYSDGIVLLKYIAGGGGAANATVASIG  483

Query  883   FQGTVYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
             F+GT YG RAP++AAFSSRGPS   PEI+KPD++APG+NILA W               V
Sbjct  484   FRGTEYGARAPIVAAFSSRGPSVAGPEIVKPDISAPGLNILAGW--------------RV  529

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNI+SGTSM+CPHVSG+AAL+KSVHGDWSPA IKSAL+TT+ T D+R  PI D  +   
Sbjct  530   QFNIISGTSMACPHVSGIAALIKSVHGDWSPAMIKSALLTTASTTDNRNQPIGDMGAGPN  589

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
              +AT F FG+GHVD  RA  PGL+YD+ST DY NYLCSL+Y S +I L       CP   
Sbjct  590   SAATAFDFGAGHVDTTRAVDPGLVYDLSTVDYLNYLCSLSYTSERILLFSGTNYTCPP--  647

Query  1423  HHQPGDLNYPSFAV-IFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
                PGDLNYPSFAV + + +   +  ++ RT TNVG P   Y  HV EP GV V V+PKV
Sbjct  648   --TPGDLNYPSFAVNLANGAKMKTVRSYRRTVTNVGSPACEYMAHVEEPKGVEVRVEPKV  705

Query  1600  LKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             LKF K+ + LSYTV+FVA   + +S    SFG+LVW S    VRSPIAV W+
Sbjct  706   LKFQKVRERLSYTVTFVAAASRDSS---SSFGALVWISDKHKVRSPIAVTWE  754



>ref|XP_010457066.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
 ref|XP_010457067.1| PREDICTED: subtilisin-like protease isoform X2 [Camelina sativa]
Length=799

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/590 (57%), Positives = 422/590 (72%), Gaps = 10/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GA  FYKGYESIVGKINET +++S RD++GHGTHTASTAAGD+V  AS+ G  RG 
Sbjct  215   KKIIGASAFYKGYESIVGKINETTDFRSARDAQGHGTHTASTAAGDMVPKASYFGQGRGL  274

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM++T+RIAAYKAC+ LGC++ DV+AA+D+A+ DGVD++SLSLGG   +PFY D IAI
Sbjct  275   ATGMRFTSRIAAYKACWALGCANTDVIAAIDKAISDGVDVISLSLGGSS-RPFYVDPIAI  333

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA QK +FV  SAGNSGP  S+VSN APW+MTVAAS  DR FPA+V +GN +   G 
Sbjct  334   AGFGAMQKNIFVSCSAGNSGPSASTVSNGAPWLMTVAASYTDRTFPAIVLIGNRKRIVGS  393

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGA---EFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             SLY GK++ + + L +  TAGG      E+C   SL   LV+G+IV+C RG S R  KG 
Sbjct  394   SLYKGKSL-KNMSLAFNTTAGGGRRGGAEYCVRDSLKRELVEGKIVICLRGASGRTAKGE  452

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
             EVKRSGGA M+L++ E EGEE+ ADPH LPA ++G S G  +  Y++ + +ATAS++F+G
Sbjct  453   EVKRSGGAAMLLVSTEAEGEELLADPHVLPAVSIGASDGKTLLSYLSGAANATASLRFRG  512

Query  892   TVYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             T YG  AP++AAFSSRGPS   PEI KPD+ APG+NILA W P  GP++L +D R V+FN
Sbjct  513   TAYGATAPIVAAFSSRGPSVAGPEISKPDIAAPGLNILAGWSPFSGPSLLRSDPRRVQFN  572

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSM+CPHVSG+AAL+KSVHGDWSPA IKSA+MTT+   D+R  PI D       +A
Sbjct  573   IISGTSMACPHVSGIAALIKSVHGDWSPAMIKSAIMTTARITDNRNRPIGDMGVGRDSAA  632

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHH--  1425
             T FA G+G V+P RA  PGL+YD ST DY NYLCSLNY S +I L    +  CPT     
Sbjct  633   TAFALGAGQVEPTRAVDPGLVYDTSTVDYLNYLCSLNYTSERILLFSGTRYTCPTTGGVV  692

Query  1426  HQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLK  1605
               PGDLNYPSFAV F +  + ++  + R  TNVG P   Y  HV EP GV V V+P+VLK
Sbjct  693   LSPGDLNYPSFAVNFVNGGATTAR-YKRAVTNVGSPACEYMAHVEEPRGVKVRVEPQVLK  751

Query  1606  FNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             F K+ + LSYTV+FV +     +    SFG+LVW    + VRSPIAV W+
Sbjct  752   FQKVRERLSYTVTFVPEAS--TNSSSSSFGALVWICDKYKVRSPIAVTWE  799



>ref|XP_010692332.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=748

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/590 (58%), Positives = 426/590 (72%), Gaps = 12/590 (2%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGSA  183
             KL+GA+ F+KGYE+  G+IN +VE++S RDS GHGTHTASTAAG+ V  ASF G A+G A
Sbjct  165   KLIGAKAFFKGYEASYGRINSSVEFRSARDSVGHGTHTASTAAGNAVPGASFSGSAQGIA  224

Query  184   GGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAIA  363
              G+ +T+RIAAYK C+   C++ D+LAA+DQAV DGVD+LSLSL      P+Y D+  IA
Sbjct  225   RGISFTSRIAAYKVCWARDCTNSDILAAIDQAVADGVDVLSLSLVADA-IPYYQDSAIIA  283

Query  364   AFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGES  543
             A GA+QKGVFV  SAGNSGPL S+V NTAPW+MTVAASSLDRRF   V+L NG    G S
Sbjct  284   ALGASQKGVFVSFSAGNSGPLPSTVGNTAPWVMTVAASSLDRRFMGDVQLSNGIKLSGAS  343

Query  544   LYS-GKAVNQKLPLVYGRTAGG-KGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             +YS  +   ++LPLVY +TAG  KGAE+C  GSLS  LVK +IVVC RG + +  KG  V
Sbjct  344   IYSSNQKKTKELPLVYNQTAGYIKGAEYCLPGSLSPSLVKDKIVVCMRGINYKTAKGLVV  403

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTV  897
             K +GGAGM+L+N  ++GEE+ ADPH LPAT LG SA  A+K Y+   KS TASI F+GT 
Sbjct  404   KSAGGAGMVLLNTRSDGEELVADPHVLPATLLGASASKAIKGYLKQHKSLTASISFRGTT  463

Query  898   YGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNIL  1077
             +G R+P+MA+FSSRGPS + P IIKPD+TAPG+NILAAWPP    T L  D R  +FNIL
Sbjct  464   FGARSPMMASFSSRGPSPLDPYIIKPDITAPGINILAAWPPISPITELSNDKRRSQFNIL  523

Query  1078  SGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATP  1257
             SGTSMSCPHVSG+AAL+KSVH DWSPAAIKSA+MT++YT D++   I+D  +T    ATP
Sbjct  524   SGTSMSCPHVSGIAALIKSVHKDWSPAAIKSAIMTSAYTHDNKGHLISDLSNTTKF-ATP  582

Query  1258  FAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHH---H  1428
             F FGSGHV+P  A +PGL+YDI+ +DY  YLCS+NY + Q+++L RKK  C ++      
Sbjct  583   FEFGSGHVNPGTALNPGLLYDITGEDYLQYLCSINYTNAQVTILARKKYNCSSNEKGKAL  642

Query  1429  QPGDLNYPSFAVIFDssssnssH-TFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLK  1605
             QPG+LNYPSFAVI D++    +  T+ RT TNVG     Y V V +P GV V V PKVL 
Sbjct  643   QPGNLNYPSFAVILDANRRRKTTLTYKRTVTNVGTARISYKVVVNKPKGVEVSVVPKVLN  702

Query  1606  FNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             F ++G+  SY VSF     +  S    SFGSL+W   +++VRSPIAV WQ
Sbjct  703   FKEVGEKQSYKVSFSVTTSRSVS----SFGSLIWMGGSYSVRSPIAVTWQ  748



>ref|XP_002892038.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68297.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/588 (57%), Positives = 427/588 (73%), Gaps = 7/588 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GA  FYKGYESIVGKINET +++S RD++GHGTHTASTAAG +V  A++ G A+G 
Sbjct  191   KKIIGASAFYKGYESIVGKINETTDFRSARDAQGHGTHTASTAAGGIVPKANYFGQAKGL  250

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM++T+RIAAYKAC+ LGC++ DV+AA+D+A+ DGVD++SLSLGG   +PFY D +AI
Sbjct  251   ASGMRFTSRIAAYKACWALGCANTDVIAAIDRAILDGVDVISLSLGGSS-RPFYVDPVAI  309

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA QK +FV  SAGNSGP  S+VSN APW+MTVAAS  DR FPA+V +GN +   G 
Sbjct  310   AGFGAMQKNIFVSCSAGNSGPTASTVSNGAPWLMTVAASYTDRTFPAIVRIGNRKSLVGS  369

Query  541   SLYSGKAVNQKLPLVYGRTAG-GKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLY GK++ + L L + RTAG G GA FC   SL   LV+G+IV+C RG S R  KG EV
Sbjct  370   SLYKGKSL-KNLSLAFNRTAGEGSGAVFCIRDSLKRELVEGKIVICLRGASGRTAKGEEV  428

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTV  897
             KRSGGA M+L++ E EGEE+ ADPH LPA ++GFS G  +  Y+ S+ +ATA+++F+GT 
Sbjct  429   KRSGGAAMLLVSTEAEGEELLADPHVLPAVSIGFSDGKTLLTYLASAANATAAVRFRGTT  488

Query  898   YGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNIL  1077
             YG  AP++AAFSSRGPS   PE+ KPD+ APG+NILA W P   P++L +D R V+FNI+
Sbjct  489   YGATAPMVAAFSSRGPSVAGPEVAKPDIAAPGMNILAGWSPFSSPSLLRSDPRRVQFNII  548

Query  1078  SGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDS-VSTNPISAT  1254
             SGTSM+CPH+SG+AAL+KSVHGDWSPA IKSA+MTT+   D+R  PI D   +    +AT
Sbjct  549   SGTSMACPHISGIAALIKSVHGDWSPAMIKSAIMTTARITDNRNRPIGDRGAAGAESAAT  608

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH-HHQ  1431
              FAFG+GHVDP RA  PGL+YD ST DY NYLCSLNY S  I L       CP++     
Sbjct  609   AFAFGAGHVDPTRAVDPGLVYDTSTVDYLNYLCSLNYTSQIILLFSGTNYTCPSNGVVLS  668

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PGDLNYPSFAV F + ++  +  + RT TNVG P   Y  HV EP GV V V+PKVLKF 
Sbjct  669   PGDLNYPSFAVNFVNGANLKTVRYKRTVTNVGSPACDYMAHVEEPKGVKVRVEPKVLKFQ  728

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             K+ + LSYTV+F A+  +  S    SFG LVW    + VRSPI+V W+
Sbjct  729   KVRERLSYTVTFDAEASRNTSSS--SFGVLVWMCDKYNVRSPISVTWE  774



>ref|XP_002966443.1| hypothetical protein SELMODRAFT_143697 [Selaginella moellendorffii]
 gb|EFJ32470.1| hypothetical protein SELMODRAFT_143697 [Selaginella moellendorffii]
Length=752

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/597 (54%), Positives = 411/597 (69%), Gaps = 16/597 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR F++GYE++ G IN + E+KSPRDS+GHGTHTASTA G  V  A  LG A G+
Sbjct  157   KKLIGARYFFRGYEAMSGPINGSTEFKSPRDSDGHGTHTASTAGGRYVYRADMLGFASGT  216

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIA YK C+T GC   D+LAA D AV DGVD++SLS+GG +  P+  D+IA+
Sbjct  217   AEGMAPKARIAVYKVCWTSGCFDSDILAAFDTAVADGVDVISLSVGGGV-MPYRMDSIAL  275

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA  +GVFV +S GN GP   SV+N APWI T+ AS++DR FPA V+LGNG  F+G 
Sbjct  276   GAFGAMTRGVFVATSGGNQGPGQLSVTNVAPWIATIGASTMDRAFPATVKLGNGESFQGV  335

Query  541   SLYSGK--AVNQKLPLVYGRTA--GGKG-----AEFCSHGSLSSRLVKGRIVVCERGNSA  693
             SLYSGK  A  +++PLVY   A  G  G     A  C  GSL  +LV+G+IV+C+RGN+A
Sbjct  336   SLYSGKGFAAGEEIPLVYSADASVGKNGSDSYSASLCLAGSLDPKLVRGKIVLCDRGNNA  395

Query  694   RAEKGSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATA  873
             R EKG  V  +GG GMIL N  T+GE + AD H LPATA+G +AG ++K YI S+KS  A
Sbjct  396   RVEKGGVVLAAGGRGMILSNSPTDGEGLIADSHLLPATAVGNAAGSSIKNYIKSAKSPVA  455

Query  874   SIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEAD  1050
             SIKF GTV G   APV+A+FSSRGP+  +PEI+KPD+ APGVNILAAW    GPT L +D
Sbjct  456   SIKFLGTVLGTSPAPVVASFSSRGPNPETPEILKPDMIAPGVNILAAWTGAAGPTGLASD  515

Query  1051  NRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSV  1230
              R V FNI+SGTSM+CPHVSGLAALL+  H DWSPAAIKSALMT++  +D+ K+ ++D  
Sbjct  516   TRKVRFNIISGTSMACPHVSGLAALLRGAHPDWSPAAIKSALMTSATLVDNTKNIMSDEA  575

Query  1231  STNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSAC  1410
             + N   +TPF FGSG V+PE A  PGL+YD+  +DY  +LCSLNY+S  + ++ R K++C
Sbjct  576   TGN--VSTPFDFGSGLVNPETAMDPGLVYDLGREDYIEFLCSLNYSSKDLRMVTRSKASC  633

Query  1411  PTHHHHQPGDLNYPSFAVIFDssssn-ssHTFTRTATNVGIPESVYAVHVMEPDGVSVIV  1587
             PT    +  DLNYPSF+ +FD S       +F RT TNVG P++ Y   V+ P G+   V
Sbjct  634   PT-SVPKTSDLNYPSFSAVFDQSVKGPMKMSFKRTVTNVGSPKAEYVASVLVPKGIEASV  692

Query  1588  KPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGHS-FGSLVWKSTNFTVRSPIAVIWQ  1755
              PK L F+++ Q LSYT++  A R  +  G   + FG L W  +   VRSPIA+  Q
Sbjct  693   VPKRLLFSELNQKLSYTLTISAPRAAVVPGDIETVFGLLTWSDSQRMVRSPIAISRQ  749



>ref|XP_002982080.1| hypothetical protein SELMODRAFT_233912 [Selaginella moellendorffii]
 gb|EFJ16748.1| hypothetical protein SELMODRAFT_233912 [Selaginella moellendorffii]
Length=752

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/597 (54%), Positives = 410/597 (69%), Gaps = 16/597 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR F++GYE++ G IN + E+KSPRDS+GHGTHTASTA G  V  A  LG A G+
Sbjct  157   KKLIGARYFFRGYEAMSGPINGSTEFKSPRDSDGHGTHTASTAGGRYVYRADMLGFASGT  216

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIA YK C+T GC   D+LAA D AV DGVD++SLS+GG +  P+  D+IA+
Sbjct  217   AEGMAPKARIAVYKVCWTSGCFDSDILAAFDTAVADGVDVISLSVGGGV-MPYRMDSIAL  275

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA  +GVFV +S GN GP   SV+N APWI T+ AS++DR FPA V+LGNG  ++G 
Sbjct  276   GAFGAMTRGVFVATSGGNQGPGQLSVTNVAPWIATIGASTMDRAFPATVKLGNGESYKGV  335

Query  541   SLYSGK--AVNQKLPLVYGRTA--GGKG-----AEFCSHGSLSSRLVKGRIVVCERGNSA  693
             SLYSGK  A  +++PLVY   A  G  G     A  C  GSL  +LV+G+IV+C+RGN+A
Sbjct  336   SLYSGKGFAAGEEIPLVYSADASVGKNGSDSYSASLCLAGSLDPKLVRGKIVLCDRGNNA  395

Query  694   RAEKGSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATA  873
             R EKG  V  +GG GMIL N  T+GE + AD H LPATA+G +AG ++K YI S+KS  A
Sbjct  396   RVEKGGVVLAAGGRGMILSNSPTDGEGLIADSHLLPATAVGNAAGSSIKNYIKSAKSPVA  455

Query  874   SIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEAD  1050
             SIKF GTV G   APV+A+FSSRGP+  +PEI+KPD+ APGVNILAAW    GPT L +D
Sbjct  456   SIKFLGTVLGTSPAPVVASFSSRGPNPETPEILKPDMIAPGVNILAAWTGAAGPTGLASD  515

Query  1051  NRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSV  1230
              R V FNI+SGTSM+CPHVSGLAALL+  H DWSPAAIKSALMTT+  +D+ K+ ++D  
Sbjct  516   TRKVRFNIISGTSMACPHVSGLAALLRGAHPDWSPAAIKSALMTTASLVDNTKNIMSDEA  575

Query  1231  STNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSAC  1410
             + N   +TPF FGSG V+PE A  PGL+YD+  +DY  +LCSLNY+S  + ++ R K++C
Sbjct  576   TGN--VSTPFDFGSGLVNPETAMDPGLVYDLGREDYIEFLCSLNYSSKDLRMVTRSKASC  633

Query  1411  PTHHHHQPGDLNYPSFAVIFDssssn-ssHTFTRTATNVGIPESVYAVHVMEPDGVSVIV  1587
             P     +  DLNYPSF+ +FD S       +F RT TNVG P++ Y   V+ P G+   V
Sbjct  634   P-KSVPKTSDLNYPSFSAVFDQSVKGPMKMSFKRTVTNVGSPKAEYVASVLVPKGIEASV  692

Query  1588  KPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGHS-FGSLVWKSTNFTVRSPIAVIWQ  1755
              PK L F+++ Q LSYT++  A R  +  G   + FG L W  +   VRSPIA+  Q
Sbjct  693   VPKRLLFSELNQKLSYTLTISAPRAAVVPGDIETVFGLLTWSDSQRMVRSPIAISRQ  749



>ref|XP_007051970.1| Subtilase family protein isoform 2, partial [Theobroma cacao]
 gb|EOX96127.1| Subtilase family protein isoform 2, partial [Theobroma cacao]
Length=641

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/453 (65%), Positives = 359/453 (79%), Gaps = 5/453 (1%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GA+ F+ GYE+ VG+INET ++KS RDS GHGTHTASTAAG LV++AS  GLA GS
Sbjct  193   RKLIGAKFFFNGYEATVGRINETEDFKSARDSNGHGTHTASTAAGSLVENASLFGLANGS  252

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A G++YT+RIA YKAC+++ CS  DVLAA++QA+ DGVD+LSLSLG    +P+Y D +A+
Sbjct  253   AAGLRYTSRIAVYKACWSI-CSIPDVLAAMEQAILDGVDVLSLSLGTAA-RPYYRDYMAL  310

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+F A   G+FV  SAGN GP  S+VSNTAPWIMTV AS LDR FP +V+LGNG+ F G 
Sbjct  311   ASFQAIANGIFVSCSAGNYGPSKSTVSNTAPWIMTVGASYLDRSFPTIVKLGNGQTFEGS  370

Query  541   SLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVK  720
             SLY GK   Q LPLVYG+TAGG+GAE C  GSL+  LV+G++VVC+RG +AR E G  VK
Sbjct  371   SLYVGKGTKQ-LPLVYGKTAGGQGAEHCIAGSLNRDLVQGKMVVCQRGENARTENGEVVK  429

Query  721   RSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVY  900
              +GGAGM+LIN E +GEE+ AD H LPA++LG SAG A+KKY+NS+KS TASI F+GT Y
Sbjct  430   MAGGAGMLLINTENDGEELLADSHVLPASSLGDSAGKAIKKYMNSTKSPTASIVFKGTTY  489

Query  901   GNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILS  1080
             GNRAP +AAFSSRGP+ V  ++IKPDVTAPGV+ILAAWP    P+ L++D R V FNI+S
Sbjct  490   GNRAPTLAAFSSRGPNLVGLDVIKPDVTAPGVDILAAWPAITSPSELKSDKRRVLFNIIS  549

Query  1081  GTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPF  1260
             GTSMSCPHVSG+AALLKS H DWSPAAIKSALMTT+Y  D++ +PI D  S +  SATPF
Sbjct  550   GTSMSCPHVSGIAALLKSKHKDWSPAAIKSALMTTAYVADNKGTPILDVASGS--SATPF  607

Query  1261  AFGSGHVDPERAAHPGLIYDISTQDYFNYLCSL  1359
               GSGH DPERA+ PGLIYDIS +DY  YLCSL
Sbjct  608   GLGSGHADPERASDPGLIYDISPKDYIYYLCSL  640



>ref|XP_001757585.1| predicted protein [Physcomitrella patens]
 gb|EDQ77642.1| predicted protein [Physcomitrella patens]
Length=749

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/593 (53%), Positives = 403/593 (68%), Gaps = 15/593 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR+F KGYE++ G INET+E +SPRD++GHGTHTASTAAG  V  AS LG A G+
Sbjct  155   RKLIGARSFSKGYEAMTGPINETMEPRSPRDTDGHGTHTASTAAGHYVYKASLLGYAEGT  214

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C+T GC   D+LAA DQAV DGVD++SLS+GG +  P+Y D+IAI
Sbjct  215   ARGMAPRARIAAYKVCWTQGCFDSDILAAFDQAVADGVDVISLSVGGGV-VPYYLDSIAI  273

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA +KG+FV  SAGNSGP   +V+N APWI TV AS+LDR FPA V L NG   +G 
Sbjct  274   GAFGAMKKGIFVACSAGNSGPDPITVANVAPWITTVGASTLDRDFPANVVLDNGDTIKGV  333

Query  541   SLYSGKAV-NQKLPLVYGRTAGGKG-------AEFCSHGSLSSRLVKGRIVVCERGNSAR  696
             SLYSGK +     PL+Y + AG K        A  C  GSL   LVKG+IV+C+RGN+ R
Sbjct  334   SLYSGKGLGTTPYPLIYAQDAGFKNNGSDTYSASLCLAGSLDPNLVKGKIVLCDRGNNPR  393

Query  697   AEKGSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATAS  876
               KG  ++ +GG GMIL N  T+GE + AD H LPATA+G   G  +K +I +SK+ TA+
Sbjct  394   VAKGGVIQAAGGVGMILANTATDGEGLIADSHVLPATAVGALEGNLIKAHIRNSKNPTAT  453

Query  877   IKFQGTVYGNRA-PVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADN  1053
             + F GT +  RA PV+A+FSSRGP++ +PEI+KPD+  PGVNILAAW  ++GPT L  D 
Sbjct  454   VTFGGTQFNTRATPVVASFSSRGPNSETPEILKPDLLGPGVNILAAWTGDMGPTGLPLDT  513

Query  1054  RSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVS  1233
             R V FNI+SGTSMSCPHVSGL AL+K  H  WSPAAIKSALMTT+   DS  S + D  +
Sbjct  514   RRVRFNIISGTSMSCPHVSGLGALVKDAHPTWSPAAIKSALMTTASIFDSTDSVLLDEAT  573

Query  1234  TNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACP  1413
              N   ++PF FG+GHV P+RA  PGL+YD++ QDY N+LC LNY    I L+    S CP
Sbjct  574   GN--MSSPFGFGAGHVRPDRALDPGLVYDLAPQDYVNFLCGLNYTDKIIQLISHDLSTCP  631

Query  1414  THHHHQPGDLNYPSFAVIFDssssns-sHTFTRTATNVGIPESVYAVHVMEPDGVSVIVK  1590
             T +  +P DLNYP+++V+FD S+S   + T TRT TNVG   S Y   V+ P GVS+ V+
Sbjct  632   T-NPPKPQDLNYPTYSVVFDQSTSKVLATTLTRTVTNVGPARSTYRSTVVSPSGVSISVR  690

Query  1591  PKVLKFNKMGQNLSYTVSFVAQRGKIASGGGHS-FGSLVWKSTNFTVRSPIAV  1746
             P +L+F+ + Q  ++TV        +  G   + FG L W      V+SPIA+
Sbjct  691   PAILQFSAVNQKKTFTVHISTSPTGLVPGESETVFGFLTWSDNTRLVQSPIAI  743



>ref|XP_010322825.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=776

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/595 (54%), Positives = 403/595 (68%), Gaps = 16/595 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K++GAR FYKGYE+  G ++E+ E KSPRD+EGHGTHTASTAAG LV +ASF   A+G 
Sbjct  181   RKIIGARMFYKGYEASQGPMDESKEAKSPRDTEGHGTHTASTAAGSLVANASFYQYAKGE  240

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT-DNIA  357
             A GM   ARIAAYK C+  GC   D+LAA+DQAV DGV ++SLS+G     P Y  D+IA
Sbjct  241   ARGMAIKARIAAYKICWKTGCFDSDILAAMDQAVDDGVHVISLSVGANGYAPHYLHDSIA  300

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AFGA++ GV V  SAGNSGP   +  N APWI+TV AS++DR FPA V LG+ RVF G
Sbjct  301   IGAFGASEHGVLVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADVILGDDRVFGG  360

Query  538   ESLYSGKAVNQ-KLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLY+G  +N  KLP+VY   +G  G+++C  G L  + V G+IV+C+RG +AR EKGS 
Sbjct  361   VSLYAGNPLNDSKLPVVY---SGDCGSKYCYPGKLDHKKVAGKIVLCDRGGNARVEKGSA  417

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GG GMIL N    GEE+ AD H LPAT +G  AG  +++Y+ S  S TA+I F+GT
Sbjct  418   VKLAGGVGMILANLADSGEELVADSHLLPATMVGQKAGDEIREYVISDPSPTATIVFKGT  477

Query  895   VYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             V GN   AP +AAFSSRGP+ ++PEI+KPDVTAPGVNILA W    GPT LE D R VEF
Sbjct  478   VIGNSPAAPRVAAFSSRGPNHLTPEILKPDVTAPGVNILAGWTGANGPTDLEIDPRRVEF  537

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPHVSGLAALL+  H  W+PAAIKSALMTT+Y LD+     TD  +     
Sbjct  538   NIISGTSMSCPHVSGLAALLRRAHSKWTPAAIKSALMTTAYNLDNSGKIFTDLATGE--E  595

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA--CPTHH  1422
             +TPF  GSGHVDP RA +PGL+YDI T DY N+LC++ Y+   I++ +R  S   C    
Sbjct  596   STPFVHGSGHVDPNRALNPGLVYDIETSDYVNFLCTIGYDGDDIAVFVRDSSRVNCSERS  655

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNV-GIPESVYAVHVMEPDGVSVIVKPKV  1599
                PGDLNYPSFAV F S S+     + R   NV G P +VY V V  P GV V V P  
Sbjct  656   LATPGDLNYPSFAVDFTSDSNGVV-KYKRVVKNVGGNPNAVYEVKVNAPLGVEVSVSPAK  714

Query  1600  LKFNKMGQNLSYTVSFVAQRGK---IASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             L F++   +LSY +SF ++R +   +  G   +FGS+ W     +VRSPIAV W+
Sbjct  715   LVFSEENNSLSYEISFTSKRSEDNIMVKGTPSAFGSIEWSDGIHSVRSPIAVRWR  769



>gb|KHN15704.1| Subtilisin-like protease [Glycine soja]
Length=741

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/591 (53%), Positives = 401/591 (68%), Gaps = 14/591 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FY GYE+  GKI+E  EYKSPRD +GHGTHTA+T AG  V  A+FLG A G+
Sbjct  154   KKIVGARMFYHGYEAATGKIDEQAEYKSPRDQDGHGTHTAATVAGSPVHGANFLGYAYGT  213

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C+T GC S D+L+AVD+AV DGVD+LS+SLGG +   +Y D++++
Sbjct  214   ARGMAPGARIAAYKVCWTGGCFSSDILSAVDRAVADGVDVLSISLGGGVSS-YYRDSLSV  272

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA +KGVFV  SAGN+GP   S++N +PWI TV AS++DR FPA V LGNGR   G 
Sbjct  273   AAFGAMEKGVFVSCSAGNAGPDPVSLTNVSPWITTVGASTMDRDFPADVRLGNGRKITGT  332

Query  541   SLYSGKA---VNQKLPLVY-GRTAGG--KGAEFCSHGSLSSRLVKGRIVVCERGNSARAE  702
             SLY G++   V ++ PLVY G T          C  G+L  R+V G+IV+C+RG S R +
Sbjct  333   SLYKGRSMLSVKKQYPLVYMGNTNSSIPDPKSLCLEGTLDRRMVSGKIVICDRGISPRVQ  392

Query  703   KGSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIK  882
             KG  VK +GGAGMIL N    GEE+ AD H LPA A+G   G  +K+Y+ +SK ATA++ 
Sbjct  393   KGQVVKNAGGAGMILTNTAANGEELVADCHLLPAVAIGEKEGKELKRYVLTSKKATATLG  452

Query  883   FQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRS  1059
             FQ T  G R +PV+AAFSSRGP+ ++ EI+KPDV APGVNILAAW   IGP+ L  D+R 
Sbjct  453   FQATRLGVRPSPVVAAFSSRGPNFLTLEILKPDVVAPGVNILAAWSEAIGPSSLPTDHRR  512

Query  1060  VEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTN  1239
             V+FNILSGTSMSCPHVSG+AALLK+ H DWSPAAIKSALMTT+Y  D+   P+ D  ++N
Sbjct  513   VKFNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVHDNTIKPLRD--ASN  570

Query  1240  PISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTH  1419
               ++TP+  G+GH++P RA  PGL+YDI  QDYF +LC+    ++++ +  +  +    H
Sbjct  571   AEASTPYDHGAGHINPRRALDPGLVYDIQPQDYFEFLCTQKLTTSELGVFAKYSNRTCKH  630

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
                 PGDLNYP+ +V+F   +S S  T  RTATNVG+P S Y V V    G SV V+P  
Sbjct  631   SLSSPGDLNYPAISVVFPLKNSTSVLTVHRTATNVGLPVSKYHVVVSPFKGASVKVEPDT  690

Query  1600  LKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             L F +  Q LSY ++   Q  +        FG LVWK     VRSPI + +
Sbjct  691   LSFTRKYQKLSYKITLTTQSRQTEP----EFGGLVWKDGVHKVRSPIVITY  737



>ref|XP_006606084.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=781

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/591 (53%), Positives = 401/591 (68%), Gaps = 14/591 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FY GYE+  GKI+E  EYKSPRD +GHGTHTA+T AG  V  A+FLG A G+
Sbjct  194   KKIVGARMFYHGYEAATGKIDEQAEYKSPRDQDGHGTHTAATVAGSPVHGANFLGYAYGT  253

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C+T GC S D+L+AVD+AV DGVD+LS+SLGG +   +Y D++++
Sbjct  254   ARGMAPGARIAAYKVCWTGGCFSSDILSAVDRAVADGVDVLSISLGGGVSS-YYRDSLSV  312

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA +KGVFV  SAGN+GP   S++N +PWI TV AS++DR FPA V LGNGR   G 
Sbjct  313   AAFGAMEKGVFVSCSAGNAGPDPVSLTNVSPWITTVGASTMDRDFPADVRLGNGRKITGT  372

Query  541   SLYSGKA---VNQKLPLVY-GRTAGG--KGAEFCSHGSLSSRLVKGRIVVCERGNSARAE  702
             SLY G++   V ++ PLVY G T          C  G+L  R+V G+IV+C+RG S R +
Sbjct  373   SLYKGRSMLSVKKQYPLVYMGNTNSSIPDPKSLCLEGTLDRRMVSGKIVICDRGISPRVQ  432

Query  703   KGSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIK  882
             KG  VK +GGAGMIL N    GEE+ AD H LPA A+G   G  +K+Y+ +SK ATA++ 
Sbjct  433   KGQVVKNAGGAGMILTNTAANGEELVADCHLLPAVAIGEKEGKELKRYVLTSKKATATLG  492

Query  883   FQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRS  1059
             FQ T  G R +PV+AAFSSRGP+ ++ EI+KPDV APGVNILAAW   IGP+ L  D+R 
Sbjct  493   FQATRLGVRPSPVVAAFSSRGPNFLTLEILKPDVVAPGVNILAAWSEAIGPSSLPTDHRR  552

Query  1060  VEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTN  1239
             V+FNILSGTSMSCPHVSG+AALLK+ H DWSPAAIKSALMTT+Y  D+   P+ D  ++N
Sbjct  553   VKFNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVHDNTIKPLRD--ASN  610

Query  1240  PISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTH  1419
               ++TP+  G+GH++P RA  PGL+YDI  QDYF +LC+    ++++ +  +  +    H
Sbjct  611   AEASTPYDHGAGHINPRRALDPGLVYDIQPQDYFEFLCTQKLTTSELGVFAKYSNRTCKH  670

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
                 PGDLNYP+ +V+F   +S S  T  RTATNVG+P S Y V V    G SV V+P  
Sbjct  671   SLSSPGDLNYPAISVVFPLKNSTSVLTVHRTATNVGLPVSKYHVVVSPFKGASVKVEPDT  730

Query  1600  LKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             L F +  Q LSY ++   Q  +        FG LVWK     VRSPI + +
Sbjct  731   LSFTRKYQKLSYKITLTTQSRQTEP----EFGGLVWKDGVHKVRSPIVITY  777



>gb|ABR18065.1| unknown [Picea sitchensis]
Length=783

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/593 (51%), Positives = 402/593 (68%), Gaps = 13/593 (2%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGSA  183
             KL+GAR F KGYE+  G ++E   Y+SPRD  GHGTHT+STAAG  V  +S LG A G+A
Sbjct  195   KLIGARFFLKGYEAKYGHVDEMENYRSPRDEGGHGTHTSSTAAGAEVPGSSLLGFAAGTA  254

Query  184   GGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAIA  363
              G+   AR+A YK C+   C S D+LA ++ A+ DGVD+LSLS+      P+Y D IAI 
Sbjct  255   RGIATKARLAVYKVCWPEECLSSDLLAGMEAAISDGVDLLSLSISDSRNLPYYKDAIAIG  314

Query  364   AFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGES  543
             A GA +KGVFV  +AGN+GP+ S + NTAPWI TV AS++DR FPA V LGNG+ +RG S
Sbjct  315   ALGAIEKGVFVSCAAGNAGPIPSKIFNTAPWITTVGASTIDREFPAPVVLGNGKNYRGSS  374

Query  544   LYSGKAV-NQKLPLVYGRTA-GGKGAEFCSHGSLSSRLVKGRIVVCER-GNSARAEKGSE  714
             LY GK + N +LPL+YG++A   + A+FC  GSL S  V G+IV+C+  G    AE G  
Sbjct  375   LYKGKTLGNGQLPLIYGKSASSNETAKFCLAGSLDSNRVSGKIVLCDLGGGEGTAEMGLV  434

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG-  891
             V+++GGAGMI  NR  +GE+++ D HFLPAT + F +GI +K YIN +K+ TA+IK +G 
Sbjct  435   VRQAGGAGMIQANRLVDGEDLWTDCHFLPATKVDFKSGIEIKAYINRTKNPTATIKAEGA  494

Query  892   TVYGN-RAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV G  RAPV+A+FSSRGP+ + PEI+KPD+ APGVN+LAAW  ++ PT L +D R V++
Sbjct  495   TVVGKTRAPVVASFSSRGPNPLVPEILKPDLIAPGVNVLAAWSGHVSPTGLTSDKRRVDY  554

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSM+CPHV+G+AAL+ +VH  W+PAAIKSALMT+S   D  K  I++SV+  P  
Sbjct  555   NIISGTSMACPHVTGIAALILAVHSAWTPAAIKSALMTSSVPFDHSKRLISESVTALPAD  614

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             A  FA G+GHV+P  A  PGL+YD    DY ++LCSLNY  +QI +L RK S+C   H  
Sbjct  615   A--FAIGAGHVNPSAALDPGLVYDADFDDYVSFLCSLNYTRSQIHILTRKASSCTRIHSQ  672

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
             QPGDLNYPSF+V+F     N      RT TNVG    VY V +  P GV++IV+P+ L F
Sbjct  673   QPGDLNYPSFSVVFK--PLNLVRALRRTVTNVGGAPCVYEVSMESPPGVNIIVEPRTLVF  730

Query  1609  NKMGQNLSYTVSFVAQRGK-IASGGGHSFGSLVWKSTN---FTVRSPIAVIWQ  1755
              +  +  SYTV F ++      S G   FG + WK        VRSP+A++W+
Sbjct  731   KEQNEKASYTVRFESKTASHNKSSGRQEFGQIWWKCVKGGTQVVRSPVAIVWE  783



>ref|XP_002994398.1| hypothetical protein SELMODRAFT_236958 [Selaginella moellendorffii]
 gb|EFJ04532.1| hypothetical protein SELMODRAFT_236958 [Selaginella moellendorffii]
Length=749

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/598 (52%), Positives = 409/598 (68%), Gaps = 16/598 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR FY+GYE++ G IN+T E+KSPRDS+GHGTHTASTAAG  V  A  LG A G+
Sbjct  152   RKLIGARFFYRGYEAMSGPINDTTEFKSPRDSDGHGTHTASTAAGRDVYRADLLGFAAGT  211

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C+  GC   D+LAA D+AV DGVD++SLS+GG +  P+Y D+IAI
Sbjct  212   ARGMAPKARIAAYKVCWQSGCFDSDILAAFDRAVSDGVDVISLSVGGGV-MPYYLDSIAI  270

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              +F A ++G+FV  S GN GP   SV+N APWI TV AS++DR FPA V+LGNG V +G 
Sbjct  271   GSFAAMERGIFVACSGGNEGPTDMSVTNIAPWITTVGASTMDRSFPANVKLGNGMVIQGV  330

Query  541   SLYSGKAV--NQKLPLVYGR---TAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLYSGK +  +Q+L LV+ +         A  C   +L  +  KG+IV CERG++ R EK
Sbjct  331   SLYSGKGLPHHQQLKLVFPKPNTKNDSYSASLCMKNTLDPKAAKGKIVFCERGSNPRVEK  390

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  V ++GGAGMIL N   +GE + AD H LPATA+G  +G  ++KY++S+++ TA+I+F
Sbjct  391   GYNVLQAGGAGMILANAVADGEGLVADSHLLPATAVGARSGSVIRKYMHSTRNPTATIEF  450

Query  886   QGTVYGN-RAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GTVYG+  APV+A+FSSRGP+  +PEI+KPD+ APGVNILA+W  + GPT L AD R V
Sbjct  451   LGTVYGSGNAPVIASFSSRGPNPETPEILKPDLVAPGVNILASWTGDAGPTGLSADTRRV  510

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSM+CPHVSGLAALLKS H  WSPAAI+SALMTTS         I D  ++N 
Sbjct  511   KFNILSGTSMACPHVSGLAALLKSAHPTWSPAAIRSALMTTSTMEGKSGHVIGDEATSN-  569

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSAC--PT  1416
              S+TPF FGSG VDP  A  PGL+YD+S +DY  +LC LNY+S   S + R   +C   +
Sbjct  570   -SSTPFDFGSGLVDPVSALDPGLVYDLSVRDYERFLCGLNYSSRARSTVTRSHFSCSKDS  628

Query  1417  HHHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPK  1596
                 +P  LNYPSF+V+FD S    + T +RT TNVG  +S+Y   V+ P GV + VKP 
Sbjct  629   TTRDRPSSLNYPSFSVVFDLSQKAYTTTVSRTVTNVGPAKSLYTARVVAPRGVEITVKPS  688

Query  1597  VLKFNKMGQNLSYTVSFVAQRGK-IASGGGHS-FGSLVWKST---NFTVRSPIAVIWQ  1755
              L+F K  Q + + +S  A+  + +A+G   + FG L+W +T      V+SPIA+  Q
Sbjct  689   KLEFQKRNQKMEFQMSITAKSSRSVAAGESETQFGVLIWSNTRGGRQMVQSPIAISRQ  746



>ref|XP_002272769.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=771

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/594 (53%), Positives = 400/594 (67%), Gaps = 21/594 (4%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             +K++GAR F+KGYE  +G+ ++E+VE KSPRD+EGHGTHTASTAAG +V+DAS    A+G
Sbjct  177   RKIIGARAFFKGYEGALGRPMDESVESKSPRDTEGHGTHTASTAAGSVVQDASLFEFAKG  236

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT-DNI  354
              A GM   ARIAAYK C++LGC   D+LAA+DQAV DGVDI+SLS+G     P Y  D+I
Sbjct  237   EARGMAVKARIAAYKICWSLGCFDSDILAAMDQAVADGVDIISLSVGATGLAPRYDHDSI  296

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AFGA   GV V  SAGNSGP   +  N APWI+TV AS++DR FPA V LG+GR+F 
Sbjct  297   AIGAFGAMDHGVLVSCSAGNSGPDPLTAVNIAPWILTVGASTIDREFPADVVLGDGRIFG  356

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G S+YSG  + +  LPLVY   AG  G+ FC  G L+   V G+IV+C+RG +AR EKG+
Sbjct  357   GVSIYSGDPLKDTNLPLVY---AGDCGSRFCFTGKLNPSQVSGKIVICDRGGNARVEKGT  413

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK + GAGMIL N    GEE+ AD H LPAT +G  AG  +K+Y+ S    TA+I F+G
Sbjct  414   AVKMALGAGMILANTGDSGEELIADSHLLPATMVGQIAGDKIKEYVKSKAFPTATIVFRG  473

Query  892   TVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             TV G    AP +AAFSSRGP+ ++PEI+KPDV APGVNILA W  +  PT L+ D R VE
Sbjct  474   TVIGTSPPAPKVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGSKAPTDLDVDPRRVE  533

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSMSCPHVSGLAALL+  +  W+PAAIKSALMTT+Y LD+  + I D  + N  
Sbjct  534   FNIISGTSMSCPHVSGLAALLRKAYPKWTPAAIKSALMTTAYNLDNSGNNIADLATGN--  591

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA--CPTH  1419
              ++PF  G+GHVDP RA +PGL+YDI   DY ++LC++ Y++ +I++ +R+ +   C T 
Sbjct  592   QSSPFIHGAGHVDPNRALYPGLVYDIDANDYISFLCAIGYDTERIAIFVRRHTTVDCNTE  651

Query  1420  HHHQPGDLNYPSFAVIF----DssssnssHTFTRTATNVG-IPESVYAVHVMEPDGVSVI  1584
               H PGDLNYP+F+V+F    D     +     R   NVG    +VY V V  P+G+ V 
Sbjct  652   KLHTPGDLNYPAFSVVFNFDHDPVHQGNEIKLKRVVKNVGSSANAVYEVKVNPPEGIEVD  711

Query  1585  VKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAV  1746
             V PK L F+K  Q  SY VSF +    I    G  FGS+ W      VRSP+AV
Sbjct  712   VSPKKLVFSKENQTASYEVSFTSVESYI----GSRFGSIEWSDGTHIVRSPVAV  761



>ref|XP_003595292.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES65543.1| subtilisin-like serine protease [Medicago truncatula]
Length=779

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/587 (53%), Positives = 400/587 (68%), Gaps = 10/587 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR+F +G+    G   +  E  SPRDS+GHGTHTASTAAG  V +ASFLG A G+
Sbjct  195   RKLIGARSFSRGFHMASGNGADR-EIVSPRDSDGHGTHTASTAAGAHVGNASFLGYATGT  253

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC + D+LA +D+A++DGVD+LSLSLGG    P++ D IAI
Sbjct  254   ARGMAPQARVAAYKVCWKDGCFASDILAGMDRAIQDGVDVLSLSLGGGS-APYFHDTIAI  312

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A ++G+FV +SAGNSGP  +S++N APWIMTV A +LDR FPA   LGN + F G 
Sbjct  313   GAFAAVERGIFVSASAGNSGPTRASLANVAPWIMTVGAGTLDRDFPAYATLGNKKRFLGV  372

Query  541   SLYSGKAV-NQKLPLVYGR-TAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SLYSGK + N+ + LVY + T   + A  C  GSL   +V+G++VVC+RG SAR EKG  
Sbjct  373   SLYSGKGMGNKPVSLVYFKGTGSNQSASICMAGSLEPAMVRGKVVVCDRGISARVEKGRV  432

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GG GMIL N    GEE+ AD H LPA A+G   G  ++KY++S  + T  + F GT
Sbjct  433   VKEAGGIGMILANTAASGEELVADSHLLPAVAVGRIIGDQIRKYVSSDLNPTTVLSFGGT  492

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V   R +PV+AAFSSRGP+ ++ EI+KPDV  PGVNILA W   +GP+ L  D R  +FN
Sbjct  493   VLNVRPSPVVAAFSSRGPNMITKEILKPDVIGPGVNILAGWSEAVGPSGLAEDTRKTKFN  552

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPH+SGLAALLK+ H  WSP+AIKSALMTT+Y  D+ KSP+ D+   +   +
Sbjct  553   IMSGTSMSCPHISGLAALLKAAHPTWSPSAIKSALMTTAYNHDNSKSPLRDAADGS--FS  610

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TP A G+GHV+P++A  PGL+YD ST+DY  +LCSLNYNS QI L++++ S   T     
Sbjct  611   TPLAHGAGHVNPQKALSPGLVYDASTKDYITFLCSLNYNSEQIQLIVKRPSVNCTKKFAN  670

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PG LNYPSF+V+F S        +TR  TNVG   SVY V V  P  V + VKP  L F 
Sbjct  671   PGQLNYPSFSVVFSSKRVVR---YTRIVTNVGEAGSVYNVVVDVPSSVGITVKPSRLVFE  727

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             K+G+   YTV+FV+++G  AS     FGS++W +    VRSPIA  W
Sbjct  728   KVGERKRYTVTFVSKKGADASKVRSGFGSILWSNAQHQVRSPIAFAW  774



>ref|XP_010047469.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79384.1| hypothetical protein EUGRSUZ_C00797 [Eucalyptus grandis]
Length=768

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/588 (53%), Positives = 398/588 (68%), Gaps = 12/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK--INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR+F KGY    G   + +  E  SPRD EGHGTHTASTAAG  V +AS LG A 
Sbjct  185   KKLIGARSFSKGYHMASGGSFLKDPKETDSPRDQEGHGTHTASTAAGSRVANASLLGYAS  244

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   AR+A+YK C+  GC   D+LA +DQA+ DGVD+LSLSLGG    P+Y D I
Sbjct  245   GTARGMATRARVASYKVCWRNGCFGSDILAGMDQAILDGVDVLSLSLGGGS-APYYRDTI  303

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI +F A ++G+FV  SAGN+GP  ++++N APWIMTV A +LDR FPA   LGN   F 
Sbjct  304   AIGSFAAVERGIFVSCSAGNAGPARATLANVAPWIMTVGAGTLDRDFPAYAVLGNKNRFT  363

Query  535   GESLYSGKAVNQKL-PLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  + +KL  LVY + + G G   C  GSL   LV+G++VVC+RG +AR EKGS
Sbjct  364   GVSLYSGPGMGKKLVGLVYDKGSDGSG-NLCLPGSLQPALVRGKVVVCDRGTNARVEKGS  422

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMIL N    GEE+ AD H LPA A+G   G  +++Y +S+ + TA+I F G
Sbjct  423   VVRAAGGVGMILANTAASGEELVADSHLLPAVAVGRKVGDLIREYASSNLNPTATIGFGG  482

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV G + +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILAAW   +GPT LE D R  +F
Sbjct  483   TVLGVQPSPVVAAFSSRGPNLVTPQILKPDVIGPGVNILAAWSGAVGPTGLEKDTRKTQF  542

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SGLAALLK+ H +WSP+AIKSALMTTSYT D+  S + D+       
Sbjct  543   NIMSGTSMSCPHISGLAALLKAAHPNWSPSAIKSALMTTSYTHDNTNSSLRDAAGGT--Y  600

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             +TP+A GSGHVDPE+A  PGL+YDIST DY  +LCSL+Y   Q+  + ++ +   +    
Sbjct  601   STPWAHGSGHVDPEKALSPGLVYDISTDDYVAFLCSLDYTIDQVRAVAKRPNVTCSRKFA  660

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG LNYPSF+V+F S        +TR  TNVG   SVYAV VM P  V V VKP  L F
Sbjct  661   DPGQLNYPSFSVLFGSKRIVR---YTRQLTNVGAAGSVYAVTVMGPPAVEVTVKPPKLVF  717

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              K+G   SYTV+FV+++G +       FGS+VW +    VRSP+A  W
Sbjct  718   AKVGDRRSYTVTFVSKKG-MNQTVRSDFGSIVWSNAQNEVRSPVAYAW  764



>ref|XP_010061844.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW90792.1| hypothetical protein EUGRSUZ_A02859 [Eucalyptus grandis]
Length=780

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/590 (53%), Positives = 403/590 (68%), Gaps = 13/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FY+GYES  GKI+E  EYKSPRD +GHGTHTA+T AG  V+ A+ LG A G+
Sbjct  194   RKIVGARIFYRGYESATGKIDERTEYKSPRDQDGHGTHTAATVAGSPVRGANLLGYAYGT  253

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+T GC S D+L+A+DQAV DGV+ILS+SLGG +  P+Y D++AI
Sbjct  254   ARGMAPGARVAAYKVCWTGGCFSSDILSAIDQAVADGVNILSISLGGGV-SPYYRDSLAI  312

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA + GV V  SAGN GP   S++N +PWI TV AS++DR FPA V LG G    G 
Sbjct  313   AAFGAMEMGVLVSCSAGNGGPDPVSLTNVSPWITTVGASTMDRDFPATVNLGAGISVTGA  372

Query  541   SLYSGK---AVNQKLPLVYGRT--AGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+   +VN++ PLVY  T  +G   +  C  G+L+   V G+IV+C+RG S R +K
Sbjct  373   SLYKGRRNLSVNKQYPLVYPGTNSSGPNPSSLCLEGTLNPHTVAGKIVICDRGISPRVQK  432

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VK +GG GMIL N    GEE+ AD H LPA A+G   G A+K Y+ +S++ATA++ F
Sbjct  433   GQVVKDAGGIGMILQNTAANGEELVADCHLLPAVAVGEKEGKAIKHYVLTSRNATATLAF  492

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G R +PV+AAFSSRGP+ +S EI+KPD+ APGVNILAAW  ++GP+ L  D+R V
Sbjct  493   GGTRLGVRPSPVVAAFSSRGPNFLSLEILKPDMVAPGVNILAAWAGDMGPSSLPTDHRKV  552

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AALLK+ H DWSPAAIKSALMTT+Y  D+ + PI D  ++  
Sbjct  553   KFNILSGTSMSCPHVSGVAALLKARHPDWSPAAIKSALMTTAYVHDNTRKPIQD--ASTA  610

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
              ++TP+  G+GH++P +A  PGL+YDI  QDYF +LC+    STQ+ +  +  +    H 
Sbjct  611   TASTPYDHGAGHINPLKAIDPGLVYDIQPQDYFEFLCAQKLTSTQLKVFAKYANRSCHHS  670

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
               + GDLNYP+ +V+F   +S +S T  RT TNVG P S Y V V    GVSV V+P  L
Sbjct  671   LARAGDLNYPAISVLFPEKASVTSLTVQRTVTNVGPPVSNYHVVVSPIKGVSVRVEPSTL  730

Query  1603  KFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             KF +  Q L+Y ++F      +A      FG LVWK     VRSPI V W
Sbjct  731   KFTQRHQKLTYKMTFTT----MARRNSPEFGGLVWKDGVHKVRSPIVVTW  776



>ref|XP_006357406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=776

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/594 (53%), Positives = 398/594 (67%), Gaps = 15/594 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K++GAR FYKGYE+  G ++E+ E KSPRD+EGHGTHTASTAAG LV +ASF   A+G 
Sbjct  182   RKIIGARMFYKGYEASHGPMDESKEAKSPRDTEGHGTHTASTAAGSLVANASFYQYAKGE  241

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT-DNIA  357
             A GM   ARIAAYK C+  GC   D+LAA+DQAV DGV ++SLS+G     P Y  D+IA
Sbjct  242   ARGMAIKARIAAYKICWKDGCFDSDILAAMDQAVADGVHVISLSVGANGYAPHYLHDSIA  301

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AFGA++ GV V  SAGNSGP   +  N APWI+TV AS++DR FPA V LG+ RVF G
Sbjct  302   IGAFGASEHGVLVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADVILGDDRVFGG  361

Query  538   ESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLYSG  + + K P+VY   +G  G+++C  G L  + V G+IV+C+RG +AR EKGS 
Sbjct  362   VSLYSGNPLTDSKFPVVY---SGDCGSKYCYPGKLDHKKVAGKIVLCDRGGNARVEKGSA  418

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GG GMIL N    GEE+ AD H LPAT +G  AG  +++Y+ S  S TA+I F+GT
Sbjct  419   VKLAGGVGMILANLAESGEELVADSHLLPATMVGQKAGDKIREYVTSDTSPTATIVFRGT  478

Query  895   VYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             V GN   AP +AAFSSRGP+ ++PEI+KPDV APGVNILA W  + GPT L  D R VEF
Sbjct  479   VIGNSPAAPRVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGSTGPTDLAIDPRRVEF  538

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPHVSGLAALL+  H  W+PAAIKSALMTT+Y LD+     TD  +     
Sbjct  539   NIISGTSMSCPHVSGLAALLRRAHSKWTPAAIKSALMTTAYNLDNSGKIFTDLATGE--E  596

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA--CPTHH  1422
             +TPF  GSGHVDP RA  PGL+YDI T DY N+LC++ Y+   I++ +R  S   C    
Sbjct  597   STPFVHGSGHVDPNRALDPGLVYDIETSDYVNFLCTIGYDGDDIAVFVRDSSRVNCSERS  656

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNV-GIPESVYAVHVMEPDGVSVIVKPKV  1599
                PGDLNYPSF+V F S S+     + R   NV G   +VY V V  P  V V V P  
Sbjct  657   LATPGDLNYPSFSVDFTSDSNGVV-KYKRVVKNVGGDSNAVYEVKVNAPSAVEVSVSPAK  715

Query  1600  LKFNKMGQNLSYTVSFVAQRGK--IASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             L F++   +LSY +SF ++R +  +  G   +FGS+ W     +VRSPIAV W+
Sbjct  716   LVFSEENNSLSYEISFTSKRSEDIMVKGIQSAFGSIEWSDGIHSVRSPIAVRWR  769



>ref|XP_010090170.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38967.1| Subtilisin-like protease [Morus notabilis]
Length=761

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/591 (52%), Positives = 392/591 (66%), Gaps = 16/591 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYE-----SIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLG  165
             KKL+GAR+F KGY+       +GK  +  E  SPRD +GHGTHTASTAAG  V +AS LG
Sbjct  177   KKLIGARSFSKGYQMSSGGGSIGK--QRKEVVSPRDRDGHGTHTASTAAGSHVANASLLG  234

Query  166   LARGSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT  345
              A G+A GM   AR+AAYK C++ GC   D+LA +D+A+ DGVD+LS+SLGG    P+Y 
Sbjct  235   YASGTARGMATRARVAAYKVCWSTGCFGSDILAGIDRAISDGVDVLSMSLGGGS-APYYH  293

Query  346   DNIAIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGR  525
             D IAI AF A +KG+FV  SAGNSGP  +S++N APWIMTV A +LDR FPA   LGN  
Sbjct  294   DTIAIGAFSAVEKGIFVSCSAGNSGPSRASLANVAPWIMTVGAGTLDRDFPAYAVLGNKN  353

Query  526   VFRGESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAE  702
              F G SLYSG  +  K + LVY + A       C  GSL   +V+G++V+C+RG +AR E
Sbjct  354   RFTGVSLYSGPGMGDKPVGLVYSKGANSSSGNLCLAGSLEPEVVRGKVVLCDRGVNARVE  413

Query  703   KGSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIK  882
             KG+ V+ +GG GMIL N    GEE+ AD H  PA A+G   G  +++Y+ S  + TA + 
Sbjct  414   KGAVVREAGGIGMILANTAASGEELVADSHLSPAVAVGMKVGDQIREYVRSDPNPTALLS  473

Query  883   FQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRS  1059
             F GTV   R +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILAAW   IGPT LE D R 
Sbjct  474   FGGTVLNVRPSPVVAAFSSRGPNLVTPQILKPDVIGPGVNILAAWSEAIGPTGLEKDTRK  533

Query  1060  VEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTN  1239
              +FNI+SGTSMSCPH+SGLAALLK+ H DWSP+AIKSALMTT+Y  D+ KSP+ D+    
Sbjct  534   TKFNIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYVTDNTKSPLRDAEGDQ  593

Query  1240  PISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTH  1419
                +TP+A G+GHVDP++A  PGL+YDIS  +Y N+LCSL+Y +  I  +++ ++   + 
Sbjct  594   --VSTPWAHGAGHVDPQKALSPGLVYDISVDEYINFLCSLDYTTDHIQTIVKHRNFTCSK  651

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
                 PG LNYPSF+V+F +        +TR  TNVG   SVY V V  P  V V VKP  
Sbjct  652   KFSDPGALNYPSFSVLFANKRVVR---YTRRLTNVGAAASVYTVAVNAPPTVKVTVKPAK  708

Query  1600  LKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             L F  +G+ L YTV+FVA RG  A      FGS+VW +    VRSP A  W
Sbjct  709   LAFKSVGERLRYTVTFVASRGA-ARTSRSEFGSIVWSNAEHQVRSPAAFAW  758



>ref|XP_004507999.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=753

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/588 (51%), Positives = 401/588 (68%), Gaps = 10/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGY-ESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KKL+GAR+F KGY  +  G   + ++  SPRD +GHGTHTA+TAAG  V +A+ LG A G
Sbjct  169   KKLIGARSFSKGYLMASTGGRKKLMDTVSPRDRDGHGTHTATTAAGSAVDNATLLGYATG  228

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
             +A GM   ARIAAYK C+T GC + D+LA +DQA++DGVD+LSLSLGG    P+Y D IA
Sbjct  229   TARGMAPQARIAAYKVCWTDGCFASDILAGIDQAIQDGVDVLSLSLGGSSSTPYYYDTIA  288

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AF A ++G+FV  SAGN+GP + S+SN APWIMTV A +LDR FPA  +LGNG+   G
Sbjct  289   IGAFAAVERGIFVSCSAGNTGPRSGSLSNVAPWIMTVGAGTLDRNFPAYAKLGNGKSLSG  348

Query  538   ESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLYSG+ + N+ + LVY        +  C  GSL   +V+G++VVC+RG ++R EKGS 
Sbjct  349   VSLYSGEGMGNEPVGLVYFNEQFNSSSSICMPGSLDPEIVRGKVVVCDRGVNSRVEKGSV  408

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             V  +GG GMIL N  + GE V AD H +PA A+G + G  +K+Y +   + TA + F GT
Sbjct  409   VNDAGGVGMILANTASSGEGVVADSHVIPAVAVGKNTGDEIKEYASLDPNPTAVLSFGGT  468

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V   + +PV+A FSSRGP+ V+P+I+KPDV  PGVNILAAW   +GP+  + D R  +FN
Sbjct  469   VLNVKPSPVVAGFSSRGPNGVTPQILKPDVIGPGVNILAAWTGAVGPSGSQ-DTRKTQFN  527

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPH+SGLAALLKSVH DWSP+AIKSALMTT+YT D+ +SP+ D  +T    +
Sbjct  528   IMSGTSMSCPHISGLAALLKSVHPDWSPSAIKSALMTTAYTRDNTESPLRD--ATGEALS  585

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA-CPTHHHH  1428
              P+A+GSGHV P++A  PGL+YD  TQDY  +LCSLNY    + L++++    C  ++  
Sbjct  586   IPWAYGSGHVSPQKALSPGLLYDTDTQDYIAFLCSLNYTLDHVQLIVKRHDVNCSKYYFA  645

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PGDLNYPSF+V+F ++S      +TR  TNVG  +SVY V V  P  V + VKP  L F
Sbjct  646   DPGDLNYPSFSVVFGNNSVVQ---YTRRLTNVGEAKSVYDVVVSGPSTVGITVKPTRLVF  702

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              ++G+  +YTV+F++ +  +     + FGS+ W +    VRSP+A  W
Sbjct  703   EQVGERQTYTVTFISNKDTVDDSVTYEFGSITWSNKRHQVRSPVAFTW  750



>ref|XP_009613479.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/595 (52%), Positives = 402/595 (68%), Gaps = 16/595 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GA+ FYKGYE+  G ++E+ E KSPRD+EGHGTHTASTAAG +V +ASF   A+G 
Sbjct  179   KKIIGAQMFYKGYEASHGPMDESKESKSPRDTEGHGTHTASTAAGSVVANASFYQYAKGE  238

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT-DNIA  357
             A GM   ARIAAYK C+  GC + D+LAA+DQAV DGV ++SLS+G     P Y  D+IA
Sbjct  239   ARGMAIKARIAAYKICWKNGCFNSDILAAMDQAVNDGVHVISLSVGANGYAPHYLLDSIA  298

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AFGA++ GV V  SAGNSGP   +  N APWI+TV AS++DR FPA V LG+ R+F G
Sbjct  299   IGAFGASEHGVLVSCSAGNSGPGAYTAVNIAPWILTVGASTIDREFPADVILGDNRIFGG  358

Query  538   ESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLYSG  + + KLP+VY   +G  G+++C  G L  + V G+IV+C+RG +AR EKGS 
Sbjct  359   VSLYSGDPLTDAKLPVVY---SGDCGSKYCYPGKLDHKKVAGKIVLCDRGGNARVEKGSA  415

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK++GG GMIL+N    GEE+ AD H LPAT +G  AG  ++ Y+ S  S TA+I F+GT
Sbjct  416   VKQAGGVGMILLNLADSGEELVADSHLLPATMVGQKAGDKIRHYVKSDPSPTATIVFRGT  475

Query  895   VYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             V G    AP +AAFSSRGP+ ++PEI+KPDV APGVNILA W  ++GPT L+ D R VEF
Sbjct  476   VIGKSPAAPRVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGSVGPTDLDIDTRRVEF  535

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH SGLAALLK  H  W+PAA+KSALMTT+Y LD+     TD  +     
Sbjct  536   NIISGTSMSCPHASGLAALLKRAHPKWTPAAVKSALMTTAYNLDNSGKVFTDLATGQ--E  593

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA--CPTHH  1422
             +TPF  GSGHVDP RA  PGL+YDI T DY N+LCS+ Y+   +++ +R  S   C   +
Sbjct  594   STPFVHGSGHVDPNRALDPGLVYDIETSDYVNFLCSIGYDGDDVAVFVRDSSRVNCSEQN  653

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGI-PESVYAVHVMEPDGVSVIVKPKV  1599
                PGDLNYPSF+V+F   S+     + R   NVG   ++VY V V  P  V V V P  
Sbjct  654   LATPGDLNYPSFSVVFTGESNGVV-KYKRVMKNVGKNTDAVYEVKVNAPSSVEVSVSPAK  712

Query  1600  LKFNKMGQNLSYTVSFVAQRG---KIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             L F++  ++LSY +SF ++     ++  G   +FGS+ W      VRSPIAV W+
Sbjct  713   LVFSEEKKSLSYEISFKSKSSGDLEMVKGIESAFGSIEWSDGIHNVRSPIAVRWR  767



>ref|XP_010557668.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557669.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557670.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557671.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=772

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/587 (52%), Positives = 399/587 (68%), Gaps = 11/587 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KKL+GAR+F KG++   G   +   E  SPRD +GHGTHT+STAAG  V++ASFLG A G
Sbjct  191   KKLIGARSFSKGFQMASGGGFSNKRESVSPRDVDGHGTHTSSTAAGSAVRNASFLGYATG  250

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
             +A GM   AR+A YK C++ GC   D+LA +D+A+ DGVD+LSLSLGG    P+Y D IA
Sbjct  251   TARGMATRARVATYKVCWSTGCFGSDILAGMDRAILDGVDVLSLSLGGGS-APYYRDTIA  309

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AF A +KG+FV  SAGNSGP  +S++N APWIMTV A +LDR FPA   LGNG  F G
Sbjct  310   IGAFSAMEKGIFVSCSAGNSGPTKASIANVAPWIMTVGAGTLDRDFPAYAALGNGDRFTG  369

Query  538   ESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLYSG+ +  K L LVY +      +  C  GSL   +V+G+IVVC+RG +AR EKG+ 
Sbjct  370   VSLYSGEGMGTKPLALVYNK-GNSSSSNLCLPGSLDPAIVRGKIVVCDRGVNARVEKGAV  428

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             V+ +GGAGMIL N    GEE+ AD H LPA A+G   G  +++Y+ S K+ TA + F+GT
Sbjct  429   VRDAGGAGMILANTAASGEELVADSHMLPAMAVGRKTGDLIREYVKSDKNPTAVLVFRGT  488

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V G R +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILA W   +GPT LE D R  +FN
Sbjct  489   VLGVRPSPVVAAFSSRGPNTVTPQILKPDVIGPGVNILAGWSEAVGPTGLEKDPRRTQFN  548

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPH+SGLAALLK+ H +WSP+AIKSALMTT+Y +D+   P+ D+ + N +S 
Sbjct  549   IMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYNVDNTNLPLRDA-ADNSLS-  606

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
              P+  GSGHVDP++A  PGL+YDIST++Y  +LCSL+Y    I  ++++ S   +     
Sbjct  607   NPWTHGSGHVDPQKAMSPGLVYDISTEEYIRFLCSLDYTVDHIQAIVKRPSVNCSRKFSD  666

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PG LNYPSF+V+F          +TR  TNVG P S+Y V V  P  V+V VKP  L F 
Sbjct  667   PGQLNYPSFSVLFGDKRVAR---YTRELTNVGTPGSIYKVAVDGPASVAVTVKPTRLVFG  723

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              +G+   YTV+F A+RG ++      FGS+ W ++  +VRSP+   W
Sbjct  724   AVGEKKRYTVTFSAKRG-MSLATSSEFGSITWSNSEHSVRSPVVFSW  769



>ref|XP_011030007.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=778

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/590 (51%), Positives = 401/590 (68%), Gaps = 13/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FYKGYE++ GKIN   EYKSPRD +GHGTHTA+T AG  V+ A+ LG A G+
Sbjct  191   KKIVGARVFYKGYEAVTGKINGQNEYKSPRDQDGHGTHTAATVAGSPVRGANLLGYAHGT  250

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C+  GC S D+L+AVD+AV DGV++LS+SLGG +   +Y D+++I
Sbjct  251   ARGMAPGARIAAYKVCWAGGCFSSDILSAVDRAVADGVNVLSISLGGGVSS-YYRDSLSI  309

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFG+ + GVFV  SAGN+GP  +S++N +PWI TV AS++DR FPA  +LG GR   G 
Sbjct  310   AAFGSMEMGVFVSCSAGNAGPEPASLTNVSPWIATVGASTMDRDFPATAKLGTGRTISGV  369

Query  541   SLYSGK---AVNQKLPLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+   +  +K PLVY  G ++    +  C  G+L+ R+V G+IV+CERG S R +K
Sbjct  370   SLYKGRRTLSSRKKYPLVYMGGNSSSLDPSSLCLEGTLNPRVVAGKIVICERGISPRVQK  429

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G   K++G  GMIL N    GEE+ AD H LPA A+G   G  +K Y  +S++ATA++ F
Sbjct  430   GQVAKQAGAVGMILANTAANGEELVADCHLLPAVAVGEREGKLIKNYALTSRNATATLAF  489

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
             +GT  G R +PV+AAFSSRGP+ ++ EI+KPD+ APGVNILAAW  ++GP+ L  D+R V
Sbjct  490   RGTSLGIRPSPVVAAFSSRGPNLLTLEILKPDIVAPGVNILAAWTGDLGPSNLPTDHRRV  549

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AALLK+ H +WSPAAIKSALMTT+Y  D+   P+ D+ +  P
Sbjct  550   KFNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVHDNTHHPLKDASAATP  609

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               +T F  G+GH++P RA  PGLIYD+  QDYF++LC+     T++ +  +  +    H 
Sbjct  610   --STSFDHGAGHINPMRAQDPGLIYDLEPQDYFDFLCTQKLTPTELKVFGKYANRSCRHS  667

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
                PGDLNYPS + +F   +S    T  RT TNVG+P S Y V V   +G +V V+P++L
Sbjct  668   LANPGDLNYPSISAVFPDDTSIKVLTLHRTVTNVGLPTSTYHVVVSPFEGATVKVEPEIL  727

Query  1603  KFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             KF +  Q LSY + F  +  +        FG LVWK     VRSPIA+ W
Sbjct  728   KFTRKNQKLSYKIIFTTKTRQTMP----EFGGLVWKDGAHKVRSPIAITW  773



>ref|XP_010029506.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=780

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/597 (52%), Positives = 409/597 (69%), Gaps = 15/597 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR FY GYE+  GK+NET +++SPRDS+GHGTHTAS AAG  V  AS LG A+G 
Sbjct  184   RKLIGARFFYNGYEAANGKMNETTQFRSPRDSDGHGTHTASIAAGRYVFPASTLGYAKGM  243

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P++ D IAI
Sbjct  244   AAGMAPKARLAAYKVCWDAGCYDSDILAAFDAAVGDGVDVISLSVGGVV-VPYHLDAIAI  302

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA + GVFV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNG++  G 
Sbjct  303   GAFGAEEAGVFVSASAGNGGPGGLTVTNVAPWVTTVGAGTIDRDFPADVKLGNGKMIPGV  362

Query  541   SLYSGKAVN--QKLPLVYGRTAGGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
             SLY G  +   +  PL+Y  T GG G  A  C  GSL   LVK +IV+C+RG ++RA KG
Sbjct  363   SLYGGPGLTPGRMYPLIYAGTEGGDGYSASLCMEGSLDQSLVKDKIVLCDRGINSRAAKG  422

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYIN-SSKS---ATAS  876
               VK++GG GMIL N   +GE + AD H LPATA+G ++G  ++KYI  +SKS   ATA+
Sbjct  423   EVVKKAGGVGMILANGVFDGEGLVADCHVLPATAVGAASGDEIRKYIEVASKSKSPATAT  482

Query  877   IKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADN  1053
             + F+GT    R APV+A+FS+RGP+ VSPEI+KPDV APG+NILAAWP NIGP+ + +D 
Sbjct  483   VIFKGTRLRVRPAPVVASFSARGPNPVSPEILKPDVIAPGLNILAAWPDNIGPSGVASDK  542

Query  1054  RSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVS  1233
             R  EFNILSGTSM+CPHVSGLAALLK+ H +WSPAAI+SALMTT+YT+D+R   + D  +
Sbjct  543   RKTEFNILSGTSMACPHVSGLAALLKAAHPEWSPAAIRSALMTTAYTVDNRGETMLDEST  602

Query  1234  TNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACP  1413
              N  ++T   +G+GHV P++A  PGLIYD++  DY ++LC+ NY +  I ++ RKK+ C 
Sbjct  603   GN--TSTVMDYGAGHVHPQKAMDPGLIYDLTPYDYVDFLCNSNYTTANIQVVTRKKADCS  660

Query  1414  -THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVSVIV  1587
                     G+LNYPS +V F         T F R+ TNVG  ESVY V V  P GVSV V
Sbjct  661   GAKRAGHSGNLNYPSLSVTFQQYGKPKMSTHFIRSVTNVGDAESVYRVSVRPPKGVSVTV  720

Query  1588  KPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             +P+ L F ++GQ L++ V    +  K++ GG     GS++W     TV SP+ V  Q
Sbjct  721   RPEKLAFRRIGQKLNFLVRVEVRAAKLSPGGSSLRSGSVIWSDGKHTVTSPLVVTLQ  777



>ref|XP_003627323.1| Cucumisin-like serine protease subtilisin-like protease [Medicago 
truncatula]
 gb|AET01799.1| subtilisin-like serine protease [Medicago truncatula]
Length=785

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/595 (52%), Positives = 404/595 (68%), Gaps = 23/595 (4%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             K++GA+ FYKGYE+ + + I+ETVE KSPRD+EGHGTHTASTAAG +V +AS  G ARG 
Sbjct  193   KIIGAKAFYKGYEAYLQRPIDETVESKSPRDTEGHGTHTASTAAGSVVGNASLFGFARGE  252

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKP-FYTDNIA  357
             A GM   ARIAAYK C+ LGC   D+LAA+D+AV DGV ++SLS+G     P +Y D+IA
Sbjct  253   AKGMATKARIAAYKICWKLGCFDSDILAAMDEAVADGVHVISLSVGSNGYAPHYYRDSIA  312

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AFGA Q GV V  SAGNSGP   +  N APWI+TV AS++DR FPA V LG+GRVF G
Sbjct  313   IGAFGAAQHGVVVSCSAGNSGPGPYTSVNIAPWILTVGASTIDREFPADVVLGDGRVFGG  372

Query  538   ESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLY G ++ + KLPL+YG   G +   +C  GSL S  V+G+IVVC+RG +AR EKGS 
Sbjct  373   VSLYYGDSLPDNKLPLIYGADCGSR---YCYLGSLDSSKVQGKIVVCDRGGNARVEKGSA  429

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK++GG GMI+ N E  GEE+ AD H + AT +G +A   +++YI SS++ TA+IKF+GT
Sbjct  430   VKKAGGLGMIMANTEENGEELLADAHLVAATMVGENAAEKIREYIKSSENPTATIKFKGT  489

Query  895   VYGNR----APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
             V G      AP +A+FSSRGP+  + EI+KPDV APGVNILA W   +GPT LE D R V
Sbjct  490   VIGGEGSPSAPQVASFSSRGPNYRTAEILKPDVIAPGVNILAGWTGKVGPTDLEIDPRRV  549

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             EFNI+SGTSMSCPHVSG+AALL+  + +WSPAAIKSALMTT+Y +D+    I D  +   
Sbjct  550   EFNIISGTSMSCPHVSGIAALLRKAYPEWSPAAIKSALMTTAYNVDNSGGKIKDLGTGK-  608

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA---CP  1413
               + PF  G+GHVDP +A +PGL+YD++  DY  +LCS+ Y++ +I +  R+ ++   C 
Sbjct  609   -ESNPFVHGAGHVDPNKALNPGLVYDLNINDYLAFLCSIGYDAKEIQIFTREPTSYNVCE  667

Query  1414  THHHH-QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIP-ESVYAVHVMEPDGVSVIV  1587
                    PGDLNYPSF+V+F +++      + R  TNVG   ++VY V V  P GV V V
Sbjct  668   NERKFTSPGDLNYPSFSVVFGANNGLV--KYKRVLTNVGDSVDAVYTVKVNAPFGVDVSV  725

Query  1588  KPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              P  L F+   +  ++ V+F     +I  GG  SFGSL W   +  VRSPIA  W
Sbjct  726   SPSKLVFSSENKTQAFEVTFT----RIGYGGSQSFGSLEWSDGSHIVRSPIAARW  776



>ref|XP_004488082.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=774

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/587 (52%), Positives = 402/587 (68%), Gaps = 10/587 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYK-SPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             +KL+GAR+F KG+    G    + E   SPRD +GHGTHTASTAAG  V +ASFLG A G
Sbjct  192   RKLIGARSFSKGFHMSNGYGKTSNEEPISPRDRDGHGTHTASTAAGSHVANASFLGYATG  251

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
             +A GM   AR+AAYK C+T GC + D+LA +D+A++DGVD+LSLSLGG    P++ D +A
Sbjct  252   TARGMAPQARVAAYKVCWTDGCFASDILAGMDRAIQDGVDVLSLSLGGES-VPYFRDTVA  310

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AF A ++G+FV  SAGNSGP  +S++N APWIMTV A +LDR FPA V LGN +   G
Sbjct  311   IGAFAAVERGIFVSCSAGNSGPARASIANVAPWIMTVGAGTLDRDFPAYVTLGNKKRLSG  370

Query  538   ESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLYSGK + ++ + LVY +      A  C  GSL   LV+G++V+C+RG SAR EKG  
Sbjct  371   VSLYSGKGMGSEPVGLVYFK-GSNHSANICMAGSLDPALVRGKVVICDRGISARVEKGKV  429

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             V+ +GG GMIL N    GEE+ AD H LPA A+G + G  +++Y +S ++ TA + F GT
Sbjct  430   VRDAGGIGMILANTAESGEELVADSHLLPAVAVGNTIGDEIREYGSSDRNPTAVLSFGGT  489

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             +   R +P++AAFSSRGP+ ++ EI+KPDV  PGVNILA W   +GP+ L  DNR  +FN
Sbjct  490   ILNVRPSPIVAAFSSRGPNMITKEILKPDVIGPGVNILAGWSDAVGPSGLAGDNRKTQFN  549

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPH+SGLAALLK+ H +WSP+AIKSALMTT+YT D+ KSP+ D+   +   +
Sbjct  550   IMSGTSMSCPHISGLAALLKAAHPNWSPSAIKSALMTTAYTHDNSKSPLRDAAGKS--FS  607

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TP+A G+GHV+P++A  PGL+YD ST+DY  +LCSLNYN  QI L++++     T+    
Sbjct  608   TPWAHGAGHVNPQKAFSPGLVYDASTKDYITFLCSLNYNPEQIQLIVKRPDVNCTNKFAN  667

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PG LNYPSF+++F S        +TR  TNVG   SVY V V  P  V + VKP  L F 
Sbjct  668   PGQLNYPSFSIMFSSKRVVR---YTRILTNVGEAGSVYNVVVDGPSWVDITVKPSRLVFE  724

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             K+G    YTV+FV+++G   S   + FGS++W +T   VRSPIA  W
Sbjct  725   KVGDRKRYTVTFVSKKGVDTSSVRNGFGSILWSNTQHQVRSPIAFAW  771



>ref|XP_009758461.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=774

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/595 (52%), Positives = 399/595 (67%), Gaps = 16/595 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK++GA+ FYKGYE+  G ++E+ E KSPRD+EGHGTHTASTAAG +V +ASF   A+G 
Sbjct  179   KKIIGAQMFYKGYEAKHGPMDESKESKSPRDTEGHGTHTASTAAGSVVANASFYQYAKGE  238

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT-DNIA  357
             A GM   ARIAAYK C+  GC + D+LAA+DQAV DGV ++SLS+G     P Y  D+IA
Sbjct  239   ARGMAIKARIAAYKICWKNGCFNSDILAAMDQAVDDGVHVISLSVGANGYAPHYLYDSIA  298

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AFGA++ GV V  SAGNSGP   +  N APW++TV AS++DR FPA V LG+ R+F G
Sbjct  299   IGAFGASEHGVLVSCSAGNSGPGAYTAVNIAPWMLTVGASTIDREFPADVILGDNRIFGG  358

Query  538   ESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLYSG  + + KLP+VY   +G  G+++C  G L  + V G+IV+C+RG +AR EKGS 
Sbjct  359   VSLYSGNPLADAKLPVVY---SGDCGSKYCYPGKLDPKKVAGKIVLCDRGGNARVEKGSA  415

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK++GG GMIL N    GEE+ AD H LPAT +G  AG  ++ Y+ S  + TA+I F+GT
Sbjct  416   VKQAGGVGMILANLADSGEELVADSHLLPATMVGQKAGDKIRHYVKSDPAPTATIVFRGT  475

Query  895   VYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             V G    AP +AAFSSRGP+ ++PEI+KPDV APGVNILA W  ++GPT L+ D R VEF
Sbjct  476   VIGKSPAAPRVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGSVGPTDLDIDTRRVEF  535

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPHVSGLAALL+  H  W+PAA+KSALMTT+Y LD+     TD  +     
Sbjct  536   NIISGTSMSCPHVSGLAALLRRAHPKWTPAAVKSALMTTAYNLDNSGKVFTDLATGQ--E  593

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA--CPTHH  1422
             +TPF  GSGHVDP RA  PGL+YDI T DY N+LCS+ Y+ T +++  R  S   C    
Sbjct  594   STPFVHGSGHVDPNRALDPGLVYDIETSDYVNFLCSIGYDGTDVAVFARDSSRVNCSERS  653

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGI-PESVYAVHVMEPDGVSVIVKPKV  1599
                PGDLNYPSF+V+F   ++     + R   NVG   ++VY V V  P  V V V P  
Sbjct  654   LATPGDLNYPSFSVVFTGETNGVV-KYKRVVKNVGKNTDAVYEVKVNAPSSVEVSVSPAK  712

Query  1600  LKFNKMGQNLSYTVSFVAQRG---KIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             L F++  Q+LSY +S   +     ++  G   +FGS+ W      VRSPIAV W+
Sbjct  713   LVFSEEKQSLSYEISLKGKSSGDLEMVKGIESAFGSIEWSDGIHNVRSPIAVRWR  767



>ref|XP_002278292.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=761

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/590 (51%), Positives = 400/590 (68%), Gaps = 14/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK--INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GA++F KGY    G   + ++ E +SPRD +GHGTHTASTAAG  V +AS LG A 
Sbjct  177   KKLIGAQSFSKGYRMASGGNFVKKSKEKESPRDVDGHGTHTASTAAGAHVSNASLLGYAS  236

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   AR+AAYK C++ GC   D+LA +D+A+ DGVD+LSLSLGG    P+Y D I
Sbjct  237   GTARGMATHARVAAYKVCWSTGCFGSDILAGMDRAIVDGVDVLSLSLGGGS-GPYYRDTI  295

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AF A + G+FV  SAGNSGP  +S++N APWIMTV A +LDR FPA   LGNG+   
Sbjct  296   AIGAFTAMEMGIFVSCSAGNSGPSKASLANVAPWIMTVGAGTLDRDFPAYALLGNGKKIT  355

Query  535   GESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG+ + +K + LVY +  G   +  C  GSL    V+G++V+C+RG +AR EKG 
Sbjct  356   GVSLYSGRGMGKKPVSLVYSK--GNSTSNLCLPGSLQPAYVRGKVVICDRGINARVEKGL  413

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMIL N    GEE+ AD H LPA A+G   G  ++ Y+ S  + TA + F G
Sbjct  414   VVRDAGGVGMILANTAVSGEELVADSHLLPAVAVGRKVGDVLRAYVKSVANPTALLSFGG  473

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   R +PV+AAFSSRGP+ V+P+I+KPD+  PGVNILAAW   +GPT LE D R  +F
Sbjct  474   TVLNVRPSPVVAAFSSRGPNLVTPQILKPDLIGPGVNILAAWSEALGPTGLEKDTRKTQF  533

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SG+AAL+K+ H +WSP+A+KSALMTT+YT D+ KSP+ D+       
Sbjct  534   NIMSGTSMSCPHISGVAALIKAAHPEWSPSAVKSALMTTAYTRDNTKSPLRDAADGG--L  591

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             +TP A GSGHVDP++A  PGL+YDISTQDY  +LCSL+Y    +  ++++++   +    
Sbjct  592   STPLAHGSGHVDPQKALSPGLVYDISTQDYVAFLCSLDYTIEHVRAIVKRQNITCSRKFS  651

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG+LNYPSF+V+F S        +TR  TNVG  +SVY V V  P  V V+V+P  L F
Sbjct  652   DPGELNYPSFSVLFGSKGFVR---YTRELTNVGAADSVYQVAVTGPPSVGVVVRPSTLVF  708

Query  1609  NKMGQNLSYTVSFVAQRGKIASG--GGHSFGSLVWKSTNFTVRSPIAVIW  1752
               +G+   YTV+FVA++GK         +FGS+VW +T   V+SP+A  W
Sbjct  709   KNVGEKKRYTVTFVAKKGKKVQNRMTRSAFGSIVWSNTQHQVKSPVAYAW  758



>ref|XP_006342924.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/592 (53%), Positives = 395/592 (67%), Gaps = 16/592 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             +K++GAR FYKGYE+  G  ++E+ E KSPRD+EGHGTHTASTAAG +V +ASF   A+G
Sbjct  177   RKIIGARLFYKGYEADRGSPMDESKESKSPRDTEGHGTHTASTAAGSVVANASFYQYAKG  236

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFY-TDNI  354
              A GM   ARIAAYK C+  GC   D+LAA+DQAV DGV ++SLS+G     P Y  D+I
Sbjct  237   EARGMAVKARIAAYKICWKTGCFDSDILAAMDQAVADGVHVISLSVGADGYSPEYDVDSI  296

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AFGAT+ GV V  SAGNSGP  S+  N APWI+TVAAS++DR FPA V LG+GR+F 
Sbjct  297   AIGAFGATEHGVVVSCSAGNSGPGASTAVNVAPWILTVAASTIDREFPADVILGDGRIFG  356

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLY+G  + N KL LVY    G   ++ C  G L    V G+IV+C+RG +AR EKGS
Sbjct  357   GVSLYTGDPLGNAKLQLVYSADCG---SQLCYPGKLDPSKVAGKIVLCDRGGNARVEKGS  413

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK++GGAGM+L N    GEE+ AD H LPAT +G  AG  ++ YI S  S TA+I F+G
Sbjct  414   AVKQAGGAGMVLANLADSGEELVADAHLLPATMVGQKAGNKIRDYIKSVPSPTATITFKG  473

Query  892   TVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             TV G    AP +AAFS RGP+ V+PEI+KPDVTAPGVNILA W   +GPT LE D R VE
Sbjct  474   TVIGKSPSAPRIAAFSGRGPNYVTPEILKPDVTAPGVNILAGWTGAVGPTDLEIDKRRVE  533

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSMSCPHVSGLAALL+  +  W+ AAIKSALMTT+Y +D+    ITD  +    
Sbjct  534   FNIISGTSMSCPHVSGLAALLRKAYPKWTTAAIKSALMTTAYNVDNSGKTITDLATGQ--  591

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA--CPTH  1419
              ++PF  GSGHVDP RA HPGL+YDI + DY  +LC++ Y  ++IS   +  S+  C  H
Sbjct  592   ESSPFVRGSGHVDPNRALHPGLVYDIESSDYVGFLCAIGYGPSRISPFTKDTSSVNCSEH  651

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPES-VYAVHVMEPDGVSVIVKPK  1596
                 PGDLNYPSF+V+F    S +   + R   NVG   + VY V V  P  V V V P 
Sbjct  652   SLASPGDLNYPSFSVVF---MSENVVKYKRVVKNVGRNANVVYKVKVNAPSSVEVKVTPS  708

Query  1597  VLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              L F++   +LSY +SF +   +   G   +FGS+ W     +VRSPIAV W
Sbjct  709   KLSFSEEKNSLSYEISFSSVGSERVKGLESAFGSIEWSDGIHSVRSPIAVRW  760



>ref|XP_010442681.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=779

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/592 (52%), Positives = 402/592 (68%), Gaps = 16/592 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FY+GYE+  GKI+E +EYKSPRD +GHGTHTA+T AG  VK A+  G A G+
Sbjct  192   RKIVGARVFYRGYEAATGKIDEELEYKSPRDKDGHGTHTAATVAGSPVKGANLFGFAYGT  251

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC S D+L+AVDQAV DGV +LS+SLGG +   +  D+++I
Sbjct  252   ARGMSPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVQVLSISLGGGI-STYSRDSLSI  310

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FPA V+LG  R F+G 
Sbjct  311   ATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTMRTFKGV  370

Query  541   SLYSGKAV---NQKLPLVY-GRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+AV   N++ PLVY GR A       FC  G+L  R V G+IV+C+RG S R +K
Sbjct  371   SLYKGRAVLSKNKQYPLVYLGRNASSPDPTSFCLDGALDQRHVAGKIVICDRGVSPRVQK  430

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VKR+GG GMIL N  T GEE+ AD H LPA A+G   G  +K+Y  +S+ ATA+++ 
Sbjct  431   GQVVKRAGGIGMILTNTATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSRKATATLEV  490

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT+ G + +PV+AAFSSRGP+ +S EI+KPD+ APGVNILAAW  ++ P+ L +D R V
Sbjct  491   LGTIIGIKPSPVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWTGDLAPSSLSSDPRRV  550

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AAL++S H DWSPAAIKSALMTT+Y  D+   P+TD+    P
Sbjct  551   KFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLKPLTDASGAAP  610

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS-ACPTH  1419
               ++P+  G+GH+DP +A  PGL+YDI  QDYF +LC+ + + +Q+ +  +  + +C   
Sbjct  611   --SSPYDHGAGHIDPLKAIDPGLVYDIGPQDYFYFLCTQDLSPSQLKVFTKHSNRSCKHT  668

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
                 PG+LNYP+ + +F  ++   S T  RT TNVG   + Y V V    G SV V+PK 
Sbjct  669   LAKNPGNLNYPAISALFPENTRVKSMTLRRTLTNVGPHIASYKVSVSPFKGASVTVQPKT  728

Query  1600  LKFNKMGQNLSYTVSFVAQ-RGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             L F    Q LSYTV+F  + R K        FG LVWKST   VRSPI + W
Sbjct  729   LNFTTKHQKLSYTVTFTTRMRMKRP-----EFGGLVWKSTTHKVRSPIIITW  775



>ref|XP_007152373.1| hypothetical protein PHAVU_004G124600g [Phaseolus vulgaris]
 gb|ESW24367.1| hypothetical protein PHAVU_004G124600g [Phaseolus vulgaris]
Length=781

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/593 (51%), Positives = 404/593 (68%), Gaps = 16/593 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FY GYE+ +G+INE  E+KS RD +GHGTHTA+T  G  V  A+ LG A G+
Sbjct  191   KKVVGARVFYHGYEAAIGRINEQKEFKSARDQDGHGTHTAATVGGSPVLGANLLGYANGT  250

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C+  GC S D+++A+D+AV DGV++LS+SLGG +   +Y D++++
Sbjct  251   ARGMAPGARIAAYKVCWIGGCFSSDIVSAIDKAVADGVNVLSISLGGGVSS-YYRDSLSV  309

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA ++GVFV  SAGN+GP  +S++N +PWI TV AS++DR FPA V+LGNG++  G 
Sbjct  310   AAFGAMERGVFVSCSAGNAGPDPASLTNVSPWITTVGASTIDRDFPAQVKLGNGKIVSGV  369

Query  541   SLYSGKAV---NQKLPLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G++     ++ PLVY    ++       C  G+L  ++V G+IVVC+RG S R +K
Sbjct  370   SLYKGQSALSFEKQYPLVYLGSNSSRVDPRSMCLEGTLDPKVVSGKIVVCDRGLSPRVQK  429

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  V+ +GG GMIL N E   EE+ AD H LPA A+G   G  +K Y+ SS+SATA++ F
Sbjct  430   GHVVRSAGGVGMILTNTEANREELVADCHLLPAVAIGEKEGKDIKSYVQSSQSATATLAF  489

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
             +GT  G R +PV+AAFSSRGP+ +S EI+KPD+ APGVNILAAW   IGP+ L+ DNR  
Sbjct  490   KGTTLGIRPSPVVAAFSSRGPNFLSLEILKPDLVAPGVNILAAWSEAIGPSGLKVDNRRE  549

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AA LKS H +WSPAAIKSALMTT+Y LD+ K  + D+ +  P
Sbjct  550   KFNILSGTSMSCPHVSGIAAFLKSRHPEWSPAAIKSALMTTAYVLDNTKKTLRDASTAKP  609

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               ++P+  GSGH+DP RA  PGL+YDI  QDYF +LC+   + TQ+ +  +  +   TH 
Sbjct  610   --SSPYDHGSGHIDPIRALDPGLVYDIEPQDYFEFLCTQKLSPTQLRVFSKYSNRSCTHS  667

Query  1423  HHQPGDLNYPSFAVIFDssssnssH---TFTRTATNVGIPESVYAVHVMEPDGVSVIVKP  1593
                PGDLNYP+ + IF   ++ S        RT TNVG P+S Y V V   +G SV V+P
Sbjct  668   LVSPGDLNYPAISSIFTQKTATSFSDPVIVHRTVTNVGPPDSNYQVVVSPFEGSSVKVEP  727

Query  1594  KVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             + L F K  QNLSY ++F  +  + +      FGSLVWK    TVRSPI + W
Sbjct  728   ETLNFTKTHQNLSYKITFTPRVRQTSP----EFGSLVWKDGLHTVRSPIVITW  776



>gb|KFK26784.1| hypothetical protein AALP_AA8G293000 [Arabis alpina]
Length=758

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/591 (52%), Positives = 397/591 (67%), Gaps = 14/591 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FY+GYE+  GKI+E +EY+SPRD +GHGTHTA+T AG  V+ A+ LG A G+
Sbjct  171   RKIVGARVFYRGYEAATGKIDEELEYRSPRDRDGHGTHTAATVAGSPVRGANLLGFAYGT  230

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC S D+L+AVDQAV DGV +LS+SLGG +   +  D++AI
Sbjct  231   ARGMAPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVQVLSISLGGGI-STYSRDSLAI  289

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FPA V+LG  R F+G 
Sbjct  290   ATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTMRSFKGV  349

Query  541   SLYSGKAV---NQKLPLVY-GRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+ V   N++ PLVY GR A       FC  G+L  R V G+IV+C+RG + R +K
Sbjct  350   SLYKGRTVLSKNKQYPLVYFGRNASSPDPTSFCLDGALDRRHVAGKIVICDRGVTPRVQK  409

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VKR+GG GMIL N  T GEE+ AD H LPA A+G   G  +K+Y  +SK ATA+++ 
Sbjct  410   GQVVKRAGGIGMILTNTATNGEELVADSHLLPAVAVGEKEGKVIKQYAMTSKRATATLEI  469

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G + +PV+AAFSSRGP+ +S EI+KPDV APGVNILAAW  ++ P+ L +D R V
Sbjct  470   LGTKVGIKPSPVVAAFSSRGPNFLSLEILKPDVLAPGVNILAAWSGDMAPSSLSSDRRRV  529

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AAL++S H DWSPAAIKSALMTT+Y  D+   PITD+    P
Sbjct  530   KFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNMLKPITDASGAAP  589

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS-ACPTH  1419
               +TP+  GSGH+DP +A  PGL+YDI  QDYF +LC+ +    Q+ +  +  +  C   
Sbjct  590   --STPYDHGSGHIDPLKAIDPGLVYDIGPQDYFEFLCTQDLTPAQLKVFTKHSNRTCKNT  647

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
               + PG+LNYP+ + +F  ++     T  RT TNVG   S Y V V    G SV V+PK 
Sbjct  648   LANNPGNLNYPAISALFPENARVKVMTLRRTVTNVGPHISSYKVSVSPFKGASVTVQPKT  707

Query  1600  LKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             L F    Q LSYTV+F   R K+       FG L+WKS    VRSP+ + W
Sbjct  708   LNFTLKHQKLSYTVTF---RTKLRMKRPE-FGGLLWKSATHKVRSPVIITW  754



>ref|XP_006339823.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=766

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/588 (52%), Positives = 398/588 (68%), Gaps = 11/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGAR F +GYE+ +G I+E+ E KSPRD +GHGTHTASTAAG +V+ AS  G A G+
Sbjct  185   RKLVGARYFSRGYETTLGPIDESKESKSPRDDDGHGTHTASTAAGSVVQGASLFGYASGT  244

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM Y AR+A YK C+  GC + D+LA +D+A+ D VD+LSLSLGG  P  +Y D+IAI
Sbjct  245   ARGMAYHARVAVYKVCWLGGCFNSDILAGMDKAIDDKVDVLSLSLGGSTPD-YYKDSIAI  303

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A +KG+ V  SAGN+GP   S+SN APWI TV A ++DR FPA V LGNG+ F G 
Sbjct  304   GAFAAMEKGILVSCSAGNAGPNQFSLSNQAPWITTVGAGTIDRDFPAYVSLGNGKNFSGV  363

Query  541   SLYSGKAV-NQKLPLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SLY+G ++ N+ LPLVY G  +       C  G+L    VKG+IV+C+RG +AR +KG  
Sbjct  364   SLYAGDSLLNKMLPLVYAGNASNVTSGNLCMMGTLIPEKVKGKIVLCDRGINARVQKGFV  423

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GGAGM+L N    GEE+ AD H LPA A+G  AG AVKKY+ S  + TA I   GT
Sbjct  424   VKAAGGAGMVLANTAANGEELVADAHLLPAAAVGLIAGDAVKKYLFSDPNPTAEILIGGT  483

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
               G + +PV+AAFSSRGP++++PEI+KPD+ APGVNILA W   +GPT +  D+R VEFN
Sbjct  484   KVGIQPSPVVAAFSSRGPNSITPEILKPDIIAPGVNILAGWTGAVGPTGMAEDDRRVEFN  543

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSGLAAL+K VH +WSPAAI+SALMTT+YT+      + D  +  P  +
Sbjct  544   IISGTSMSCPHVSGLAALVKGVHPEWSPAAIRSALMTTAYTVYKNGGALLDVATGKP--S  601

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TPF  G+GHVDP  A +PGL+YDI+  DY N++C+L Y  +QI+ L R+   C +   + 
Sbjct  602   TPFDHGAGHVDPVSAVNPGLVYDINADDYLNFMCALKYTPSQINSLARRNFTCDSSKKYS  661

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPD-GVSVIVKPKVLKF  1608
               DLNYPSFAV F + + +++  ++RT TNVG P   Y V V  P+  V +IV+P+ + F
Sbjct  662   VTDLNYPSFAVSFPADTGSNTIKYSRTLTNVG-PAGTYKVTVSSPNSSVKIIVEPETVSF  720

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              ++ +  SYTVSF A      S     FG + W      V SP+A+ W
Sbjct  721   TQINEKKSYTVSFTAPS---KSSSTDVFGRIEWSDGKHVVSSPVAISW  765



>emb|CAN81091.1| hypothetical protein VITISV_040911 [Vitis vinifera]
Length=430

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/434 (65%), Positives = 337/434 (78%), Gaps = 6/434 (1%)
 Frame = +1

Query  460   MTVAASSLDRRFPAMVELGNGRVFRGESLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSL  639
             MTVAASSLDR FP +V+LGNG  F G SLYSGKA  Q L L YG TAG  G  +C  G+L
Sbjct  1     MTVAASSLDRSFPTIVKLGNGETFHGASLYSGKATKQLL-LAYGETAGRVGVNYCVGGTL  59

Query  640   SSRLVKGRIVVCERGNSARAEKGSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGF  819
             S  LVKG+IVVC+RG ++R  KG +VK +GGAGMIL+N E +GEE+ ADPH LPA +LG 
Sbjct  60    SPNLVKGKIVVCKRGVNSRVVKGEQVKMAGGAGMILLNTEAQGEELVADPHVLPAISLGA  119

Query  820   SAGIAVKKYINSSKSATASIKFQGTVYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVN  999
             SAG ++  YINS  S TASI F+GT YGN APVMAAFSSRGP++  P +IKPDVTAPGVN
Sbjct  120   SAGKSIINYINSGNS-TASIVFRGTAYGNPAPVMAAFSSRGPASEGPYVIKPDVTAPGVN  178

Query  1000  ILAAWPPNIGPTMLEADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALM  1179
             ILAAWPP + PT L++DNRSV F++LSGTSMSCPHVSGLAALLKSVH DWSPAAIKSALM
Sbjct  179   ILAAWPPTVSPTGLKSDNRSVLFDVLSGTSMSCPHVSGLAALLKSVHKDWSPAAIKSALM  238

Query  1180  TTSYTLDSRKSPITDSVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSL  1359
             TT+YTLD+++SPI+D  S    SATPFA+GSGHV+PE+A++PGLIYDI+T+DY NYLCS+
Sbjct  239   TTAYTLDNKRSPISDXGSGG-SSATPFAYGSGHVNPEKASNPGLIYDITTEDYLNYLCSV  297

Query  1360  NYNSTQISLLLRKKS-ACPTHH-HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIP  1533
             NY S+QI+ + R+ S  CP    H QPGDLNYPSFAV+F+ ++  +  T+ R+ TNVG P
Sbjct  298   NYTSSQIARVSRRISFTCPNDTVHLQPGDLNYPSFAVLFNGNAQKNRATYKRSVTNVGYP  357

Query  1534  ESVYAVHVMEPDGVSVIVKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKS  1713
              + Y   V EP+GVSV+VKP VLKF ++ Q LSY VSFVA R K ++    SFGSLVW S
Sbjct  358   TTTYVAQVQEPEGVSVMVKPNVLKFKELNQKLSYKVSFVASR-KTSTSSNWSFGSLVWVS  416

Query  1714  TNFTVRSPIAVIWQ  1755
               + VRSPIAV WQ
Sbjct  417   RKYRVRSPIAVTWQ  430



>ref|XP_004305758.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=773

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/593 (52%), Positives = 399/593 (67%), Gaps = 19/593 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             +K++GAR ++ GYES +GK ++E+ E +SPRD+EGHGTHTASTA G  V +ASF   A G
Sbjct  182   RKIIGARAYFNGYESHLGKPMDESNESRSPRDTEGHGTHTASTAGGSRVSNASFYEYASG  241

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT-DNI  354
              A GM   ARIAAYK C+T GC   D+LAA+DQA+ DGV I+SLS+G     P Y  D+I
Sbjct  242   EARGMASKARIAAYKICWTFGCFDSDILAAMDQAIADGVHIISLSVGASGGAPPYDRDSI  301

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AFGA Q GV V +SAGNSGP   + +N APWI+TV AS+LDR FPA V LG+GRVF 
Sbjct  302   AIGAFGAAQHGVLVSASAGNSGPGKFTATNIAPWILTVGASTLDREFPADVVLGDGRVFN  361

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG+ + + KLPLVYG   G  G+  C  G+L    V+G+IVVC+RG +AR  KGS
Sbjct  362   GVSLYSGEGLMDYKLPLVYG---GDCGSRLCYSGALQPSKVQGKIVVCDRGGNARVAKGS  418

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GG GMI+ N E  GEE+ AD H +PAT +G  A   ++ YI +  +ATA+IKF+G
Sbjct  419   AVKLAGGIGMIMANTEESGEELLADSHLIPATMVGQMAADQIRSYIKTGHNATATIKFRG  478

Query  892   TVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             TV G    +P +A+FSSRGP++++PEI+KPDV APGVNILA W     PT L+ D R VE
Sbjct  479   TVIGTSPPSPKVASFSSRGPNSLTPEILKPDVIAPGVNILAGWTGASSPTDLDIDPRRVE  538

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSMSCPHVSG+AALL+  +  WSPAAIKSAL+TT+YTLD+  + I D    N  
Sbjct  539   FNIISGTSMSCPHVSGIAALLRKAYPKWSPAAIKSALVTTAYTLDNSGNKIKD--LANGG  596

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRK---KSACPT  1416
              +TPF  G+GHVDP RA +PGL+YDI   DY  ++CS+ Y   QI++ +R+      C  
Sbjct  597   ESTPFVHGAGHVDPNRALNPGLVYDIDVNDYVAFMCSIGYGPRQIAVFMRELAGDDICAR  656

Query  1417  HHHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVG-IPESVYAVHVMEPDGVSVIVKP  1593
             +    PGDLNYPSFAV+F          + R  TNVG + ++VY V+V  P GV + V+P
Sbjct  657   NSLASPGDLNYPSFAVVFKPGRELV--KYKRVVTNVGSVVDAVYEVNVDAPAGVEISVEP  714

Query  1594  KVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
               L F+++ Q  SY V+F    G +    G  +GS+ W      VRSP+AV W
Sbjct  715   SKLVFSEVNQTQSYEVTFAKGIGYV---NGERYGSIEWSDGRHHVRSPVAVRW  764



>ref|XP_002318860.1| hypothetical protein POPTR_0012s14140g [Populus trichocarpa]
 gb|EEE97080.1| hypothetical protein POPTR_0012s14140g [Populus trichocarpa]
Length=778

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/590 (51%), Positives = 396/590 (67%), Gaps = 13/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FY+GYE++ GKIN   EYKSPRD +GHGTHTA+T AG  V+ A+ LG A G 
Sbjct  191   KKIVGARVFYRGYEAVTGKINGQNEYKSPRDQDGHGTHTAATVAGSPVRGANLLGYAHGI  250

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIA YK C+  GC S D+L+AVD+AV DGV++LS+SLGG +   +Y D+++I
Sbjct  251   ARGMAPGARIAVYKVCWAGGCFSSDILSAVDRAVADGVNVLSISLGGGVSS-YYRDSLSI  309

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFG+ + GVFV  SAGN+GP  +S++N +PWI TV AS++DR FPA   LG GR   G 
Sbjct  310   AAFGSMEMGVFVSCSAGNAGPEPASLTNVSPWITTVGASTMDRDFPATARLGTGRTIYGV  369

Query  541   SLYSGK---AVNQKLPLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+   +  ++ PLVY  G ++    +  C  G+L+ R+V G+IV+CERG S R +K
Sbjct  370   SLYKGRRTLSTRKQYPLVYMGGNSSSLDPSSLCLEGTLNPRVVAGKIVICERGISPRVQK  429

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G   K++G  GMIL N    GEE+ AD H LPA A+G   G  +K Y  +S++ATA++ F
Sbjct  430   GQVAKQAGAVGMILANTAANGEELVADCHLLPAVAVGEKEGKLIKSYALTSRNATATLAF  489

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
             +GT  G R +PV+AAFSSRGP+ ++ EI+KPD+ APGVNILAAW  ++GP+ L  D+R  
Sbjct  490   RGTSLGIRPSPVVAAFSSRGPNLLTLEILKPDIVAPGVNILAAWTGDLGPSSLPTDHRRS  549

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AALLK+ H +WSPAAIKSALMTT+Y  D+   P+ D+ +  P
Sbjct  550   KFNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVHDNTHHPLKDASTATP  609

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               +TPF  G+GH++P +A  PGLIYD+  QDYF++LC+     TQ+ +  +  +    H 
Sbjct  610   --STPFDHGAGHINPMKAQDPGLIYDLEPQDYFDFLCTQKLTPTQLKVFGKYANRSCRHS  667

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
                PGDLNYPS + IF   +S    T  RT TNVG+P S Y V V    G +V V+P++L
Sbjct  668   LANPGDLNYPSISAIFPDDTSIKVLTLHRTVTNVGLPTSTYHVVVSPFKGATVKVEPEIL  727

Query  1603  KFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              F +  Q LSY + F  +  K        FG LVWK     VRSPIA+ W
Sbjct  728   NFTRKNQKLSYKIIFTTKTRKTMP----EFGGLVWKDGAHKVRSPIAITW  773



>ref|XP_006849717.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
 gb|ERN11298.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
Length=780

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/591 (52%), Positives = 403/591 (68%), Gaps = 15/591 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGY---ESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLA  171
             +KL+GAR+F +GY   E + G  N ++E  SPRD +GHGTHTASTAAG  V  AS  G A
Sbjct  194   RKLIGARSFSRGYLAAEGLGGSSNSSMESASPRDRDGHGTHTASTAAGAAVPGASLFGYA  253

Query  172   RGSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDN  351
             RG+A GM   AR+A YK C++ GC S D+LA +D+AV DGVD+LSLSLGG    P+Y D 
Sbjct  254   RGTARGMAQRARVAVYKVCWSSGCFSSDILAGMDRAVTDGVDVLSLSLGGGA-APYYRDA  312

Query  352   IAIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVF  531
             IAI AF A +KGVFV  SAGN+GP  S+++N APWI T+ A +LDR FPA V L N + F
Sbjct  313   IAIGAFSAAEKGVFVSCSAGNAGPDASTLANVAPWIATIGAGTLDRDFPAYVLLDNNQRF  372

Query  532   RGESLYSGKAVN-QKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
              G SLYSG+ +  ++L +VYG+++G   +  C  G+L  +LV+G+IV+C+RG +AR EKG
Sbjct  373   TGVSLYSGRGLKGKRLSIVYGQSSGLNSSNLCLAGTLDPKLVRGKIVLCDRGINARVEKG  432

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYIN-SSKSATASIKF  885
               V+ +GGAGMIL N    GEE+ AD H LPA A+G  AG  ++ Y+   S  A A++  
Sbjct  433   EVVRSAGGAGMILANTAANGEELVADSHQLPAVAVGKKAGDEIRAYVRGKSGIARATLAI  492

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
             +GTV G R +PV+AAFSSRGP+ V+P+++KPDV  PGVNILA W    GP+ L  D R  
Sbjct  493   RGTVLGVRPSPVVAAFSSRGPNMVTPQVLKPDVVGPGVNILAGWTGAAGPSGLAKDKRRT  552

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNI+SGTSMSCPH+SG+AALLK+ H DWSPAAIKSALMTT+YT D+  SP+ D+ +T  
Sbjct  553   KFNIISGTSMSCPHISGVAALLKAAHPDWSPAAIKSALMTTAYTRDTTGSPLRDA-ATGG  611

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS-ACPTH  1419
             +S TP A GSGHVDP+ A  PGLIYD+ST DY ++LCSLNY+ TQ+ ++ +  + +CP  
Sbjct  612   LS-TPLAHGSGHVDPQNALDPGLIYDLSTSDYLDFLCSLNYSDTQVRIVSKHSNFSCPRD  670

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
                  G+LNYPSF+VIF          ++R  TNVG P SVY V V  P+GV + VKP+ 
Sbjct  671   KVLDTGNLNYPSFSVIFRGYEKVVR--YSRVLTNVGEPSSVYTVSVSAPEGVGITVKPQR  728

Query  1600  LKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             L F  +G    YTV F +   KI + G   FG ++W +    VRSPIA  W
Sbjct  729   LVFKGVGNKQGYTVEFAS---KIKTSGPMDFGWILWSNQKHKVRSPIAFSW  776



>ref|XP_007135377.1| hypothetical protein PHAVU_010G124400g [Phaseolus vulgaris]
 gb|ESW07371.1| hypothetical protein PHAVU_010G124400g [Phaseolus vulgaris]
Length=781

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/602 (51%), Positives = 404/602 (67%), Gaps = 20/602 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F  GYE+ +GK+NET E++S RDS+GHGTHTAS AAG  V  AS LG A+G 
Sbjct  179   RKLIGARYFSGGYEATIGKMNETTEFRSARDSDGHGTHTASIAAGRYVSPASTLGYAKGV  238

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A YK C+  GC   D+LAA D AV DGVD++SLS+GG++  P++ D IAI
Sbjct  239   AAGMAPKARLAVYKVCWNGGCYDSDILAAFDSAVADGVDVVSLSVGGVV-VPYHLDVIAI  297

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA   GVFV SSAGN GP   +V+N APW+ TV A ++DR FPA V+LGNG++  G 
Sbjct  298   GAFGAASAGVFVSSSAGNGGPGGLTVTNVAPWVTTVGAGTIDRDFPANVKLGNGKIVPGI  357

Query  541   SLYSGKAVN--QKLPLVYGRTAGGK----------GAEFCSHGSLSSRLVKGRIVVCERG  684
             S+Y G  +   +  P+VY                  +  C  GSL  + VKG+IVVC+RG
Sbjct  358   SIYGGPGLTPGRMYPIVYAGIGQFGGGGGGGGDGYSSSLCLDGSLDPKTVKGKIVVCDRG  417

Query  685   NSARAEKGSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKS  864
              ++RA KG EVK++GG GMIL N   +GE + AD H LPATA+G +AG  ++ YI +S+S
Sbjct  418   INSRAAKGEEVKKNGGVGMILANGVFDGEGLVADCHVLPATAVGANAGDEIRNYIGNSRS  477

Query  865   -ATASIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTM  1038
              ATA+I F+GT  G R APV+A+FS+RGP+ VSPEI+KPDV APG+NILAAWP ++GP+ 
Sbjct  478   PATATIVFKGTRLGVRPAPVVASFSARGPNPVSPEILKPDVIAPGLNILAAWPDHVGPSG  537

Query  1039  LEADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPI  1218
             + +D R  EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+YT+D++  P+
Sbjct  538   VPSDGRRTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNKGDPM  597

Query  1219  TDSVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRK  1398
              D  ST  +S+  F +G+GHV P +A +PGL+YDIS  DY N+LC+ NY +  I ++ RK
Sbjct  598   LDE-STGNVSSV-FDYGAGHVHPVKAMNPGLVYDISPSDYVNFLCNSNYTTNSIHVITRK  655

Query  1399  KSACP-THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDG  1572
              + C         G+LNYPS + +F         T F RT TNVG P SVY V +  P G
Sbjct  656   SADCSGAKRAGHSGNLNYPSLSAVFQQYGKKRMSTHFIRTVTNVGDPNSVYKVTIKPPGG  715

Query  1573  VSVIVKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVI  1749
             + V VKP  L F KMGQ L++ V    +  K+++GG     GS+VW     TV SP+ V 
Sbjct  716   MVVTVKPDTLTFRKMGQKLNFLVRVQTRAVKLSAGGSSVKSGSIVWSDGKHTVTSPLVVT  775

Query  1750  WQ  1755
              Q
Sbjct  776   MQ  777



>ref|XP_003536496.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN02773.1| Subtilisin-like protease [Glycine soja]
Length=782

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/591 (52%), Positives = 397/591 (67%), Gaps = 15/591 (3%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGSA  183
             K+VGAR FY GYE+  GKI+E  EYKSPRD +GHGTHTA+T AG  V  A+ LG A G+A
Sbjct  195   KIVGARMFYHGYEAATGKIDEQAEYKSPRDQDGHGTHTAATVAGSPVHGANLLGYAYGTA  254

Query  184   GGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAIA  363
              GM   ARIAAYK C+T GC S D+L+AVD+AV DGVD+LS+SLGG +   +Y D++++A
Sbjct  255   RGMAPGARIAAYKVCWTGGCFSSDILSAVDRAVDDGVDVLSISLGGGVSS-YYRDSLSVA  313

Query  364   AFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGES  543
             +FGA +KGVFV  SAGN+GP   S++N +PWI TV AS++DR FPA V LGNGR   G S
Sbjct  314   SFGAMEKGVFVSCSAGNAGPDPVSLTNVSPWITTVGASTMDRDFPADVSLGNGRKITGTS  373

Query  544   LYSGKA---VNQKLPLVY-GRTAGG--KGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             LY G++   V ++ PLVY G T          C  G+L  R+V G+IV+C+RG S R +K
Sbjct  374   LYKGRSMLSVKKQYPLVYMGDTNSSIPDPKSLCLEGTLDRRMVSGKIVICDRGISPRVQK  433

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYI-NSSKSATASIK  882
             G  VK +GG GMILIN    GEE+ AD H LPA A+G   G  +K Y+  S K ATA++ 
Sbjct  434   GQVVKNAGGVGMILINTAANGEELVADCHLLPAVAIGEKEGKELKHYVLTSKKKATATLG  493

Query  883   FQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRS  1059
             F+ T  G R +PV+AAFSSRGP+ ++ EI+KPDV APGVNILAAW   IGP+ L  D+R 
Sbjct  494   FRATRLGVRPSPVVAAFSSRGPNFLTLEILKPDVVAPGVNILAAWSEAIGPSSLPTDHRR  553

Query  1060  VEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTN  1239
             V+FNILSGTSMSCPHVSG+AALLK+ H DWSPAAIKSALMTT+Y  D+   P+ D  ++N
Sbjct  554   VKFNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVHDNTIKPLRD--ASN  611

Query  1240  PISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTH  1419
               ++TP+  G+GH++P RA  PGL+YDI  QDY  +LCSL   ++++ +  +  +    H
Sbjct  612   AEASTPYDHGAGHINPRRALDPGLVYDIQPQDYIEFLCSLKLTTSELGVFAKYSNRTCRH  671

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
                 PGDLNYP+ +V+F   +S S  T  RTATNVG+P S Y V V    G SV V+P  
Sbjct  672   SLSSPGDLNYPAISVVFPLKNSTSVLTVHRTATNVGLPVSKYHVVVSSFKGASVKVEPDT  731

Query  1600  LKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             L F +  Q LSY V+F  Q  +        FG LVWK     VRS I + +
Sbjct  732   LSFTRKYQKLSYKVTFTTQSRQTEP----EFGGLVWKDGVQKVRSAIVITY  778



>ref|XP_010482516.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
 ref|XP_010482517.1| PREDICTED: subtilisin-like protease isoform X2 [Camelina sativa]
Length=779

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/592 (52%), Positives = 401/592 (68%), Gaps = 16/592 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FY+GYE+  GKI+E +EYKSPRD +GHGTHTA+T AG  VK A+  G A G+
Sbjct  192   RKIVGARVFYRGYEAATGKIDEELEYKSPRDKDGHGTHTAATVAGSPVKGANLFGFAYGT  251

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC S D+L+AVDQAV DGV +LS+SLGG +   +  D+++I
Sbjct  252   ARGMSPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVQVLSISLGGGI-STYSRDSLSI  310

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FPA V+LG  R F+G 
Sbjct  311   ATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTMRTFKGV  370

Query  541   SLYSGKAV---NQKLPLVY-GRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+AV   N++ PLVY GR A       FC  G+L  R V G+IV+C+RG S R +K
Sbjct  371   SLYKGRAVLSKNKQYPLVYLGRNASSPDPTSFCLDGALDRRHVAGKIVICDRGVSPRVQK  430

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VKR+GG GMIL N  T GEE+ AD H LPA A+G   G  +K+Y  +S+ ATA+++ 
Sbjct  431   GQVVKRAGGIGMILTNTATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSRKATATLEV  490

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G + +PV+AAFSSRGP+ +S EI+KPD+ APGVNILAAW  ++ P+ L +D R V
Sbjct  491   LGTRIGIKPSPVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWTGDLAPSSLSSDPRRV  550

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AAL++S H DWSPAAIKSALMTT+Y  D+   P+TD+    P
Sbjct  551   KFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLKPLTDASGAAP  610

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS-ACPTH  1419
               ++P+  G+GH+DP +A  PGL+YDI  QDYF +LC+ + + +Q+ +  +  + +C   
Sbjct  611   --SSPYDHGAGHIDPLKAIDPGLVYDIGPQDYFEFLCTQDLSPSQLKVFTKHSNRSCKHT  668

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
                 PG+LNYP+ + +F  ++   S T  RT TNVG   + Y V V    G SV V+PK 
Sbjct  669   LAKNPGNLNYPAISALFPENTRVKSITLRRTVTNVGPHIASYKVSVSPFKGASVTVQPKT  728

Query  1600  LKFNKMGQNLSYTVSFVAQ-RGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             L F    Q LSYTV+F  + R K        FG LVWKST   VRSP+ + W
Sbjct  729   LSFTSKHQKLSYTVTFTTRMRMKRP-----EFGGLVWKSTTHKVRSPVIITW  775



>ref|XP_004141727.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN45447.1| hypothetical protein Csa_7G448090 [Cucumis sativus]
Length=777

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/597 (52%), Positives = 400/597 (67%), Gaps = 15/597 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F  GYE+  GK+NET EY+SPRDS+GHGTHTAS AAG  V  AS LG ARG 
Sbjct  180   RKLIGARFFCSGYEATNGKMNETTEYRSPRDSDGHGTHTASIAAGRYVFPASTLGYARGK  239

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D IAI
Sbjct  240   AAGMAPKARLAAYKVCWNAGCYDSDILAAFDAAVSDGVDVVSLSVGGVV-VPYYLDAIAI  298

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              A+ A   GVFV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNGRV  G 
Sbjct  299   GAYRAVAAGVFVSASAGNGGPGGLTVTNVAPWVTTVGAGTMDRDFPADVKLGNGRVVLGT  358

Query  541   SLYSGKAV--NQKLPLVYGRTAGGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
             S+Y G A+   +  PL+Y  T GG G  +  C  GSL+  LVKG+IV+C+RG ++RA KG
Sbjct  359   SVYGGPALIPGRLYPLIYAGTEGGDGYSSSLCLEGSLNPNLVKGKIVLCDRGINSRAAKG  418

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYI----NSSKSATAS  876
               VK++GG GMIL N   +GE + AD H LPATA+G S G  ++KYI     S    TA+
Sbjct  419   EVVKKAGGLGMILANGVFDGEGLVADCHVLPATAVGASGGDEIRKYIAEAAKSHLQPTAT  478

Query  877   IKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADN  1053
             I F+GT  G R APV+A+FS+RGP+  SPEI+KPDV APG+NILAAWP  IGP+ +  D 
Sbjct  479   ILFKGTRLGVRPAPVVASFSARGPNPESPEIVKPDVIAPGLNILAAWPDKIGPSGIPTDK  538

Query  1054  RSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVS  1233
             R+ EFNILSGTSM+CPHVSGLAALLK+ H  WSPAAIKSALMTT+YTLD+R   + D  S
Sbjct  539   RTTEFNILSGTSMACPHVSGLAALLKAAHPGWSPAAIKSALMTTAYTLDNRGETMLDESS  598

Query  1234  TNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACP  1413
              N  ++T   FG+GHV P++A  PGLIYD++T DY ++LC+ NY +  I ++  K + C 
Sbjct  599   GN--TSTVLDFGAGHVHPQKAMDPGLIYDLNTYDYVDFLCNSNYTTKNIQVITGKIADCS  656

Query  1414  -THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVSVIV  1587
                     G+LNYPS AV+F     +   T F RT TNVG   S+Y V +  P G+SV V
Sbjct  657   GAKRAGHSGNLNYPSLAVVFQQYGKHKMSTHFIRTVTNVGDANSIYKVTIKPPSGISVTV  716

Query  1588  KPKVLKFNKMGQNLSYTVSFVAQRGKIASG-GGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             +P+ L F ++GQ LS+ V   A   +++ G      GS++W      V SP+ V  Q
Sbjct  717   EPEKLAFRRVGQKLSFLVRVQAMAVRLSPGSSSMKSGSIIWTDGKHEVTSPLVVTMQ  773



>ref|XP_004155899.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease-like 
[Cucumis sativus]
Length=776

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/597 (52%), Positives = 400/597 (67%), Gaps = 15/597 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F  GYE+  GK+NET EY+SPRDS+GHGTHTAS AAG  V  AS LG ARG 
Sbjct  179   RKLIGARFFCSGYEATNGKMNETTEYRSPRDSDGHGTHTASIAAGRYVFPASTLGYARGK  238

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D IAI
Sbjct  239   AAGMAPKARLAAYKVCWNAGCYDSDILAAFDAAVSDGVDVVSLSVGGVV-VPYYLDAIAI  297

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              A+ A   GVFV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNGRV  G 
Sbjct  298   GAYRAVAAGVFVSASAGNGGPGGLTVTNVAPWVTTVGAGTMDRDFPADVKLGNGRVVLGT  357

Query  541   SLYSGKAV--NQKLPLVYGRTAGGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
             S+Y G A+   +  PL+Y  T GG G  +  C  GSL+  LVKG+IV+C+RG ++RA KG
Sbjct  358   SVYGGPALIPGRLYPLIYAGTEGGDGYSSSLCLEGSLNPNLVKGKIVLCDRGINSRAAKG  417

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYI----NSSKSATAS  876
               VK++GG GMIL N   +GE + AD H LPATA+G S G  ++KYI     S    TA+
Sbjct  418   EVVKKAGGLGMILANGVFDGEGLVADCHVLPATAVGASGGDEIRKYIAEAAKSHLQPTAT  477

Query  877   IKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADN  1053
             I F+GT  G R APV+A+FS+RGP+  SPEI+KPDV APG+NILAAWP  IGP+ +  D 
Sbjct  478   ILFKGTRLGVRPAPVVASFSARGPNPESPEIVKPDVIAPGLNILAAWPDKIGPSGIPTDK  537

Query  1054  RSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVS  1233
             R+ EFNILSGTSM+CPHVSGLAALLK+ H  WSPAAIKSALMTT+YTLD+R   + D  S
Sbjct  538   RTTEFNILSGTSMACPHVSGLAALLKAAHPGWSPAAIKSALMTTAYTLDNRGETMLDESS  597

Query  1234  TNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACP  1413
              N  ++T   FG+GHV P++A  PGLIYD++T DY ++LC+ NY +  I ++  K + C 
Sbjct  598   GN--TSTVLDFGAGHVHPQKAMDPGLIYDLNTYDYVDFLCNSNYTTKNIQVITGKIADCS  655

Query  1414  -THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVSVIV  1587
                     G+LNYPS AV+F     +   T F RT TNVG   S+Y V +  P G+SV V
Sbjct  656   GAKRAGHTGNLNYPSLAVVFQQYGKHKMSTHFIRTVTNVGDANSIYKVTIKPPSGISVTV  715

Query  1588  KPKVLKFNKMGQNLSYTVSFVAQRGKIASG-GGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             +P+ L F ++GQ LS+ V   A   +++ G      GS++W      V SP+ V  Q
Sbjct  716   EPEKLAFRRVGQKLSFLVRVQAMAVRLSPGSSSMKSGSIIWTDGKHEVTSPLVVTMQ  772



>ref|XP_002885025.1| hypothetical protein ARALYDRAFT_478841 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61284.1| hypothetical protein ARALYDRAFT_478841 [Arabidopsis lyrata subsp. 
lyrata]
Length=776

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/600 (51%), Positives = 407/600 (68%), Gaps = 18/600 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGAR F  GYE+  GK+NET E++SPRDS+GHGTHTAS +AG  V  AS LG ARG 
Sbjct  177   RKLVGARFFCGGYEATNGKMNETTEFRSPRDSDGHGTHTASISAGRYVFPASTLGYARGV  236

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D IAI
Sbjct  237   AAGMAPKARLAAYKVCWNSGCYDSDILAAFDTAVADGVDVISLSVGGVV-VPYYLDAIAI  295

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA  +G+FV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNG++  G 
Sbjct  296   GAFGAIDRGIFVSASAGNGGPGALTVTNVAPWMTTVGAGTIDRDFPANVKLGNGKMIAGV  355

Query  541   SLYSGKAVN--QKLPLVYGRTA-GGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             S+Y G  +N  +  PLVYG +  GG G  +  C  GSL   LVKG+IV+C+RG ++RA K
Sbjct  356   SVYGGPGLNPGRMYPLVYGGSLIGGDGYSSSLCLEGSLDPNLVKGKIVLCDRGINSRATK  415

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYIN------SSKSA  867
             G  V+++GG GMI+ N   +GE + AD H LPAT++G S G  +++YI+      SSK  
Sbjct  416   GEIVRKNGGLGMIIANGVFDGEGLVADCHVLPATSVGASGGDEIRRYISESSKARSSKHP  475

Query  868   TASIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLE  1044
             TA+I F+GT  G R APV+A+FS+RGP+  +PEI+KPDV APG+NILAAWP  IGP+ + 
Sbjct  476   TATIVFKGTRLGIRPAPVVASFSARGPNPETPEILKPDVIAPGLNILAAWPDRIGPSGVP  535

Query  1045  ADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITD  1224
             +DNR  EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+Y +D+R  P+ D
Sbjct  536   SDNRRTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYRVDNRGDPMMD  595

Query  1225  SVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS  1404
               + N  +++   +GSGHV P +A  PGL+YDI+  DY N+LC+ NY  T I  + R+++
Sbjct  596   ESTGN--TSSVMDYGSGHVHPTKAMDPGLVYDITPYDYINFLCNSNYTGTNIVTITRRQA  653

Query  1405  ACP-THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVS  1578
              C         G+LNYPSF+V+F     +   T F RT TNVG P+SVY + +  P G +
Sbjct  654   DCDGARRAGHVGNLNYPSFSVVFQQYGESKMSTHFIRTVTNVGDPDSVYEIKIRPPRGTT  713

Query  1579  VIVKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             V V+P+ L F ++GQ LS+ V       K++ G  +   G ++W      V SP+ V  Q
Sbjct  714   VTVEPEKLSFRRVGQKLSFVVRVKTTEVKLSPGATNVQTGHIIWSDGKRNVTSPLVVTLQ  773



>emb|CDX82491.1| BnaA03g33300D [Brassica napus]
Length=767

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/594 (52%), Positives = 402/594 (68%), Gaps = 12/594 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGAR F  GYE+  GK+NET E++SPRDS+GHGTHTAS +AG  V  AS LG ARG 
Sbjct  174   RKLVGARFFCGGYEATNGKMNETTEFRSPRDSDGHGTHTASISAGRYVFPASILGYARGV  233

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P++ D IAI
Sbjct  234   ASGMAPKARLAAYKVCWNSGCYDSDILAAFDTAVADGVDVVSLSVGGVV-VPYHLDAIAI  292

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA  +GVFV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNG+   G 
Sbjct  293   GAFGAIDRGVFVSASAGNGGPGALTVTNVAPWMTTVGAGTIDRDFPANVKLGNGKTVPGV  352

Query  541   SLYSGKAVN--QKLPLVYGRTA-GGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             S+Y G  +   +  PLVYG +  GG G  +  C  GSL   LVKG+IV+C+RG ++RA K
Sbjct  353   SVYGGPDLEPGRMYPLVYGGSLLGGDGYSSSLCIEGSLDPSLVKGKIVLCDRGINSRATK  412

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  V+R+GG+GMI+ N   +GE + AD H LPAT++G S G  +++YI+ SK  TA+I F
Sbjct  413   GEIVRRNGGSGMIIANGVFDGEGLVADCHVLPATSVGASGGDEIRRYISESKQPTATIVF  472

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
             +GT  G R APV+A+FS+RGP+  SPEI+KPDV APG+NILAAWP  IGP+ + +DNR  
Sbjct  473   KGTRLGIRPAPVVASFSARGPNPESPEILKPDVIAPGLNILAAWPDRIGPSGVPSDNRRT  532

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+YT+D+R  P+ D  + N 
Sbjct  533   EFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNRDEPMLDESTGN-  591

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACP-TH  1419
              +++   +GSGHV P +A  PGL+YDI++ DY N+LC+ NY    I  + R+K+ C    
Sbjct  592   -TSSVMDYGSGHVHPTKAMDPGLVYDITSYDYINFLCNSNYTGANIVTITRRKADCDGAR  650

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVSVIVKPK  1596
                  G+LNYPSF+V+F     +   T F RT TNVG  +SVY V +  P G +V V P+
Sbjct  651   RAGHVGNLNYPSFSVVFQQYGESKMSTHFIRTVTNVGDSDSVYEVKIRPPRGTNVTVAPE  710

Query  1597  VLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
              L F ++GQ LS+ V        ++ G      G +VW      V SP+ V  Q
Sbjct  711   KLSFRRVGQKLSFVVRVKTTEVTLSPGATSVETGHIVWSDGKRNVTSPLVVTLQ  764



>ref|NP_568765.1| subtilase 1.3 [Arabidopsis thaliana]
 dbj|BAB11244.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AAL87307.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AED96122.1| subtilase 1.3 [Arabidopsis thaliana]
Length=780

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/592 (52%), Positives = 399/592 (67%), Gaps = 16/592 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FY+GYE+  GKI+E +EYKSPRD +GHGTHTA+T AG  VK A+  G A G+
Sbjct  193   RKIVGARVFYRGYEAATGKIDEELEYKSPRDRDGHGTHTAATVAGSPVKGANLFGFAYGT  252

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC S D+L+AVDQAV DGV +LS+SLGG +   +  D+++I
Sbjct  253   ARGMAQKARVAAYKVCWVGGCFSSDILSAVDQAVADGVQVLSISLGGGV-STYSRDSLSI  311

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FPA V++G  R F+G 
Sbjct  312   ATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVKIGTMRTFKGV  371

Query  541   SLYSGKAV---NQKLPLVY-GRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+ V   N++ PLVY GR A       FC  G+L  R V G+IV+C+RG + R +K
Sbjct  372   SLYKGRTVLPKNKQYPLVYLGRNASSPDPTSFCLDGALDRRHVAGKIVICDRGVTPRVQK  431

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VKR+GG GM+L N  T GEE+ AD H LPA A+G   G  +K+Y  +SK ATAS++ 
Sbjct  432   GQVVKRAGGIGMVLTNTATNGEELVADSHMLPAVAVGEKEGKLIKQYAMTSKKATASLEI  491

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G + +PV+AAFSSRGP+ +S EI+KPD+ APGVNILAAW  ++ P+ L +D R V
Sbjct  492   LGTRIGIKPSPVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWTGDMAPSSLSSDPRRV  551

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AAL+KS H DWSPAAIKSALMTT+Y  D+   P+TD+    P
Sbjct  552   KFNILSGTSMSCPHVSGVAALIKSRHPDWSPAAIKSALMTTAYVHDNMFKPLTDASGAAP  611

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS-ACPTH  1419
               ++P+  G+GH+DP RA  PGL+YDI  Q+YF +LC+ + + +Q+ +  +  +  C   
Sbjct  612   --SSPYDHGAGHIDPLRATDPGLVYDIGPQEYFEFLCTQDLSPSQLKVFTKHSNRTCKHT  669

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
                 PG+LNYP+ + +F  ++   + T  RT TNVG   S Y V V    G SV V+PK 
Sbjct  670   LAKNPGNLNYPAISALFPENTHVKAMTLRRTVTNVGPHISSYKVSVSPFKGASVTVQPKT  729

Query  1600  LKFNKMGQNLSYTVSFVAQ-RGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             L F    Q LSYTV+F  + R K        FG LVWKST   VRSP+ + W
Sbjct  730   LNFTSKHQKLSYTVTFRTRFRMKRP-----EFGGLVWKSTTHKVRSPVIITW  776



>ref|XP_010273831.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=786

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/597 (51%), Positives = 403/597 (68%), Gaps = 15/597 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F  GYE+  GK+NE+ EY+SPRDS+GHGTHTAS AAG  V  AS LG ARG 
Sbjct  190   RKLIGARFFCGGYEATNGKMNESSEYRSPRDSDGHGTHTASIAAGRYVFPASTLGYARGV  249

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D IAI
Sbjct  250   AAGMAPKARLAAYKVCWNAGCYDSDILAAFDTAVSDGVDVVSLSVGGVV-VPYYLDAIAI  308

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA+  GVFV +SAGN GP   SV+N APW+ TV A ++DR FPA V+LGNGR+  G 
Sbjct  309   GAFGASDHGVFVSASAGNGGPGGLSVTNVAPWVTTVGAGTMDRDFPADVKLGNGRIIPGV  368

Query  541   SLYSGK--AVNQKLPLVYGRTAGGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
             S+Y G   A  +  P++Y  + GG G  +  C  GSL    V+G+IV+C+RG ++RA KG
Sbjct  369   SIYGGPGLASGRLYPVIYAGSEGGDGYSSSLCLEGSLDPNFVEGKIVLCDRGINSRAAKG  428

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSA----TAS  876
               V+++GG GMIL N   +GE + AD H LPATA+G S G  ++KYI+++  +    TA+
Sbjct  429   EVVRKAGGIGMILANGVFDGEGLVADCHVLPATAVGASGGDEIRKYISAASKSHSPPTAT  488

Query  877   IKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADN  1053
             I F+GT  G R APV+A+FS+RGP+  SP+I+KPDV APG+NILAAWP  +GP+ L +D 
Sbjct  489   IVFRGTRLGVRPAPVVASFSARGPNPESPDILKPDVIAPGLNILAAWPDGVGPSGLASDK  548

Query  1054  RSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVS  1233
             R  EFNILSGTSM+CPHVSGLAALLK+ H +WSPAAI+SALMT++YT+D+R   + D  +
Sbjct  549   RRTEFNILSGTSMACPHVSGLAALLKAAHPEWSPAAIRSALMTSAYTVDNRGEVMVDEST  608

Query  1234  TNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACP  1413
              N   +T   FG+GHVDP++A  PGL+YD+++ DY N+LC+ NY    I  + R+ S C 
Sbjct  609   GN--FSTVMDFGAGHVDPQKAMEPGLVYDLTSYDYVNFLCNSNYTEKNIRAITRRNSDCN  666

Query  1414  -THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVSVIV  1587
                     G+LNYPS + +F         T F RT TNVG P+SVY   V EP+G  V V
Sbjct  667   GARRAGHVGNLNYPSMSAVFQQYGEKRMSTHFIRTVTNVGDPKSVYEAKVKEPNGAKVTV  726

Query  1588  KPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             +P+ L F ++GQ LS+ V    +  K++ G    + GSL W+     VRSPI V  Q
Sbjct  727   QPEKLVFRRIGQKLSFMVRVEVRAVKLSPGASTVTSGSLTWEDGKHQVRSPIVVTMQ  783



>ref|XP_006297042.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
 gb|EOA29940.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
Length=757

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/589 (51%), Positives = 396/589 (67%), Gaps = 12/589 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYE--SIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR+F KG++  S  G  +   E  SPRD +GHGTHT++TAAG  V++ASFLG A 
Sbjct  175   KKLIGARSFSKGFQMASGGGGFSSKRESVSPRDVDGHGTHTSTTAAGSAVRNASFLGYAA  234

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   AR+A YK C++ GC   D+LAA+D+A+ DGVD+LSLSLGG    P+Y D I
Sbjct  235   GTARGMATRARVATYKVCWSTGCFGSDILAAMDRAILDGVDVLSLSLGGGS-APYYRDTI  293

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI +F A +KGVFV  SAGNSGP  +SV+N APW+MTV A +LDR FPA   LGNG+   
Sbjct  294   AIGSFSAMEKGVFVSCSAGNSGPTRASVANVAPWVMTVGAGTLDRDFPAFANLGNGKRLT  353

Query  535   GESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  +  K L LVY +      +  C  GSL S +V+G+IVVC+RG +AR EKG+
Sbjct  354   GVSLYSGVGMGTKPLELVYNQ-GNSSSSNLCLPGSLDSSIVRGKIVVCDRGVNARVEKGA  412

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMI+ N    GEE+ AD H LPA A+G   G  +++Y+ S  + TA + F+G
Sbjct  413   VVRDAGGLGMIMANTAASGEELVADSHLLPAIAVGKKTGDLLREYVKSDSNPTAVLVFKG  472

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   + +PV+AAFSSRGP+ V+PEI+KPDV  PGVNILA W   IGPT LE D+R  +F
Sbjct  473   TVLDVKPSPVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLEKDSRRTQF  532

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SGLA LLK+ H +WSP+AIKSALMTT+Y LD+  SP+ D+ + N +S
Sbjct  533   NIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYVLDNTNSPLHDA-ADNSLS  591

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
               P A GSGHVDP++A  PGL+YDIST++Y  +LCSL Y    I  ++++ S   T    
Sbjct  592   -NPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLEYTVDHIVAIVKRSSVNCTKKFS  650

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG LNYPSF+V+F          +TR  TNVG   SVY V V     V + VKP  L F
Sbjct  651   DPGQLNYPSFSVLFGGKRVVR---YTREVTNVGAANSVYKVMVNGAPTVEISVKPSKLTF  707

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
              ++G+   YTV+FV+++G ++      FGS+ W +    VRSP+A  W 
Sbjct  708   KRVGEKKRYTVTFVSKKG-VSMTNKAEFGSITWINPQHEVRSPVAFSWN  755



>ref|XP_009343496.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=783

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/590 (52%), Positives = 396/590 (67%), Gaps = 13/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FY GYE+  GKINE  E+KSPRD +GHGTHTA+T AG  V+ A+ LG ARG+
Sbjct  197   KKIVGARIFYHGYEAATGKINEQTEFKSPRDQDGHGTHTAATVAGSPVRGANLLGYARGT  256

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM  +ARIAAYK C+  GC S D+L+AVD+AV DGV++LS+SLGG +   +Y D++++
Sbjct  257   ARGMAPSARIAAYKVCWVGGCFSSDILSAVDRAVADGVNVLSISLGGGVSS-YYRDSLSV  315

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA + G+FV  SAGN GP   S++N +PWI TV AS++DR FPA V+LGNGR   G 
Sbjct  316   AAFGAMEMGIFVSCSAGNGGPDPVSLTNVSPWITTVGASTMDRDFPATVKLGNGRTITGV  375

Query  541   SLYSGK---AVNQKLPLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+   + N++ P+VY    +     +  C  G+L  R+V G+IV+C+RG S R +K
Sbjct  376   SLYRGRMKLSTNKQYPVVYLGSNSTSPNPSSLCLEGTLDRRVVAGKIVICDRGISPRVQK  435

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VK +GG GMIL N    GEE+ AD H +PA A+G +    +K Y ++S  ATA++ F
Sbjct  436   GEVVKEAGGVGMILANTAANGEELVADCHLVPAVAVGENEARGIKHYASTSPRATATLTF  495

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G R +PV+AAFSSRGP+ VS EI+KPD+ APGVNILAAW   +GP+ L AD R V
Sbjct  496   LGTRVGVRPSPVVAAFSSRGPNLVSLEILKPDMVAPGVNILAAWTGALGPSSLPADRRRV  555

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AALLK+ H DWSPAAIKSALMTT+Y  D+ + P+ DS S   
Sbjct  556   KFNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVHDNTRKPLQDS-SAAS  614

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
             IS TP+  G+GH++P RA  PGLIYDI  QDY  +LC+     TQ+ +  +  +    ++
Sbjct  615   IS-TPYDHGAGHINPGRALDPGLIYDIEAQDYLEFLCTQRLTPTQLKVFTKYSNRSCKNN  673

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
                PGDLNYP+ +V+F   ++ S  T  RT TNVG   S Y   V    G +V V+P+ L
Sbjct  674   LASPGDLNYPALSVVFPDRTNVSVLTLHRTVTNVGPAVSNYHAIVSPFKGANVKVEPRTL  733

Query  1603  KFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             KF K  Q LSY + F  +  +        FG LVWK     VRSPI V+W
Sbjct  734   KFTKANQKLSYKIIFTTKSRQAVP----EFGGLVWKDGVHRVRSPIVVVW  779



>gb|KCW56428.1| hypothetical protein EUGRSUZ_I02156 [Eucalyptus grandis]
Length=897

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/597 (52%), Positives = 409/597 (69%), Gaps = 15/597 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR FY GYE+  GK+NET +++SPRDS+GHGTHTAS AAG  V  AS LG A+G 
Sbjct  301   RKLIGARFFYNGYEAANGKMNETTQFRSPRDSDGHGTHTASIAAGRYVFPASTLGYAKGM  360

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P++ D IAI
Sbjct  361   AAGMAPKARLAAYKVCWDAGCYDSDILAAFDAAVGDGVDVISLSVGGVV-VPYHLDAIAI  419

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA + GVFV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNG++  G 
Sbjct  420   GAFGAEEAGVFVSASAGNGGPGGLTVTNVAPWVTTVGAGTIDRDFPADVKLGNGKMIPGV  479

Query  541   SLYSGKAVN--QKLPLVYGRTAGGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
             SLY G  +   +  PL+Y  T GG G  A  C  GSL   LVK +IV+C+RG ++RA KG
Sbjct  480   SLYGGPGLTPGRMYPLIYAGTEGGDGYSASLCMEGSLDQSLVKDKIVLCDRGINSRAAKG  539

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYIN-SSKS---ATAS  876
               VK++GG GMIL N   +GE + AD H LPATA+G ++G  ++KYI  +SKS   ATA+
Sbjct  540   EVVKKAGGVGMILANGVFDGEGLVADCHVLPATAVGAASGDEIRKYIEVASKSKSPATAT  599

Query  877   IKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADN  1053
             + F+GT    R APV+A+FS+RGP+ VSPEI+KPDV APG+NILAAWP NIGP+ + +D 
Sbjct  600   VIFKGTRLRVRPAPVVASFSARGPNPVSPEILKPDVIAPGLNILAAWPDNIGPSGVASDK  659

Query  1054  RSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVS  1233
             R  EFNILSGTSM+CPHVSGLAALLK+ H +WSPAAI+SALMTT+YT+D+R   + D  +
Sbjct  660   RKTEFNILSGTSMACPHVSGLAALLKAAHPEWSPAAIRSALMTTAYTVDNRGETMLDEST  719

Query  1234  TNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACP  1413
              N  ++T   +G+GHV P++A  PGLIYD++  DY ++LC+ NY +  I ++ RKK+ C 
Sbjct  720   GN--TSTVMDYGAGHVHPQKAMDPGLIYDLTPYDYVDFLCNSNYTTANIQVVTRKKADCS  777

Query  1414  -THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVSVIV  1587
                     G+LNYPS +V F         T F R+ TNVG  ESVY V V  P GVSV V
Sbjct  778   GAKRAGHSGNLNYPSLSVTFQQYGKPKMSTHFIRSVTNVGDAESVYRVSVRPPKGVSVTV  837

Query  1588  KPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             +P+ L F ++GQ L++ V    +  K++ GG     GS++W     TV SP+ V  Q
Sbjct  838   RPEKLAFRRIGQKLNFLVRVEVRAAKLSPGGSSLRSGSVIWSDGKHTVTSPLVVTLQ  894



>ref|XP_004510506.1| PREDICTED: subtilisin-like protease-like isoform X1 [Cicer arietinum]
 ref|XP_004510507.1| PREDICTED: subtilisin-like protease-like isoform X2 [Cicer arietinum]
Length=769

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/593 (51%), Positives = 406/593 (68%), Gaps = 21/593 (4%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             K++GA+ FYKGYES + + I+ETVE KSPRD+EGHG+HTASTAAG +V +AS    A+G 
Sbjct  179   KIIGAKAFYKGYESYLQRPIDETVESKSPRDTEGHGSHTASTAAGSIVSNASLFSFAQGE  238

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKP-FYTDNIA  357
             A GM   ARIAAYK C++LGC   D+LAA+D+AV DGV ++SLS+G     P +Y D+IA
Sbjct  239   AKGMATKARIAAYKICWSLGCFDSDILAAMDEAVSDGVHVISLSVGASGYAPQYYHDSIA  298

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AFGA+Q GV V  SAGNSGP + + +N APWI+TV AS++DR FPA V LG+GRVF G
Sbjct  299   IGAFGASQHGVVVSCSAGNSGPGSYTSTNIAPWILTVGASTIDREFPADVILGDGRVFGG  358

Query  538   ESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLY G  + + KLPLVYG   G +   +C  GSL S  V+G+IVVC+RG +AR EKGS 
Sbjct  359   VSLYDGDDLPDYKLPLVYGADCGSR---YCFIGSLDSSKVQGKIVVCDRGVNARVEKGSA  415

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GG GMI+ N E  GEE+ AD H + AT +G  A   +++YI SS+  TA+I+F+GT
Sbjct  416   VKLAGGLGMIMANTEGSGEELLADAHLVAATMVGQIAADKIREYIRSSQYPTATIEFKGT  475

Query  895   VYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             V G    AP +A+FSSRGP+ V+ EI+KPDV APGVNILA W   +GPT L+ D R VEF
Sbjct  476   VIGGSPAAPQVASFSSRGPNYVTSEILKPDVIAPGVNILAGWTGKVGPTDLDFDTRRVEF  535

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPHVSG+AALL+  + +WSPAAIKSALMTT+Y +D+    I D  +     
Sbjct  536   NIISGTSMSCPHVSGIAALLRKAYPNWSPAAIKSALMTTAYDVDNSGEKIKDLGTGK--E  593

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             + PF  G+GHVDP RA +PGL+YD+++ DY ++LCS+ Y++ +I +  R+ ++       
Sbjct  594   SNPFVHGAGHVDPNRALNPGLVYDLNSNDYLSFLCSIGYDAKKIQIFTREPTSFDVCEKR  653

Query  1429  Q----PGDLNYPSFAVIFDssssnssHTFTRTATNV-GIPESVYAVHVMEPDGVSVIVKP  1593
             +    PG+LNYPSF+V+F  ++      + R  TNV G  ++VY V V  P GV V V P
Sbjct  654   EKLVSPGNLNYPSFSVVFGVNNGLVK--YKRVVTNVGGYVDAVYTVKVNSPFGVDVSVSP  711

Query  1594  KVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
               L F+   +  ++ ++F     ++  GG  SFGS+ W   +  VRSPIAV W
Sbjct  712   SKLVFSGENKTQAFEITF----ARVGYGGSQSFGSIEWSDGSHIVRSPIAVRW  760



>ref|XP_010273846.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=761

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/589 (51%), Positives = 400/589 (68%), Gaps = 12/589 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVG---KINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLA  171
             KKL+GAR+F +GY    G     N   + +SPRD +GHGTHTASTAAG  V +AS LG A
Sbjct  177   KKLIGARSFSRGYRMASGGRHTTNNPNQIESPRDRDGHGTHTASTAAGSHVANASLLGYA  236

Query  172   RGSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDN  351
              G+A GM   AR+A YK C++ GC   D+LA +D+A+ DGVD+LSLSLGG    P+Y D 
Sbjct  237   SGTARGMATRARVATYKVCWSTGCFGSDILAGIDRAIADGVDVLSLSLGGGS-SPYYRDI  295

Query  352   IAIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVF  531
             IAI AF A +KG+FV  SAGNSGP  ++++N APWIMTVAA +LDR FPA   LGNG+ F
Sbjct  296   IAIGAFAAMEKGIFVSCSAGNSGPGRATLTNVAPWIMTVAAGTLDRDFPAYASLGNGKRF  355

Query  532   RGESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
              G SLYSGK +  K + LVY +  G + +  C   SL S+ V+G++V+C+RG +AR EKG
Sbjct  356   AGVSLYSGKGMGTKPVGLVYSK--GNETSNLCLPDSLESKRVRGKVVICDRGINARVEKG  413

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQ  888
             + V+ +GG GMIL N    GEE+ AD H LPA A+G+  G  +++Y  S  + TA + F 
Sbjct  414   AVVRDAGGLGMILANTAASGEEMVADSHLLPAVAVGWKTGDLIREYTRSDPNPTAMLSFG  473

Query  889   GTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             GTV   R +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILA+W   +GPT L+ D R  +
Sbjct  474   GTVLNIRPSPVVAAFSSRGPNVVTPQILKPDVIGPGVNILASWSELVGPTGLKNDTRKAQ  533

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSMSCPH+SG+AALLK+ H  WSP+AIKSALMTT+YT D+ KSP+ D+   +  
Sbjct  534   FNIMSGTSMSCPHISGVAALLKAAHPKWSPSAIKSALMTTAYTSDNTKSPLRDAAGGD--  591

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHH  1425
              +TP+A GSGHVDP +A +PGL+YD +  DY  +LCSL+Y+  Q+  + ++++   +   
Sbjct  592   ISTPWAHGSGHVDPHKALNPGLVYDATPDDYITFLCSLDYSIDQVKAITKRQNITCSRRF  651

Query  1426  HQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLK  1605
               PG+LNYPSF+V+F +        +TR  TNVG   SVY V +  P  V V VKP  L 
Sbjct  652   ADPGELNYPSFSVLFGTKKRVVR--YTRELTNVGPTGSVYNVAIGGPSSVGVTVKPTKLV  709

Query  1606  FNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             F ++G+   YTV+FVA++G     G   FG +VW++  + VRSP++  W
Sbjct  710   FKEVGEMKKYTVTFVAKKGLSRMLGTAEFGWIVWRNEQYQVRSPVSYEW  758



>ref|XP_008354210.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=783

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/590 (52%), Positives = 396/590 (67%), Gaps = 13/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FY GYE+  GKINE  E+KSPRD +GHGTHTA+T AG  V+ A+ LG ARG+
Sbjct  197   KKIVGARIFYHGYEAATGKINEQTEFKSPRDQDGHGTHTAATVAGSPVRGANLLGYARGT  256

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM  +ARIAAYK C+  GC S D+L+AVD+AV DGV++LS+SLGG +   +Y D++++
Sbjct  257   ARGMAPSARIAAYKVCWVGGCFSSDILSAVDRAVADGVNVLSISLGGGVSS-YYRDSLSV  315

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA + G+FV  SAGN GP   S++N +PWI TV AS++DR FPA V+LGNGR   G 
Sbjct  316   AAFGAMEMGIFVSCSAGNGGPDPVSLTNVSPWITTVGASTMDRDFPATVKLGNGRTITGV  375

Query  541   SLYSGK---AVNQKLPLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+   + N++ P+VY    +     +  C  G+L  R+V G+IV+C+RG S R +K
Sbjct  376   SLYRGRMKLSTNKQYPVVYLGSNSTSPNPSSLCLEGTLDRRVVAGKIVICDRGISPRVQK  435

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VK +GG GMIL N    GEE+ AD H +PA A+G +    +K Y ++S  ATA++ F
Sbjct  436   GEVVKEAGGVGMILANTAANGEELVADCHLVPAVAVGENEAKGIKHYASTSPRATATLTF  495

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G R +PV+AAFSSRGP+ VS EI+KPD+ APGVNILAAW   +GP+ L AD R+V
Sbjct  496   LGTRVGVRPSPVVAAFSSRGPNLVSLEILKPDMVAPGVNILAAWTGALGPSSLPADRRNV  555

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AALLK+ H DWSPAAIKSALMTT+Y  D+ + P+ DS S   
Sbjct  556   KFNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVHDNTRKPLQDS-SAAS  614

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
             IS TP+  G+GH++P RA  PGLIYDI  QDY  +LC+     TQ+ +  +  +    ++
Sbjct  615   IS-TPYDHGAGHINPVRALDPGLIYDIEAQDYLEFLCTQRLTPTQLKVFTKYSNRSCKNN  673

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
                PGDLNYP+ +V+F   ++ S  T  RT TNVG   S Y   V    G  V V+P+ L
Sbjct  674   LASPGDLNYPALSVVFPERTNVSVLTLHRTVTNVGPAVSNYHAIVSPFKGAYVKVEPRTL  733

Query  1603  KFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             KF K  Q LSY + F  +  +        FG LVWK     VRSPI V+W
Sbjct  734   KFTKANQKLSYKIIFTTKSRQAVP----EFGGLVWKDGVHRVRSPIVVVW  779



>ref|XP_002516266.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF46268.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=768

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/591 (51%), Positives = 398/591 (67%), Gaps = 15/591 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYE--SIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR F KGY   S    + ++ E +SPRD EGHGTHTASTAAG  V +AS LG A 
Sbjct  182   KKLIGARFFSKGYRMASAGSYLKKSKEIESPRDQEGHGTHTASTAAGSQVVNASLLGYAS  241

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   AR+++YK C++ GC + D+LA +D+A+ DGVD+LSLSLGG    P+Y D I
Sbjct  242   GNARGMATHARVSSYKVCWSTGCYASDILAGMDKAIADGVDVLSLSLGGGS-APYYRDTI  300

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             A+ AF A ++G+FV  SAGNSGP  ++++N APWIMTV A +LDR FPA   LGN   F 
Sbjct  301   AVGAFAAVERGIFVSCSAGNSGPSKATLANVAPWIMTVGAGTLDRDFPAYAVLGNQNRFT  360

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  + N+ + LVY +  G   +  C  GSL   +V+G++VVC+RG + R EKG+
Sbjct  361   GVSLYSGTGMGNKPVGLVYNK--GNSSSNLCLPGSLVPSIVRGKVVVCDRGINPRVEKGA  418

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMIL N    GEE+ AD H LPA A+G  AG  +++Y+  S++ TA + F G
Sbjct  419   VVRDAGGIGMILANTAASGEELVADSHLLPAVAVGSKAGDMIREYMKGSRNPTALLSFGG  478

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   R +PV+AAFSSRGP+ V+P+I+KPD+  PGVNILAAW   +GPT LE D R  +F
Sbjct  479   TVLNVRPSPVVAAFSSRGPNMVTPQILKPDLIGPGVNILAAWSEAVGPTGLEKDTRKTQF  538

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SG+AALLK+    WSP+AIKSALMTT+Y +D+  +P+ D+ ST  I 
Sbjct  539   NIMSGTSMSCPHISGVAALLKAARPGWSPSAIKSALMTTAYVVDNTHAPLRDAGSTT-IP  597

Query  1249  AT---PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTH  1419
              T   P+A GSGHVDP +A  PGL+YD+ST+DY  +LCSL Y    + L++++ +     
Sbjct  598   GTLSNPWAHGSGHVDPHKAMSPGLVYDVSTEDYVAFLCSLGYTIDHVQLIVKRPNVTCAR  657

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
                 PG+LNYPSF+V+F +        +TR  TNVG   S+Y V V  P  V V VKP  
Sbjct  658   KFSDPGELNYPSFSVVFGNKRVVR---YTRELTNVGEAGSIYEVEVTAPSTVGVSVKPTK  714

Query  1600  LKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             L F  +G  L YTV+FVA++G I     + FGS+VW++    VRSP+A  W
Sbjct  715   LVFRNVGDKLRYTVTFVAKKG-IRKAARNGFGSIVWRNAEHQVRSPVAFAW  764



>ref|XP_008462247.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=777

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/597 (52%), Positives = 400/597 (67%), Gaps = 15/597 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F  GYE+  GK+NET EY+SPRDS+GHGTHTAS AAG  V  AS LG ARG 
Sbjct  180   RKLIGARFFCSGYEATNGKMNETTEYRSPRDSDGHGTHTASIAAGRYVFPASTLGYARGK  239

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D IAI
Sbjct  240   AAGMAPKARLAAYKVCWNAGCYDSDILAAFDAAVSDGVDVVSLSVGGVV-VPYYLDAIAI  298

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              A+ A   GVFV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNGRV  G 
Sbjct  299   GAYRAVAAGVFVSASAGNGGPGGLTVTNVAPWVTTVGAGTMDRDFPADVKLGNGRVVLGT  358

Query  541   SLYSGKAV--NQKLPLVYGRTAGGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
             S+Y G A+   +  PL+Y  T GG G  +  C  GSL+  LVKG+IV+C+RG ++RA KG
Sbjct  359   SVYGGPALIPGRLYPLIYAGTEGGDGYSSSLCLEGSLNPNLVKGKIVLCDRGINSRAAKG  418

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYI----NSSKSATAS  876
               VK++GG GMIL N   +GE + AD H LPATA+G S G  ++KYI     S    TA+
Sbjct  419   EVVKKAGGLGMILANGVFDGEGLVADCHVLPATAVGASGGDEIRKYIAEAAKSHSPPTAT  478

Query  877   IKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADN  1053
             I F+GT  G R APV+A+FS+RGP+  SPEI+KPDV APG+NILAAWP  IGP+ +  D 
Sbjct  479   ILFKGTRLGVRPAPVVASFSARGPNPESPEIVKPDVIAPGLNILAAWPDKIGPSGIPTDK  538

Query  1054  RSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVS  1233
             R+ EFNILSGTSM+CPHVSGLAALLK+ H  WSPAAIKSALMTT+YTLD+R   + D  S
Sbjct  539   RTTEFNILSGTSMACPHVSGLAALLKAAHPGWSPAAIKSALMTTAYTLDNRGETMLDESS  598

Query  1234  TNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACP  1413
              N  ++T   FG+GHV P++A  PGLIYD++T DY ++LC+ NY +  I ++  K + C 
Sbjct  599   GN--TSTVLDFGAGHVHPQKAMDPGLIYDLNTYDYVDFLCNANYTTKNIQVITGKIADCS  656

Query  1414  -THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVSVIV  1587
                     G+LNYPS +V+F     +   T F RT TNVG   S+Y V +  P G+SV V
Sbjct  657   GAKRAGHTGNLNYPSLSVVFQQYGKHKMSTHFIRTVTNVGDANSIYKVTIKPPSGISVTV  716

Query  1588  KPKVLKFNKMGQNLSYTVSFVAQRGKIASG-GGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             +P+ L F ++GQ LS+ V   A   +++ G      GS++W      V SP+ V  Q
Sbjct  717   EPEKLAFRRVGQKLSFLVRVQAMAVRLSPGSSSMKGGSIIWTDGKHEVTSPLVVTMQ  773



>ref|XP_007143339.1| hypothetical protein PHAVU_007G064100g [Phaseolus vulgaris]
 gb|ESW15333.1| hypothetical protein PHAVU_007G064100g [Phaseolus vulgaris]
Length=778

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/591 (52%), Positives = 396/591 (67%), Gaps = 14/591 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FY GYE+  GKI+E  EYKSPRD +GHGTHTA+T AG  V  A+ LG A G+
Sbjct  191   KKIVGARMFYHGYEAATGKIDEKTEYKSPRDQDGHGTHTAATVAGSPVHGANLLGYAYGT  250

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C+T GC S D+L+AVD+AV DGVD+LS+SLGG +   +Y D++++
Sbjct  251   ARGMAPGARIAAYKVCWTGGCFSSDILSAVDRAVADGVDVLSISLGGGVSS-YYRDSLSV  309

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA +KGV V  SAGN+GP  +S++N +PWI TV AS++DR FPA V LG GR   G 
Sbjct  310   AAFGAMEKGVLVSCSAGNAGPDPASLTNVSPWITTVGASTMDRDFPAEVSLGTGRKITGT  369

Query  541   SLYSGKAV---NQKLPLVYGRTAGGKGAE---FCSHGSLSSRLVKGRIVVCERGNSARAE  702
             SLY G++V    ++ PLVY         +    C  G+L  R+V G+IV+C+RG S R +
Sbjct  370   SLYKGRSVLSVKKQYPLVYMGNINSSIPDPRSLCLEGTLDRRMVSGKIVICDRGISPRVQ  429

Query  703   KGSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIK  882
             KG  VK +GG GMILIN    GEE+ AD H LPA A+G   G  +K Y+ +SK ATA++ 
Sbjct  430   KGQVVKNAGGVGMILINTAANGEELVADCHLLPAVAVGEKEGKELKHYVLTSKKATATLG  489

Query  883   FQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRS  1059
             F  T  G R +PV+AAFSSRGP+ ++ EI+KPDV APGVNILAAW   IGP+ L  D+R 
Sbjct  490   FMATRLGVRPSPVVAAFSSRGPNFLTLEILKPDVVAPGVNILAAWSGAIGPSSLPTDHRR  549

Query  1060  VEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTN  1239
             V+FNILSGTSMSCPHVSG+AALLK+ H +WSPAAIKSALMTT+Y  D+   P+ D+ S +
Sbjct  550   VKFNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVHDNTIKPLRDASSAD  609

Query  1240  PISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTH  1419
               ++TP+  G+GH++P RA  PGL+YDI  QDYF +LC+     +++ +  +  +    H
Sbjct  610   --ASTPYDHGAGHINPNRALDPGLVYDIQPQDYFEFLCTQKLTPSELGVFAKYSNRTCRH  667

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
                 PGDLNYP+ +V+F   +S+S  T  RTATNVG   S Y V V    G SV V+P+ 
Sbjct  668   SLASPGDLNYPAISVVFSQINSSSVLTVHRTATNVGPAVSKYHVVVSPFKGASVKVEPET  727

Query  1600  LKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             L F K  Q LSY V+F  Q  +        FG LVWK     VRSPI + +
Sbjct  728   LSFTKKYQKLSYKVTFTTQSRQTEP----EFGGLVWKDGVHKVRSPIVLTY  774



>gb|KHN31561.1| Subtilisin-like protease [Glycine soja]
Length=646

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/593 (50%), Positives = 403/593 (68%), Gaps = 16/593 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FY GYE+ +G+INE  EYKSPRD +GHGTHTA+T  G  V  A+ LG A G+
Sbjct  56    KKVVGARVFYHGYEAAIGRINEQKEYKSPRDQDGHGTHTAATVGGSPVHGANLLGYANGT  115

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C+  GC S D+++A+D+AV DGV++LS+SLGG +   +Y D++++
Sbjct  116   ARGMAPGARIAAYKVCWVGGCFSSDIVSAIDKAVADGVNVLSISLGGGVSS-YYRDSLSV  174

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA ++GVFV  SAGN+GP  +S++N +PWI TV AS++DR FPA V LGNG+   G 
Sbjct  175   AAFGAMERGVFVSCSAGNAGPDPASLTNVSPWITTVGASTMDRDFPADVRLGNGKKVTGV  234

Query  541   SLYSGK---AVNQKLPLVYGRTAGGK--GAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY GK   ++ ++ PLVY  +   +      C  G+L  ++V G+IV+C+RG S R +K
Sbjct  235   SLYKGKNVLSIEKQYPLVYMGSNSSRVDPRSMCLEGTLDPKVVSGKIVICDRGLSPRVQK  294

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G+ V+ +GG GMIL N E  GEE+ AD H LPA A+G   G  +K Y+ SSKS+TA++ F
Sbjct  295   GNVVRSAGGVGMILTNTEANGEELVADSHLLPAVAIGEKEGKELKSYVLSSKSSTATLAF  354

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
             +GT  G + +P++AAFSSRGP+ ++ +I+KPD+ APGVNILAAW   IGP+ L+ DNR V
Sbjct  355   KGTRLGIKPSPIVAAFSSRGPNFLTLDILKPDLVAPGVNILAAWSEAIGPSGLKIDNRKV  414

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNI+SGTSMSCPHVSG+AAL+KS H +WSPAAIKSALMTT+Y LD+ K  + D+ +  P
Sbjct  415   KFNIVSGTSMSCPHVSGIAALVKSRHPEWSPAAIKSALMTTAYVLDNTKKTLRDASTAKP  474

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               ++P+  G+GH+DP RA  PGL+YDI  QDYF +LC+ N   TQ+ +  +  +    H 
Sbjct  475   --SSPYDHGAGHIDPIRALDPGLVYDIVPQDYFEFLCTQNLTPTQLKVFAKYSNRSCRHS  532

Query  1423  HHQPGDLNYPSFAVIFDssssnssHT---FTRTATNVGIPESVYAVHVMEPDGVSVIVKP  1593
                PGDLNYP+ + +F   +  S  +     RT TNVG P+S Y V V    G S+ V+P
Sbjct  533   LASPGDLNYPAISSVFTQKTPTSFPSPVIVHRTVTNVGPPDSKYHVVVSPFKGASIKVEP  592

Query  1594  KVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             + L F    Q LSY ++F  +  + +      FGS+ WK    TVRSPI + W
Sbjct  593   ETLNFTGKHQKLSYKITFKPKVRQTSP----EFGSMEWKDGLHTVRSPIVITW  641



>ref|XP_010111996.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32307.1| Subtilisin-like protease [Morus notabilis]
Length=826

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/597 (52%), Positives = 399/597 (67%), Gaps = 23/597 (4%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             K++GAR+FYKGY + +GK I+E+ E  SPRD+EGHGTHT+STAAG +V +ASFL  A G 
Sbjct  233   KIIGARSFYKGYLAALGKPIDESKESLSPRDTEGHGTHTSSTAAGAVVSNASFLHYAPGE  292

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C++LGC   D+LAA+DQA+ DGV I+SLS+G     P++ D+IAI
Sbjct  293   ARGMATKARIAAYKICWSLGCYDSDILAAMDQAISDGVHIISLSVGSSHASPYFLDSIAI  352

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              +FGA Q GV V  SAGNSGP   + +N APWI+TV AS++DR FPA V LG+ R+F G 
Sbjct  353   GSFGAAQHGVLVSCSAGNSGPDAYTATNIAPWILTVGASTIDREFPADVILGDDRIFNGV  412

Query  541   SLYSGKAVN-QKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLY+G ++   KLPLVY R AG +   +C  G L  + V+G IVVC+RG +AR EKGS V
Sbjct  413   SLYAGDSLGASKLPLVYAREAGDR---YCHEGKLIPKKVEGTIVVCDRGGNARVEKGSAV  469

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTV  897
             K +GG GM+L N E  GEE+ AD H LPAT +G   G  +K+YI S+++ TA+I F+GTV
Sbjct  470   KHAGGFGMVLANLEDSGEELLADSHLLPATMVGQINGDKIKEYIKSTENPTATIVFRGTV  529

Query  898   YGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
              G+   AP +AAFSSRGP+ ++PEI+KPDV APGVNILA W   IGPT LE D R VEFN
Sbjct  530   IGSSPAAPKVAAFSSRGPNILNPEILKPDVIAPGVNILAGWTGFIGPTDLEIDPRRVEFN  589

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSG+AALL+  +  WSPAAIKSAL+TT+Y +D+    + D  +     +
Sbjct  590   IISGTSMSCPHVSGIAALLRKAYPSWSPAAIKSALITTAYDVDNSGETLRDLATGE--ES  647

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA---CPTHH  1422
              PF  G+GHVDP RA +PGL+YD    DY  +LCS+ Y+S  IS+ +R+ ++   C    
Sbjct  648   NPFVHGAGHVDPNRALNPGLVYDAGVNDYVAFLCSIGYDSALISIFVREPTSSDICAKTF  707

Query  1423  HH-----QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIP-ESVYAVHVMEPDGVSVI  1584
                      GDLNYPSF+V+FDS+       + R  TNVG   ++VY V V EP GV + 
Sbjct  708   DKIGALISSGDLNYPSFSVVFDSNRQVVK--YKRVVTNVGSETDAVYEVSVSEPAGVDIK  765

Query  1585  VKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             V P  L F    Q  ++ V+F      I S     FGS+VW      VRSP+A  W+
Sbjct  766   VSPSRLVFRADNQKQTFEVTFTTSVDYIKSS---RFGSVVWTDGTHRVRSPVAFKWR  819



>ref|XP_008242250.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=763

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/588 (51%), Positives = 394/588 (67%), Gaps = 12/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK--INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             +KL+GAR F KG+    G   + ++ E +SPRD +GHGTHT+STAAG  V +AS LG A 
Sbjct  179   RKLIGARCFSKGFHMASGGSFMRKSKEAESPRDRDGHGTHTSSTAAGSHVANASLLGYAT  238

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   AR+AAYK C++ GC   D+LA +D+A+ DGVD+LSLSLGG    P+Y D I
Sbjct  239   GTARGMAPHARVAAYKVCWSTGCFGSDILAGMDRAIVDGVDVLSLSLGGGS-SPYYRDTI  297

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AF AT++G+FV  SAGNSGP  +S++NTAPWIMTV A +LDR FPA   LGN + F 
Sbjct  298   AIGAFTATERGIFVSCSAGNSGPSKASLANTAPWIMTVGAGTLDRDFPAYALLGNKKRFT  357

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  + N+ + LVY +      +  C  GSL    V+G++VVC+RG +AR EKG 
Sbjct  358   GVSLYSGTGMGNKPVQLVYNK-GSNSSSNLCLPGSLRPEHVRGKVVVCDRGINARVEKGG  416

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMIL N    GEE+ AD H LPA A+G   G  +++Y     + TA I F G
Sbjct  417   VVRAAGGIGMILANTAASGEELVADSHLLPAVAVGMRVGDLIREYAQHDSNPTALISFGG  476

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   R +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILA WP +IGPT LE D R  +F
Sbjct  477   TVLNVRPSPVVAAFSSRGPNLVTPQILKPDVIGPGVNILAGWPESIGPTGLEEDTRKSQF  536

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SGLAALLK+ H DWSP+AIKSALMTT+YT D+ K+P+ D+   +   
Sbjct  537   NIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTQDNTKAPLRDAADGS--L  594

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             + P+A GSGHV+P++A  PGL+YDIST DY  +LCSL+Y    +  +++K +   +  + 
Sbjct  595   SNPWAHGSGHVEPQKALSPGLVYDISTDDYVAFLCSLDYTLEHVQAIVKKPNVTCSRKYS  654

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG LNYPSF+V+F          ++R  TNVG   S+Y V V  P  V + VKP  L F
Sbjct  655   DPGQLNYPSFSVVFGKKRVVR---YSREFTNVGAAGSIYRVAVTGPQMVRIAVKPTRLVF  711

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
               +G+   YTV+FVA +G   +     FGS+VW++    V+SPIA  W
Sbjct  712   KNVGEKQKYTVTFVANKGADKTARSE-FGSIVWQNPQHQVKSPIAFAW  758



>ref|XP_009391730.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009391731.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=770

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/593 (51%), Positives = 395/593 (67%), Gaps = 17/593 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVG-----KINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLG  165
             +KLVGAR+F +GY +  G     K  E  EY SPRD +GHGTHTASTAAG  V +AS LG
Sbjct  183   RKLVGARSFGRGYRAAAGGGDADKPRE--EYASPRDRDGHGTHTASTAAGAPVANASLLG  240

Query  166   LARGSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT  345
              A G A GM   AR+A YK C+  GC   D+LA +D+A++DGVD+LSLSLGG    PF  
Sbjct  241   YASGVARGMAPGARVAVYKVCWANGCYGSDILAGIDKAIEDGVDVLSLSLGGGS-APFSR  299

Query  346   DNIAIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGR  525
             D +A+ AF A Q+G+FV  SAGNSGP  SS++NTAPWI TV A +LDR FPA V+LGNG 
Sbjct  300   DPVAVGAFSAVQRGIFVACSAGNSGPSPSSLTNTAPWITTVGAGTLDRDFPATVQLGNGE  359

Query  526   VFRGESLYSGKAV-NQKLPLVYGR--TAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSAR  696
              + G SL SG  + +Q +P+VYG+    G   ++FC  G+L    VKG++V C+RG +AR
Sbjct  360   RYAGLSLCSGAGLEDQMVPIVYGKGVQVGSNSSKFCMPGTLDPEQVKGKVVFCDRGINAR  419

Query  697   AEKGSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATAS  876
              EKG  VK +GG GMIL N    GEE+ AD H LP  A+G  +G  ++ ++ +S + TA 
Sbjct  420   VEKGQVVKEAGGVGMILANAAVNGEELVADSHLLPTVAVGAKSGNLIRDFVRTSSNPTAM  479

Query  877   IKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADN  1053
             + F+GTV G + +PV+AAFSSRGP+ V P+++KPD+  PGVNILAAW  ++GPT L  D 
Sbjct  480   LSFRGTVLGVQPSPVVAAFSSRGPNTVVPQLLKPDLIGPGVNILAAWSGSVGPTGLAKDE  539

Query  1054  RSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVS  1233
             R   FNI+SGTSMSCPH+SG+AALLK+ H DWSP+AIKSALMTT+YT D+  SP+ D   
Sbjct  540   RRSAFNIMSGTSMSCPHISGVAALLKAAHPDWSPSAIKSALMTTAYTDDNTGSPLVDGAG  599

Query  1234  TNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACP  1413
              +P  ATP+A+GSGHVDP++A  PGLIYDI T DY  +LCSL Y++  I  + +  +   
Sbjct  600   GSP--ATPWAYGSGHVDPQKALSPGLIYDIGTGDYLAFLCSLEYSTDHIQAISKSTNKTC  657

Query  1414  THHHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKP  1593
             +     PG+LNYPSF+V+F   S      + R  TNVG+P SVY V V  P GV V VKP
Sbjct  658   SRRLPNPGNLNYPSFSVVFGRRSRRFVK-YNRVLTNVGVPGSVYNVKVGGPPGVKVTVKP  716

Query  1594  KVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
               L FN++GQ L Y V+F +   K       +FG + W S    VRSP++  W
Sbjct  717   TKLIFNQVGQKLRYKVTFTST--KAGDPVDMAFGWITWSSEQHQVRSPVSYRW  767



>ref|XP_008392153.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=815

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/597 (52%), Positives = 407/597 (68%), Gaps = 15/597 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F  G+ES  GK+NET EY+SPRDS+GHGTHTAS AAG  V  AS LG A+G 
Sbjct  219   RKLIGARFFSAGFESTNGKMNETTEYRSPRDSDGHGTHTASIAAGRYVFPASTLGYAKGV  278

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C++ GC   D+LAA D AV DG D++SLS+GG++  P+Y D IAI
Sbjct  279   AAGMAPKARLAAYKVCWSAGCYDSDILAAFDSAVADGCDVVSLSVGGVV-VPYYLDAIAI  337

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA+  GVFV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNGR   G 
Sbjct  338   GAFGASDAGVFVSASAGNGGPGGLTVTNVAPWVTTVGAGTIDRDFPADVKLGNGRTIPGM  397

Query  541   SLYSGK--AVNQKLPLVYGRTAGGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
             S+YSG   A  +  PLVY  + G  G  +  C  GSLS  LVKG+IVVC+RG ++RA KG
Sbjct  398   SVYSGPGLAAGRMYPLVYADSEGSDGYSSSLCLEGSLSQDLVKGKIVVCDRGINSRAAKG  457

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSA----TAS  876
               V+++GG GMIL N   +GE + AD H LPATA+G + G  +++YI ++  +    TA+
Sbjct  458   DVVRKAGGVGMILANGVFDGEGLVADCHVLPATAVGAATGDEIRRYITAASKSKSPPTAT  517

Query  877   IKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADN  1053
             I F+GT    R APV+A+FS+RGP+  +PEI+KPDV APG+NILAAWP  IGP+ + +D 
Sbjct  518   IVFKGTRIRVRPAPVVASFSARGPNPQAPEILKPDVIAPGLNILAAWPDKIGPSGVASDK  577

Query  1054  RSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVS  1233
             R+ EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+YT+D+R   + D  S
Sbjct  578   RNTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNRGETMLDESS  637

Query  1234  TNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACP  1413
              N  ++T   FG+GHV P++A  PGL+YDI++ DY N+LC+ NY +  I  + RK + C 
Sbjct  638   GN--TSTVMDFGAGHVHPQKAMDPGLVYDITSYDYVNFLCNYNYTTKNIQTVTRKLANCN  695

Query  1414  -THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVSVIV  1587
                     G+LNYPS +V+F     +  +T F RT TNVG P+SVY V +  P G +V V
Sbjct  696   GAKRAGHAGNLNYPSLSVVFQQYGKHKMNTHFIRTVTNVGGPKSVYQVRISPPAGTTVTV  755

Query  1588  KPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             +P+ L F ++GQ L++ V   A   K++ G    + GS+VW     TV SP+ V  Q
Sbjct  756   EPERLAFRRVGQKLNFLVRVHALAVKLSPGSTSVTSGSIVWSDGKHTVTSPLVVTMQ  812



>ref|XP_006828664.1| hypothetical protein AMTR_s00129p00121180 [Amborella trichopoda]
 gb|ERM96080.1| hypothetical protein AMTR_s00129p00121180 [Amborella trichopoda]
Length=799

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/597 (52%), Positives = 398/597 (67%), Gaps = 16/597 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGAR F  GYE++ G +NET EY+SPRDS+GHGTHTAS AAG  V  A  LG A G 
Sbjct  204   RKLVGARYFSGGYEAMSGPMNETAEYRSPRDSDGHGTHTASIAAGRYVYPADMLGYAHGV  263

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+T GC   D+LAA D+AV DGV+++SLS+GG +  PFY D+IAI
Sbjct  264   AAGMAPKARLAAYKVCWTSGCFDSDILAAFDRAVLDGVNVISLSVGGGV-VPFYLDSIAI  322

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A Q  +FV +SAGN GP  S+V+N APWI TV A +LDR FPA + LGNG  F G 
Sbjct  323   GAFAAAQHNIFVSASAGNEGPAESTVTNVAPWITTVGAGTLDRNFPAEISLGNGVKFSGV  382

Query  541   SLYSGKAVNQK--LPLVYGRTA---GGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARA  699
             SLYSG  ++QK  +PLVY   A   GG G  +  C   SL   +V+G+IV+C+RG++AR 
Sbjct  383   SLYSGPHLSQKPEIPLVYAGNAPATGGDGYSSSLCMENSLDPEMVRGKIVLCDRGSNARV  442

Query  700   EKGSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASI  879
              KG  VK +GG GMIL N   +GE + AD H LPA A+G +AG  V+ Y+NS K+ TA+I
Sbjct  443   NKGIVVKEAGGVGMILANGAGDGEGLVADSHVLPAAAIGANAGDLVRSYVNSVKNPTATI  502

Query  880   KFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNR  1056
             +FQGT  G R APV+A+FS+RGP+ V+PEI+KPDV APGVNILAAW  ++GP  + +D R
Sbjct  503   RFQGTQLGVRPAPVVASFSARGPNPVAPEILKPDVIAPGVNILAAWTDDVGPAGVTSDRR  562

Query  1057  SVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSP-ITDSVS  1233
               EFNILSGTSM+CPHVSGLAALL   H DW+P+ I+SALMTT+Y  D+R  P + D  +
Sbjct  563   KTEFNILSGTSMACPHVSGLAALLMGAHPDWTPSMIRSALMTTAYVRDNRGGPHMLDEAT  622

Query  1234  TNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACP  1413
              N  +++P  +G+GHVDP RA  PGL+YD++ QD+ ++LCS NY++  I ++ RK   C 
Sbjct  623   WN--ASSPLDYGAGHVDPNRAMVPGLVYDLTIQDHVDFLCSSNYSAKNIEIITRKPEKCS  680

Query  1414  THHHHQPGDLNYPSFAVIFDssssnssHT--FTRTATNVGIPESVYAVHVMEPDGVSVIV  1587
                 H  G+LNYP+ + +F+     +  +  F RT TNVG   SVY V V  P G  V V
Sbjct  681   QKVTHA-GNLNYPAISAVFERVPGRAKMSTHFIRTVTNVGDGPSVYKVTVKAPLGSVVSV  739

Query  1588  KPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             +P  L F K+ Q LS+ V    +  K+ +GG   S G + W      V SPI V  Q
Sbjct  740   EPGKLVFTKVKQRLSFVVRVEVRAVKLVAGGSRVSTGYVTWTDGKHVVNSPIVVTLQ  796



>ref|XP_009135372.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=767

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/594 (52%), Positives = 401/594 (68%), Gaps = 12/594 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGAR F  GYE+  GK+NET E++SPRDS+GHGTHTAS +AG  V  AS LG ARG 
Sbjct  174   RKLVGARFFCGGYEATNGKMNETTEFRSPRDSDGHGTHTASISAGRYVFPASILGYARGV  233

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P + D IAI
Sbjct  234   ASGMAPKARLAAYKVCWNSGCYDSDILAAFDTAVADGVDVVSLSVGGVV-VPCHLDAIAI  292

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA  +GVFV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNG+   G 
Sbjct  293   GAFGAIDRGVFVSASAGNGGPGALTVTNVAPWMTTVGAGTIDRDFPANVKLGNGKTVPGV  352

Query  541   SLYSGKAVN--QKLPLVYGRTA-GGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             S+Y G  +   +  PLVYG +  GG G  +  C  GSL   LVKG+IV+C+RG ++RA K
Sbjct  353   SVYGGPDLEPGRMYPLVYGGSLLGGDGYSSSLCIEGSLDPSLVKGKIVLCDRGINSRATK  412

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  V+R+GG+GMI+ N   +GE + AD H LPAT++G S G  +++YI+ SK  TA+I F
Sbjct  413   GEIVRRNGGSGMIIANGVFDGEGLVADCHVLPATSVGASGGDEIRRYISESKQPTATIVF  472

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
             +GT  G R APV+A+FS+RGP+  SPEI+KPDV APG+NILAAWP  IGP+ + +DNR  
Sbjct  473   KGTRLGIRPAPVVASFSARGPNPESPEILKPDVIAPGLNILAAWPDRIGPSGVPSDNRRT  532

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+YT+D+R  P+ D  + N 
Sbjct  533   EFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNRDEPMLDESTGN-  591

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACP-TH  1419
              +++   +GSGHV P +A  PGL+YDI++ DY N+LC+ NY    I  + R+K+ C    
Sbjct  592   -TSSVMDYGSGHVHPTKAMDPGLVYDITSYDYINFLCNSNYTGANIVTITRRKADCDGAR  650

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVSVIVKPK  1596
                  G+LNYPSF+V+F     +   T F RT TNVG  +SVY V +  P G +V V P+
Sbjct  651   RAGHVGNLNYPSFSVVFQQYGESKMSTHFIRTVTNVGDSDSVYEVKIRPPRGTNVTVAPE  710

Query  1597  VLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
              L F ++GQ LS+ V        ++ G      G +VW      V SP+ V  Q
Sbjct  711   KLSFRRVGQKLSFVVRVKTTEVTLSPGATSVETGHIVWSDGKRNVTSPLVVTLQ  764



>ref|XP_010443674.1| PREDICTED: subtilisin-like protease isoform X2 [Camelina sativa]
 ref|XP_010443682.1| PREDICTED: subtilisin-like protease isoform X3 [Camelina sativa]
Length=779

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/592 (51%), Positives = 399/592 (67%), Gaps = 16/592 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FY+GYE+  GKI+E +EYKSPRD +GHGTHTA+T AG  VK A+  G A G+
Sbjct  192   RKIVGARVFYRGYEAATGKIDEELEYKSPRDKDGHGTHTAATVAGSPVKGANLFGFAYGT  251

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC S D+L+AVDQAV DGV +LS+SLGG +   +  D+++I
Sbjct  252   ARGMSPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVQVLSISLGGGI-STYSRDSLSI  310

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FPA V+LG  R F+G 
Sbjct  311   ATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTMRTFKGV  370

Query  541   SLYSGKAV---NQKLPLVY-GRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+AV   N++ PL+Y GR A       FC  G+L  R V G+IV+C+RG S R +K
Sbjct  371   SLYKGRAVLSKNKQYPLIYLGRNASSPDPTSFCLDGALDRRHVAGKIVICDRGVSPRVQK  430

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VKR+GG GMIL N  T GEE+ AD H LPA A+G   G  +K+Y  +S+ ATA+++ 
Sbjct  431   GQVVKRAGGIGMILTNTATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSRKATATLEV  490

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G + +PV+AAFSSRGP+ +S EI+KPD+ APGVNILAAW  ++ P+ L +D R V
Sbjct  491   LGTRIGIKPSPVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWTGDLAPSSLSSDPRRV  550

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AAL++S H DWSPAAIKSALMTT+Y  D+   P+TD+    P
Sbjct  551   KFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLKPLTDASGAAP  610

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS-ACPTH  1419
               ++P+  G+GH+DP +A  PG +YDI  QDYF +LC+ + + +Q+ +  +  + +C   
Sbjct  611   --SSPYDHGAGHIDPLKAIDPGFVYDIGPQDYFEFLCTQDLSPSQLKVFTKHSNRSCKHT  668

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
                 PG+LNYP+ + +F  ++   S T  RT TNVG   + Y V V    G SV V PK 
Sbjct  669   LAKNPGNLNYPAISALFPENTRVKSMTLRRTVTNVGPHIASYKVSVSPFKGASVTVLPKT  728

Query  1600  LKFNKMGQNLSYTVSFVAQ-RGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             L F    Q LSYTV+F  + R K        FG LVWKST   VRSP+ + W
Sbjct  729   LNFTTKHQKLSYTVTFTTRMRMKRP-----EFGGLVWKSTTHKVRSPVIITW  775



>ref|XP_008462294.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=770

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/590 (53%), Positives = 393/590 (67%), Gaps = 19/590 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYES-IVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             +K++GAR F+ GYES + G +  + ++KS RD++GHGTHTASTAAG  VK+ASF   ARG
Sbjct  182   RKIIGARAFFXGYESNLRGSLKGSSDFKSARDTDGHGTHTASTAAGSFVKNASFFQYARG  241

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKP-FYTDNI  354
              A GM   ARIAAYK C+  GC   D+LAA+DQA+ DGVD++SLS+G     P +Y D+I
Sbjct  242   EARGMASRARIAAYKICWEFGCYDSDILAAMDQAISDGVDVISLSVGSSGRAPAYYRDSI  301

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AFGA Q G+ V  SAGNSGP   +  N APWI+TV AS++DR F A V LG+ RVF 
Sbjct  302   AIGAFGAMQHGIVVSCSAGNSGPGPYTAVNIAPWIVTVGASTIDREFLADVILGDNRVFS  361

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  + + KLPLVYG   G  G+ +C  GSL S  V GRIVVC+RG +AR  KG 
Sbjct  362   GVSLYSGDPLGDSKLPLVYG---GDCGSRYCYSGSLDSSKVAGRIVVCDRGGNARVAKGG  418

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GG GM+L N E  GEE+ AD H +P T +G  AG  ++ YI++  + TA+I F+G
Sbjct  419   AVKSAGGLGMVLANTEENGEELLADSHLIPGTMVGEIAGNKLRDYIHTDPNPTATIVFRG  478

Query  892   TVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             TV G+   AP +A+FSSRGP+  + EI+KPDV APGVNILA W     PT L  D R VE
Sbjct  479   TVIGDSPPAPKVASFSSRGPNYRTAEILKPDVIAPGVNILAGWSGYSSPTGLNIDPRRVE  538

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSMSCPHVSG+AALL+     WSPAAIKSAL+TTSY+LDS  SPI D  ++   
Sbjct  539   FNIISGTSMSCPHVSGVAALLRKAFPTWSPAAIKSALITTSYSLDSSGSPIKDLATSE--  596

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHH  1425
              + PF  G+GH+DP +A +PGLIYD++ QDY ++LCS+ Y+S QI++ ++  S      H
Sbjct  597   ESNPFVHGAGHIDPNQALNPGLIYDLTPQDYVSFLCSIGYDSKQIAVFVKGSSYSQLCEH  656

Query  1426  H--QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIP-ESVYAVHVMEPDGVSVIVKPK  1596
                 PG+LNYPSF+V+FD         +TRT TNVG   E VY V V  P GV + V P 
Sbjct  657   KLSNPGNLNYPSFSVVFDDGEVV---KYTRTVTNVGDETEVVYGVKVEAPQGVEISVVPN  713

Query  1597  VLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAV  1746
              L+FNK    LSY ++F    G   S    SFGS+ W      VRSPIAV
Sbjct  714   KLEFNKEKTTLSYEITFTKINGFKESA---SFGSIQWSDGIHNVRSPIAV  760



>ref|XP_010412797.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=754

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/588 (52%), Positives = 394/588 (67%), Gaps = 11/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KKL+GAR+F KG++   G   +   E  SPRD +GHGTHT++TAAG  V++ASFLG A G
Sbjct  173   KKLIGARSFSKGFQMASGGGFSSKRESVSPRDVDGHGTHTSTTAAGSAVRNASFLGYAAG  232

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
             +A GM   AR+A YK C++ GC   D+LAA+D+A+ DGVD+LSLSLGG    P+Y D IA
Sbjct  233   TARGMASRARVATYKVCWSTGCFGSDILAAMDRAILDGVDVLSLSLGGGS-APYYRDTIA  291

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I +F A +KGVFV  SAGNSGP  +SV+N APW+MTV A +LDR FPA   LGNG+   G
Sbjct  292   IGSFSAMEKGVFVSCSAGNSGPTRASVANVAPWVMTVGAGTLDRDFPAFANLGNGKRLTG  351

Query  538   ESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLYSG  +  K L LVY +      +  C  GSL S LV+G+IVVC+RG +AR EKG+ 
Sbjct  352   VSLYSGVGMGTKPLELVYNQ-GNSSSSNLCLPGSLDSTLVRGKIVVCDRGVNARVEKGAM  410

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             V+ +GG GMI+ N    GEE+ AD H LPA A+G   G  +++YI S    TA + F+GT
Sbjct  411   VRDAGGLGMIMANTAASGEELVADSHLLPAIAVGKKTGDLLREYIKSDSHPTAVLVFKGT  470

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V   + +PV+AAFSSRGP+ V+PEI+KPDV  PGVNILA W   IGPT LE D+R  +FN
Sbjct  471   VLDVKPSPVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLEKDSRRTQFN  530

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPH+SGLA LLK+ H +WSP+AIKSALMTT+Y LD+  SP+ D+ + N +S 
Sbjct  531   IMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYVLDNTNSPLHDA-ADNRLS-  588

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
              P A GSGHVDP++A  PGL+YDIST++Y  +LCSL Y    I  ++++ S   +     
Sbjct  589   NPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLEYTVDHIVAIVKRPSVNCSKKFSD  648

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PG LNYPSF+V+F          +TR  TNVG   SVY V V     V + VKP  L F 
Sbjct  649   PGQLNYPSFSVLFGGKRVVR---YTREVTNVGAASSVYKVMVNGAPSVGISVKPTKLAFK  705

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             ++G+   YTV+FV+++G ++      FGS+ W +    VRSP+A  W 
Sbjct  706   RVGEKKRYTVTFVSKKG-VSMTNKAEFGSITWINPQHEVRSPVAFSWN  752



>ref|XP_010443668.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
Length=779

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/592 (51%), Positives = 399/592 (67%), Gaps = 16/592 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FY+GYE+  GKI+E +EYKSPRD +GHGTHTA+T AG  VK A+  G A G+
Sbjct  192   RKIVGARVFYRGYEAATGKIDEELEYKSPRDKDGHGTHTAATVAGSPVKGANLFGFAYGT  251

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC S D+L+AVDQAV DGV +LS+SLGG +   +  D+++I
Sbjct  252   ARGMSPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVQVLSISLGGGI-STYSRDSLSI  310

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FPA V+LG  R F+G 
Sbjct  311   ATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTMRTFKGV  370

Query  541   SLYSGKAV---NQKLPLVY-GRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+AV   N++ PL+Y GR A       FC  G+L  R V G+IV+C+RG S R +K
Sbjct  371   SLYKGRAVLSKNKQYPLIYLGRNASSPDPTSFCLDGALDRRHVAGKIVICDRGVSPRVQK  430

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VKR+GG GMIL N  T GEE+ AD H LPA A+G   G  +K+Y  +S+ ATA+++ 
Sbjct  431   GQVVKRAGGIGMILTNTATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSRKATATLEV  490

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G + +PV+AAFSSRGP+ +S EI+KPD+ APGVNILAAW  ++ P+ L +D R V
Sbjct  491   LGTRIGIKPSPVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWTGDLAPSSLSSDPRRV  550

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AAL++S H DWSPAAIKSALMTT+Y  D+   P+TD+    P
Sbjct  551   KFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLKPLTDASGAAP  610

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS-ACPTH  1419
               ++P+  G+GH+DP +A  PG +YDI  QDYF +LC+ + + +Q+ +  +  + +C   
Sbjct  611   --SSPYDHGAGHIDPLKAIDPGFVYDIGPQDYFEFLCTQDLSPSQLKVFTKHSNRSCKHT  668

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
                 PG+LNYP+ + +F  ++   S T  RT TNVG   + Y V V    G SV V PK 
Sbjct  669   LAKNPGNLNYPAISALFPENTRVKSMTLRRTVTNVGPHIASYKVSVSPFKGASVTVLPKT  728

Query  1600  LKFNKMGQNLSYTVSFVAQ-RGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             L F    Q LSYTV+F  + R K        FG LVWKST   VRSP+ + W
Sbjct  729   LNFTTKHQKLSYTVTFTTRMRMKRP-----EFGGLVWKSTTHKVRSPVIITW  775



>ref|XP_010917483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=778

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/593 (53%), Positives = 397/593 (67%), Gaps = 16/593 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             +KL+GAR FYKGYES +G  I+E+ E KSP D+EGHGTHTASTAAG  V+DA F   ARG
Sbjct  187   RKLIGARFFYKGYESAMGHPIDESRESKSPLDTEGHGTHTASTAAGAAVEDAGFYQYARG  246

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKP-FYTDNI  354
              A GM   ARIAAYK C+  GC   D+LAA+D A+ DG D++SLS+G     P FY D+I
Sbjct  247   EARGMATKARIAAYKICWAAGCFDSDILAAMDAAIDDGADVISLSVGATGFAPSFYRDSI  306

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AFGA + GV V  SAGNSGP   +  N APWI+TV AS++DR FPA V LG+G  + 
Sbjct  307   AIGAFGAARHGVTVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADVILGDGTTYG  366

Query  535   GESLYSGKAVNQ-KLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLY+G+ +N   LPLVY   AG  G+  C  G L S  V G+IV+C+RG +AR EKGS
Sbjct  367   GVSLYAGELLNSTDLPLVY---AGDCGSRLCISGYLDSAKVAGKIVLCDRGANARVEKGS  423

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GGAGMIL N    GEE+ AD H +PAT +G SAG  ++ YI S  S TA++ F+G
Sbjct  424   AVKLAGGAGMILANTAENGEELIADSHLIPATMVGESAGDKIRDYIKSQSSPTATVVFRG  483

Query  892   TVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             TV  +   AP +AAFSSRGP+  +PEI+KPDV APGVNILAAW     PT L+ D R V 
Sbjct  484   TVISSSPPAPKVAAFSSRGPNYRAPEILKPDVIAPGVNILAAWTGISSPTDLDIDPRRVL  543

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSMSCPHVSG+AALL   + DWSPAAIKSALMTT+Y LD+    I D +ST   
Sbjct  544   FNIISGTSMSCPHVSGIAALLHKTYPDWSPAAIKSALMTTAYNLDNSGEIIKD-LSTGEE  602

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA--CPTH  1419
             S TPF  G+GHVDP +A  PGLIYD   +DY  +LC++ Y++ QI+L  R ++   C   
Sbjct  603   S-TPFVRGAGHVDPNKALDPGLIYDSQVEDYLAFLCAIGYSTQQIALFTRDETTVNCSAM  661

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIP-ESVYAVHVMEPDGVSVIVKPK  1596
                 PGDLNYP+F+V+F S+S     TF+R   NVG P ++VY   +  P GV+V V P 
Sbjct  662   TLASPGDLNYPAFSVVFSSTSDIV--TFSRVVRNVGGPDDAVYEAEISGPPGVNVTVAPS  719

Query  1597  VLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
              L F+ + Q+LSY ++F A     A  G + FG + W     +VRSPIAV W+
Sbjct  720   KLVFDAVDQSLSYEITF-ASIADAAVAGSNGFGGISWSDGTHSVRSPIAVSWR  771



>ref|XP_004305780.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=770

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/597 (52%), Positives = 405/597 (68%), Gaps = 15/597 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F  GYES  GK+N+T E++SPRD++GHGTHTAS AAG  V  AS LG A+G 
Sbjct  173   RKLIGARYFCGGYESTNGKMNQTTEFRSPRDTDGHGTHTASIAAGRYVFPASTLGYAKGV  232

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DG D++SLS+GG++  P+Y D IAI
Sbjct  233   AAGMAPKARLAAYKVCWNAGCYDSDILAAFDAAVADGCDVVSLSVGGVV-VPYYLDAIAI  291

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA+  GVFV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNGR+  G 
Sbjct  292   GAFGASDAGVFVSASAGNGGPGGLTVTNVAPWVTTVGAGTIDRDFPADVKLGNGRIIPGM  351

Query  541   SLYSGKAV--NQKLPLVYGRTAGGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
             S+Y G  +   +  PLVY  + GG G  +  C  GSL   LVK +IVVC+RG ++RA KG
Sbjct  352   SVYGGPGLPPGRMFPLVYAGSEGGDGYSSSLCLEGSLDKSLVKNKIVVCDRGINSRAAKG  411

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINS---SKSA-TAS  876
               VK++GG GMIL N   +GE + AD H LPATA+  S G  ++KYI +   SKS  TA+
Sbjct  412   EVVKKAGGVGMILANGVFDGEGLVADCHVLPATAVAASTGDEIRKYITAAAKSKSPPTAT  471

Query  877   IKFQGT-VYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADN  1053
             I F+GT +    APV+A+FS+RGP+  +PEI+KPDV APG+NILAAWP  +GP+ + +D 
Sbjct  472   ILFKGTRIRVKPAPVVASFSARGPNPEAPEIVKPDVIAPGLNILAAWPDKVGPSGIPSDK  531

Query  1054  RSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVS  1233
             RS EFNILSGTSM+CPHVSGLAALLK+ H +WSPAAI+SALMTT+YT+D+R   + D  S
Sbjct  532   RSTEFNILSGTSMACPHVSGLAALLKAAHPEWSPAAIRSALMTTAYTVDNRGETMLDESS  591

Query  1234  TNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACP  1413
              N  ++T   FG+GHV P++A  PGLIYDIS+ DY ++LC+ NY +  I ++ RK + C 
Sbjct  592   GN--TSTVMDFGAGHVHPQKAMDPGLIYDISSSDYVDFLCNSNYTTKNIQVVTRKLANCN  649

Query  1414  -THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVSVIV  1587
                     G+LNYPS +V+F         T F RT TNVG P+SVY V +  P G+SV V
Sbjct  650   GAKRAGHSGNLNYPSLSVVFQQYGKRKKSTHFIRTVTNVGDPKSVYHVTIRPPRGMSVTV  709

Query  1588  KPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             +P+ L F ++GQ L++ V   A+  K++ G      GS++W     TV SP+ V  Q
Sbjct  710   QPEKLAFRRVGQKLNFLVRVQAREVKLSPGSSSMESGSIMWSDGKHTVTSPLVVTMQ  766



>ref|XP_002864127.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40386.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=740

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/591 (51%), Positives = 400/591 (68%), Gaps = 14/591 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FY+GYE+  GKI+E +EYKSPRD +GHGTHTA+T AG  VK A+  G A G+
Sbjct  153   RKIVGARVFYRGYEAATGKIDEELEYKSPRDRDGHGTHTAATVAGSSVKGANLFGFAYGT  212

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC S D+L+AVDQAV DGV +LS+SLGG +   +  D+++I
Sbjct  213   ARGMAPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVQVLSISLGGGI-STYSRDSLSI  271

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FPA V++G  R F+G 
Sbjct  272   ATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVKIGTLRTFKGV  331

Query  541   SLYSGKAV---NQKLPLVY-GRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+ V   N++ PLVY GR A       FC  G+L  R V G+IV+C+RG + R +K
Sbjct  332   SLYKGRTVLSKNKQYPLVYLGRNASSPDPTSFCLDGALDRRHVAGKIVICDRGVTPRVQK  391

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VKR+GG GMIL N  T GEE+ AD H LPA A+G + G  +K+Y  +SK ATAS++ 
Sbjct  392   GQVVKRAGGIGMILTNTATNGEELVADSHLLPAVAVGENEGKLIKQYAMTSKKATASLEI  451

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G + +PV+AAFSSRGP+ +S EI+KPD+ APGVNILAAW  ++ P+ L +D R V
Sbjct  452   LGTRIGIKPSPVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWTGDMAPSSLSSDPRRV  511

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AAL++S H DWSPAAIKSALMTT+Y  D+   P+TD+    P
Sbjct  512   KFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTLKPLTDASGAAP  571

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS-ACPTH  1419
               ++P+  G+GH+DP +A  PGL+YDI  Q+YF +LC+ + + +Q+ +  +  +  C   
Sbjct  572   --SSPYDHGAGHIDPLKAIDPGLVYDIGPQEYFEFLCTQDLSPSQLKVFTKHSNRTCKHT  629

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
                 PG+LNYP+ + +F  ++   + T  RT TNVG   S Y V V    G SV V+PK 
Sbjct  630   LAKNPGNLNYPAISALFPENTHVKAMTLRRTVTNVGPHISSYKVSVSPFKGASVTVQPKT  689

Query  1600  LKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             L F    Q LSYTV+F   R ++       FG LVWKS+   VRSP+ + W
Sbjct  690   LNFTSKHQKLSYTVTF-RTRMRLKR---PEFGGLVWKSSTHKVRSPVIITW  736



>ref|XP_008450936.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=765

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/588 (52%), Positives = 391/588 (66%), Gaps = 12/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYE--SIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR+F KGY+  S  G   +  E +S RD +GHGTHTASTAAG  V +AS LG AR
Sbjct  183   KKLIGARSFSKGYQMASGGGYFRKPRENQSARDQDGHGTHTASTAAGSHVPNASLLGYAR  242

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G A GM   AR+AAYK C+  GC   D+LA +D+A+ DGVD+LSLSLGG    P+Y D I
Sbjct  243   GIARGMAPQARVAAYKTCWPTGCFGSDILAGMDRAISDGVDVLSLSLGGGS-APYYRDTI  301

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AF A +KGVFV  SAGNSGP  +S++N APWIMTV A +LDR FPA V+LGNG+ F 
Sbjct  302   AIGAFAAMEKGVFVSCSAGNSGPNKASLANVAPWIMTVGAGTLDRDFPAYVQLGNGKRFT  361

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG+ + N+ + LVY +      +  C  GSL   +V+G++VVC+RG +AR EKG 
Sbjct  362   GVSLYSGQGMGNKAVALVYNK-GSNTSSNMCLPGSLDPAVVRGKVVVCDRGINARVEKGG  420

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMIL N    GEE+ AD H LPA A+G   G  +++Y+ S  + TA + F G
Sbjct  421   VVRDAGGIGMILANTAASGEELVADSHLLPAVAVGRKTGDLIRQYVRSDSNPTAVLSFGG  480

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             T+   R +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILAAW  +IGPT LE D R  +F
Sbjct  481   TILNVRPSPVVAAFSSRGPNLVTPQILKPDVIGPGVNILAAWSESIGPTGLENDKRKTQF  540

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SGLAALLK+ H  WSP+AIKSALMTT+YT D+  S + D+       
Sbjct  541   NIMSGTSMSCPHISGLAALLKAAHPQWSPSAIKSALMTTAYTQDNTNSSLRDAAGGG--F  598

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             + P+A G+GHVDP +A  PGL+YDIST DY  +LCSL+Y    +  ++++ +   +    
Sbjct  599   SNPWAHGAGHVDPHKALSPGLLYDISTNDYIAFLCSLDYGIDHVQAIVKRSNITCSRKFA  658

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG LNYPSF+V+F S        +TR  TNVG   SVY V    P  V V VKP  L F
Sbjct  659   DPGQLNYPSFSVVFGSKRVVR---YTRIVTNVGAAGSVYDVATTAPSVVKVTVKPSKLVF  715

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              K+G+   YTV+FVA R   A      FGS+VW +    VRSP++  W
Sbjct  716   TKVGERKRYTVTFVASR-DAAQTTRFGFGSIVWSNDQHQVRSPVSFAW  762



>gb|KHN10472.1| Subtilisin-like protease [Glycine soja]
Length=711

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/593 (50%), Positives = 403/593 (68%), Gaps = 16/593 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FY GYE+ +G+INE  EYKSPRD +GHGTHTA+T  G  V  A+ LG A G+
Sbjct  121   KKVVGARVFYHGYEAAIGRINEQKEYKSPRDQDGHGTHTAATVGGSPVHGANLLGYANGT  180

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM    RIAAYK C+  GC S D+++A+D+AV DGV++LS+SLGG +   +Y D++++
Sbjct  181   ARGMAPGTRIAAYKVCWIGGCFSSDIVSAIDKAVADGVNVLSISLGGGVSS-YYRDSLSV  239

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA ++GVFV  SAGNSGP  +S++N +PWI TV AS++DR FP+ V+LGNG+   G 
Sbjct  240   AAFGAMERGVFVSCSAGNSGPDPASLTNVSPWITTVGASTMDRDFPSDVKLGNGKKIIGV  299

Query  541   SLYSGK---AVNQKLPLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY GK   ++ ++ PLVY    ++       C  G+L  ++V G+IV+C+RG S R  K
Sbjct  300   SLYKGKNVLSIKKQYPLVYLGSNSSRVDPRSMCLEGTLDPKVVSGKIVICDRGLSPRVLK  359

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  V+ +GG GMIL N E  GEE+ AD H LPA A+G   G  +K Y+ SSK+ATA++ F
Sbjct  360   GHVVRSAGGVGMILTNTEANGEELVADSHLLPAVAIGEKEGKELKSYVLSSKTATAALAF  419

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
             +GT+ G + +PV+AAFSSRGP+ +S EI+KPD+ APGVNILAAW   IGP+ L+ DNR V
Sbjct  420   KGTILGIKPSPVVAAFSSRGPNFLSLEILKPDLVAPGVNILAAWSEAIGPSGLKIDNRRV  479

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNI+SGTSMSCPHVSG+AAL+KS H +WSPAAIKSALMTTSY LD+ K  + DS +  P
Sbjct  480   KFNIVSGTSMSCPHVSGVAALVKSRHPEWSPAAIKSALMTTSYVLDNTKKTLRDSSTAKP  539

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               ++P+  G+GH+DP RA  PGL+YD+  QDYF +LC+ N   TQ+ +  +  +    H 
Sbjct  540   --SSPYDHGAGHIDPIRALDPGLVYDMVPQDYFEFLCTQNLTPTQLKVFAKYSNRSCRHS  597

Query  1423  HHQPGDLNYPSFAVIFDssssnssHT---FTRTATNVGIPESVYAVHVMEPDGVSVIVKP  1593
                 GDLNYP+ + +F   ++ S  +     R  TNVG P+S Y V V    G S+ V+P
Sbjct  598   LASSGDLNYPAISSVFTQKTTTSFPSPVILHRIVTNVGPPDSKYHVVVSPFKGASIKVEP  657

Query  1594  KVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             + L F +  Q LSY ++F  +  + +      FGSLVWK    TVRSPI + W
Sbjct  658   ETLNFTRKHQKLSYKITFKPKVRQTSP----EFGSLVWKDGFHTVRSPIVITW  706



>ref|XP_004231903.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=754

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/589 (52%), Positives = 397/589 (67%), Gaps = 12/589 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGAR F +GYE+ +G I+E+ E KSPRD +GHGTHTASTAAG +V+ AS  G A G+
Sbjct  172   RKLVGARYFSRGYETTLGPIDESKESKSPRDDDGHGTHTASTAAGSVVQGASLFGYASGT  231

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM Y AR+A YK C+  GC + D+LA +D+A+ D VD+LSLSLGG  P  +Y D+IAI
Sbjct  232   ARGMAYRARVAMYKVCWLGGCFNSDILAGMDKAIDDKVDVLSLSLGGSTPD-YYKDSIAI  290

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A +KG+ V  SAGN+GP   S++N APWI TV A ++DR FPA V LGNG+ F G 
Sbjct  291   GAFAAMEKGILVSCSAGNAGPNQFSLANQAPWITTVGAGTIDRDFPAYVSLGNGKNFSGV  350

Query  541   SLYSGKAV-NQKLPLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SLY+G ++ N+ LPLVY G  +       C  G+L    VKG+IV+C+RG SAR +KG  
Sbjct  351   SLYAGDSLLNKMLPLVYAGNASNVTSGNLCMMGTLIPEKVKGKIVLCDRGISARVQKGFV  410

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GGAGM+L N    GEE+ AD H LPA A+G  AG  +KKY+ S  + TA I F GT
Sbjct  411   VKEAGGAGMVLANTAANGEELVADAHLLPAAAVGQKAGDVIKKYLFSDPNPTAEILFGGT  470

Query  895   -VYGNRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
              V    +PV+AAFSSRGP++++PEI+KPD+ APGVNILA W   +GPT +  D+R VEFN
Sbjct  471   KVDIEPSPVVAAFSSRGPNSITPEILKPDIIAPGVNILAGWTGAVGPTGMAEDDRRVEFN  530

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSGLAAL+K VH +WSPAAI+SALMT++YT+      + D  +  P  +
Sbjct  531   IISGTSMSCPHVSGLAALIKGVHPEWSPAAIRSALMTSAYTVYKNGGALVDVATGKP--S  588

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TPF  G+GHVDP  A +PGL+YDI+  DY N++C+L Y  +QI+ L R+   C +   + 
Sbjct  589   TPFDHGAGHVDPVSAVNPGLVYDINADDYLNFMCALKYTPSQINSLARRNFTCDSSKTYS  648

Query  1432  PGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPD-GVSVIVKPKVLK  1605
               DLNYPSFAV F + S  S+   ++RT TNVG P   Y V V  P+  V +IV+P+ L 
Sbjct  649   VTDLNYPSFAVSFVAGSDGSNTIKYSRTLTNVG-PAGTYKVTVSSPNSSVKIIVEPETLS  707

Query  1606  FNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             F ++ +  SYTVSF A     A+     FG + W      V SP+A+ W
Sbjct  708   FTQINEKKSYTVSFTAPSKSSAT---DVFGRIEWSDGKHVVSSPVAISW  753



>emb|CAN75240.1| hypothetical protein VITISV_014207 [Vitis vinifera]
Length=579

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/574 (53%), Positives = 383/574 (67%), Gaps = 20/574 (3%)
 Frame = +1

Query  58    INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGSAGGMKYTARIAAYKACYTL  237
             ++E+ E KSPRD+EGHGTHTASTAAG +V+DAS    A+G A GM   ARIAAYK C++L
Sbjct  5     MDESAESKSPRDTEGHGTHTASTAAGSVVQDASLFEFAKGEARGMAVKARIAAYKICWSL  64

Query  238   GCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT-DNIAIAAFGATQKGVFVCSSAGN  414
             GC   D+LAA+DQAV DGVDI+SLS+G     P Y  D+IAI AFGA   GV V  SAGN
Sbjct  65    GCFDSDILAAMDQAVADGVDIISLSVGATGLAPRYDHDSIAIGAFGAMDHGVLVSCSAGN  124

Query  415   SGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGESLYSGKAV-NQKLPLVYG  591
             SGP   +  N APWI+TV AS++DR FPA V LG+GR+F G S+YSG  + +  LPLVY 
Sbjct  125   SGPDPLTAVNIAPWILTVGASTIDREFPADVVLGDGRIFGGVSIYSGDPLKDTNLPLVY-  183

Query  592   RTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEVKRSGGAGMILINRETEGE  771
               AG  G+ FC  G L+   V G+IV+C+RG +AR EKG+ VK + GAGMIL N    GE
Sbjct  184   --AGDCGSRFCFTGKLNPSQVSGKIVICDRGGNARVEKGTAVKMALGAGMILANTGDSGE  241

Query  772   EVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTVYGNR--APVMAAFSSRGP  945
             E+ AD H LPAT +G  AG  +K+Y+ S    TA+I F+GTV G    AP +AAFSSRGP
Sbjct  242   ELIADSHLLPATMVGQIAGDKIKEYVKSKAFPTATIAFRGTVIGTSPPAPKVAAFSSRGP  301

Query  946   SAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNILSGTSMSCPHVSGLAAL  1125
             + ++PEI+KPDV APGVNILA W  +  PT L+ D R VEFNI+SGTSMSCPHVSGLAAL
Sbjct  302   NHLTPEILKPDVIAPGVNILAGWTGSKAPTDLDVDPRRVEFNIISGTSMSCPHVSGLAAL  361

Query  1126  LKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISATPFAFGSGHVDPERAAHP  1305
             L+  +  W+PAAIKSALMTT+Y LD+  + I D  + N   ++PF  G+GHVDP RA +P
Sbjct  362   LRKAYPKWTPAAIKSALMTTAYNLDNSGNNIADLATGN--QSSPFIHGAGHVDPNRALYP  419

Query  1306  GLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA--CPTHHHHQPGDLNYPSFAVIF---  1470
             GL+YDI   DY ++LC++ Y++ +I++ +R+ +   C T   H PGDLNYP+F+V+F   
Sbjct  420   GLVYDIDANDYISFLCAIGYDTERIAIFVRRHTTVDCNTEKLHTPGDLNYPAFSVVFNFD  479

Query  1471  -DssssnssHTFTRTATNVG-IPESVYAVHVMEPDGVSVIVKPKVLKFNKMGQNLSYTVS  1644
              D     +     R   NVG    +VY V V  P+G+ V V PK L F+K  Q  SY VS
Sbjct  480   HDPVHQGNEIKLKRVVKNVGSSANAVYEVKVNPPEGIEVDVSPKKLVFSKENQTASYEVS  539

Query  1645  FVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAV  1746
             F +    I    G  FGS+ W      VRSP+AV
Sbjct  540   FTSVESYI----GSRFGSIEWSDGTHIVRSPVAV  569



>ref|XP_009348638.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=846

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/590 (51%), Positives = 395/590 (67%), Gaps = 13/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FY GYE+  GKINE  E+KSPRD +GHGTHTA+T AG  V+ A+ LG ARG+
Sbjct  260   KKIVGARIFYHGYEAATGKINEQTEFKSPRDQDGHGTHTAATVAGSPVRGANLLGYARGT  319

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM  +ARIAAYK C+  GC S D+L+AVD+AV DGV++LS+SLGG +   +Y D++++
Sbjct  320   ARGMAPSARIAAYKVCWVGGCFSSDILSAVDRAVTDGVNVLSISLGGGVSS-YYRDSLSV  378

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA + G+FV  SAGN GP   S++N +PWI TV AS++DR FPA V+LGNGR   G 
Sbjct  379   AAFGAMEMGIFVSCSAGNGGPDPVSLTNVSPWITTVGASTMDRDFPATVKLGNGRTITGV  438

Query  541   SLYSGK---AVNQKLPLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+   + N++ P+VY    +        C  G+L  R+V G+IV+C+RG S R +K
Sbjct  439   SLYRGRMKLSTNKQYPVVYLGSNSTSPNPGSLCLEGTLDRRVVAGKIVICDRGISPRVQK  498

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VK +GG GMIL N    GEE+ AD H +PA A+G +    +K Y ++S  ATA++ F
Sbjct  499   GEVVKEAGGVGMILANTAANGEELVADCHLVPAVAVGENEAKGIKHYASTSPRATATLTF  558

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G R +PV+AAFSSRGP+ VS EI+KPD+ APGVNILAAW   +GP+ L AD R V
Sbjct  559   LGTRVGVRPSPVVAAFSSRGPNLVSLEILKPDMVAPGVNILAAWTGALGPSSLPADRRRV  618

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AALLK+ H DWSPAAIKSALMTT+Y  D+ + P+ DS + + 
Sbjct  619   KFNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVHDNTRKPLQDSSAAS-  677

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               +TP+  G+GH++P RA  PGLIYDI  QDY  +LC+     TQ+ +  +  +    ++
Sbjct  678   -ISTPYDHGAGHINPGRALDPGLIYDIEAQDYLEFLCTQRLTPTQLKVFAKYSNRSCKNN  736

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
                PGDLNYP+ +V+F   ++ S  T  RT TNVG   S Y   V    G +V V+P+ L
Sbjct  737   LASPGDLNYPALSVVFPDRTNVSVLTLHRTVTNVGPAVSNYHAIVSPFKGANVKVEPRTL  796

Query  1603  KFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             KF K  Q LSY + F  +  +        FG LVWK     VRSPI V+W
Sbjct  797   KFTKANQKLSYKIIFTTKSRQAVP----EFGGLVWKDGVHRVRSPIVVVW  842



>ref|XP_006396129.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
 gb|ESQ36908.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
Length=762

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/588 (52%), Positives = 393/588 (67%), Gaps = 11/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KKL+GAR+F KG++   G   +   E  SPRD +GHGTHT+STAAG  V++ASFLG A G
Sbjct  181   KKLIGARSFSKGFQMASGGGFSSKRESVSPRDVDGHGTHTSSTAAGSAVRNASFLGYAAG  240

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
             +A GM   ARIA YK C++ GC   D+LAA+D+A+ DGVD+LSLSLGG    P+Y D IA
Sbjct  241   TARGMATRARIATYKVCWSTGCFGSDILAAMDRAILDGVDVLSLSLGGGS-APYYRDTIA  299

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AF A +KGVFV  SAGNSGP  SSV+N APW+MTV A +LDR FPA   LGNG+   G
Sbjct  300   IGAFSAMEKGVFVSCSAGNSGPTRSSVANVAPWVMTVGAGTLDRDFPAFANLGNGKRLVG  359

Query  538   ESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLYSG+ +  K L LVY +      +  C  GSL    V+G+IVVC+RG +AR EKG+ 
Sbjct  360   VSLYSGEGMGTKPLELVYNK-GNSSSSNLCLPGSLDPTTVRGKIVVCDRGVNARVEKGAV  418

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             V+ +GG GMI+ N    GEE+ AD H LPA A+G   G  +++Y+ S  +  A + F+GT
Sbjct  419   VRDAGGLGMIMANTAASGEELVADSHLLPAIAVGKKTGDLLREYVKSETNPMAVLVFKGT  478

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             +   R +PV+AAFSSRGP+ V+PEI+KPDV  PGVNILA W   IGPT LE D+R  +FN
Sbjct  479   ILDVRPSPVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLEKDSRRTQFN  538

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPH+SGLA LLK+ H +WSP+AIKSALMTT+YTLD+  SP+ D+ + N +S 
Sbjct  539   IMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYTLDNTNSPLRDA-ADNSLS-  596

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
              P   GSGHVDP +A  PGL+YDIST++Y  +LCSL+Y    I  ++++ S         
Sbjct  597   NPHVHGSGHVDPLKALTPGLVYDISTEEYIKFLCSLDYTVDHIVAIVKRPSVNCLKKFSN  656

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PG LNYPSF+V+F          +TR  TNVG   +VY V V     V + VKP  L F 
Sbjct  657   PGQLNYPSFSVLFGGKRVVR---YTREVTNVGAANAVYKVVVSGAPSVGISVKPSKLAFR  713

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             K+G+   YTV+FV+++G ++      +GS+ W +T   VRSP+A  W 
Sbjct  714   KVGEKKRYTVTFVSKKG-VSLTNKAEYGSITWTNTQHEVRSPVAFSWN  760



>ref|XP_004144036.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004166699.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=763

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/588 (52%), Positives = 391/588 (66%), Gaps = 12/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYE--SIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR+F KGY+  S  G   +  E +S RD +GHGTHTASTAAG  V +AS LG AR
Sbjct  181   KKLIGARSFSKGYQMASGGGYFRKPRENESARDQDGHGTHTASTAAGSHVANASLLGYAR  240

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G A GM   AR+AAYK C+  GC   D+LA +D+A+ DGVD+LSLSLGG    P+Y D I
Sbjct  241   GIARGMAPQARVAAYKTCWPTGCFGSDILAGMDRAIMDGVDVLSLSLGGGS-APYYRDTI  299

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AF A +KGVFV  SAGNSGP  +S++N APWIMTV A +LDR FPA V+LGNG+ F 
Sbjct  300   AIGAFAAMEKGVFVSCSAGNSGPNKASLANVAPWIMTVGAGTLDRDFPAYVQLGNGKRFT  359

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG+ + N+ + LVY +      +  C  GSL   +V+G++VVC+RG +AR EKG 
Sbjct  360   GVSLYSGQGMGNKAVALVYNK-GSNTSSNMCLPGSLEPAVVRGKVVVCDRGINARVEKGG  418

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMIL N    GEE+ AD H LPA A+G   G  +++Y+ S  + TA + F G
Sbjct  419   VVRDAGGIGMILANTAASGEELVADSHLLPAVAVGRKTGDLIRQYVRSDSNPTAVLSFGG  478

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             T+   R +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILAAW  +IGPT LE D R  +F
Sbjct  479   TILNVRPSPVVAAFSSRGPNLVTPQILKPDVIGPGVNILAAWSESIGPTGLENDKRKTQF  538

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SGLAALLK+ H  WSP+AIKSALMTT+YT D+  S + D+       
Sbjct  539   NIMSGTSMSCPHISGLAALLKAAHPQWSPSAIKSALMTTAYTQDNTNSSLRDAAGGG--F  596

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             + P+A G+GHVDP +A  PGL+YDIST DY  +LCSL+Y    +  ++++ +   +    
Sbjct  597   SNPWAHGAGHVDPHKALSPGLLYDISTNDYVAFLCSLDYGIDHVQAIVKRSNITCSRKFA  656

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG LNYPSF+V+F S        +TR  TNVG   SVY V    P  V V VKP  L F
Sbjct  657   DPGQLNYPSFSVVFGSKRVVR---YTRIVTNVGAAGSVYDVATTAPPVVKVTVKPSKLVF  713

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              K+G+   YTV+FVA R   A      FGS+VW +    VRSP++  W
Sbjct  714   TKVGERKRYTVTFVASR-DAAQTTRFGFGSIVWSNDQHQVRSPVSFAW  760



>ref|NP_565330.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAC95169.1| subtilisin-like serine protease, putative [Arabidopsis thaliana]
 gb|AAK59595.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAN13182.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEC05985.1| Subtilase-like protein [Arabidopsis thaliana]
Length=754

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/588 (51%), Positives = 395/588 (67%), Gaps = 11/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KKL+GAR+F KG++   G   +   E  SPRD +GHGTHT++TAAG  V++ASFLG A G
Sbjct  173   KKLIGARSFSKGFQMASGGGFSSKRESVSPRDVDGHGTHTSTTAAGSAVRNASFLGYAAG  232

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
             +A GM   AR+A YK C++ GC   D+LAA+D+A+ DGVD+LSLSLGG    P+Y D IA
Sbjct  233   TARGMATRARVATYKVCWSTGCFGSDILAAMDRAILDGVDVLSLSLGGGS-APYYRDTIA  291

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AF A ++GVFV  SAGNSGP  +SV+N APW+MTV A +LDR FPA   LGNG+   G
Sbjct  292   IGAFSAMERGVFVSCSAGNSGPTRASVANVAPWVMTVGAGTLDRDFPAFANLGNGKRLTG  351

Query  538   ESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLYSG  +  K L LVY +      +  C  GSL S +V+G+IVVC+RG +AR EKG+ 
Sbjct  352   VSLYSGVGMGTKPLELVYNK-GNSSSSNLCLPGSLDSSIVRGKIVVCDRGVNARVEKGAV  410

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             V+ +GG GMI+ N    GEE+ AD H LPA A+G   G  +++Y+ S    TA + F+GT
Sbjct  411   VRDAGGLGMIMANTAASGEELVADSHLLPAIAVGKKTGDLLREYVKSDSKPTALLVFKGT  470

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V   + +PV+AAFSSRGP+ V+PEI+KPDV  PGVNILA W   IGPT L+ D+R  +FN
Sbjct  471   VLDVKPSPVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLDKDSRRTQFN  530

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPH+SGLA LLK+ H +WSP+AIKSALMTT+Y LD+  +P+ D+ + N +S 
Sbjct  531   IMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYVLDNTNAPLHDA-ADNSLS-  588

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
              P+A GSGHVDP++A  PGL+YDIST++Y  +LCSL+Y    I  ++++ S   +     
Sbjct  589   NPYAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRPSVNCSKKFSD  648

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PG LNYPSF+V+F          +TR  TNVG   SVY V V     V + VKP  L F 
Sbjct  649   PGQLNYPSFSVLFGGKRVVR---YTREVTNVGAASSVYKVTVNGAPSVGISVKPSKLSFK  705

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
              +G+   YTV+FV+++G ++      FGS+ W +    VRSP+A  W 
Sbjct  706   SVGEKKRYTVTFVSKKG-VSMTNKAEFGSITWSNPQHEVRSPVAFSWN  752



>ref|XP_010467108.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=756

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/589 (51%), Positives = 395/589 (67%), Gaps = 12/589 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYE--SIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR+F KG++  S  G  +   E  SPRD +GHGTHT++TAAG  V++ASFLG A 
Sbjct  174   KKLIGARSFSKGFQMASGGGGFSSKRESVSPRDVDGHGTHTSTTAAGSAVRNASFLGYAA  233

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   AR+A YK C++ GC   D+LAA+D+A+ DGVD+LSLSLGG    P+Y D I
Sbjct  234   GTARGMATRARVATYKVCWSTGCFGSDILAAMDRAILDGVDVLSLSLGGGS-APYYRDTI  292

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI +F A +KGVFV  SAGNSGP  +SV+N APW+MTV A +LDR FPA   LGNG+   
Sbjct  293   AIGSFSAMEKGVFVSCSAGNSGPTRASVANVAPWVMTVGAGTLDRDFPAFANLGNGKRLT  352

Query  535   GESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  +  K L LVY +      +  C  GSL S LV+G+IVVC+RG +AR EKG+
Sbjct  353   GVSLYSGVGMGTKPLELVYNQ-GNSSSSNLCLPGSLDSTLVRGKIVVCDRGVNARVEKGA  411

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMI+ N    GEE+ AD H LPA A+G   G  +++Y+ S  + TA + F+G
Sbjct  412   MVRDAGGLGMIIANTAASGEELVADSHLLPAIAVGKKTGDLLREYVKSDSNPTALLVFKG  471

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   + +PV+AAFSSRGP+ V+PEI+KPDV  PGVNILA W   IGPT LE D+R  +F
Sbjct  472   TVLDVKPSPVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLEKDSRRTQF  531

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SGLA LLK+ H +WSP+AIKSALMTT+Y LD+  SP+ D+ + N +S
Sbjct  532   NIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYVLDNTNSPLHDA-ADNSLS  590

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
               P A GSGHVDP++A  PGL+YDIST++Y  +LCSL Y    I  ++++ S   +    
Sbjct  591   -NPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLEYTVDHIVAIVKRPSVNCSKKFS  649

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG LNYPSF+V+F          +TR  TNVG   SVY V V     V + VKP  L F
Sbjct  650   DPGQLNYPSFSVLFGGKRVVR---YTREVTNVGAASSVYKVMVNGAPSVGISVKPLKLAF  706

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
               +G+   YTV+FV+++G ++      FGS+ W +    VRSP+A  W 
Sbjct  707   KSVGEKKRYTVTFVSKKG-VSMTNKAEFGSITWINPQHEVRSPVAFSWN  754



>ref|XP_009102354.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=763

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/588 (52%), Positives = 394/588 (67%), Gaps = 11/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYE-SIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KKLVGAR+F KG++ S  G  +   E  SPRD +GHGTHT+STAAG  V +ASFLG A G
Sbjct  182   KKLVGARSFSKGFQMSSGGGFSTKRESVSPRDVDGHGTHTSSTAAGSAVTNASFLGYAAG  241

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
             +A GM   AR+A YK C++ GC   D+LAA+D+A+ DGVD+LSLSLGG    P+Y D IA
Sbjct  242   TARGMATGARVATYKVCWSSGCFGSDILAAMDRAILDGVDVLSLSLGGGS-APYYRDTIA  300

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I +F A +KGVFV  SAGNSGP  SSV+N APW+MTV A +LDR FPA   LGNG+   G
Sbjct  301   IGSFSAMEKGVFVSCSAGNSGPTRSSVANVAPWVMTVGAGTLDRDFPAYANLGNGKRLVG  360

Query  538   ESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLYSG+ +  K L LVY +      +  C   SL    V+G+IVVC+RG +AR EKG+ 
Sbjct  361   VSLYSGEGMGTKPLELVYNK-GNSSSSNLCLPASLDPTTVRGKIVVCDRGVNARVEKGAV  419

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             V+ +GG GMI+ N    GEE+ AD H LPA A+G   G  +++YI S  + TA + F+GT
Sbjct  420   VRDAGGLGMIMANTAASGEELVADSHLLPAIAVGKKTGDLLREYIKSDSNPTALLVFKGT  479

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V   R +PV+AAFSSRGP+ V+PEI+KPDV  PGVNILA W   IGPT L+ D+R  +FN
Sbjct  480   VLDVRPSPVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLDKDSRRTQFN  539

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPH+SGLA LLK+ H +WSP+AIKSALMTT+Y LD+  SP+ D+ + N +S 
Sbjct  540   IMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYNLDNTNSPLRDA-ADNSLS-  597

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
              P A GSGHVDP++A  PGL+YDIST++Y  +LCSL+Y    I  ++++ S   +     
Sbjct  598   NPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRPSVNCSKKFSN  657

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PG LNYPSF+V+F          +TR  TNVG P SVY V V     V + VKP  L F 
Sbjct  658   PGQLNYPSFSVLFGGKRVVR---YTREVTNVGAPNSVYKVVVNGAPSVGISVKPSKLSFR  714

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
              +G+   YTV+FV+++G ++      FGS+ W +    VRSP+A  W 
Sbjct  715   SVGEKKRYTVTFVSKKG-VSLTNKAEFGSITWSNPQHQVRSPVAFSWN  761



>ref|XP_010541995.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=765

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/587 (52%), Positives = 398/587 (68%), Gaps = 12/587 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KKL+GAR+F KG++   G   +   E  SPRD +GHGTHT+STAAG  V++ASFLG A G
Sbjct  185   KKLIGARSFSKGFQMASGGGFSNKRESVSPRDVDGHGTHTSSTAAGSAVRNASFLGYATG  244

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
             +A GM   +R+A YK C++ GC   D+LA +D+A+ DGVD+LSLSLGG    P+Y D IA
Sbjct  245   TARGMATRSRVATYKVCWSTGCFGSDILAGMDRAILDGVDVLSLSLGGGS-APYYRDTIA  303

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AF A +KG+FV  SAGNSGP  +S++N APWIMTV A +LDR FPA   L NG   +G
Sbjct  304   IGAFSAMEKGIFVSCSAGNSGPTKASIANVAPWIMTVGAGTLDRDFPAYAVLDNGDRIKG  363

Query  538   ESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLYSG+ +  K L LVY +      +  C  GSL   LV+G+IVVC+RG +AR EKG+ 
Sbjct  364   VSLYSGEGMGTKPLALVYNK-GNSSSSNLCLPGSLDPTLVRGKIVVCDRGLNARVEKGAV  422

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             V+ +GGAGMIL N    GEE+ AD H LPA A+G   G  +++Y+ SSK+ TA + F+GT
Sbjct  423   VRDAGGAGMILANTAASGEELVADSHLLPAMAVGRKIGDLIREYMKSSKNPTAVLVFRGT  482

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V G R +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILA W   +GPT  E D R  +FN
Sbjct  483   VLGVRPSPVVAAFSSRGPNMVTPQILKPDVIGPGVNILAGWSEAVGPTGQEKDTRRTQFN  542

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPH+SGLAA LK+ H +WSP+AIKSALMTT+Y LD+  SP+ D+ + N +S 
Sbjct  543   IMSGTSMSCPHISGLAAFLKAAHPEWSPSAIKSALMTTAYNLDNTNSPLRDA-ADNSLS-  600

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
              P+A GSGHVDP++A  PGL+YDIST++Y  +LCSL+Y    I  ++++ +   +     
Sbjct  601   NPWAHGSGHVDPKKALSPGLVYDISTEEYIRFLCSLDYTLNHIQAIIKRPNVNCSRKFSD  660

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PG LNYPSF+V+F          +TR  TNVG P SVY V V     VSV V+PK L F 
Sbjct  661   PGQLNYPSFSVLFRDKRVVR---YTRELTNVGAPGSVYKVTVDVSVSVSVTVRPKRLVFR  717

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
               G+   YTV+F A+RG   SG    FGS+ W ++   VRSP+A  W
Sbjct  718   TAGEKKRYTVTFSAKRG--VSGATAEFGSITWSNSQHQVRSPVAFSW  762



>ref|XP_006369092.1| subtilase family protein [Populus trichocarpa]
 gb|ERP65661.1| subtilase family protein [Populus trichocarpa]
Length=773

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/600 (51%), Positives = 405/600 (68%), Gaps = 19/600 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F  GYE+  GK+NET EY+SPRDS+GHGTHTAS AAG  V  AS  G ARG 
Sbjct  175   RKLIGARYFCNGYEATNGKMNETTEYRSPRDSDGHGTHTASIAAGRYVFPASTFGYARGV  234

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D IAI
Sbjct  235   AAGMAPKARLAAYKVCWNAGCYDSDILAAFDAAVSDGVDVISLSVGGVV-VPYYLDAIAI  293

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              +FGA  +GVFV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNG+V  G 
Sbjct  294   GSFGAVDRGVFVSASAGNGGPGGLTVTNVAPWVTTVGAGTIDRDFPADVKLGNGKVISGV  353

Query  541   SLYSGKAV--NQKLPLVYGRTAGGKGAEF----CSHGSLSSRLVKGRIVVCERGNSARAE  702
             SLY G  +   +  P+VY  ++GG G E+    C  GSL  +LV+G+IVVC+RG ++RA 
Sbjct  354   SLYGGPGLAPGKMYPVVYAGSSGG-GDEYSSSLCIEGSLDPKLVEGKIVVCDRGINSRAA  412

Query  703   KGSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSA-----  867
             KG  VK+SGG GMIL N   +GE + AD H LPATA+G S G  +++Y++++  +     
Sbjct  413   KGEVVKKSGGVGMILANGVFDGEGLVADCHVLPATAVGASGGDEIRRYMSAASKSKSSPP  472

Query  868   TASIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLE  1044
             TA+I F+GT    R APV+A+FS+RGP+  SPEI+KPDV APG+NILAAWP  +GP+ + 
Sbjct  473   TATIVFRGTRVNVRPAPVVASFSARGPNPESPEILKPDVIAPGLNILAAWPDKVGPSGIP  532

Query  1045  ADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITD  1224
             +D R +EFNILSGTSM+CPHVSGLAALLK+ H +WS AAI+SALMTT+YT+D+R   + D
Sbjct  533   SDQRKIEFNILSGTSMACPHVSGLAALLKAAHPEWSSAAIRSALMTTAYTVDNRGEEMID  592

Query  1225  SVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS  1404
               + N   +T   FG+GHV P++A +PGLIYDIS+ DY ++LC+ NY  T I ++ R+ +
Sbjct  593   ESTGN--VSTVLDFGAGHVHPQKAMNPGLIYDISSFDYMDFLCNSNYTLTNIQVVTRRNA  650

Query  1405  ACP-THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVS  1578
              C         G+LNYPS  V+F     +   T F RT TNVG P SVY V +  P G S
Sbjct  651   DCSGAKRAGHAGNLNYPSLTVVFQQYGKHQMSTHFIRTVTNVGDPNSVYKVTIRPPSGTS  710

Query  1579  VIVKPKVLKFNKMGQNLSYTVSFVAQRGKIASGG-GHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             V V+P+ L F ++GQ L++ V       K+A G      GS++W     TV SP+ V  Q
Sbjct  711   VTVQPEKLVFRRVGQKLNFLVRVETTAVKLAPGASSMKSGSIIWADGKHTVTSPVVVTMQ  770



>ref|XP_003541310.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=751

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/587 (51%), Positives = 393/587 (67%), Gaps = 9/587 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
              KL+GAR+F KGY        +  E  SPRD +GHGTHTASTAAG  V +A+ LG A G+
Sbjct  168   NKLIGARSFSKGYRMASANARKNREPASPRDLDGHGTHTASTAAGSAVSNATLLGYATGT  227

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPK-PFYTDNIA  357
             A GM   AR+AAYK C+T GC + D+LA +DQA++DGVD+LSLSLGG     P+Y DNIA
Sbjct  228   ARGMAPQARVAAYKVCWTGGCFASDILAGMDQAIQDGVDVLSLSLGGSSSSVPYYFDNIA  287

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AF A ++G+FV  SAGN+GP + SV+N APWIMTV A +LDR FPA   LGNG+ F G
Sbjct  288   IGAFAALERGIFVACSAGNTGPRSGSVANVAPWIMTVGAGTLDRDFPAYATLGNGKRFAG  347

Query  538   ESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLYSG+ + ++ + LVY           C  GSL    V+G++VVC+RG ++R EKG+ 
Sbjct  348   VSLYSGEGMGDEPVGLVYFSDRSNSSGSICMPGSLDPDSVRGKVVVCDRGLNSRVEKGAV  407

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             V+ +GG GMIL N    GE + AD H + A A+G SAG  +++Y +   + TA + F GT
Sbjct  408   VRDAGGVGMILANTAASGEGLVADSHLVAAVAVGESAGDEIREYASLDPNPTAVLSFGGT  467

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V   R +PV+AAFSSRGP+ V+ +I+KPDV  PGVNILA W   +GP+  + D R   FN
Sbjct  468   VLNVRPSPVVAAFSSRGPNGVTAQILKPDVIGPGVNILAGWSGAVGPSGSQ-DTRKTGFN  526

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPH+SGLAALLK+ H DWSP+AIKSALMTT+YT D+ +SP+ D+     +S 
Sbjct  527   IMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTYDNTESPLRDATGEESLS-  585

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TP+A+G+GHV+P++A  PGL+YD STQDY  +LCSLNY    + LL++   A  +     
Sbjct  586   TPWAYGAGHVNPQKALSPGLLYDASTQDYIYFLCSLNYTLDHLRLLVKHPDANCSKKFAD  645

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PGDLNYPSF+V+F S+       +TRT TNVG P S Y V V  P  V + V P  L+F 
Sbjct  646   PGDLNYPSFSVVFGSNKVVR---YTRTLTNVGEPGSAYDVAVSAPSTVDITVNPNKLEFG  702

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             ++G+  +YTV+FV+ R  +       FGS++W +    VRSP+A  W
Sbjct  703   EVGERQTYTVTFVSNR-SVNDSATSGFGSIMWSNEQHQVRSPVAFTW  748



>ref|XP_003528733.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=782

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/603 (51%), Positives = 401/603 (67%), Gaps = 21/603 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F  GYE+  GK+NET E++SPRDS+GHGTHTAS AAG  V  AS LG A+G 
Sbjct  179   RKLIGARWFSGGYEATHGKMNETTEFRSPRDSDGHGTHTASIAAGRYVSQASTLGYAKGV  238

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A YK C++ GC   D+LAA D AV DGVD+ SLS+GG++  P++ D IAI
Sbjct  239   AAGMAPKARLAVYKVCWSDGCYDSDILAAFDAAVSDGVDVASLSVGGVV-VPYHLDVIAI  297

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA   GVFV +SAGN GP   +V+N APW+ TV A +LDR FPA V+LGNG++  G 
Sbjct  298   GAFGAASAGVFVSASAGNGGPGGLTVTNVAPWVTTVGAGTLDRDFPANVKLGNGKIVPGI  357

Query  541   SLYSGKAVN--QKLPLVYGRTAGGKGAE-----------FCSHGSLSSRLVKGRIVVCER  681
             S+Y G  +   +  P+VY       G              C  GSL  + VKG+IVVC+R
Sbjct  358   SIYGGPGLTPGRMYPIVYAGVGQFGGGGGSGGVDGYSSSLCLEGSLDPKFVKGKIVVCDR  417

Query  682   GNSARAEKGSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSK  861
             G ++RA KG EVK++GG GMIL N   +GE + AD H LPATA+G + G  ++ YI +S+
Sbjct  418   GINSRAAKGEEVKKNGGVGMILANGVFDGEGLVADCHVLPATAVGATGGDEIRSYIGNSR  477

Query  862   S-ATASIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPT  1035
             + ATA+I F+GT  G R APV+A+FS+RGP+  SPEI+KPDV APG+NILAAWP ++GP+
Sbjct  478   TPATATIVFKGTRLGVRPAPVVASFSARGPNPESPEILKPDVIAPGLNILAAWPDHVGPS  537

Query  1036  MLEADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSP  1215
              + +D R  EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+YT+D++  P
Sbjct  538   GVPSDGRRTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNKGDP  597

Query  1216  ITDSVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLR  1395
             + D  ST  +S+  F +G+GHV P +A +PGL+YDIST DY N+LC+ NY +  I ++ R
Sbjct  598   MLDE-STGNVSSV-FDYGAGHVHPVKAMNPGLVYDISTSDYVNFLCNSNYTTNTIHVITR  655

Query  1396  KKSACP-THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPD  1569
             + + C         G+LNYPS + +F         T F RT TNVG P SVY V +  P 
Sbjct  656   RNADCSGAKRAGHSGNLNYPSLSAVFQLYGKKRMATHFIRTVTNVGDPNSVYKVTIKPPR  715

Query  1570  GVSVIVKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAV  1746
             G  V VKP  L F ++GQ L++ V    +  K++ GG     GS+VW     TV SP+ V
Sbjct  716   GTVVTVKPDTLNFRRVGQKLNFLVRVQIRAVKLSPGGSSVKSGSIVWSDGKHTVTSPLVV  775

Query  1747  IWQ  1755
               Q
Sbjct  776   TMQ  778



>ref|XP_007217156.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
 gb|EMJ18355.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
Length=772

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/593 (52%), Positives = 401/593 (68%), Gaps = 19/593 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKI-NETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             +K++GAR ++ GYES +G++ +ET E KSPRD+EGHGTHTASTAAG +V +ASF   A+G
Sbjct  181   RKIIGARAYFNGYESHIGRLMDETTEAKSPRDTEGHGTHTASTAAGAVVANASFFSYAQG  240

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT-DNI  354
              A GM   ARIA YK C++ GC   D+LAA+DQA+ DGVDI+SLS+G     P Y  D+I
Sbjct  241   DARGMATKARIAVYKICWSFGCFDSDILAAMDQAIADGVDIISLSVGASGNAPPYDRDSI  300

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AFGA Q GV V +SAGNSGP   + +N APWI+TV AS++DR FPA V LG+ RV  
Sbjct  301   AIGAFGAAQHGVLVSASAGNSGPNPFTATNIAPWILTVGASTIDREFPADVVLGDNRVIS  360

Query  535   GESLYSGKA-VNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG+  V+ KLPLVYG   G  G+ +C  G+L    V+G+IVVC+RG +AR  KG 
Sbjct  361   GVSLYSGEPLVDYKLPLVYG---GDCGSRYCYEGALQPSKVQGKIVVCDRGGNARVAKGG  417

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GG GMIL N E  GEE+ AD H +PAT +G  A   +++YI  S+  TA+I F+G
Sbjct  418   AVKLAGGLGMILANTEESGEELLADGHLIPATEVGEIAANQIREYIRLSQYPTATIVFRG  477

Query  892   TVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             TV G+   +P +AAFSSRGP++++PEI+KPDV APGVNILA W     PT L+ D R VE
Sbjct  478   TVIGSSPSSPQVAAFSSRGPNSLTPEILKPDVIAPGVNILAGWTGATAPTDLDIDPRRVE  537

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSMSCPHVSG+AALL+    +WS AAIKSAL+TT+YTLD+    I D  +    
Sbjct  538   FNIISGTSMSCPHVSGIAALLRKAFPNWSIAAIKSALITTAYTLDNAGKKIKDLGTGE--  595

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA---CPT  1416
              +TPF  G+GHVDP RA +PGLIYD++  DY  +LCS+ Y+  QI++ + K +    C  
Sbjct  596   ESTPFVHGAGHVDPNRALNPGLIYDLNVNDYVAFLCSIGYSPRQIAVFVGKPTGSDMCTR  655

Query  1417  HHHHQPGDLNYPSFAVIFDssssnssHTFTRTATNV-GIPESVYAVHVMEPDGVSVIVKP  1593
             +    PGDLNYPSF+V+  S        + R ATNV G  ++VY V V  P GV + V+P
Sbjct  656   NSLASPGDLNYPSFSVVLSSDQGLIK--YKRIATNVGGDADAVYEVTVNAPAGVEISVEP  713

Query  1594  KVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             + L F+   Q  SY V+F  +RG +   GG  +GS+ W      VRSP+AV W
Sbjct  714   RKLVFSAENQTQSYEVTF--KRG-VGYDGGERYGSIEWTDGRHLVRSPVAVRW  763



>gb|KFK39884.1| hypothetical protein AALP_AA3G301200 [Arabis alpina]
Length=754

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/588 (51%), Positives = 397/588 (68%), Gaps = 11/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KKL+GAR+F KG++   G   +   E  SPRD +GHGTHT+STAAG  V++ASFLG A G
Sbjct  173   KKLIGARSFSKGFQMASGGGFSTKRESVSPRDVDGHGTHTSSTAAGSAVRNASFLGYAAG  232

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
             +A GM   AR+A YK C++ GC   D+LAA+D+A+ DGVD+LSLSLGG    P++ D IA
Sbjct  233   TARGMATHARVATYKVCWSTGCFGSDILAAMDRAILDGVDVLSLSLGGGS-APYFRDTIA  291

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AF A ++GVFV +SAGNSGP  +SV+N APW+MTV A +LDR FPA   LGNG+   G
Sbjct  292   IGAFSAMERGVFVSASAGNSGPTRASVANVAPWVMTVGAGTLDRDFPAFANLGNGKSLTG  351

Query  538   ESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLYSG+ + +K L +VY +      +  C  GSL    VKG+IVVC+RG +AR EKG+ 
Sbjct  352   VSLYSGEGMGKKPLEIVYNK-GNSSSSNLCLPGSLDPATVKGKIVVCDRGVNARVEKGAV  410

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             V+ +GG GMI+ N    GEE+ AD H +PA A+G   G  +++Y+ S  + TA + F+GT
Sbjct  411   VRDAGGLGMIMANTAASGEELVADSHLIPAIAVGKKTGDLLREYVKSDSNPTAVLVFKGT  470

Query  895   VYG-NRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V   + +PV+AAFSSRGP+ V+PEI+KPDV  PGVNILA W   +GPT LE D+R   FN
Sbjct  471   VLDVHPSPVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDALGPTGLEKDSRRTHFN  530

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPH+SGLA LLK+ H +WSP+AIKSALMTT+Y LD+  SP+ D+ + N +S 
Sbjct  531   IMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYILDNTNSPLRDA-ADNSLS-  588

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
              P+A GSGHVDP++A  PGL+YDIST++Y  +LCSL+Y    I  ++++ S   +     
Sbjct  589   NPWAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRPSVNCSKKFAD  648

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PG LNYPSF+V+F          +TR  TNVG   SVY V V     V + VKP  L F 
Sbjct  649   PGQLNYPSFSVVFGGKRVVR---YTREVTNVGAASSVYKVTVNGAASVGISVKPAKLAFR  705

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             ++G+   YTV+FV+++G ++      FGS+ W +    VRSP+A  W 
Sbjct  706   RVGEKKRYTVTFVSKKG-VSLTNKAEFGSITWSNPQHEVRSPVAFSWN  752



>gb|ACN40199.1| unknown [Picea sitchensis]
Length=766

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/553 (53%), Positives = 383/553 (69%), Gaps = 9/553 (2%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGSA  183
             KL+GAR F KGYE+  G ++E   Y+SPRD  GHGTHT+STAAG  V  +S LG A G+A
Sbjct  195   KLIGARFFLKGYEAKYGHVDEMENYRSPRDEGGHGTHTSSTAAGAEVPGSSLLGFAAGTA  254

Query  184   GGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAIA  363
              G+   AR+A YK C+   C S D+LA ++ A+ DGVD+LSLS+      P+Y D IAI 
Sbjct  255   RGIATKARLAVYKVCWPEECLSSDLLAGMEAAISDGVDLLSLSISDNRNLPYYKDAIAIG  314

Query  364   AFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGES  543
             A GA +KGVFV  +AGN+GP+ S + NTAPWI TV AS++DR FPA V LGNG+ +RG S
Sbjct  315   ALGAIEKGVFVSCAAGNAGPIPSKIFNTAPWITTVGASTIDREFPAPVVLGNGKNYRGSS  374

Query  544   LYSGKAV-NQKLPLVYGRTA-GGKGAEFCSHGSLSSRLVKGRIVVCER-GNSARAEKGSE  714
             LY GK + N +LPL+YG++A   + A+FC  GSL S  V G+IV+C+  G    AE G  
Sbjct  375   LYKGKTLGNGQLPLIYGKSASSNETAKFCLPGSLDSNRVSGKIVLCDLGGGEGTAEMGLV  434

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG-  891
             V+++GGAGMI  NR  +GE+++ D HFLPAT + F +GI +K YIN +K+ TA+IK +G 
Sbjct  435   VRQAGGAGMIQANRLVDGEDLWTDCHFLPATKVDFKSGIEIKAYINRTKNPTATIKAEGA  494

Query  892   TVYGN-RAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV G  RAPV+A+FSSRGP+ + PEI+KPD+ APGVN+LAAW  ++ PT L +D R V++
Sbjct  495   TVVGKTRAPVVASFSSRGPNPLVPEILKPDLIAPGVNVLAAWSGHVSPTGLTSDKRRVDY  554

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSM+CPHV+G+AAL+ +VH  W+PAAIKSALMT+S   D  K  I++SV+  P  
Sbjct  555   NIISGTSMACPHVTGIAALILAVHSAWTPAAIKSALMTSSVPFDHSKRLISESVTALPAD  614

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             A  FA G+GHV+P  A  PGL+YD    DY ++LCSLNY  +QI +L RK S+C   H  
Sbjct  615   A--FAIGAGHVNPSAALDPGLVYDADFDDYVSFLCSLNYTRSQIHILTRKASSCTRIHSQ  672

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
             QPGDLNYPSF+V+F     N      RT TNVG    VY V +  P GV++IV+P+ L F
Sbjct  673   QPGDLNYPSFSVVFK--PLNLVRALRRTVTNVGGAPCVYEVSMESPPGVNIIVEPRTLVF  730

Query  1609  NKMGQNLSYTVSF  1647
              +  +  SYTV F
Sbjct  731   KEQNEKASYTVRF  743



>emb|CDX97560.1| BnaA05g25190D [Brassica napus]
Length=770

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/600 (51%), Positives = 403/600 (67%), Gaps = 18/600 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGA+ F  GYE+  GK+NET E++SPRDS+GHGTHTAS +AG  V  AS LG ARG 
Sbjct  171   RKLVGAKFFCGGYEATNGKMNETTEFRSPRDSDGHGTHTASISAGRYVFPASTLGYARGV  230

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D IAI
Sbjct  231   ASGMAPKARLAAYKVCWNSGCYDSDILAAFDAAVADGVDVVSLSVGGVV-VPYYLDAIAI  289

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA  +G+FV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNG+   G 
Sbjct  290   GAFGAIDRGIFVSASAGNGGPGALTVTNVAPWMTTVGAGTIDRDFPANVKLGNGKTIPGV  349

Query  541   SLYSGKAVN--QKLPLVYGRTA-GGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             S+Y G  ++  +  PLVYG +  GG G  +  C  GSL   LVKG+IV+C+RG ++RA K
Sbjct  350   SVYGGPDLDPDKMYPLVYGGSLLGGDGYSSSLCIEGSLDPSLVKGKIVLCDRGINSRATK  409

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYIN------SSKSA  867
             G  V+++GG GMI+ N   +GE + AD H LPAT++G S G  +++YI+      SSK  
Sbjct  410   GEIVRKNGGVGMIIANGVFDGEGLVADCHVLPATSVGASGGDEIRRYISETAKSRSSKQP  469

Query  868   TASIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLE  1044
             TA+I F+GT  G R APV+A+FS+RGP+  +PEIIKPDV APG+NILAAWP  IGP+ + 
Sbjct  470   TATIVFKGTRLGIRPAPVVASFSARGPNPETPEIIKPDVIAPGLNILAAWPDKIGPSGVP  529

Query  1045  ADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITD  1224
              DNR  EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+YT+D+R   + D
Sbjct  530   TDNRRTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNRDERMLD  589

Query  1225  SVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS  1404
               + N  ++    +GSGHV P +A  PGL+YDI++ DY N+LC+ NY  T I  + R+K+
Sbjct  590   ESTGN--ASAVMDYGSGHVHPTKAMDPGLVYDITSYDYINFLCNSNYTGTNIVTITRRKA  647

Query  1405  ACP-THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVS  1578
              C         G+LNYPSF+V+F     +   T F RT TNVG  +SVY V +  P G +
Sbjct  648   DCDGARRAGHVGNLNYPSFSVVFQQYGESKLSTHFIRTVTNVGDSDSVYEVKIRPPRGTT  707

Query  1579  VIVKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             V V+PK L F ++GQ LS+ V       K++ G      G +VW      V SP+ V  Q
Sbjct  708   VTVEPKKLSFRRVGQKLSFVVRVKTTEVKLSPGATSVETGHIVWSDGKRNVTSPLVVTLQ  767



>ref|XP_010089708.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38258.1| Subtilisin-like protease [Morus notabilis]
Length=787

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/597 (51%), Positives = 402/597 (67%), Gaps = 15/597 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F +GYES  GK+NET EY+SPRDS+GHGTHTAS AAG  V  AS LG ARG 
Sbjct  191   RKLIGARFFCEGYESTNGKMNETTEYRSPRDSDGHGTHTASIAAGRYVFPASTLGYARGV  250

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D+IAI
Sbjct  251   AAGMAPKARLAAYKVCWNAGCYDSDILAAFDAAVADGVDVISLSVGGVV-VPYYLDSIAI  309

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA   GVFV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNGR   G 
Sbjct  310   GAFGAADNGVFVSASAGNGGPGGLTVTNVAPWVTTVGAGTMDRDFPADVKLGNGRTIPGV  369

Query  541   SLYSGKAVN--QKLPLVYGRTAGGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
             S+Y G  ++  +   L+Y    G  G  +  C  GSL+   VKG+IV+C+RG ++RA KG
Sbjct  370   SVYGGPDLSPGRMYSLIYAGNEGSDGYSSSLCLEGSLNPSSVKGKIVLCDRGINSRATKG  429

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSA----TAS  876
               VK++GG GMIL N   +GE + AD H LPAT++G S+G  ++KYI S+  +    TA+
Sbjct  430   EVVKKAGGVGMILANGVFDGEGLVADCHVLPATSVGASSGDEIRKYITSASKSRSPPTAT  489

Query  877   IKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADN  1053
             I F+GT  G R APV+A+FS+RGP+  SPEI+KPDV APG+NILAAWP  +GP+ + +D 
Sbjct  490   ILFKGTKLGIRPAPVVASFSARGPNPESPEILKPDVIAPGLNILAAWPDRVGPSGIPSDK  549

Query  1054  RSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVS  1233
             R  EFNILSGTSM+CPHVSGLAALLK+ H +WSPAAI+SALMTT+YT+D+R   + D  +
Sbjct  550   RRTEFNILSGTSMACPHVSGLAALLKAAHPEWSPAAIRSALMTTAYTVDNRGETVLDEST  609

Query  1234  TNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACP  1413
              N  S+T   FG+GHV PE+A  PGL+YDI++ DY ++LC+ NY +  I ++ RK + C 
Sbjct  610   GN--SSTVMDFGAGHVHPEKAIDPGLVYDITSYDYVDFLCNSNYTTKNIQVITRKSADCS  667

Query  1414  -THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVSVIV  1587
                     G+LNYPS + +F     +   T F RT TNVG P SVY V +  P G  V V
Sbjct  668   GAKKAGHAGNLNYPSLSALFQQYGRHKMSTHFIRTVTNVGDPNSVYRVTISPPSGTVVTV  727

Query  1588  KPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             +P+ L F ++GQ L++ V   A   K++ G  +   GS+VW      V SP+ V  Q
Sbjct  728   EPEKLAFRRVGQRLNFLVRVEATAVKLSPGNSYVKSGSIVWSDGKHKVTSPLVVTMQ  784



>ref|XP_010488783.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=755

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/589 (52%), Positives = 394/589 (67%), Gaps = 12/589 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYE--SIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR+F KG++  S  G  +   E  SPRD +GHGTHT++TAAG  V++ASFLG A 
Sbjct  173   KKLIGARSFSKGFQMASGGGGFSSKRESVSPRDVDGHGTHTSTTAAGSAVRNASFLGYAA  232

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   AR+A YK C++ GC   D+LAA+D+A+ DGVD+LSLSLGG    P+Y D I
Sbjct  233   GTARGMATRARVATYKVCWSTGCFGSDILAAMDRAILDGVDVLSLSLGGGS-APYYRDTI  291

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI +F A +KGVFV  SAGNSGP  +SV+N APW+MTV A +LDR FPA   LGNG+   
Sbjct  292   AIGSFSAMEKGVFVSCSAGNSGPTRASVANVAPWVMTVGAGTLDRDFPAFANLGNGKRLT  351

Query  535   GESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  +  K L LVY +      +  C  GSL S LV+G+IVVC+RG +AR EKG+
Sbjct  352   GVSLYSGVGMGTKPLELVYNQ-GNSSSSNLCLPGSLDSTLVRGKIVVCDRGVNARVEKGA  410

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMI+ N    GEE+ AD H LPA A+G   G  +++Y+ S  + TA + F+G
Sbjct  411   MVRDAGGLGMIIANTAASGEELVADSHLLPAIAVGKKTGDLLREYVKSDSNPTALLVFKG  470

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   + +PV+AAFSSRGP+ V+PEI+KPDV  PGVNILA W   IGPT LE D+R  +F
Sbjct  471   TVLDVKPSPVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLEKDSRRTQF  530

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SGLA LLK+ H +WSP+AIKSALMTT+Y LD+  SP+ D+ + N +S
Sbjct  531   NIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYVLDNTNSPLHDA-ADNSLS  589

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
               P A GSGHVDP +A  PGL+YDIST++Y  +LCSL Y    I  ++++ S   +    
Sbjct  590   -NPHAHGSGHVDPLKALSPGLVYDISTEEYIRFLCSLEYTVDHIVAIVKRPSVNCSKKFS  648

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG LNYPSF+V+F          +TR  TNVG   SVY V V     V V VKP  L F
Sbjct  649   DPGQLNYPSFSVLFGGKRVVR---YTREVTNVGAASSVYKVMVNGAPSVGVSVKPLKLAF  705

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
               +G+   YTV+FV+++G ++      FGS+ W +    VRSP+A  W 
Sbjct  706   KSVGEKKRYTVTFVSKKG-VSMTNKAEFGSITWINPQHEVRSPVAFSWN  753



>ref|XP_010693651.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=782

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/592 (51%), Positives = 405/592 (68%), Gaps = 17/592 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FY+GYE+  GKINE +EYKSPRD +GHG+HTA T AG LV  A+ LG A G+
Sbjct  196   KKIVGARVFYRGYEAATGKINEDMEYKSPRDQDGHGSHTAGTVAGSLVHGANLLGYAPGT  255

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+T GC S D+L+AVDQA+ DGVD+LS+SLGG +   ++ D++++
Sbjct  256   ARGMYPRARVAAYKVCWTGGCFSSDILSAVDQAITDGVDVLSISLGGGVSS-YFRDSLSV  314

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA +KGVFV  SAGN GP   S++N APW+ TV AS+LDR FPA V LG+G+ F G 
Sbjct  315   ATFGAMEKGVFVSCSAGNGGPEPVSLTNVAPWVATVGASTLDRNFPANVRLGSGKSFTGV  374

Query  541   SLYSG--KAVNQKL-PLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             S+Y G  K   +KL P+VY    +        C  G+L  R V+G+IV+C+RG + R +K
Sbjct  375   SIYKGRMKLSTEKLYPVVYLGSNSTNLDLDSLCLEGTLDRRKVQGKIVICDRGINPRVQK  434

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VK +GG GMIL N E  GEE+ AD H LPA A+G   G  +K+Y  +S +  A++ F
Sbjct  435   GQVVKEAGGVGMILANTEANGEELVADCHLLPAVAVGEREGNIIKRYAMTSPNPRATMSF  494

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G + +P++AAFSSRGP+ +S E++KPDV APGVNILAAW  + GP+ + AD R V
Sbjct  495   LGTKVGIKPSPIVAAFSSRGPNILSLEVLKPDVVAPGVNILAAWTGSTGPSSVSADQRRV  554

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AAL+K+VH  WSPAAIKSALMTT+Y  D+ K P+ D+ + + 
Sbjct  555   KFNILSGTSMSCPHVSGVAALIKAVHPSWSPAAIKSALMTTAYIHDNSKRPLIDAATGS-  613

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
              S++PF  G+GH+DP RA +PGL+YDI+ Q YF++LC+      Q+ +  +       + 
Sbjct  614   -SSSPFDHGAGHIDPVRALNPGLVYDITPQQYFDFLCTQKPTPLQLKVFSKGGKMACRNT  672

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
               + GDLNYP+ +V+F S+ S SS T  RT TNVG P S Y V V    G  V+++PKVL
Sbjct  673   ILKAGDLNYPALSVLFPSNVSISSITLQRTVTNVGQPVSSYRVRVTPFKGAKVLIEPKVL  732

Query  1603  KFNKMGQNLSYTVSF--VAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              F KM Q LSY V+F  V+++ ++ +      G LVWK+    VRSP+ + W
Sbjct  733   NFTKMNQKLSYKVTFKTVSRQPRLEN------GYLVWKNGVHRVRSPVVLTW  778



>ref|XP_007024651.1| Subtilase family protein [Theobroma cacao]
 gb|EOY27273.1| Subtilase family protein [Theobroma cacao]
Length=767

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/592 (52%), Positives = 396/592 (67%), Gaps = 15/592 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIV-GKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             +K++GAR FYKGYES + G ++ET E KSPRD+EGHGTHTASTAAG +V +AS    A G
Sbjct  175   RKIIGARAFYKGYESYLEGPMDETKESKSPRDTEGHGTHTASTAAGSVVSNASLFEFAYG  234

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT-DNI  354
              A GM   ARIAAYK C++LGC   D+LAA+DQA+ DGV+++SLS+G     P Y  D+I
Sbjct  235   EARGMATKARIAAYKICWSLGCFDSDLLAAMDQAIADGVNVISLSVGATGYAPQYDHDSI  294

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AFGA Q G+ V  SAGNSGP   +  N APWI+TV AS++DR FPA   LG+GR+F 
Sbjct  295   AIGAFGAAQHGIVVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADAILGDGRIFG  354

Query  535   GESLYSGKA-VNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG   V+ KLPLVY   AG  G  +C  GSLS   V+G+IV C+RG +AR EKG 
Sbjct  355   GVSLYSGDPLVDIKLPLVY---AGDSGNRYCYMGSLSPSKVQGKIVFCDRGGNARVEKGF  411

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GG GMIL N    GEE+ AD H +PAT +G  AG  +++YI  S+  TA+I F G
Sbjct  412   AVKLAGGLGMILANTAESGEELIADAHLIPATTVGEKAGNEIRQYIKISQFPTATIVFHG  471

Query  892   TVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             TV G    AP +AAFSSRGP+ ++PEI+KPDV APGVNILA W   IGP+ L  D R V 
Sbjct  472   TVIGPSPPAPKVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGFIGPSQLNIDTRRVN  531

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSMSCPHVSGLAALL   + +WSPAAIKSALMTT+Y+LD+  + I D  +   +
Sbjct  532   FNIISGTSMSCPHVSGLAALLIKAYPNWSPAAIKSALMTTAYSLDNSGNTIKDLATG--V  589

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHH  1425
              ++PF +G+GHVDP  A  PGL+YDI   DY  +LCS+ Y+S +I++ +R+ +       
Sbjct  590   ESSPFVYGAGHVDPNIALMPGLVYDIDDGDYVAFLCSIGYDSKRIAIFVREPTGPDVCEG  649

Query  1426  H--QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIP-ESVYAVHVMEPDGVSVIVKPK  1596
                 PG+LNYPSF+V+FDS+       + RT  NVG   ++VY   V  P GV + V P 
Sbjct  650   KLATPGNLNYPSFSVVFDSNDHVV--KYKRTVKNVGPSVDAVYEAKVNAPPGVEISVSPS  707

Query  1597  VLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              L+F+   Q LSY ++F +    + +    +FGS+ W      VRSPIAV W
Sbjct  708   KLEFSAENQTLSYEITFASDGLALFAVALEAFGSIEWSDGVHLVRSPIAVRW  759



>ref|XP_006587373.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=781

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/593 (50%), Positives = 403/593 (68%), Gaps = 16/593 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FY GYE+ +G+INE  EYKSPRD +GHGTHTA+T  G  V  A+ LG A G+
Sbjct  191   KKVVGARVFYHGYEAAIGRINEQKEYKSPRDQDGHGTHTAATVGGSPVHGANLLGYANGT  250

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM    RIAAYK C+  GC S D+++A+D+AV DGV++LS+SLGG +   +Y D++++
Sbjct  251   ARGMAPGTRIAAYKVCWIGGCFSSDIVSAIDKAVADGVNVLSISLGGGVSS-YYRDSLSV  309

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA ++GVFV  SAGNSGP  +S++N +PWI TV AS++DR FP+ V+LGNG+   G 
Sbjct  310   AAFGAMERGVFVSCSAGNSGPDPASLTNVSPWITTVGASTMDRDFPSDVKLGNGKKIIGV  369

Query  541   SLYSGK---AVNQKLPLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY GK   ++ ++ PLVY    ++       C  G+L  ++V G+IV+C+RG S R  K
Sbjct  370   SLYKGKNVLSIKKQYPLVYLGSNSSRVDPRSMCLEGTLDPKVVSGKIVICDRGLSPRVLK  429

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  V+ +GG GMIL N E  GEE+ AD H LPA A+G   G  +K Y+ SSK+ATA++ F
Sbjct  430   GHVVRSAGGVGMILTNTEANGEELVADSHLLPAVAIGEKEGKELKSYVLSSKTATAALAF  489

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
             +GT+ G + +PV+AAFSSRGP+ +S EI+KPD+ APGVNILAAW   IGP+ L+ DNR V
Sbjct  490   KGTILGIKPSPVVAAFSSRGPNFLSLEILKPDLVAPGVNILAAWSEAIGPSGLKIDNRRV  549

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNI+SGTSMSCPHVSG+AAL+KS H +WSPAAIKSALMTTSY LD+ K  + DS +  P
Sbjct  550   KFNIVSGTSMSCPHVSGVAALVKSRHPEWSPAAIKSALMTTSYVLDNTKKTLRDSSTAKP  609

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               ++P+  G+GH+DP RA  PGL+YD+  QDYF +LC+ N   TQ+ +  +  +    H 
Sbjct  610   --SSPYDHGAGHIDPIRALDPGLVYDMVPQDYFEFLCTQNLTPTQLKVFAKYSNRSCRHS  667

Query  1423  HHQPGDLNYPSFAVIFDssssnssHT---FTRTATNVGIPESVYAVHVMEPDGVSVIVKP  1593
                 GDLNYP+ + +F   ++ S  +     R  TNVG P+S Y V V    G S+ V+P
Sbjct  668   LASSGDLNYPAISSVFTQKTTTSFPSPVILHRIVTNVGPPDSKYHVVVSPFKGASIKVEP  727

Query  1594  KVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             + L F +  Q LSY ++F  +  + +      FG+LVWK    TVRSPI + W
Sbjct  728   ETLNFTRKHQKLSYKITFKPKVRQTSP----EFGTLVWKDGFHTVRSPIVITW  776



>ref|XP_010049348.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW81893.1| hypothetical protein EUGRSUZ_C03260 [Eucalyptus grandis]
Length=778

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/588 (50%), Positives = 396/588 (67%), Gaps = 12/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK--INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR F KG+    G   +    E +SPRD +GHGTHTASTAAG  V +AS LG A 
Sbjct  194   KKLIGARFFSKGFRMASGSSFLKNPKEVESPRDRDGHGTHTASTAAGSQVANASLLGYAS  253

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   AR+AAYK C++ GC   D+LA +D+A+ DGVD+LSLSLGG +  P+Y D I
Sbjct  254   GTARGMAEHARVAAYKVCWSSGCFGADILAGMDRAILDGVDVLSLSLGGGI-APYYRDTI  312

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AF A ++G+FV  SAGNSGP+  S++N APWIMTV A +LDR FPA   LGNG+ + 
Sbjct  313   AIGAFTAMERGIFVSCSAGNSGPVKESLANVAPWIMTVGAGTLDRDFPAYALLGNGKRYA  372

Query  535   GESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  +    +P++Y + +   G + C  GSL+  L +G++V+C+RG +AR EKG 
Sbjct  373   GVSLYSGPGMGHNPVPVIYSKDSNISG-QLCLPGSLNPALTRGKVVLCDRGVNARVEKGQ  431

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMIL N    GEE+ AD H +PA A+G   G  +++Y+ S +S TA + F+G
Sbjct  432   VVRDAGGVGMILANTAANGEELVADSHLIPAVAVGRKMGDVIREYVKSDRSPTAVLSFRG  491

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   R +PV+AAFSSRGP+ V+ +I+KPDV  PGVNILA W    GPT LE+D R   F
Sbjct  492   TVVNVRPSPVVAAFSSRGPNTVTQQILKPDVIGPGVNILAGWSEAAGPTGLESDTRKTLF  551

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NILSGTSMSCPH+SG+AALLKS H +WSP+AIKSALMTT+Y LD+ +SP+ D+       
Sbjct  552   NILSGTSMSCPHISGVAALLKSAHPNWSPSAIKSALMTTAYDLDNTRSPLRDAAGGT--V  609

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             +TP+A GSGHVDP++A  PGL+YD++ +DY  +LCSL+Y    +  ++++ +   +    
Sbjct  610   STPWAHGSGHVDPQKALSPGLVYDLTAEDYIAFLCSLDYTIDHVKTIVKRPNVTCSRKFS  669

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG+LNYPSF+V+F+         +TR  TNVG   S+Y V V  P  V V VKP  L F
Sbjct  670   DPGELNYPSFSVVFNDKKVVR---YTRELTNVGAAGSMYNVSVTGPSTVGVTVKPMKLIF  726

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              K+G  + YTV+FV+++G   +     FGS+VW +    VRSP+A  W
Sbjct  727   PKVGDKMRYTVTFVSKKGTNPTTRSE-FGSIVWSNAQNKVRSPVAYAW  773



>ref|XP_010666857.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=776

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/590 (51%), Positives = 393/590 (67%), Gaps = 12/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KKL+GAR+F  GY+   G  I+ T +  SPRD++GHGTHTASTAAG  V +AS LG A G
Sbjct  188   KKLIGARSFSHGYKMASGGGISTTDDVVSPRDTDGHGTHTASTAAGGHVGNASLLGYASG  247

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
             +A GM   AR+A YK CY  GC   D+LA +D+A+ DGVD+LSLSLGG    P++ D IA
Sbjct  248   TARGMAPRARVAVYKVCYKSGCFGSDILAGIDKAIADGVDVLSLSLGGGS-APYFRDTIA  306

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AF A +KG+FV  SAGNSGP  +S++NTAPWIMTV A +LDR FPA   LGNG+ F G
Sbjct  307   IGAFSAIEKGIFVSCSAGNSGPTKASLANTAPWIMTVGAGTLDRDFPAFAVLGNGKKFTG  366

Query  538   ESLYSGKAVNQK-LPLVYGRTAGGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
              SLYSGK + +K + LVY   +G +   +  C  GSL S LVKG++VVC+RG + R EKG
Sbjct  367   VSLYSGKGMGRKSVGLVYAGVSGRRNGSSNLCMPGSLDSSLVKGKVVVCDRGVNPRVEKG  426

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYI-NSSKSATASIKF  885
               VK +GG GMIL N    GEE+ AD H +PA A+G   G  +++Y+ N+ + A A + F
Sbjct  427   EVVKEAGGIGMILANTAANGEELVADSHLIPAVAVGMKIGEEIREYVRNAGRKARAVLSF  486

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GTV   R +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILAAW    GPT LE D R  
Sbjct  487   GGTVLNVRPSPVVAAFSSRGPNLVTPQIMKPDVIGPGVNILAAWSEIAGPTGLEKDTRKT  546

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNI+SGTSMSCPH+SGLAALLK+ H +WSP+AIKSALMTT+Y  D+ ++P+ D+   + 
Sbjct  547   KFNIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYNHDNMQNPLRDAADGS-  605

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               + P+  G+GHVDP +A  PGL+YDIS  DY  +LCSL+Y      ++ ++ +   +  
Sbjct  606   -LSNPWVHGAGHVDPHKAISPGLVYDISVDDYIAFLCSLDYTPLHRQIIAKRPNITCSRK  664

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
                PG LNYPSF++ F  S       +TR  TNVG   ++Y V V  P  V V V+P  L
Sbjct  665   LSDPGQLNYPSFSIQFGKSRIVR---YTRELTNVGAARTLYQVQVDAPRSVGVKVRPSRL  721

Query  1603  KFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              F  +G+   YTV+FVA++GK       +FGSL+W S    VRSP++  W
Sbjct  722   LFRSIGEKKKYTVTFVARKGKTPPPTRTAFGSLLWSSKTNQVRSPVSFTW  771



>ref|XP_008782639.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Phoenix 
dactylifera]
Length=772

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/594 (51%), Positives = 394/594 (66%), Gaps = 18/594 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKIN-----ETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLG  165
             +KL+GAR+F +G+ + V   +      T EY S RD +GHGTHTASTAAG  V +AS LG
Sbjct  187   RKLIGARSFSRGFRAGVAAEDGRAGGRTKEYASVRDRDGHGTHTASTAAGFPVANASLLG  246

Query  166   LARGSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT  345
              A G+A GM   ARIAAYK C+T GC   D+LA +D A+ DGVDILSLS+GG    P++ 
Sbjct  247   YAAGTARGMATGARIAAYKVCWTSGCFGSDILAGIDAALTDGVDILSLSIGGGS-APYFR  305

Query  346   DNIAIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGR  525
             D IA+ AF A ++GVFV  SAGNSGP   +++N APWI TV A +LDR FPA   LG+G 
Sbjct  306   DTIAVGAFAAAERGVFVACSAGNSGPGAGTLANAAPWIATVGAGTLDRDFPAFARLGSGA  365

Query  526   VFRGESLYSGKAVNQKL-PLVYGRTAGGK--GAEFCSHGSLSSRLVKGRIVVCERGNSAR  696
              + G SLYSGK + +KL P+VYG   GGK   ++ C  G+L    V+G++V C+RG +AR
Sbjct  366   RYTGVSLYSGKGMGKKLVPMVYG---GGKDNSSKLCLAGTLDPSYVRGKLVFCDRGITAR  422

Query  697   AEKGSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATAS  876
              +KG+ VK +GG GMIL N    GEE+ AD H LPA A+G S G  +++Y+         
Sbjct  423   VQKGAVVKAAGGVGMILANTAVNGEELVADSHLLPAVAVGKSVGDKIREYVKRDPRPRGV  482

Query  877   IKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADN  1053
             + F GTV G R +PV+AAFSSRGP+ V PEI+KPD   PGVNILA W  +IGPT L  D+
Sbjct  483   LSFGGTVLGVRPSPVVAAFSSRGPNTVVPEILKPDFIGPGVNILAGWSGSIGPTGLTKDD  542

Query  1054  RSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVS  1233
             R   FNI+SGTSMSCPH+SG+AALLK+ H DWSPAAIKSAL TT+Y +D+  SP+ DS  
Sbjct  543   RRTAFNIMSGTSMSCPHISGVAALLKAAHPDWSPAAIKSALTTTAYNIDNTNSPLRDSAG  602

Query  1234  TNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACP  1413
              +   ATPFAFG+GHVDP +A  PGL+YDI+T DY  +LCSL+Y    I +++++ +   
Sbjct  603   GS--LATPFAFGAGHVDPRKALSPGLVYDITTDDYIAFLCSLDYTIQHIQVIVKRPNVTC  660

Query  1414  THHHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKP  1593
             +     PGDLNYPSF+VIF+  S      + R  TNVG   SVY+V +  P+ +SV VKP
Sbjct  661   SRRFSNPGDLNYPSFSVIFEKKSRKVVK-YRRELTNVGSAGSVYSVKITGPENISVTVKP  719

Query  1594  KVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
               L F  +GQ L Y+V F +++G   +    +FG + W +    VRSP+A  W+
Sbjct  720   AKLIFKHVGQKLKYSVIFASKKG--GNPKNAAFGWITWSNKQHKVRSPVAYTWK  771



>ref|XP_009146389.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=770

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/600 (51%), Positives = 402/600 (67%), Gaps = 18/600 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGA+ F  GYE+  GK+NET E++SPRDS+GHGTHTAS +AG  V  AS LG ARG 
Sbjct  171   RKLVGAKFFCGGYEATNGKMNETTEFRSPRDSDGHGTHTASISAGRYVFPASTLGYARGV  230

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D IAI
Sbjct  231   ASGMAPKARLAAYKVCWNSGCYDSDILAAFDAAVADGVDVVSLSVGGVV-VPYYLDAIAI  289

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA  +G+FV +SAGN GP   +V+N APW+ TV A ++DR FPA V LGNG+   G 
Sbjct  290   GAFGAVDRGIFVSASAGNGGPGALTVTNVAPWMTTVGAGTIDRDFPANVRLGNGKTIPGV  349

Query  541   SLYSGKAVN--QKLPLVYGRTA-GGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             S+Y G  ++  +  PLVYG +  GG G  +  C  GSL   LVKG+IV+C+RG ++RA K
Sbjct  350   SVYGGPDLDPDKMYPLVYGGSLLGGDGYSSSLCIEGSLDPSLVKGKIVLCDRGINSRATK  409

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYIN------SSKSA  867
             G  V+++GG GMI+ N   +GE + AD H LPAT++G S G  +++YI+      SSK  
Sbjct  410   GEIVRKNGGVGMIIANGVFDGEGLVADCHVLPATSVGGSGGDEIRRYISETAKSRSSKQP  469

Query  868   TASIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLE  1044
             TA+I F+GT  G R APV+A+FS+RGP+  +PEIIKPDV APG+NILAAWP  IGP+ + 
Sbjct  470   TATIVFKGTRLGIRPAPVVASFSARGPNPETPEIIKPDVIAPGLNILAAWPDKIGPSGVP  529

Query  1045  ADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITD  1224
              DNR  EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+YT+D+R   + D
Sbjct  530   TDNRRTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNRDERMLD  589

Query  1225  SVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS  1404
               + N  ++    +GSGHV P +A  PGL+YDI++ DY N+LC+ NY  T I  + R+K+
Sbjct  590   ESTGN--ASAVMDYGSGHVHPTKAMDPGLVYDITSYDYINFLCNSNYTGTNIVTITRRKA  647

Query  1405  ACP-THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVS  1578
              C         G+LNYPSF+V+F     +   T F RT TNVG  +SVY V +  P G +
Sbjct  648   DCDGARRAGHVGNLNYPSFSVVFQQYGESKLSTHFIRTVTNVGDSDSVYEVKIRPPRGTT  707

Query  1579  VIVKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             V V+PK L F ++GQ LS+ V       K++ G      G +VW      V SP+ V  Q
Sbjct  708   VTVEPKKLSFRRVGQKLSFVVRVKTTEVKLSPGATSVETGHIVWSDGKRNVTSPLVVTLQ  767



>ref|XP_003549134.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=781

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/593 (50%), Positives = 403/593 (68%), Gaps = 16/593 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FY GYE+ +G+INE  EYKSPRD +GHGTHTA+T  G  V  A+ LG A G+
Sbjct  191   KKVVGARVFYHGYEAAIGRINEQKEYKSPRDQDGHGTHTAATVGGSPVHGANLLGYANGT  250

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C+  GC S D+++A+D+AV DGV++LS+SLGG +   +Y D++++
Sbjct  251   ARGMAPGARIAAYKVCWVGGCFSSDIVSAIDKAVADGVNVLSISLGGGVSS-YYRDSLSV  309

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA ++GVFV  SAGN+GP  +S++N +PWI TV AS++DR FPA V LGNG+   G 
Sbjct  310   AAFGAMERGVFVSCSAGNAGPDPASLTNVSPWITTVGASTMDRDFPADVRLGNGKKVTGV  369

Query  541   SLYSGK---AVNQKLPLVYGRTAGGK--GAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY GK   ++ ++ PLVY  +   +      C  G+L  ++V G+IV+C+RG S R +K
Sbjct  370   SLYKGKNVLSIEKQYPLVYMGSNSSRVDPRSMCLEGTLDPKVVSGKIVICDRGLSPRVQK  429

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G+ V+ +GG GMIL N E  GEE+ AD H LPA A+G   G  +K Y+ SSKS+TA++ F
Sbjct  430   GNVVRSAGGVGMILTNTEANGEELVADSHLLPAVAIGEKEGKELKSYVLSSKSSTATLAF  489

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
             +GT  G + +P++AAFSSRGP+ ++ +I+KPD+ APGVNILAAW   IGP+ L+ DNR V
Sbjct  490   KGTRLGIKPSPIVAAFSSRGPNFLTLDILKPDLVAPGVNILAAWSEAIGPSGLKIDNRKV  549

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNI+SGTSMSCPHVSG+AAL+KS H +WSPAAIKSALMTT+Y LD+ K  + D+ +  P
Sbjct  550   KFNIVSGTSMSCPHVSGIAALVKSRHPEWSPAAIKSALMTTAYVLDNTKKTLRDASTAKP  609

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               ++P+  G+GH+DP RA  PGL+YDI  QDYF +LC+ N   TQ+ +  +  +    H 
Sbjct  610   --SSPYDHGAGHIDPIRALDPGLVYDIVPQDYFEFLCTQNLTPTQLKVFAKYSNRSCRHS  667

Query  1423  HHQPGDLNYPSFAVIFDssssnssHT---FTRTATNVGIPESVYAVHVMEPDGVSVIVKP  1593
                PGDLNYP+ + +F   +  S  +     RT TNVG P+S Y V V    G S+ V+P
Sbjct  668   LASPGDLNYPAISSVFTQKTPTSFPSPVIVHRTVTNVGPPDSKYHVVVSPFKGASIKVEP  727

Query  1594  KVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             + L F    Q LSY ++F  +  + +      FGS+ WK    TVRSPI + W
Sbjct  728   ETLNFTGKHQKLSYKITFKPKVRQTSP----EFGSMEWKDGLHTVRSPIMITW  776



>gb|KFK38784.1| hypothetical protein AALP_AA3G160100 [Arabis alpina]
Length=773

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/600 (51%), Positives = 403/600 (67%), Gaps = 18/600 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKLVGAR F  GYE+  GK+NET E++SPRDS+GHGTHTAS +AG  V  AS LG ARG 
Sbjct  174   KKLVGARFFCGGYEATNGKMNETTEFRSPRDSDGHGTHTASISAGRYVFPASTLGYARGV  233

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D IAI
Sbjct  234   ASGMAPKARLAAYKVCWNSGCYDSDILAAFDTAVADGVDVISLSVGGVV-VPYYLDAIAI  292

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA  +G+FV +SAGN GP   +V+N APW+ TV A ++DR FPA V LGNG++  G 
Sbjct  293   GAFGAIDRGIFVSASAGNGGPGALTVTNVAPWMTTVGAGTIDRDFPANVRLGNGKMIPGV  352

Query  541   SLYSGKAVN--QKLPLVYGRTA-GGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             S+Y G  ++  +  PLVYG +  GG G  +  C  GSL   LVKG+IV+C+RG ++RA K
Sbjct  353   SVYGGPGLDPGRMYPLVYGGSLLGGDGYSSSLCIEGSLDPSLVKGKIVLCDRGINSRATK  412

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYI------NSSKSA  867
             G  V+++GG GMI+ N   +GE + AD H LPAT++G + G  +++YI      +SS+  
Sbjct  413   GEIVRKNGGFGMIIANGVFDGEGLVADCHVLPATSVGATGGDEIRRYISESAKSHSSEQP  472

Query  868   TASIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLE  1044
             +A+I F+GT  G R APV+A+FS+RGP+  +PEIIKPDV APG+NILAAWP  IGP+ + 
Sbjct  473   SATIVFKGTRLGIRPAPVVASFSARGPNPETPEIIKPDVIAPGLNILAAWPDRIGPSGVP  532

Query  1045  ADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITD  1224
             +DNR  EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+YT+D+R  P+ D
Sbjct  533   SDNRRTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNRGEPMMD  592

Query  1225  SVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS  1404
               + N  +++   +GSG V P +A  PGL+YDI   DY N+LC+ NY  T I  + R+K+
Sbjct  593   ESTGN--TSSVMDYGSGQVHPTKAMDPGLVYDIMPYDYINFLCNSNYTGTNIVTITRRKA  650

Query  1405  ACP-THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVS  1578
              C         G+LNYPSF+V+F         T F RT TNVG  +SVY + +  P G +
Sbjct  651   DCDGARRAGHVGNLNYPSFSVVFQQYGERKMSTHFIRTVTNVGDADSVYEIKIRPPRGTN  710

Query  1579  VIVKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             V V+PK L F ++GQ LS+ V       K++ G  +   G +VW      V SP+ V  Q
Sbjct  711   VTVEPKRLSFRRVGQKLSFVVRVKTTEVKLSPGATNVETGHIVWSDGKRNVTSPLVVTLQ  770



>emb|CDX98438.1| BnaC05g39370D [Brassica napus]
Length=770

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/600 (51%), Positives = 403/600 (67%), Gaps = 18/600 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGA+ F  GYE+  GK+NET E++SPRDS+GHGTHTAS +AG  V  AS LG ARG 
Sbjct  171   RKLVGAKFFCGGYEATNGKMNETTEFRSPRDSDGHGTHTASISAGRYVFPASTLGYARGV  230

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D IAI
Sbjct  231   ASGMAPKARLAAYKVCWNSGCYDSDILAAFDAAVADGVDVVSLSVGGVV-VPYYLDAIAI  289

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA  +G+FV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNG+   G 
Sbjct  290   GAFGAIDRGIFVSASAGNGGPGALTVTNVAPWMTTVGAGTIDRDFPANVKLGNGKTIPGV  349

Query  541   SLYSGKAVN--QKLPLVYGRTA-GGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             S+Y G  ++  +  PLVYG +  GG G  +  C  GSL   LVKG+IV+C+RG ++RA K
Sbjct  350   SVYGGPDLDPSKMYPLVYGGSLLGGDGYSSSLCIEGSLDPSLVKGKIVLCDRGINSRATK  409

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYIN------SSKSA  867
             G  V+++GG GMI+ N   +GE + AD H LPAT++G S G  +++YI+      SSK  
Sbjct  410   GEIVRKNGGVGMIIANGVFDGEGLVADCHVLPATSVGASGGDEIRRYISETAKSRSSKQP  469

Query  868   TASIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLE  1044
             TA+I F+GT  G R APV+A+FS+RGP+  +PEIIKPDV APG+NILAAWP  IGP+ + 
Sbjct  470   TATIVFKGTRLGIRPAPVVASFSARGPNPETPEIIKPDVIAPGLNILAAWPDKIGPSGVP  529

Query  1045  ADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITD  1224
              DNR   FNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+YT+D+R   + D
Sbjct  530   TDNRRTAFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNRDERMLD  589

Query  1225  SVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS  1404
               + N  +++   +GSGHV P +A  PGL+YDI++ DY N+LC+ NY  T I  + R+K+
Sbjct  590   ESTGN--ASSVMDYGSGHVHPTKAMDPGLVYDITSYDYINFLCNSNYTGTNIVTITRRKA  647

Query  1405  ACP-THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVS  1578
              C         G+LNYPSF+V+F     +   T F RT TNVG  +SVY V +  P G +
Sbjct  648   DCDGARRAGHVGNLNYPSFSVVFQQYGESKLSTHFIRTVTNVGDSDSVYEVKIRPPRGTT  707

Query  1579  VIVKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             V V+PK L F ++GQ LS+ V       K++ G      G +VW      V SP+ V  Q
Sbjct  708   VTVEPKKLSFRRVGQKLSFVVRVTTTEVKLSPGATSVETGHIVWSDGKRNVTSPLVVTLQ  767



>gb|KFK28394.1| hypothetical protein AALP_AA8G509300 [Arabis alpina]
Length=754

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/588 (51%), Positives = 395/588 (67%), Gaps = 13/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F KGYE+ +G I+E+ E +SPRD +GHGTHT+STAAG  V+ AS LG A G+
Sbjct  175   RKLIGARFFSKGYEATMGPIDESKESRSPRDDDGHGTHTSSTAAGSFVEGASLLGFANGT  234

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A YK C+  GC S D+LAA+D+A+ D V++LS+SLGG +   +Y D++AI
Sbjct  235   ARGMAPKARVAVYKVCWVGGCFSSDILAAIDKAIDDNVNVLSMSLGGGMSD-YYRDSVAI  293

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              +F A +KG+ V  SAGN+GP + S+SN APWI TV A +LDR FPA+  LGNG+ + G 
Sbjct  294   GSFAAMEKGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDRDFPALAVLGNGKNYSGV  353

Query  541   SLYSGKAVNQKL-PLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SL+ G ++  KL P VY G  +       C  G+L   LVKG+IV+C+RG +AR +KG  
Sbjct  354   SLFKGDSLPSKLLPFVYAGNASNATNGNLCMSGTLIPELVKGKIVMCDRGVNARVQKGEV  413

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GG GMIL N    GEE+ AD H LP TA+G  AG  ++ Y+ +  + TAS+  QGT
Sbjct  414   VKAAGGVGMILANTAANGEELVADAHLLPTTAVGQKAGDLIRHYVLTEPNPTASVLIQGT  473

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V   + +PV+AAFSSRGP++++P I+KPD+ APGVNILAAW    GPT L +D+R VEFN
Sbjct  474   VVNIKPSPVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAQGPTGLASDSRRVEFN  533

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSGLAALLKSVH +WSPAAI+SALMTT+Y       PI D  +  P  +
Sbjct  534   IISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYQTYKDGKPILDIATGKP--S  591

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TPF  GSGHV P  A +PGLIYD++T+DY  +LC+LNY S+QI  + R+   C +   + 
Sbjct  592   TPFDHGSGHVSPTTAINPGLIYDLTTEDYLGFLCALNYTSSQIRSVARRNLTCDSSKSYS  651

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVM-EPDGVSVIVKPKVLKF  1608
               DLNYPSFAV  D      ++ +TRT T+VG     Y+V +  E   V + V+P VL F
Sbjct  652   VADLNYPSFAVNVD---GAGAYKYTRTVTSVG-GSGTYSVKLYSETTAVKISVEPAVLNF  707

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              ++ +  SYTV+F     K    G +SFGS+ W      V SP+AV W
Sbjct  708   KEVNEKKSYTVTFTVDSSK--GSGSNSFGSIEWSDGKHVVASPVAVSW  753



>ref|XP_009782030.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/588 (51%), Positives = 394/588 (67%), Gaps = 14/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYE-SIVGKI-NETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR F KGY+ S  G   N+  + +SPRD +GHGTHT+STAAG  V +AS LG A 
Sbjct  182   KKLIGARFFSKGYQMSASGSFTNQPRQPESPRDQDGHGTHTSSTAAGAPVANASLLGYAS  241

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G A GM   AR+A YK C+  GC   D+LA +++A+ DGVD+LSLSLGG    P+Y D I
Sbjct  242   GVARGMAPRARVATYKVCWPTGCFGSDILAGMERAILDGVDVLSLSLGGGS-GPYYRDTI  300

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AF A +KG+ V  SAGNSGP   S++NTAPWIMTV A ++DR FPA   LGNG+   
Sbjct  301   AIGAFSAMEKGIVVSCSAGNSGPAKGSLANTAPWIMTVGAGTIDRDFPAFATLGNGKKIT  360

Query  535   GESLYSGKAVNQKL-PLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSGK + +K+ PLVY   +    A  C  GSL  ++V+G+IV+C+RG +AR EKG 
Sbjct  361   GVSLYSGKGMGKKVVPLVYSTDSS---ASLCLPGSLDPKMVRGKIVLCDRGTNARVEKGL  417

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GG GMIL N    GEE+ AD H LPA A+G   G  +++Y+ S K+  A + F G
Sbjct  418   VVKEAGGVGMILANTAESGEELVADSHLLPAVAVGRKLGDFIRQYVKSEKNPAAVLSFGG  477

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   + +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILAAW   +GPT LE D R  +F
Sbjct  478   TVVNVKPSPVVAAFSSRGPNTVTPQILKPDVIGPGVNILAAWSEAVGPTGLEKDTRRTKF  537

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SGLAALLK+ H +WSP+AIKSALMTT+Y  D+  SP+ D+       
Sbjct  538   NIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYVRDTTNSPLRDAEGGQ--L  595

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             +TP+A GSGHVDP +A  PGLIYDI+ +DY  +LCSL+Y    I  ++++ +   T    
Sbjct  596   STPWAHGSGHVDPHKALSPGLIYDITPEDYIKFLCSLDYELNHIQAIVKRPNVTCTKKFA  655

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG +NYPSF+V+F  S       +TR  TNVG   SVY V V  P  V+V VKP  L F
Sbjct  656   DPGQINYPSFSVLFGKSRVVR---YTRAVTNVGAAGSVYEVTVDAPPSVTVTVKPSKLVF  712

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              ++G+ L YTV+FV+++G +      +FGS+ W +    VRSP++  W
Sbjct  713   KRVGERLRYTVTFVSKKG-VNMMRKSAFGSISWNNAQNQVRSPVSYSW  759



>ref|XP_002885806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=752

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/588 (51%), Positives = 395/588 (67%), Gaps = 11/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KKL+GAR+F KG++   G   +   E  SPRD +GHGTHT++TAAG  V +ASFLG A G
Sbjct  171   KKLIGARSFSKGFQMASGGGFSSKRESVSPRDVDGHGTHTSTTAAGSAVGNASFLGYAAG  230

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
             +A GM   AR+A YK C++ GC   D+LAA+D+A+ DGVD+LSLSLGG    P+Y D IA
Sbjct  231   TARGMATHARVATYKVCWSSGCFGSDILAAMDRAILDGVDVLSLSLGGGS-APYYRDTIA  289

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I +F A ++GVFV  SAGNSGP  +SV+N APW+MTV A +LDR FPA   LGNG+   G
Sbjct  290   IGSFSAMERGVFVSCSAGNSGPTRASVANVAPWVMTVGAGTLDRDFPAFANLGNGKRLTG  349

Query  538   ESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLYSG  +  K L LVY +      +  C  GSL S +V+G+IVVC+RG +AR EKG+ 
Sbjct  350   VSLYSGVGMGTKPLELVYNK-GNSSSSNLCLPGSLDSGIVRGKIVVCDRGVNARVEKGAV  408

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             V+ +GG GMI+ N    GEE+ AD H LPA A+G   G  +++Y+ S  + TA + F+GT
Sbjct  409   VRDAGGLGMIMANTAASGEELVADSHLLPAVAVGKKTGDLLREYVKSDSNPTAVLVFKGT  468

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V   + +PV+AAFSSRGP+ V+PEI+KPDV  PGVNILA W   IGPT LE D+R  +FN
Sbjct  469   VLDVKPSPVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLEKDSRRTQFN  528

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPH+SGLA LLK+ H +WSP+AIKSALMTT+Y LD+  +P+ D+ + N +S 
Sbjct  529   IMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALMTTAYVLDNTNAPLHDA-ADNSLS-  586

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
              P A GSGHVDP++A  PGL+YDIST++Y  +LCSL+Y    I  ++++ S   +     
Sbjct  587   NPHAHGSGHVDPQKALSPGLVYDISTEEYIRFLCSLDYTVDHIVAIVKRPSVNCSKKFSD  646

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PG LNYPSF+V+F          +TR  TNVG   SVY V V     V++ VKP  L F 
Sbjct  647   PGQLNYPSFSVLFGGKRVVR---YTREVTNVGAENSVYKVTVNGAPSVAISVKPSKLAFR  703

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
              +G+   YTV+FV+++G ++      FGS+ W +    VRSP+A  W 
Sbjct  704   SVGEKKRYTVTFVSKKG-VSMTNKAEFGSITWSNPQHEVRSPVAFSWN  750



>ref|XP_011010186.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=766

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/588 (51%), Positives = 396/588 (67%), Gaps = 10/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F +GYE+ +G ++E+ E KSPRD +GHGTHT+STA G  V DAS  G A G+
Sbjct  184   RKLIGARFFARGYEATLGPVDESKESKSPRDDDGHGTHTSSTAGGSFVADASLFGYAAGT  243

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A YK C+  GC S D+LAA+D+A+ DGV++LS+SLGG +   +Y D++AI
Sbjct  244   ARGMAARARVAVYKVCWVGGCFSSDILAAMDKAIDDGVNVLSMSLGGSMSY-YYRDSVAI  302

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A +KG+FV  SAGNSGP + S+SN APWI TV A +LDR FPA   LGNG+ + G 
Sbjct  303   GAFAAMEKGIFVSCSAGNSGPSSYSLSNVAPWITTVGAGTLDRDFPAFASLGNGKNYSGV  362

Query  541   SLYSGKAV--NQKLPLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             SLY G A+   + LP VY G  +       C  G+L    V G+IV+C+RG + R +KG+
Sbjct  363   SLYKGDAILPGKLLPFVYAGNASNATNGNLCMMGALIPEQVAGKIVLCDRGVNPRVQKGA  422

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GG GM+L N +  GEE+ AD H LPATA+G   G  +KKY+ S    T +I F+G
Sbjct  423   VVKAAGGLGMVLSNTDANGEELVADAHLLPATAVGQKGGDEIKKYLFSDSKPTVNILFEG  482

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             T  G + +PV+AAFSSRGP++++P+I+KPD+ APGVNILA W  ++GPT L  D R VEF
Sbjct  483   TKVGIQPSPVVAAFSSRGPNSITPDILKPDMIAPGVNILAGWVGSVGPTGLATDGRRVEF  542

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPHVSGLAAL+K+ H DWSPAAIKSALMTT+Y      + + D V+T   S
Sbjct  543   NIISGTSMSCPHVSGLAALIKAAHPDWSPAAIKSALMTTAYVTYKNGNKLQD-VATGKDS  601

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
              TPF  G+GHVDP  A +PGL+YD++  DY N+LC+LNY++T+I+ L R+K  C     +
Sbjct  602   -TPFDHGAGHVDPVSALNPGLVYDLTADDYLNFLCALNYSATEITSLARRKFTCDASKKY  660

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
                DLNYPSFAV F S S++     +RT TNVG P +   +  ++  GV V V+P+ L F
Sbjct  661   SVTDLNYPSFAVNFGSGSADVVIKHSRTLTNVGAPGTYKVLISLQSPGVKVAVEPETLSF  720

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              +  +  SYTV+F    G     G ++FG + W +    V SPIAV W
Sbjct  721   RQANEKKSYTVTFT---GSSMPAGTNTFGRIEWSNGKQIVGSPIAVSW  765



>ref|XP_007219861.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
 gb|EMJ21060.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
Length=780

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/590 (51%), Positives = 392/590 (66%), Gaps = 13/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FY GYE+  GKINE  E+KSPRD +GHGTHTA+T AG  V+ A+ LG A G+
Sbjct  194   KKIVGARIFYHGYEAATGKINEQTEFKSPRDQDGHGTHTAATVAGSPVRGANLLGYAHGT  253

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C+  GC S D+L+AVD+AV DGV++LS+SLGG +   +Y D+++I
Sbjct  254   ARGMAPGARIAAYKVCWVGGCFSSDILSAVDKAVADGVNVLSISLGGGV-SAYYRDSLSI  312

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FP+ V+LGNGR   G 
Sbjct  313   AAFGAMEMGVFVSCSAGNGGPDPVSLTNVSPWITTVGASTMDRDFPSSVKLGNGRTVTGV  372

Query  541   SLYSGK---AVNQKLPLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+   + N++ P+VY    +     +  C  G+L  R+V G+IV+C+RG S R +K
Sbjct  373   SLYKGRMMLSTNKQYPVVYMGDNSTSPDPSSLCLEGTLDRRVVAGKIVICDRGISPRVQK  432

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VK +GG GMIL N    GEE+ AD H +PA A+G +   A+K Y  +S  ATA++ F
Sbjct  433   GQVVKDAGGVGMILANTAANGEELVADCHLVPAVAVGETEAKAIKHYALTSPRATATLAF  492

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G R +PV+AAFSSRGP+ VS EI+KPDV APGVNILAAW   +GP+ L  D+R V
Sbjct  493   LGTRTGVRPSPVVAAFSSRGPNFVSLEILKPDVVAPGVNILAAWTGALGPSSLPTDHRRV  552

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AALLK+ H +WSPAAIKSALMTT+Y  D+   P+ D+ +   
Sbjct  553   KFNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVHDNTHKPLQDASAAE-  611

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
              ++TP+  G+GH++P +A  PGL+YDI  QDY  +LC+      Q+ +  +  +    H 
Sbjct  612   -ASTPYDHGAGHINPRKALDPGLVYDIEAQDYLEFLCTQRLTPMQLKVFTKYSNRSCKHA  670

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
                PGDLNYP+ +V+F   ++ S  T  RT TNVG P S Y   V    G  V V+P+ L
Sbjct  671   LASPGDLNYPAISVVFPERTNVSLLTLHRTVTNVGPPVSNYHAIVSPFKGAYVKVEPRTL  730

Query  1603  KFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             KF +  Q LSY ++F  +  +        FG LVWK     VRSPI V+W
Sbjct  731   KFTRANQKLSYKITFTTKSRQATP----EFGGLVWKDGVHRVRSPIVVVW  776



>ref|XP_006280041.1| hypothetical protein CARUB_v10025918mg [Capsella rubella]
 gb|EOA12939.1| hypothetical protein CARUB_v10025918mg [Capsella rubella]
Length=779

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/591 (51%), Positives = 397/591 (67%), Gaps = 14/591 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FYKGYE+  GKI E +EYKSPRD +GHGTHTA+T AG  VK A+  G A G+
Sbjct  192   RKIVGARVFYKGYEAATGKIEEELEYKSPRDKDGHGTHTAATVAGSPVKGANLFGFAYGT  251

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC S D+L+AVDQAV DGV +LS+SLGG +   +  D+++I
Sbjct  252   ARGMAPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVHVLSISLGGGI-STYSRDSLSI  310

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FPA V+LG  R F+G 
Sbjct  311   ATFGAMEMGVFVSCSAGNGGPDPLSLTNVSPWITTVGASTMDRDFPATVKLGTMRTFKGV  370

Query  541   SLYSGKAV---NQKLPLVY-GRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+AV   N++ PLVY GR A       FC  G+L    V G+IV+C+RG + R +K
Sbjct  371   SLYKGRAVLSKNKQYPLVYLGRNASSPDPTSFCLDGALDRSHVVGKIVICDRGVTPRVQK  430

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VK++GG GMIL N  T GEE+ AD H LPA A+G   G  +K+Y  +SK ATA+++ 
Sbjct  431   GQVVKKAGGIGMILTNTATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSKKATATLEI  490

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G + +PV+AAFSSRGP+ +S EI+KPD+ APGVNILAAW  ++ P+ L +D R V
Sbjct  491   LGTRIGIKPSPVVAAFSSRGPNFLSLEILKPDLVAPGVNILAAWTGDLAPSSLSSDPRRV  550

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AAL++S H DWSPAA+KSALMTT+Y  D+   P++D+    P
Sbjct  551   KFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAVKSALMTTAYVHDNTLKPLSDASGAAP  610

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS-ACPTH  1419
               ++P+  G+GH+DP +A  PGL+YDI  QDYF +LC+ + + +Q+ +  +  +  C   
Sbjct  611   --SSPYDHGAGHIDPLKAMDPGLVYDIGPQDYFEFLCTQDLSPSQLKVFTKHSNRTCKHT  668

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKV  1599
                 PG+LNYP+ + +F  ++   S T  RT  NVG   S Y V V    G SV V+PK 
Sbjct  669   LAKNPGNLNYPAISALFPENTRVKSMTLRRTVINVGPHISSYKVFVSPFKGASVTVQPKT  728

Query  1600  LKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             L F    Q LSYTV+F   R ++       FG LVWKST   VRSP+ + W
Sbjct  729   LNFTSKHQKLSYTVTF---RTRMRMNRPE-FGGLVWKSTTHKVRSPVIITW  775



>ref|XP_008391410.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/593 (52%), Positives = 401/593 (68%), Gaps = 19/593 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKI-NETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             +K++GAR ++ GYE+ +G++ +E+ E KSPRD+EGHGTHTASTAAG  V +AS    ARG
Sbjct  181   RKIIGARAYFDGYEAYIGRLMDESNESKSPRDTEGHGTHTASTAAGSPVANASLFSYARG  240

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT-DNI  354
              A GM   ARIA YK C++ GC   D+LAA+DQA+ DGVDI+SLS+G     P Y  D+I
Sbjct  241   EARGMATKARIAVYKICWSFGCFDSDILAAMDQAIADGVDIISLSVGASGRSPAYDRDSI  300

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI +FGA Q GV V +SAGNSGP   + +N APWI+TV AS++DR FPA V LG+ RVF 
Sbjct  301   AIGSFGAAQHGVLVSASAGNSGPNPFTATNIAPWILTVGASTVDREFPADVILGDNRVFG  360

Query  535   GESLYSGKA-VNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG+  V+ +LPL+YG   G  G+ +C  G+L    V+G+IVVC+RG +AR  KGS
Sbjct  361   GVSLYSGEPLVDHQLPLIYG---GDAGSRYCYAGALKPSKVQGKIVVCDRGGNARVGKGS  417

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GG G IL N    GEE+ AD H +PAT +G  A   +++YI  S+  TA+I F+G
Sbjct  418   AVKLAGGLGFILANTADSGEELLADAHLIPATEVGEIAADQIREYIRLSQYPTATIVFRG  477

Query  892   TVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             TV G    AP +AAFSSRGP++++PEI+KPDV APGVNILA W     PT L+ D R  E
Sbjct  478   TVVGTSPAAPKVAAFSSRGPNSLTPEILKPDVIAPGVNILAGWTGASAPTDLDIDPRRTE  537

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSMSCPHVSG+AALL+  + +WS AAIKSAL+TT+YTLD     I D  +    
Sbjct  538   FNIISGTSMSCPHVSGIAALLRKAYPNWSIAAIKSALITTAYTLDDSGKKIRDLATGK--  595

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA---CPT  1416
              +TPF  G+GHVDP RA +PGLIYD++  DY  +LCS+ Y+  QI++ L K +    C  
Sbjct  596   ESTPFVHGAGHVDPNRALNPGLIYDLNVNDYVAFLCSIGYSPRQIAVFLGKPTGSDICTK  655

Query  1417  HHHHQPGDLNYPSFAVIFDssssnssHTFTRTATNV-GIPESVYAVHVMEPDGVSVIVKP  1593
             +    PGDLNYPS +VI  S  S     + R ATNV G  ++VY V+V  P GV + V P
Sbjct  656   NSLASPGDLNYPSLSVILSSDQSLV--KYKRVATNVGGNVDAVYKVNVTAPAGVEISVSP  713

Query  1594  KVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
               L+F++  Q+LSY V+F  +RG +   GG  +GS+ W   +  VRSP+AV W
Sbjct  714   SKLEFSEENQSLSYEVTF--RRG-VGYDGGERYGSIEWTDGSHLVRSPVAVRW  763



>ref|XP_010685295.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=808

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/596 (51%), Positives = 396/596 (66%), Gaps = 17/596 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FYKGYE+  G +NET E KSPRD+EGHGTHTASTAAG +V DA     ARG 
Sbjct  206   RKIVGARAFYKGYEAAKGPMNETKESKSPRDTEGHGTHTASTAAGSVVPDAGLFDYARGE  265

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKP-FYTDNIA  357
             A GM   ARIAAYK C++ GC   D+LAA+DQA++DGV ++SLS+G     P F  D IA
Sbjct  266   ARGMATKARIAAYKICWSTGCYDSDILAAMDQAIEDGVHVISLSVGSSGLAPQFDKDGIA  325

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I A  A Q GV V  SAGNSGP   + +N APWI+TV AS++DR FPA V LG+GR F+G
Sbjct  326   IGALHAVQSGVLVSCSAGNSGPDAFTATNIAPWILTVGASTIDREFPADVVLGDGRTFKG  385

Query  538   ESLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
              SLY G  +N  + L   R A   G+  C  G L +    G++V+C+RG++AR  KG  V
Sbjct  386   VSLYYGDGLNDSVYLELVRGADC-GSRLCKAGDLDTSKAAGKMVICDRGDTARVAKGDAV  444

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTV  897
             K++GG GMIL N    GEE+ AD H +PAT +G  AG  ++ Y+++  + TA+I+F+GTV
Sbjct  445   KQAGGVGMILANTAESGEELIADSHLIPATMVGQIAGDQIRDYVSAVPNPTATIRFKGTV  504

Query  898   YGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
              G    AP +AAFSSRGP+ ++PEI+KPDV APGVNILA W  +  PT LE D R V+FN
Sbjct  505   IGPSPSAPRVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGSAAPTDLEIDPRRVQFN  564

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSGLAALL++ +  WSPAA+KSALMTT+Y LD+    ITD  +     +
Sbjct  565   IISGTSMSCPHVSGLAALLRNAYPSWSPAAVKSALMTTAYYLDNSGKNITDLATGK--QS  622

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA--CPTHHH  1425
             +PF  GSGHVDP +A +PGL+YDI+  DY + LC++ YNST+I++ L++ +   C   + 
Sbjct  623   SPFVHGSGHVDPNKALNPGLVYDINANDYISLLCAMGYNSTRIAIFLKEPTTIDCAAKNL  682

Query  1426  HQPGDLNYPSFAVIFDssssnssHTFTRTATNVG-IPESVYAVHVMEPDGVSVIVKPKVL  1602
                G+LNYPSF+V+F+S  +     +TR   NVG   ++VY V V  P  V V V P+ L
Sbjct  683   STAGNLNYPSFSVVFESGKNVVK--YTRVVKNVGSSADAVYEVSVNAPLNVDVSVSPRKL  740

Query  1603  KFNKMGQNLSYTVSFVAQRGKIASG------GGHSFGSLVWKSTNFTVRSPIAVIW  1752
             +F+   Q LSY +SF +      +G      G  SFGS+ W   +  VRSPIAV W
Sbjct  741   EFSADKQTLSYEISFTSISETYLTGKVKPILGTSSFGSIEWSDGSHRVRSPIAVRW  796



>ref|XP_007204263.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
 gb|EMJ05462.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
Length=763

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/588 (51%), Positives = 392/588 (67%), Gaps = 12/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK--INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR+F KG+    G   + ++ E +SPRD +GHGTHT+STAAG  V +AS LG A 
Sbjct  179   KKLIGARSFSKGFHMASGGSFMRKSKEAESPRDRDGHGTHTSSTAAGSHVANASLLGYAT  238

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   AR+AAYK C++ GC   D+LA +D+A+ DGVD+LSLSLGG    P+Y D I
Sbjct  239   GTARGMAPHARVAAYKVCWSTGCFGSDILAGMDRAIVDGVDVLSLSLGGGA-SPYYRDTI  297

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AF A ++G+FV  SAGNSGP  +S++NTAPWIMTV A +LDR FPA   LGN + F 
Sbjct  298   AIGAFTAMERGIFVSCSAGNSGPSKASLANTAPWIMTVGAGTLDRDFPAYALLGNKKRFT  357

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  + N+ + LVY +      +  C   SL    V+G++VVC+RG +AR EKG 
Sbjct  358   GVSLYSGTGMGNKPVQLVYNK-GSNSSSNLCLPASLQPEHVRGKVVVCDRGINARVEKGG  416

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMIL N    GEE+ AD H LPA A+G   G  +++Y     + TA I F G
Sbjct  417   VVRAAGGIGMILANTAASGEELVADSHLLPAVAVGMRVGDLIREYAQHDSNPTALISFGG  476

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   R +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILA W  +IGPT L+ D R  +F
Sbjct  477   TVLNVRPSPVVAAFSSRGPNLVTPQILKPDVIGPGVNILAGWSESIGPTGLQEDTRKSQF  536

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SGLAALLK+ H DWSP+AIKSALMTT+YT D+ KSP+ D+   +   
Sbjct  537   NIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTQDNTKSPLRDAADGS--F  594

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             + P+A GSGHV+P++A  PGL+YDIST DY  +LCSL+Y    +  +++K +   +  + 
Sbjct  595   SNPWAHGSGHVEPQKALSPGLVYDISTDDYVAFLCSLDYTLEHVQAIVKKPNVTCSRKYS  654

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG LNYPSF+V+F +        ++R  TNVG   S+Y V V  P  V + VKP  L F
Sbjct  655   DPGQLNYPSFSVVFGNKRVVR---YSRELTNVGAAGSIYRVAVTGPQMVRIAVKPTRLVF  711

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
               +G+   YTV+FVA +G   +     FGS+VW +    V+SPIA  W
Sbjct  712   KNVGEKQKYTVTFVANKGADKTARSE-FGSIVWANPQHQVKSPIAFAW  758



>ref|XP_010519206.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010519207.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=775

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/590 (51%), Positives = 404/590 (68%), Gaps = 13/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FYKGYE+  GKI+E +EYKSPRD +GHGTHTA+T AG  V+ A+ LG A G+
Sbjct  189   RKIVGARVFYKGYEAATGKIDEQLEYKSPRDRDGHGTHTAATVAGSPVRGANLLGYAYGT  248

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C+  GC S D+L+AVD+AV DGV +LS+SLGG +   +Y D+++I
Sbjct  249   ARGMAPRARIAAYKVCWVGGCFSSDILSAVDRAVADGVHVLSISLGGGI-STYYRDSLSI  307

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FPA V LG+GR  RG 
Sbjct  308   AAFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVNLGSGRTVRGV  367

Query  541   SLYSGKAV---NQKLPLVY-GRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G  V   N++ PLVY G  A     + FC  G+L  R V G+IV+C+RG + R +K
Sbjct  368   SLYKGTTVLSKNRQYPLVYMGSNASSPDPSSFCLDGALDRRHVAGKIVICDRGVTPRVQK  427

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  V+ +GG GMIL N  T GEE+ AD H LPA A+G   G  +K+Y  +S+  TA+++ 
Sbjct  428   GQVVREAGGIGMILTNTATNGEELVADCHLLPAVAVGEKEGKMIKQYAMTSRRPTANLQI  487

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G + +PV+AAFSSRGP+ ++ EI+KPD+ APGVNILAAW  ++GP+ L +D+R V
Sbjct  488   LGTRLGIKPSPVVAAFSSRGPNFLTLEILKPDLVAPGVNILAAWTGDMGPSSLSSDHRRV  547

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AAL+K+ H DWSPAAIKSAL+TT+Y  D+  +P+ D+ +  P
Sbjct  548   KFNILSGTSMSCPHVSGVAALIKARHPDWSPAAIKSALLTTAYVHDNNLNPLRDASTGAP  607

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               +TP+  G+GH++P +A  PGL+YDI  QDYF +LC+ + + +Q+ +  R  +    + 
Sbjct  608   --STPYDHGAGHINPLKALDPGLVYDIGPQDYFEFLCTQDLSPSQLKVFSRHSNRICRNT  665

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
                PGDLNY + + +F  +++ S+ T  RT TNVG   S Y V V    G SVIV+PK+L
Sbjct  666   LSGPGDLNYAAISAVFTENTNVSALTLHRTVTNVGPHVSSYKVVVSPFKGASVIVEPKML  725

Query  1603  KFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              F    Q LSY ++F   R K+       FG LVW+S+   VRSPI V W
Sbjct  726   NFTSKHQKLSYRITF---RTKLRQKRPE-FGGLVWRSSTHKVRSPIVVTW  771



>ref|XP_006465816.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=778

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/598 (51%), Positives = 402/598 (67%), Gaps = 17/598 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F +GYES  GK+NET E++SPRDS+GHGTHTAS AAG  V  AS LG A G 
Sbjct  182   RKLIGARFFSQGYESTNGKMNETTEFRSPRDSDGHGTHTASIAAGRYVSPASTLGYASGV  241

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A YK C+  GC   D+LAA D AV DGVD++SLS+GG++  P++ D IAI
Sbjct  242   AAGMAPKARLAVYKVCWNAGCYDSDILAAFDSAVSDGVDVVSLSVGGVV-VPYFLDAIAI  300

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA+  GVFV +SAGN GP   +V+N APW+ TV A ++DR FPA V LGNG++  G 
Sbjct  301   AAFGASDHGVFVSASAGNGGPGGLTVTNVAPWVTTVGAGTIDRDFPADVHLGNGKIIPGV  360

Query  541   SLYSGKAV--NQKLPLVYGRTAGGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
             S+YSG  +  +Q   LVY  +  G G  A  C  GSL    V+G+IVVC+RG ++R  KG
Sbjct  361   SVYSGPGLKKDQMYSLVYAGSESGDGYSASLCLEGSLDPAFVRGKIVVCDRGINSRPAKG  420

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKS----ATAS  876
               VK++GG GMIL N   +GE + AD H LPAT++G ++G  ++KYI S++     ATA+
Sbjct  421   EVVKKAGGVGMILANGVFDGEGLVADCHVLPATSVGAASGDEIRKYIMSAEKSKSPATAT  480

Query  877   IKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADN  1053
             I F+GT    R APV+A+FS+RGP+  +PEI+KPDV APG+NILAAWP  +GP+ +  D 
Sbjct  481   IVFKGTRVNVRPAPVVASFSARGPNPETPEILKPDVIAPGLNILAAWPDKVGPSGIPTDK  540

Query  1054  RSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVS  1233
             R  EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+YT+D+R   + D  +
Sbjct  541   RKTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNRGETMIDEST  600

Query  1234  TNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSAC-  1410
              N  ++T   FG+GHV P++A +PGLIYD+++ DY N+LC+ NY    I ++ R+K+ C 
Sbjct  601   GN--TSTALDFGAGHVHPQKAMNPGLIYDLTSYDYVNFLCNSNYTVNNIQVITRRKADCS  658

Query  1411  -PTHHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVSVI  1584
               T   H  G+LNYPS + +F     +   T F RT TNVG P S Y V +  P G++V 
Sbjct  659   GATRAGHV-GNLNYPSLSAVFQQYGKHKMSTHFIRTVTNVGDPNSAYKVTIRPPSGMTVT  717

Query  1585  VKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             V+P+ L F ++GQ L++ V   A   K++ G      G +VW      V SPI V  Q
Sbjct  718   VQPEKLVFRRVGQKLNFLVRVEATAVKLSPGSSSMKSGKIVWSDGKHNVTSPIVVTMQ  775



>ref|XP_006426785.1| hypothetical protein CICLE_v10024934mg [Citrus clementina]
 gb|ESR40025.1| hypothetical protein CICLE_v10024934mg [Citrus clementina]
Length=778

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/598 (51%), Positives = 402/598 (67%), Gaps = 17/598 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F +GYES  GK+NET E++SPRDS+GHGTHTAS AAG  V  AS LG A G 
Sbjct  182   RKLIGARFFSQGYESTNGKMNETTEFRSPRDSDGHGTHTASIAAGRYVSPASTLGYASGV  241

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A YK C+  GC   D+LAA D AV DGVD++SLS+GG++  P++ D IAI
Sbjct  242   AAGMAPKARLAVYKVCWNAGCYDSDILAAFDSAVSDGVDVVSLSVGGVV-VPYFLDAIAI  300

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA+  GVFV +SAGN GP   +V+N APW+ TV A ++DR FPA V LGNG++  G 
Sbjct  301   AAFGASDHGVFVSASAGNGGPGGLTVTNVAPWVTTVGAGTIDRDFPADVHLGNGKIIPGV  360

Query  541   SLYSGKAV--NQKLPLVYGRTAGGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
             S+YSG  +  +Q   LVY  +  G G  A  C  GSL    V+G+IVVC+RG ++R  KG
Sbjct  361   SVYSGPGLKKDQMYSLVYAGSESGDGYSASLCLEGSLDPAFVRGKIVVCDRGINSRPAKG  420

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKS----ATAS  876
               VK++GG GMIL N   +GE + AD H LPAT++G ++G  ++KYI S++     ATA+
Sbjct  421   EVVKKAGGVGMILANGVFDGEGLVADCHVLPATSVGAASGDEIRKYIMSAEKSKSPATAT  480

Query  877   IKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADN  1053
             I F+GT    R APV+A+FS+RGP+  +PEI+KPDV APG+NILAAWP  +GP+ +  D 
Sbjct  481   IVFKGTRVNVRPAPVVASFSARGPNPETPEILKPDVIAPGLNILAAWPDKVGPSGIPTDK  540

Query  1054  RSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVS  1233
             R  EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+YT+D+R   + D  +
Sbjct  541   RKTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNRGETMIDEST  600

Query  1234  TNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSAC-  1410
              N  ++T   FG+GHV P++A +PGLIYD+++ DY N+LC+ NY    I ++ R+K+ C 
Sbjct  601   GN--TSTALDFGAGHVHPQKAMNPGLIYDLTSYDYVNFLCNSNYTVNNIQVITRRKADCS  658

Query  1411  -PTHHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVSVI  1584
               T   H  G+LNYPS + +F     +   T F RT TNVG P S Y V +  P G++V 
Sbjct  659   GATRAGHV-GNLNYPSLSAVFQQYGKHKMSTHFIRTVTNVGDPNSAYKVTIRPPSGMTVT  717

Query  1585  VKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             V+P+ L F ++GQ L++ V   A   K++ G      G +VW      V SPI V  Q
Sbjct  718   VQPEKLVFRRVGQKLNFLVRVEATAVKLSPGSSSMKSGKIVWSDGKHNVTSPIVVTMQ  775



>gb|ABR17987.1| unknown [Picea sitchensis]
Length=772

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/595 (51%), Positives = 401/595 (67%), Gaps = 21/595 (4%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGSA  183
             KL+GAR F KGYE++ G+I++  +Y+SPRD++GHGTHT+STAAG  V  AS  G ARG+A
Sbjct  186   KLIGARYFVKGYEAMYGRIDKKEDYRSPRDADGHGTHTSSTAAGSEVPGASLFGFARGTA  245

Query  184   GGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAIA  363
              G+   AR+A YK C+ + C + DVLA ++ AV DGVD+LSLSLG +   P+Y D IAI 
Sbjct  246   RGIATKARLAVYKVCWAVTCVNSDVLAGMEAAVADGVDLLSLSLGIVDDVPYYHDTIAIG  305

Query  364   AFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGES  543
             A GA +KGVFV  SAGN+GP   ++ NTAPWI TV AS++DR FPA V LGNG+ + G S
Sbjct  306   ALGAIEKGVFVSCSAGNAGPY--AIFNTAPWITTVGASTIDREFPAPVVLGNGKSYMGSS  363

Query  544   LYSGKAV-NQKLPLVYGRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             L   K +  ++LPLVYG+TA  K  A FC  GSL   +V+G+IV+C+     R EKG  V
Sbjct  364   LDKDKTLAKEQLPLVYGKTASSKQYANFCIDGSLDPDMVRGKIVLCDLEEGGRIEKGLVV  423

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG-T  894
             +R+GGAGMIL ++  E +      + LPAT +   AG  +K Y+N++++  A+IK +G T
Sbjct  424   RRAGGAGMILASQFKEEDYSATYSNLLPATMVDLKAGEYIKAYMNTTRNPLATIKTEGLT  483

Query  895   VYGN-RAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V G  RAPV+ AFSSRGP+ V+PEI+KPD+ APGVNILAAW  +  PT L +D R V+FN
Sbjct  484   VIGKARAPVVIAFSSRGPNRVAPEILKPDLVAPGVNILAAWTGHTSPTGLISDKRRVDFN  543

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHV+G+AAL++S H  W+PAAIKSALMT+S   D+RKSPI+DS++  P  A
Sbjct  544   IISGTSMSCPHVAGIAALIRSAHPAWTPAAIKSALMTSSALFDNRKSPISDSITALPADA  603

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
                A G+GHV+P  A  PGL+YD+   DY ++LCSLNY +  I +L +  ++CP     +
Sbjct  604   --LAMGAGHVNPNAALDPGLVYDLGIDDYVSFLCSLNYTAKHIQILTKNATSCP-KLRSR  660

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PGDLNYPSF+V+F     +      RT TNVG   SVY + V  P+ V+VIV+P+ L F 
Sbjct  661   PGDLNYPSFSVVF--KPRSLVRVTRRTVTNVGGAPSVYEMAVESPENVNVIVEPRTLAFT  718

Query  1612  KMGQNLSYTVSFVAQRGKIASGGG----HSFGSLVWKSTN---FTVRSPIAVIWQ  1755
             K  +  +YTV F     KIAS         FG ++WK        VRSP+A+ W+
Sbjct  719   KQNEKATYTVRF---ESKIASDNKSKRHRGFGQILWKCVKGGTQVVRSPVAIAWK  770



>gb|AES92191.2| subtilisin-like serine protease [Medicago truncatula]
Length=756

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/588 (50%), Positives = 399/588 (68%), Gaps = 9/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGY--ESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR+F KGY   S  G   ++V+  SPRD +GHGTHTA+TAAG  V +A+ LG A 
Sbjct  171   KKLIGARSFSKGYLMASPGGGRKKSVDPISPRDRDGHGTHTATTAAGSAVANATLLGYAT  230

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   ARIA YK C+T GC + D+LA +DQA++DGVD+LSLSLGG    P+Y D I
Sbjct  231   GTARGMAPQARIAVYKVCWTDGCFASDILAGIDQAIQDGVDVLSLSLGGSSSTPYYFDTI  290

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AF A ++G+FV  SAGN+GP + S+SN APWIMTV A +LDR FPA   LGNG+ F 
Sbjct  291   AIGAFAAVERGIFVSCSAGNTGPRSGSLSNVAPWIMTVGAGTLDRDFPAYATLGNGKRFS  350

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG+ + N+ + LVY        +  C  GSL S +V+G++VVC+RG ++R EKG+
Sbjct  351   GVSLYSGEGMGNEPVGLVYFNERFNSSSSICMPGSLDSEIVRGKVVVCDRGVNSRVEKGT  410

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V  +GG GMIL N    GE V AD + +PA ++G + G  +KKY     + TA + F G
Sbjct  411   VVIDAGGVGMILANTAASGEGVVADSYLVPAVSVGKNEGDEIKKYAALDSNPTAILNFGG  470

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   + +PV+A+FSSRGP+ V+P+I+KPDV  PGVNILA W   +GP+  + D R  +F
Sbjct  471   TVLNVKPSPVVASFSSRGPNGVTPQILKPDVIGPGVNILAGWTGAVGPSGSQ-DTRKAQF  529

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SG+AALLK+ H +WSP+AIKSALMTT+YTLD+ +SP+ D++      
Sbjct  530   NIMSGTSMSCPHISGVAALLKAAHPEWSPSAIKSALMTTAYTLDNTESPLRDAMGE--AL  587

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             +TP+A+GSGHV+P++A  PGL+YD   +DY  +LCSLNY+   + L++++ +   + +  
Sbjct  588   STPWAYGSGHVNPQKALSPGLVYDADIEDYIAFLCSLNYSLDHVKLIVKRPNVNCSTYLS  647

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PGDLNYPSF+V+F ++S      + RT TNVG  ESVY V V  P  V +IV P  L F
Sbjct  648   GPGDLNYPSFSVVFGNNSGVVQ--YKRTLTNVGEAESVYDVAVSGPSTVGIIVNPTKLVF  705

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              ++G+  +Y V F++ +  +       FGS+ W +    VRSPIA  W
Sbjct  706   EQVGERQTYMVKFISNKDIVDDSVTSEFGSITWSNKQHQVRSPIAFTW  753



>ref|XP_003609994.1| Subtilisin-like protease [Medicago truncatula]
Length=756

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/588 (50%), Positives = 399/588 (68%), Gaps = 9/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGY--ESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR+F KGY   S  G   ++V+  SPRD +GHGTHTA+TAAG  V +A+ LG A 
Sbjct  171   KKLIGARSFSKGYLMASPGGGRKKSVDPISPRDRDGHGTHTATTAAGSAVANATLLGYAT  230

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   ARIA YK C+T GC + D+LA +DQA++DGVD+LSLSLGG    P+Y D I
Sbjct  231   GTARGMAPQARIAVYKVCWTDGCFASDILAGIDQAIQDGVDVLSLSLGGSSSTPYYFDTI  290

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AF A ++G+FV  SAGN+GP + S+SN APWIMTV A +LDR FPA   LGNG+ F 
Sbjct  291   AIGAFAAVERGIFVSCSAGNTGPRSGSLSNVAPWIMTVGAGTLDRDFPAYATLGNGKRFS  350

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG+ + N+ + LVY        +  C  GSL S +V+G++VVC+RG ++R EKG+
Sbjct  351   GVSLYSGEGMGNEPVGLVYFNERFNSSSSICMPGSLDSEIVRGKVVVCDRGVNSRVEKGT  410

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V  +GG GMIL N    GE V AD + +PA ++G + G  +KKY     + TA + F G
Sbjct  411   VVIDAGGVGMILANTAASGEGVVADSYLVPAVSVGKNEGDEIKKYAALDSNPTAILNFGG  470

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   + +PV+A+FSSRGP+ V+P+I+KPDV  PGVNILA W   +GP+  + D R  +F
Sbjct  471   TVLNVKPSPVVASFSSRGPNGVTPQILKPDVIGPGVNILAGWTGAVGPSGSQ-DTRKAQF  529

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SG+AALLK+ H +WSP+AIKSALMTT+YTLD+ +SP+ D++      
Sbjct  530   NIMSGTSMSCPHISGVAALLKAAHPEWSPSAIKSALMTTAYTLDNTESPLRDAMGE--AL  587

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             +TP+A+GSGHV+P++A  PGL+YD   +DY  +LCSLNY+   + L++++ +   + +  
Sbjct  588   STPWAYGSGHVNPQKALSPGLVYDADIEDYIAFLCSLNYSLDHVKLIVKRPNVNCSTYLS  647

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PGDLNYPSF+V+F ++S      + RT TNVG  ESVY V V  P  V +IV P  L F
Sbjct  648   GPGDLNYPSFSVVFGNNSGVVQ--YKRTLTNVGEAESVYDVAVSGPSTVGIIVNPTKLVF  705

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              ++G+  +Y V F++ +  +       FGS+ W +    VRSPIA  W
Sbjct  706   EQVGERQTYMVKFISNKDIVDDSVTSEFGSITWSNKQHQVRSPIAFTW  753



>ref|NP_569048.1| subtilisin-like protease [Arabidopsis thaliana]
 sp|O65351.1|SUBL_ARATH RecName: Full=Subtilisin-like protease; AltName: Full=Cucumisin-like 
serine protease; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK25995.1|AF360285_1 putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AAC18851.1| cucumisin-like serine protease [Arabidopsis thaliana]
 dbj|BAB09021.1| cucumisin-like serine protease [Arabidopsis thaliana]
 gb|AAN13181.1| putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AED98332.1| subtilisin-like protease [Arabidopsis thaliana]
 dbj|BAP16469.1| cucumisin-like serine protease [Cloning vector pTACAtg1]
Length=757

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/588 (51%), Positives = 395/588 (67%), Gaps = 13/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F +GYES +G I+E+ E +SPRD +GHGTHT+STAAG +V+ AS LG A G+
Sbjct  178   RKLIGARFFARGYESTMGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGT  237

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A YK C+  GC S D+LAA+D+A+ D V++LS+SLGG +   +Y D +AI
Sbjct  238   ARGMAPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLGGGMSD-YYRDGVAI  296

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A ++G+ V  SAGN+GP +SS+SN APWI TV A +LDR FPA+  LGNG+ F G 
Sbjct  297   GAFAAMERGILVSCSAGNAGPSSSSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFTGV  356

Query  541   SLYSGKAVNQKL-PLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SL+ G+A+  KL P +Y G  +       C  G+L    VKG+IV+C+RG +AR +KG  
Sbjct  357   SLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGINARVQKGDV  416

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GG GMIL N    GEE+ AD H LPAT +G  AG  ++ Y+ +  + TASI   GT
Sbjct  417   VKAAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVTTDPNPTASISILGT  476

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V G + +PV+AAFSSRGP++++P I+KPD+ APGVNILAAW    GPT L +D+R VEFN
Sbjct  477   VVGVKPSPVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRVEFN  536

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSGLAALLKSVH +WSPAAI+SALMTT+Y       P+ D  +  P  +
Sbjct  537   IISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYKTYKDGKPLLDIATGKP--S  594

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TPF  G+GHV P  A +PGLIYD++T+DY  +LC+LNY S QI  + R+   C     + 
Sbjct  595   TPFDHGAGHVSPTTATNPGLIYDLTTEDYLGFLCALNYTSPQIRSVSRRNYTCDPSKSYS  654

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVM-EPDGVSVIVKPKVLKF  1608
               DLNYPSFAV  D      ++ +TRT T+VG     Y+V V  E  GV + V+P VL F
Sbjct  655   VADLNYPSFAVNVD---GVGAYKYTRTVTSVG-GAGTYSVKVTSETTGVKISVEPAVLNF  710

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              +  +  SYTV+F     K +  G +SFGS+ W      V SP+A+ W
Sbjct  711   KEANEKKSYTVTFTVDSSKPS--GSNSFGSIEWSDGKHVVGSPVAISW  756



>ref|XP_007217030.1| hypothetical protein PRUPE_ppa001661mg [Prunus persica]
 gb|EMJ18229.1| hypothetical protein PRUPE_ppa001661mg [Prunus persica]
Length=784

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/596 (52%), Positives = 405/596 (68%), Gaps = 16/596 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F  G+ES  GK+NET EY+SPRDS+GHGTHTAS AAG  V  AS LG A+G 
Sbjct  191   RKLIGARFFSAGFESTNGKMNETSEYRSPRDSDGHGTHTASIAAGRYVFPASTLGYAKGV  250

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C++ GC   D+LAA D AV DG D++SLS+GG++  P++ D IAI
Sbjct  251   AAGMAPKARLAAYKVCWSAGCYDSDILAAFDAAVADGCDVVSLSVGGVV-VPYHLDAIAI  309

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              A+GA+  GVFV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNGR+  G 
Sbjct  310   GAYGASDSGVFVSASAGNGGPGGLTVTNVAPWVTTVGAGTIDRDFPADVKLGNGRIIPGM  369

Query  541   SLYSGK--AVNQKLPLVYGRTAGGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
             S+YSG   A  +  PLVY    GG G  +  C  GSLS   VKG+IVVC+RG ++RA KG
Sbjct  370   SIYSGPGLAPGRMYPLVYAGGVGGDGYSSSLCLEGSLSQ--VKGKIVVCDRGINSRAAKG  427

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKS---ATASI  879
               VK++GG GMIL N   +GE + AD H LPATA+  S G  +++YI +SKS   ATA+I
Sbjct  428   DVVKKAGGVGMILANGVFDGEGLVADCHVLPATAVAASTGDEIRRYIAASKSKSPATATI  487

Query  880   KFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNR  1056
              F+GT    R APV+A+FS+RGP+  SPEI+KPDV APG+NILAAWP  +GP+ + +D R
Sbjct  488   VFKGTRIRVRPAPVVASFSARGPNPESPEILKPDVIAPGLNILAAWPDKVGPSGVASDKR  547

Query  1057  SVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVST  1236
             + EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+YT+D+R   + D  S 
Sbjct  548   NTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNRGETMLDESSG  607

Query  1237  NPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACP-  1413
             N  +++   FG+GHV P++A  PGL+YDI + DY ++LC+ NY +  I ++ RK + C  
Sbjct  608   N--TSSVMDFGAGHVHPQKAMDPGLVYDIVSYDYVDFLCNSNYTTKNIQVVTRKFANCNG  665

Query  1414  THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVSVIVK  1590
                    G+LNYPS +V+F     +   T F RT TNVG P SVY V V    G++V V+
Sbjct  666   AKRAGHAGNLNYPSLSVVFQQYGKHKMSTHFIRTVTNVGTPNSVYQVTVKPAAGMTVTVE  725

Query  1591  PKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             P+ L F ++GQ LS+ V   A   K++ G      GS+VW     TV SP+ V  Q
Sbjct  726   PEKLAFRRVGQKLSFLVRVQALAVKLSPGSTSVKSGSIVWSDGKHTVTSPLVVTMQ  781



>ref|XP_006401917.1| hypothetical protein EUTSA_v10012740mg [Eutrema salsugineum]
 gb|ESQ43370.1| hypothetical protein EUTSA_v10012740mg [Eutrema salsugineum]
Length=779

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/592 (51%), Positives = 399/592 (67%), Gaps = 15/592 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FYKGYE+  GKI+E VEY+SPRD +GHGTHTA+T AG  V+ A+  G A G+
Sbjct  191   RKIVGARVFYKGYEAATGKIDEEVEYRSPRDKDGHGTHTAATVAGSPVRGANLFGFAYGT  250

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC S D+L+AVDQAV DGV +LS+SLGG +   +  D++AI
Sbjct  251   ARGMAPRARVAAYKVCWVGGCFSSDILSAVDQAVADGVQVLSISLGGGI-STYSRDSLAI  309

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FPA ++LG  R+F+G 
Sbjct  310   ATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATMKLGTKRIFKGV  369

Query  541   SLYSGKAV---NQKLPLVY-GRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+     N++ PLVY GR A       FC  GSL    V G+IV+C+RG + R +K
Sbjct  370   SLYKGRTALSRNKQYPLVYLGRNASSPDPTSFCLDGSLDRHNVAGKIVICDRGVTPRVQK  429

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VKR+GG GM+L N  T GEE+ AD H LPA A+G   G  +K+Y  +SK ATA+++ 
Sbjct  430   GQVVKRAGGIGMVLTNTATNGEELVADSHLLPAVAVGEKEGKLIKQYAMTSKKATATLEI  489

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G + +PV+AAFSSRGP+ +S EI+KPD+ APGVNILAAW  ++ P+ L +D R V
Sbjct  490   LGTRIGIKPSPVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWSGDMAPSSLSSDPRRV  549

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AAL++S H DWSPAAIKSALMTT+Y  D+   P+TD+    P
Sbjct  550   KFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAIKSALMTTAYVHDNTFKPLTDASGAAP  609

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               ++P+  G+GH++P +A  PGLIYDI  QDYF++LC+   + +Q+ +  +  +    H 
Sbjct  610   --SSPYDHGAGHINPLKAIDPGLIYDIGPQDYFDFLCTQELSPSQLKVFTKHSNRSCKHS  667

Query  1423  H--HQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPK  1596
                + PG+LNYP+ + +F  ++   S T  RT TNVG   + Y V V    G SV V+PK
Sbjct  668   LAGNNPGNLNYPAISALFPENTHVKSMTLRRTVTNVGPHIASYKVSVSPFKGASVTVQPK  727

Query  1597  VLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              L F +  Q LSYTV+F   R K+       FG L+WKS    VRSP+ + W
Sbjct  728   TLNFTRKHQKLSYTVTF---RTKLRLKRPE-FGGLLWKSATHRVRSPVIITW  775



>ref|XP_002865008.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41267.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
Length=753

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/588 (51%), Positives = 394/588 (67%), Gaps = 13/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F +GYES +G I+E+ E +SPRD +GHGTHT+STAAG +V+ AS LG A G+
Sbjct  174   RKLIGARFFARGYESTMGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGT  233

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A YK C+  GC S D+LAA+D+A+ D V++LS+SLGG +   +Y D +AI
Sbjct  234   ARGMAPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLGGGMSD-YYRDGVAI  292

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A ++G+ V  SAGN+GP + S+SN APWI TV A +LDR FPA+  LGNG+ F G 
Sbjct  293   GAFAAMERGILVSCSAGNAGPSSYSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFTGV  352

Query  541   SLYSGKAVNQKL-PLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SL+ G+A+  KL P +Y G  +       C  G+L    VKG+IV+C+RG +AR +KG  
Sbjct  353   SLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGVNARVQKGDV  412

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GG GMIL N    GEE+ AD H LPAT +G  AG  ++ Y+ +  + TASI   GT
Sbjct  413   VKAAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVTTDPNPTASISILGT  472

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V G + +PV+AAFSSRGP++++P I+KPD+ APGVNILAAW    GPT L +D+R VEFN
Sbjct  473   VVGVKPSPVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTTAAGPTGLASDSRRVEFN  532

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSGLAALLKSVH +WSPAAI+SALMTT+Y       P+ D  +  P  +
Sbjct  533   IISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYKTYKDGKPLLDIATGKP--S  590

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TPF  G+GHV P  A +PGLIYD+ST+DY  +LC+LNY S+QI  + R+   C     + 
Sbjct  591   TPFDHGAGHVSPTTATNPGLIYDLSTEDYLGFLCALNYTSSQIRSVSRRNYTCDPSKSYS  650

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVM-EPDGVSVIVKPKVLKF  1608
               DLNYPSFAV  D      ++ +TRT T+VG     Y+V V  E  G  + V+P VL F
Sbjct  651   VADLNYPSFAVNVD---GAGAYKYTRTVTSVG-GAGTYSVKVTSETRGAKISVEPAVLNF  706

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              +  +  SYTV+F     K  + G +SFGS+ W      V SP+A+ W
Sbjct  707   KEANEKKSYTVTFTVDSSK--ASGSNSFGSIEWSDGKHVVGSPVAISW  752



>ref|XP_010042589.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=781

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/588 (50%), Positives = 395/588 (67%), Gaps = 12/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK--INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR F KG+    G   +    E +SPRD +GHGTHTASTAAG  V +AS LG A 
Sbjct  197   KKLIGARFFSKGFRMASGSSFLKNPQEVESPRDRDGHGTHTASTAAGSPVANASLLGYAS  256

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   AR+AAYK C++ GC   D+LA +D+A+ DGVD+LSLSLGG +  P+Y D I
Sbjct  257   GTARGMAEHARVAAYKVCWSSGCFGADILAGMDRAILDGVDVLSLSLGGGI-APYYRDTI  315

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AF A ++G+FV  SAGNSGP+  S++N APWIMTV A +LDR FPA   LGNG+ + 
Sbjct  316   AIGAFTAMERGIFVSCSAGNSGPVKESLANVAPWIMTVGAGTLDRDFPAYALLGNGKRYA  375

Query  535   GESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  +    +P++Y + +   G + C  GSL+  L +G++V+C+RG +AR EKG 
Sbjct  376   GVSLYSGPGMGHNPVPVIYSKDSNISG-QLCLPGSLNPALTRGKVVLCDRGVNARVEKGQ  434

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMIL N    GEE+ AD H +PA A+G   G  +++Y  S +S TA + F+G
Sbjct  435   VVRDAGGVGMILANTAANGEELVADSHLIPAVAVGRKMGDVIREYAKSDRSPTAVLSFRG  494

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   R +PV+AAFSSRGP+ V+ +I+KPDV  PGVNILA W    GPT LE+D R   F
Sbjct  495   TVVNVRPSPVVAAFSSRGPNTVTQQILKPDVIGPGVNILAGWSEAAGPTGLESDTRKTLF  554

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NILSGTSMSCPH+SG+AALLKS H +WSP+AIKSALMTT+Y LD+ +SP+ D+       
Sbjct  555   NILSGTSMSCPHISGVAALLKSAHPNWSPSAIKSALMTTAYDLDNTRSPLRDAAGGT--V  612

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             +TP+A GSGHVDP++A  PGL+YD++ +DY  +LCSL+Y    +  ++++ +   +    
Sbjct  613   STPWAHGSGHVDPQKALSPGLVYDLTAEDYIAFLCSLDYTIDHVKTIVKRPNVTCSRKFS  672

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG+LNYPSF+V+F+         +TR  TNVG   S+Y V V  P  V V VKP  L F
Sbjct  673   DPGELNYPSFSVVFNDKKVVR---YTRELTNVGAAGSMYNVSVTGPSTVGVTVKPMKLIF  729

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              K+G  + YTV+FV+++G   +     FGS+VW +    VRSP+A  W
Sbjct  730   PKVGDKMRYTVTFVSKKGTNPTTRSE-FGSIVWSNAQNKVRSPVAYAW  776



>ref|XP_009380035.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380036.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380037.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=767

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/601 (51%), Positives = 395/601 (66%), Gaps = 31/601 (5%)
 Frame = +1

Query  1     KKLVGARTFYKGYE---------SIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDA  153
             +KLVGAR+F +G+          ++ GK NE   Y SPRD +GHGTHTASTAAG  V +A
Sbjct  181   RKLVGARSFSRGFRAAAAVAGDGTVRGKPNE---YDSPRDRDGHGTHTASTAAGSAVANA  237

Query  154   SFLGLARGSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPK  333
             S LG A G+A GM   AR+AAYK C+  GC   D+LA +D A+ DG DILSLSLGG    
Sbjct  238   SLLGYATGTARGMAIAARVAAYKVCWASGCFGSDILAGIDTAISDGADILSLSLGGGS-T  296

Query  334   PFYTDNIAIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVEL  513
             P++ D IAI AF A ++G+FV  SAGNSGP  ++++N APWI TV A +LDR FPA   L
Sbjct  297   PYFRDTIAIGAFAAAERGIFVSCSAGNSGPGPATLANGAPWIATVGAGTLDRDFPATARL  356

Query  514   GNGRVFRGESLYSGKAVNQKL-PLVYGRTAGGK--GAEFCSHGSLSSRLVKGRIVVCERG  684
             GNG  + G SLYSGK + +KL P VYG   GG+   ++ C  G+L    V+G++V+C+RG
Sbjct  357   GNGARYTGVSLYSGKGMGKKLVPAVYG---GGRSNASKLCLAGTLDPARVRGKLVLCDRG  413

Query  685   NSARAEKGSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKS  864
              SAR EKG+ VK +GGAGMIL N    GEE+ AD H LPA A+G   G  +++Y+ ++  
Sbjct  414   VSARVEKGAVVKAAGGAGMILANTAANGEELVADSHLLPAVAVGKKEGDLIRQYVTTNPR  473

Query  865   ATASIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTML  1041
                ++ F GTV G R +PV+AAFSSRGP+ VSP+I+KPD   PGVNILA W  +IGPT L
Sbjct  474   PRGALSFGGTVLGVRPSPVVAAFSSRGPNPVSPQILKPDFIGPGVNILAGWSGSIGPTGL  533

Query  1042  EADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPIT  1221
               D R  +FNI+SGTSMSCPH+SG+AALLK  H +WSPAAIKSALMTTSY LD+  SP+ 
Sbjct  534   LKDGRRTQFNIMSGTSMSCPHISGVAALLKGAHPNWSPAAIKSALMTTSYVLDNTNSPLR  593

Query  1222  DSVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKK  1401
             D+   +   ATPFA+G+GHVDP+RA  PGL+YDI+  DY  +LCSLNY    I  + ++ 
Sbjct  594   DAAGGS--YATPFAYGAGHVDPQRALSPGLVYDITADDYIAFLCSLNYTIPHIQAITKRP  651

Query  1402  --SACPTHHHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGV  1575
               + C +     PG+LNYPSF+V+F          + R  TNVG   S Y   V  P GV
Sbjct  652   NVTTC-SRRFSDPGNLNYPSFSVVFGKKWRVV--KYRRELTNVGSASSTYEAKVSGPGGV  708

Query  1576  SVIVKPKVLKFNKMGQNLSYTVSFVA-QRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             +V VKP  L F  + Q L Y+V+F + +RG+ A   G +FG + W +    VRSP+A  W
Sbjct  709   AVTVKPAKLMFKHVNQKLKYSVTFASKERGRSA---GTAFGWITWSNKQHKVRSPVAYTW  765

Query  1753  Q  1755
             +
Sbjct  766   K  766



>ref|XP_009107228.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=775

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/592 (51%), Positives = 398/592 (67%), Gaps = 15/592 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FY+GYE+  GKI++ +EY+SPRD +GHGTHTA+T AG  V+ A+ LG A G+
Sbjct  187   RKIVGARVFYRGYEAATGKIDQELEYRSPRDKDGHGTHTAATVAGSPVRGANLLGFAYGT  246

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC S D+L+AVDQAV DGV +LS+SLGG +   +  D++AI
Sbjct  247   ARGMAPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVHVLSISLGGGI-STYSRDSLAI  305

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FPA V LG  RVF+G 
Sbjct  306   ATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVRLGTRRVFKGV  365

Query  541   SLYSGKAV---NQKLPLVY-GRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+ V    ++ PLVY GR A       FC  G+L    V G+IV+C+RG + R +K
Sbjct  366   SLYKGRTVLSRGKQYPLVYLGRNASSPDPTSFCLDGALDQHNVAGKIVICDRGVTPRVQK  425

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VKR+GG GMIL N  T GEE+ AD H LPA A+G   G  +K+Y  +SK ATAS++ 
Sbjct  426   GQVVKRAGGVGMILTNTATNGEELVADCHLLPAVAVGEKEGKVIKEYAMTSKRATASLEI  485

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G + +PV+AAFSSRGP+ +S EI+KPD+ APGVNILAAW  ++ P+ L +D R V
Sbjct  486   LGTRVGIKPSPVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWSGDMAPSSLSSDKRRV  545

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AAL++S H DWSPAA+KSALMTT+Y  D+   P+TD+    P
Sbjct  546   KFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAVKSALMTTAYVHDNMLEPLTDAAGAEP  605

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               ++P+  G+GH+DP +A  PGL+YDI  Q+YF++LC+   + +Q+ +  +  +    H 
Sbjct  606   --SSPYDHGAGHIDPLKAIDPGLVYDIGPQEYFDFLCTQELSPSQLKVFTKHSNRSCRHS  663

Query  1423  H--HQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPK  1596
                + PG+LNYP+ + +F  ++   + T  RT TNVG   S Y V V    G +V V+PK
Sbjct  664   LAGNNPGNLNYPAISALFPENTHVKAMTLRRTVTNVGPHVSSYKVSVSPFKGATVTVQPK  723

Query  1597  VLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              L F    Q LSYTV+F   R K+       FG L+WKS    VRSP+ + W
Sbjct  724   TLNFTTKHQKLSYTVTF---RTKLRMKRPE-FGGLLWKSATHKVRSPVIITW  771



>ref|XP_003632775.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=787

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/597 (51%), Positives = 402/597 (67%), Gaps = 15/597 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F  GYE+  GK+NET+E +SPRDS+GHGTHTAS AAG  V  AS LG ARG 
Sbjct  191   RKLIGARFFCGGYEATNGKMNETLESRSPRDSDGHGTHTASIAAGRYVFPASTLGYARGV  250

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DG D++SLS+GG++  P+Y D+IAI
Sbjct  251   AAGMAPKARLAAYKVCWNAGCYDSDILAAFDAAVADGADVVSLSVGGVV-VPYYLDSIAI  309

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA+  GVFV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNG++  G 
Sbjct  310   GAFGASDHGVFVSASAGNGGPGGLTVTNVAPWVTTVGAGTMDRDFPANVKLGNGKLIPGV  369

Query  541   SLYSGKAV--NQKLPLVYGRTAGGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
             S+Y G  +   +  PL+Y  + GG G  +  C  GSL    VKG+IV+C+RG ++RA KG
Sbjct  370   SVYGGPGLAPGRLYPLIYAGSVGGDGYSSSLCLEGSLDPSFVKGKIVLCDRGINSRATKG  429

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYIN-SSKSA---TAS  876
               V+++GG GMIL N   +GE + AD H LPATA+G S G  ++KYI  +SKS    TA+
Sbjct  430   EVVRKAGGIGMILANGVFDGEGLVADCHVLPATAIGASGGDEIRKYITVASKSKSPPTAT  489

Query  877   IKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADN  1053
             I F+GT  G R APV+A+FS+RGP+  SPEI+KPDV APG+NILAAWP  +GP+ + +D 
Sbjct  490   IIFRGTRLGVRPAPVVASFSARGPNPESPEILKPDVIAPGLNILAAWPDRVGPSGIPSDK  549

Query  1054  RSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVS  1233
             R  EFNILSGTSM+CPH+SGLAALLK+ H +WSPAAI+SALMTT+YT D+R   + D  +
Sbjct  550   RRTEFNILSGTSMACPHISGLAALLKAAHPEWSPAAIRSALMTTAYTEDNRGETMLDEAT  609

Query  1234  TNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSAC-  1410
              N  ++T   FG+GHV P++A  PGLIYD+++ DY ++LC+ NY  T I ++ RK + C 
Sbjct  610   GN--TSTVMDFGAGHVHPQKAMDPGLIYDLTSNDYIDFLCNSNYTVTNIQMITRKMADCS  667

Query  1411  PTHHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVSVIV  1587
                     G+LNYPS + +F     +   T F RT TNVG P SVY V V  P G  V V
Sbjct  668   KARKAGHVGNLNYPSMSAVFQQYGKHKFSTHFIRTVTNVGDPNSVYQVTVKPPTGTLVTV  727

Query  1588  KPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             +P+ L F ++GQ L++ V   A   K++ G      GS+VW     TV SPI V  +
Sbjct  728   QPEKLVFRRLGQKLNFLVRVEAMAVKLSPGSTSIKSGSIVWADGKHTVTSPIVVTLE  784



>emb|CDY00497.1| BnaA10g07760D [Brassica napus]
Length=775

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/592 (51%), Positives = 398/592 (67%), Gaps = 15/592 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FY+GYE+  GKI++ +EY+SPRD +GHGTHTA+T AG  V+ A+ LG A G+
Sbjct  187   RKIVGARVFYRGYEAATGKIDQELEYRSPRDKDGHGTHTAATVAGSPVRGANLLGFAYGT  246

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC S D+L+AVDQAV DGV +LS+SLGG +   +  D++AI
Sbjct  247   ARGMAPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVHVLSISLGGGI-STYSRDSLAI  305

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FPA V LG  RVF+G 
Sbjct  306   ATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVRLGTRRVFKGV  365

Query  541   SLYSGKAV---NQKLPLVY-GRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+ V    ++ PLVY GR A       FC  G+L    V G+IV+C+RG + R +K
Sbjct  366   SLYKGRTVLSRGKQYPLVYLGRNASSPDPTSFCLDGALDQHNVAGKIVICDRGVTPRVQK  425

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VKR+GG GMIL N  T GEE+ AD H LPA A+G   G  +K+Y  +SK ATAS++ 
Sbjct  426   GQVVKRAGGVGMILTNTATNGEELVADCHLLPAVAVGEKEGKVIKEYAMTSKRATASLEI  485

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G + +PV+AAFSSRGP+ +S EI+KPD+ APGVNILAAW  ++ P+ L +D R V
Sbjct  486   LGTRVGIKPSPVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWSGDMAPSSLSSDKRRV  545

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AAL++S H DWSPAA+KSALMTT+Y  D+   P+TD+    P
Sbjct  546   KFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAVKSALMTTAYVHDNMLEPLTDAAGAEP  605

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               ++P+  G+GH+DP +A  PGL+YDI  Q+YF++LC+   + +Q+ +  +  +    H 
Sbjct  606   --SSPYDHGAGHIDPLKAIDPGLVYDIGPQEYFDFLCTQELSPSQLKVFTKHSNRSCRHS  663

Query  1423  H--HQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPK  1596
                + PG+LNYP+ + +F  ++   + T  RT TNVG   S Y V V    G +V V+PK
Sbjct  664   LAGNNPGNLNYPAISALFPENTHVKAMTLRRTVTNVGPHVSSYKVSVSPFKGATVTVQPK  723

Query  1597  VLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              L F    Q LSYTV+F   R K+       FG L+WKS    VRSP+ + W
Sbjct  724   TLNFTTKHQKLSYTVTF---RTKLRMKRPE-FGGLLWKSATHKVRSPVIITW  771



>ref|XP_008780099.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=813

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/590 (51%), Positives = 391/590 (66%), Gaps = 14/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGAR FY+GYE+  G I+E  E+KSPRD +GHGTHTA+T AG  V+ A+ LG ARG+
Sbjct  228   QKLVGARIFYRGYEASSGAIDERSEFKSPRDQDGHGTHTAATVAGAPVRGANLLGYARGT  287

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A YK C+T GC S D+LAAVD+AV DGVD+LS+SLGG +   +Y D++++
Sbjct  288   ARGMAPRARVAVYKVCWTGGCFSSDILAAVDRAVADGVDVLSISLGGGI-STYYRDSLSV  346

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FPA V LGNG    G 
Sbjct  347   AAFGAMEMGVFVACSAGNGGPEPISLTNVSPWIATVGASTMDRDFPAPVRLGNGMNLTGV  406

Query  541   SLYSGK---AVNQKLPLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+   +  ++ PLVY  G T+       C  G+L   +V G+IVVC+RG S R +K
Sbjct  407   SLYKGRRNLSPRRQYPLVYMGGNTSIPDPRSLCLEGTLDPHVVAGKIVVCDRGISPRVQK  466

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VK +GG GMIL N +  GEE+ AD H LPA A+G +AG A+K+Y N     TA++ F
Sbjct  467   GQVVKDAGGLGMILANTDANGEELVADSHLLPAVAVGEAAGKAIKQYSNVGSHPTATMTF  526

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
             +GT  G R +PV+AAFSSRGP+ ++ EI+KPDV APGVNILAAW  +  P+ L AD+R V
Sbjct  527   EGTKVGIRPSPVVAAFSSRGPNILTLEILKPDVVAPGVNILAAWSGDASPSSLLADHRRV  586

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
              FNILSGTSMSCPHV G+AALLK+ H DWSP+AIKSALMTT+YT D+   P+ D+ +  P
Sbjct  587   RFNILSGTSMSCPHVGGVAALLKASHPDWSPSAIKSALMTTAYTHDNTFRPLKDAATGAP  646

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               +TP+  G+GH+ P +A  PGLIYDIS  DYF +LC+      Q+ +  +  +    H 
Sbjct  647   --STPYDHGAGHIRPAKAVDPGLIYDISPDDYFEFLCTQKLTPLQLKVFSKSSNRTCKHR  704

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
                PGDLNYP+ + +F    + +  T  RT TNVG P S Y V V    GV V V+PK L
Sbjct  705   LASPGDLNYPAISAVFREQPAPAL-TLHRTVTNVGPPVSTYHVRVTPFRGVDVAVEPKTL  763

Query  1603  KFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              F    Q LSY V+F  +  +   G    FG+L+W      VRSP+AV W
Sbjct  764   HFTHQNQKLSYKVTFRTKSPQPMPG----FGALIWSDGIHLVRSPVAVTW  809



>ref|XP_008234331.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=841

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/590 (51%), Positives = 392/590 (66%), Gaps = 13/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FY+GYE+  GKINE  E+KSPRD +GHGTHTA+T AG  V+ A+ LG A G+
Sbjct  255   KKIVGARIFYQGYEAATGKINEQTEFKSPRDQDGHGTHTAATVAGSPVRGANLLGYAHGT  314

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C+  GC S D+L+AVD+AV DGV++LS+SLGG +   +Y D+++I
Sbjct  315   ARGMAPGARIAAYKVCWVGGCFSSDILSAVDKAVADGVNVLSISLGGGV-SAYYRDSLSI  373

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FP+ V+LGNGR   G 
Sbjct  374   AAFGAMEMGVFVSCSAGNGGPDPVSLTNVSPWITTVGASTMDRDFPSTVKLGNGRTVTGV  433

Query  541   SLYSGK---AVNQKLPLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G    + N++ P+VY    +     +  C  G+L  R+V G+IV+C+RG S R +K
Sbjct  434   SLYKGTMMLSTNKQYPVVYMGNNSTSPDPSSLCLEGTLDRRVVAGKIVICDRGISPRVQK  493

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VK +GG GMIL N    GEE+ AD H +PA A+G +   A+K Y  +S  ATA++ F
Sbjct  494   GQVVKDAGGVGMILANTAANGEELVADCHLVPAVAVGETEAKAIKHYALTSPRATATLAF  553

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G R +PV+AAFSSRGP+ VS EI+KPDV APGVNILAAW   +GP+ L  D+R V
Sbjct  554   LGTRTGVRPSPVVAAFSSRGPNFVSLEILKPDVVAPGVNILAAWTGALGPSSLPTDHRRV  613

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AALLK+ H +WSPAAIKSALMTT+Y  D+   P+ D+ +   
Sbjct  614   KFNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVHDNTHKPLQDASAAE-  672

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
              ++TP+  G+GH++P +A  PGL+YDI  QDY  +LC+      Q+ +  +  +    H 
Sbjct  673   -ASTPYDHGAGHINPRKALDPGLVYDIEAQDYLEFLCTQRLTPMQLKVFTKYSNRSCKHS  731

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
                PGDLNYP+ +V+F   ++ S  T  RT TNVG P S Y   V    G  V V+P+ L
Sbjct  732   LASPGDLNYPAISVVFPERTNVSLLTLHRTVTNVGPPVSNYHAIVSPFKGAYVKVEPRTL  791

Query  1603  KFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             KF +  Q LSY ++F  +  +        FG LVWK     VRSPI ++W
Sbjct  792   KFTRANQKLSYKITFTTKSRQATP----EFGGLVWKDGVHRVRSPIVIVW  837



>ref|XP_009788688.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=776

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/595 (53%), Positives = 397/595 (67%), Gaps = 19/595 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             +K++GAR FYKGYE+  G  I+E+ E KSPRD+EGHGTHTASTAAG +V +ASF   A+G
Sbjct  181   RKIIGARLFYKGYEADRGSPIDESKESKSPRDTEGHGTHTASTAAGSVVANASFFQYAKG  240

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFY-TDNI  354
              A GM   ARIAAYK C+  GC   D+LAA+DQAV DGV ++SLS+G     P Y  D+I
Sbjct  241   EARGMAVKARIAAYKICWKTGCFDSDILAAMDQAVADGVHVISLSVGADGYAPEYDVDSI  300

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AFGA++ GV V  SAGNSGP  S+  N APWI+TVAAS++DR FPA V LG+GR+F 
Sbjct  301   AIGAFGASEHGVVVSCSAGNSGPGASTAVNVAPWILTVAASTIDREFPANVILGDGRIFG  360

Query  535   GESLYSGKAVNQ-KLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  +N  KLPLVY   +G  G++ C  G L    V G+IV+C+RG +AR EKGS
Sbjct  361   GVSLYSGDPLNDTKLPLVY---SGDCGSQLCYPGKLDPSKVAGKIVLCDRGGNARVEKGS  417

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GGAGM+L N    GEE+ AD H LPAT +G  AG  ++ Y+ S  S  A+I F+G
Sbjct  418   AVKLAGGAGMVLANLADSGEELVADSHLLPATMVGQKAGDKIRDYVKSDSSPKATIVFKG  477

Query  892   TVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             TV G    AP +AAFS RGP+ V+PEI+KPDVTAPGVNILA W  +IGPT LE D R VE
Sbjct  478   TVIGKSPTAPRIAAFSGRGPNYVTPEILKPDVTAPGVNILAGWTGSIGPTDLEIDTRRVE  537

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSMSCPHVSGLAALL+  +  W+ AAIKSALMTT+Y +D+     TD  +    
Sbjct  538   FNIISGTSMSCPHVSGLAALLRKAYPKWTTAAIKSALMTTAYNVDNSGKTFTDLATGQ--  595

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA--CPTH  1419
              ++PF  GSGHVDP RA  PGL+YDI  +DY N+LC++ Y+  +IS  +++ S+  C   
Sbjct  596   ESSPFVHGSGHVDPNRALDPGLVYDIEMKDYVNFLCAIGYDPKRISPFVKETSSVNCSEK  655

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGI-PESVYAVHVMEPDGVSVIVKPK  1596
                 PGDLNYPSF+V     SS S   + R   NVG    +VY V +  P  V V V P 
Sbjct  656   SFVSPGDLNYPSFSV---VFSSESVVKYKRVVKNVGRNTNAVYEVKISVPASVEVKVTPT  712

Query  1597  VLKFNKMGQNLSYTVSFVAQRG---KIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              L F++  ++LSY +SF +      +   G   +FGS+ W     +VRSPIAV W
Sbjct  713   KLSFSEENKSLSYEISFSSNGSVGLETVKGLESAFGSIEWSDGIHSVRSPIAVYW  767



>ref|XP_002270958.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=774

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/590 (51%), Positives = 394/590 (67%), Gaps = 14/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FY+GYES  GKINE  EYKSPRD +GHGTHTA+T AG  V+ A+ LG A G+
Sbjct  189   KKIVGARVFYRGYESASGKINEKDEYKSPRDQDGHGTHTAATVAGSPVRHANLLGYAAGT  248

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C+  GC S D+L+AVD+AV DGV++LS+SLGG +   +Y D++AI
Sbjct  249   ARGMAPGARIAAYKVCWVGGCFSSDILSAVDRAVADGVNVLSISLGGGVSS-YYRDSLAI  307

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FPA+V LG G+   G 
Sbjct  308   ATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPAVVNLGTGKSITGV  367

Query  541   SLYSGKA---VNQKLPLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+      ++ PLVY    ++       C  G+L    V G+IV+C+RG S R +K
Sbjct  368   SLYKGRRNLFTKKQYPLVYTGSNSSNPDPNSLCLEGTLDPHTVAGKIVICDRGISPRVQK  427

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VK +GG G+IL N    GEE+ AD H LPA A+G + G  +K+Y  +  +ATA++ F
Sbjct  428   GQVVKDAGGVGLILTNTAANGEELVADSHLLPAVAVGETTGKLIKRYALTKPNATATLGF  487

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G R +PV+AAFSSRGP+ +S EI+KPDV APGVNILAAW  ++GP+ L  D+R V
Sbjct  488   LGTRLGIRPSPVVAAFSSRGPNFLSLEILKPDVVAPGVNILAAWSGDMGPSSLPTDHRKV  547

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
              FNILSGTSMSCPHVSG+AALLK+ H DWSPAAI+SALMTT+Y  D+ ++P+ D+ +  P
Sbjct  548   RFNILSGTSMSCPHVSGIAALLKARHPDWSPAAIRSALMTTAYVHDNTRNPLRDASTGQP  607

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               +TP+  G+GH++P +A  PGLIYDI  QDYF +LC       Q+ +  + K +C  H 
Sbjct  608   --STPYDHGAGHINPLKALDPGLIYDIGPQDYFEFLCKQKLTPIQLKVFGKSKRSC-RHT  664

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
                 GDLNYP+ + +F   +S ++ T  RT TNVG P S Y V V +  GV+V ++P VL
Sbjct  665   LASGGDLNYPAISAVFPDKASVTTLTLHRTVTNVGPPMSKYHVAVSQFKGVAVKIEPAVL  724

Query  1603  KFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              F    Q LSY ++   +  + +      FGSL+WK     VRSP+A+ W
Sbjct  725   NFTSKHQKLSYKITLTTKSRQSSP----EFGSLIWKDGVHKVRSPVAITW  770



>ref|XP_010552189.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=790

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/600 (52%), Positives = 402/600 (67%), Gaps = 18/600 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGAR F  GYE+  GK+NET EY+SPRDS+GHGTHTAS AAG  V  AS LG ARG 
Sbjct  191   RKLVGARYFCGGYEATNGKMNETTEYRSPRDSDGHGTHTASIAAGRYVFPASTLGYARGV  250

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D IAI
Sbjct  251   AAGMAPKARLAAYKVCWNSGCYDSDILAAFDAAVADGVDVVSLSVGGVV-VPYYLDAIAI  309

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA  +G+FV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNG+V  G 
Sbjct  310   GAFGAIDRGIFVSASAGNGGPGGMTVTNVAPWMTTVGAGTIDRDFPADVKLGNGKVVPGV  369

Query  541   SLYSGKAVN--QKLPLVYGRTA-GGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G  ++  +   ++YG +  GG G  +  C  GSL   +VKG+IV+C+RG ++RA K
Sbjct  370   SLYGGPGLDPGRMYAVIYGGSLLGGDGYSSSLCLEGSLDPNMVKGKIVLCDRGINSRATK  429

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSA------  867
             G  V+++GG GMIL N   +GE + AD H LPATA+G S G  ++KYI+ S         
Sbjct  430   GEVVRKAGGIGMILANGVFDGEGLVADCHVLPATAVGSSGGDEIRKYISGSGKPGSSSEP  489

Query  868   TASIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLE  1044
             TA+I F+GT  G R APV+A+FS+RGP+  SPEI+KPDV APG+NILAAWP  IGP+ + 
Sbjct  490   TATIVFKGTRLGVRPAPVVASFSARGPNPESPEILKPDVIAPGLNILAAWPDKIGPSGVP  549

Query  1045  ADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITD  1224
             +D R  EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+YT+D+R  P+ +
Sbjct  550   SDKRRTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNRGEPMLE  609

Query  1225  SVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS  1404
               + N   +T   FGSGHV P +A  PGL+YD++  DY N+LC+ NY  + I  + R+K+
Sbjct  610   ESTGN--VSTVMDFGSGHVHPTKAMDPGLVYDLTPYDYVNFLCNSNYTGSNIVTIARRKA  667

Query  1405  ACP-THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVS  1578
              C         G+LNYPS +V+F         T F RT TNVG   SVY V V  P G+S
Sbjct  668   DCEGAKRAGHVGNLNYPSLSVVFQQFGDGKMSTHFIRTVTNVGDSGSVYKVRVRPPSGIS  727

Query  1579  VIVKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             V V+P+ L F ++GQ LS+ V   A   K++ GG   + G +VW      V SP+ V  Q
Sbjct  728   VTVEPERLSFRRIGQKLSFLVRVQATAVKLSPGGTSVNTGYIVWSDGKRNVTSPLVVTLQ  787



>ref|XP_006343203.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=770

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/594 (51%), Positives = 398/594 (67%), Gaps = 17/594 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F KGYES +G I+ + E KSPRD +GHGTHT++TAAG +V+ AS LG A G+
Sbjct  183   RKLIGARYFAKGYESTLGPIDVSKESKSPRDDDGHGTHTSTTAAGSVVQGASLLGYASGN  242

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A YK C+  GC S D+LA +D+A+ D V++LSLSLGG     +Y D+IAI
Sbjct  243   ARGMATHARVAVYKVCWVGGCFSSDILAGLDKAIDDNVNVLSLSLGGGNSD-YYRDSIAI  301

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A +KG+ V  SAGN+GP   S+SN APWI TV A +LDR FPA V LGNG+ F G 
Sbjct  302   GAFAAMEKGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNFSGV  361

Query  541   SLYSGKA-VNQKLPLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SLY G + +++ LP VY G  +       C  G+L    VKG+IV+C+RG + R +KGS 
Sbjct  362   SLYKGDSSLSKMLPFVYAGNASNMTNGNLCMTGTLIPEEVKGKIVLCDRGINPRVQKGSV  421

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GGAGM+L N    G+E+ AD H +PAT++G + G A+KKY+ S  + TA+I F+GT
Sbjct  422   VKAAGGAGMVLANTAANGDELIADAHLIPATSVGQTTGEAIKKYLTSDPNPTATILFEGT  481

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
               G + +PV+AAFSSRGP++++ EI+KPD+ APGVNILA W    GPT L  D+R VEFN
Sbjct  482   KVGIKPSPVVAAFSSRGPNSITQEILKPDIIAPGVNILAGWTGAAGPTGLAEDDRRVEFN  541

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSGLAALLK  H DWSPAAI+SALMTT+YT+  +   + D V+  P  +
Sbjct  542   IISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALMTTAYTVYKKGGALQDVVTGKP--S  599

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TPF  G+GHVDP  A +PGL+YD+   DY N+LC+LNY S QI+ + R+  +C T     
Sbjct  600   TPFDHGAGHVDPVAALNPGLVYDLKADDYLNFLCALNYTSIQINSVARRPFSCETSKKFS  659

Query  1432  PGDLNYPSFAVIFDssssnssHT------FTRTATNVGIPESVYAVHVMEP-DGVSVIVK  1590
               DLNYPSFAV+F    + SS +       TRT TNVG P   Y V+V+ P + V V+V+
Sbjct  660   VADLNYPSFAVVFPEQMTASSGSGSSSIKHTRTLTNVG-PAGTYKVNVISPSNSVKVVVE  718

Query  1591  PKVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             P++L F +M +  SYTV+F A          + +  + W      V SP+A+ W
Sbjct  719   PEILAFTRMNEQKSYTVTFTAPSMPSTE---NVYARIEWSDGKHIVSSPVAISW  769



>ref|XP_011039978.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=767

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/588 (50%), Positives = 390/588 (66%), Gaps = 12/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK---INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLA  171
             KKL+GAR F KGY    G    + +  E +SPRD +GHGTHTASTAAG LV +AS LG A
Sbjct  185   KKLIGARYFSKGYHMASGGRSFLKKPKEIESPRDQDGHGTHTASTAAGSLVANASLLGYA  244

Query  172   RGSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDN  351
              G+A GM   AR+A+YK C+T GC   D+LA +D+A++DGVD++SLSLGG    P+Y D 
Sbjct  245   SGTARGMATRARVASYKVCWTSGCFGSDILAGMDRAIEDGVDVMSLSLGGGS-APYYRDT  303

Query  352   IAIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVF  531
             IAI AF A ++G+FV  SAGNSGP  +S++N APWIMTV A +LDR FPA   +GN + F
Sbjct  304   IAIGAFTAMERGIFVSCSAGNSGPNIASLANVAPWIMTVGAGTLDRDFPAYAVMGNKKRF  363

Query  532   RGESLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
              G SLYSG         +  +         C  GSL  +LV+G++V+C+RG + R EKG+
Sbjct  364   AGVSLYSGAGXXXXXXXLVYKKGSNSTCNLCMPGSLEPQLVRGKVVICDRGINPRVEKGA  423

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMIL N    GEE+ AD H LPA A+G   G  +++Y+ S  + TA + F G
Sbjct  424   VVRDAGGVGMILANTAESGEELVADSHLLPAVAVGRKVGDVIREYVKSDPNPTAVLSFGG  483

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   R +PV+AAFSSRGP+ V+ EI+KPD+  PGVNILAAW   IGPT LE+D R  +F
Sbjct  484   TVLDVRPSPVVAAFSSRGPNLVTREILKPDLIGPGVNILAAWSETIGPTGLESDTRKTQF  543

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SG+AALLK+ H  WSP+AIKSALMTT+Y  D+  SP+ D+       
Sbjct  544   NIMSGTSMSCPHISGVAALLKAAHPTWSPSAIKSALMTTAYFSDNTNSPLQDAAGG--AL  601

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             + P+A GSGHVDP++A  PGL+YDIST DY  +LCSL+Y    +  ++++ +   +   +
Sbjct  602   SNPWAHGSGHVDPQKALSPGLVYDISTDDYVAFLCSLDYTIEHVQAIVKRPNITCSRKFN  661

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG+LNYPSF+V+F ++       +TR  TNVG   S+Y V V  P  V V VKP  L F
Sbjct  662   -PGNLNYPSFSVVFTNNRVVR---YTRELTNVGAAGSIYEVAVTGPQAVQVTVKPSKLVF  717

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
               +G  L YTV+FVA++G   +G    FG+++W++    VRSP+A  W
Sbjct  718   KNIGDKLRYTVTFVARKGASLTGRSE-FGAIMWRNAQHQVRSPVAFSW  764



>gb|EYU25847.1| hypothetical protein MIMGU_mgv1a001711mg [Erythranthe guttata]
Length=770

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/592 (51%), Positives = 393/592 (66%), Gaps = 16/592 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR F KGY ++      + E +SPRD +GHGTHTASTAAG  V++AS LG A G+
Sbjct  183   KKLIGARFFSKGYNTMASG-GGSKESQSPRDGDGHGTHTASTAAGFQVENASLLGYAAGN  241

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A Y+ C+  GC   D+LAA+D+A+ DGVD+LSLSLGG    P+  D IA+
Sbjct  242   ARGMATHARLATYRVCWKTGCLGSDILAAMDRAILDGVDVLSLSLGGGS-APYARDTIAV  300

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A +KG+FV  SAGNSGP  +S++N APWIMTV A +LDR FPA   LGNG  + G 
Sbjct  301   GAFAAMEKGIFVSCSAGNSGPTRASLANVAPWIMTVGAGTLDRDFPAFAALGNGLKYTGV  360

Query  541   SLYSGKAVNQKL-PLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLYSG+ +  KL  LVY    G      C  GSL    V+G++V+C+RG SAR EKGS V
Sbjct  361   SLYSGEGMGSKLVELVYNNNGGNTSGNLCLAGSLDPAAVRGKVVLCDRGISARVEKGSVV  420

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTV  897
             K +GG GMIL N    GEE+ AD H LPA A+G   G  +++Y+ + K+ TA + F GTV
Sbjct  421   KEAGGVGMILANTAASGEELVADSHLLPAVAVGRKVGDLIRQYVKTGKNPTAGLSFGGTV  480

Query  898   YGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
                + +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILAAWP  +GPT L+ D R  +FNI
Sbjct  481   VNVKPSPVVAAFSSRGPNMVTPQILKPDVIGPGVNILAAWPQGVGPTGLDKDARKTQFNI  540

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISAT  1254
             +SGTSMSCPH+SGLAALLK+ H DWSP+AIKSALMTT+YT+D+  SP+ D+   +   +T
Sbjct  541   MSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTVDNANSPLRDAADYS--LST  598

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSAC--PTHHHH  1428
             P+A G+GHVDP +A  PGL+YD +  DY ++LCSL+Y    + L+ R+ +A    +    
Sbjct  599   PWAHGAGHVDPHKALSPGLVYDATPDDYVSFLCSLDYTDDAVQLIARRPNATCSSSRRFR  658

Query  1429  QPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLK  1605
              PG LNYPSF+V+F     NS    +TR  TNVG   S Y   +  P  V   VKP  L 
Sbjct  659   DPGQLNYPSFSVVFGGGKKNSRVVRYTRELTNVGPAGSAYVAELEVPPTVGATVKPSKLV  718

Query  1606  FNKMGQNLSYTVSFVAQRG---KIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             F  +G+ L YTV+FV+++     + SG    FGS+ WK+    VRSP++  W
Sbjct  719   FGNVGEKLRYTVTFVSKKDVDYSLTSG----FGSITWKNAQHQVRSPVSFSW  766



>gb|KDO64998.1| hypothetical protein CISIN_1g045236mg, partial [Citrus sinensis]
Length=604

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/592 (52%), Positives = 396/592 (67%), Gaps = 15/592 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KK++GAR FY+GYES + + I+ET E KSPRD+EGHGTHTASTAAG LV +AS    ARG
Sbjct  12    KKIIGARAFYRGYESYMERPIDETEESKSPRDTEGHGTHTASTAAGSLVSNASLFDYARG  71

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFY-TDNI  354
              A GM   ARIA YK C++ GC   D+LAA+DQA+ DGVD++SLS+G     P Y  D+I
Sbjct  72    EARGMAVKARIAVYKICWSPGCFDSDILAAMDQAIADGVDVISLSVGASGYAPQYDQDSI  131

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI +FGA Q GV V  SAGNSGP   + +N APWI+TV AS++DR FPA   LG+GR+F 
Sbjct  132   AIGSFGAAQHGVVVSCSAGNSGPGPFTATNIAPWILTVGASTIDREFPADAILGDGRIFG  191

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLY+G+++ + KL LVYG   G  G  FC  G L    V+G+IVVC+RG +AR EKG+
Sbjct  192   GVSLYAGESLPDFKLHLVYG---GDCGDRFCYMGRLEPSKVQGKIVVCDRGGNARVEKGA  248

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GG GMIL N +  GEE+ AD H +PAT +G  AG  +++YI  S+  TA+I F+G
Sbjct  249   AVKLAGGLGMILANTDESGEELIADSHLIPATMVGAIAGDKIREYIKLSQYPTATIVFRG  308

Query  892   TVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             TV      AP +AAFSSRGP++++ EI+KPDV APGVNILAAW  + GPT LE D R V+
Sbjct  309   TVISPSPPAPKVAAFSSRGPNSLTAEILKPDVIAPGVNILAAWTGSTGPTDLEIDPRRVD  368

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSMSCPHVSGLAALL+  + DWSPAAIKSALMTT+Y LD+    I D  S    
Sbjct  369   FNIISGTSMSCPHVSGLAALLRKAYPDWSPAAIKSALMTTAYNLDNSGENIKDLASGE--  426

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRK--KSACPTH  1419
              +TPF  G+GHVDP RA +PGL+YDI   +Y  +LCS+ Y+  +IS+ +R+   S   T 
Sbjct  427   ESTPFIHGAGHVDPNRALNPGLVYDIDVSEYVAFLCSIGYDVKRISVFVREPVSSDICTR  486

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIP-ESVYAVHVMEPDGVSVIVKPK  1596
                 PG+LNYPSF+V+F+S++      + R   NVG   ++VY V V  P  V+V V P 
Sbjct  487   ALATPGNLNYPSFSVVFNSNNDVV--KYKRVVKNVGSSVDAVYEVKVNAPPNVAVNVWPS  544

Query  1597  VLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              L F+   + L+Y ++F +             GS+ W      VRSPIAV W
Sbjct  545   KLAFSAEKKALAYEITFSSVGLDGLGVSPQQSGSIEWSDGVHLVRSPIAVRW  596



>ref|XP_011041660.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=778

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/590 (50%), Positives = 395/590 (67%), Gaps = 13/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FY+GYE+  GKINE  EYKSPRD +GHGTHTA+T AG  V+ A+ LG A G+
Sbjct  191   RKIVGARVFYRGYEAATGKINEQNEYKSPRDQDGHGTHTAATVAGSPVRGANLLGYAYGT  250

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C++ GC S D+L+AVD+AV DGV++LS+SLGG +   +Y D+++I
Sbjct  251   ARGMAPGARIAAYKVCWSGGCFSSDILSAVDRAVADGVNVLSISLGGGVSS-YYRDSLSI  309

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA + GVFV  SAGN GP  +S++N +PWI TV ASS+DR FPA   +G GR   G 
Sbjct  310   AAFGAMEMGVFVSCSAGNGGPSPASLTNVSPWITTVGASSMDRDFPATAMIGTGRTISGV  369

Query  541   SLYSGKAV---NQKLPLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+ +    ++ PLVY    ++    +  C  G+L+ R+V G+IV+C+RG + R +K
Sbjct  370   SLYRGQRILSTRKQYPLVYMGSNSSSPDPSSLCLEGTLNPRVVSGKIVICDRGITPRVQK  429

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G   K +G  GMIL N    GEE+ AD H LPA A+G   G  +K Y  +S++ATA++ F
Sbjct  430   GQVAKEAGAVGMILSNTAANGEELVADSHLLPAVAVGEKEGKLIKSYALTSQNATATLAF  489

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G + +PV+AAFSSRGP+ ++ EI+KPDV APGVNILAAW  ++GP+ L  D+R V
Sbjct  490   LGTRLGIKPSPVVAAFSSRGPNFLTLEILKPDVLAPGVNILAAWTGDLGPSNLPTDHRRV  549

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AALLK+ H +WSPAAIKSALMTT+Y  D+   P+ D+ +T P
Sbjct  550   KFNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVHDNTHHPLKDASATTP  609

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               +TP+  G+GH++P +A  PGLIYDI  QDYF++LC+     TQ+ +  +  +    H 
Sbjct  610   --STPYDHGAGHINPMKALDPGLIYDIEPQDYFDFLCTQKLTPTQLKVFGKYANRSCRHS  667

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
                PGDLNYP+ +V+F   +S    T  RT TNVG+P S Y   +    G +V V+P++L
Sbjct  668   LANPGDLNYPAISVVFPDDTSIKVLTLHRTVTNVGLPTSKYHAVISPFKGATVKVEPEIL  727

Query  1603  KFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              F    Q LSY + F  +  +        FG LVWK     VRSP+ + W
Sbjct  728   NFTMKNQKLSYKIIFTRRTRQTIP----EFGGLVWKDGAHKVRSPVVITW  773



>ref|XP_011048615.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=773

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/600 (51%), Positives = 405/600 (68%), Gaps = 19/600 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F KGYE+  GK+NET EY+SPRDS+GHGTHTAS AAG  V  AS  G ARG 
Sbjct  175   RKLIGARYFCKGYEATNGKMNETTEYRSPRDSDGHGTHTASIAAGRYVFPASTFGYARGV  234

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D IAI
Sbjct  235   AAGMAPKARLAAYKVCWNAGCYDSDILAAFDAAVSDGVDVISLSVGGVV-VPYYLDAIAI  293

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              +FGA  +GVFV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNG+V  G 
Sbjct  294   GSFGAVDRGVFVSASAGNGGPGGLTVTNVAPWVTTVGAGTIDRDFPADVKLGNGKVISGV  353

Query  541   SLYSGKAV--NQKLPLVYGRTAGGKGAEF----CSHGSLSSRLVKGRIVVCERGNSARAE  702
             SLY G  +   +  P+VY  ++GG G E+    C  GSL  +LV+G+IV+C+RG ++RA 
Sbjct  354   SLYGGPGLAPGKMYPVVYAGSSGG-GDEYSSSLCLDGSLDPKLVEGKIVLCDRGINSRAA  412

Query  703   KGSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSA-----  867
             KG  VK++GG GMIL N   +GE + AD H LPATA+G S G  +++Y++++  +     
Sbjct  413   KGEVVKKAGGVGMILANGVFDGEGLVADCHVLPATAVGASGGDEIRRYMSAASKSKSSPP  472

Query  868   TASIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLE  1044
             TA+I F+GT    R APV+A+FS+RGP+  SPEI+KPDV APG+NILAAWP  +GP+ + 
Sbjct  473   TATIVFRGTRVNVRPAPVVASFSARGPNPESPEILKPDVIAPGLNILAAWPDKVGPSGIP  532

Query  1045  ADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITD  1224
             +D R +EFNILSGTSM+CPHVSGLAALLK+ H +WS AAI+SALMTT+YT+D+R   + D
Sbjct  533   SDQRKIEFNILSGTSMACPHVSGLAALLKAAHPEWSSAAIRSALMTTAYTVDNRGEEMID  592

Query  1225  SVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS  1404
               + N   +T   FG+GHV P++A +PGLIYDIS+ DY ++LC+ NY  T I ++ R+ +
Sbjct  593   ESTGN--VSTVLDFGAGHVHPQKAMNPGLIYDISSFDYVDFLCNSNYTLTNIQVVTRRNA  650

Query  1405  ACP-THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVS  1578
              C         G+LNYPS  V+F     +   T F RT TNVG   SVY V +  P G +
Sbjct  651   DCSGAKRAGHAGNLNYPSLTVVFQQYGKHQMSTHFIRTVTNVGDANSVYKVTIRPPSGTA  710

Query  1579  VIVKPKVLKFNKMGQNLSYTVSFVAQRGKIASGG-GHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             V V+P+ L F ++GQ L++ V       K+A G      GS++W     TV SP+ V  Q
Sbjct  711   VTVQPEKLVFRRVGQKLNFLVRVETTAVKLAPGASSMKSGSIIWADGKHTVTSPVVVTMQ  770



>ref|XP_010051409.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=791

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/588 (50%), Positives = 393/588 (67%), Gaps = 12/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK--INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR F KG+    G   +    E +SPRD +GHGTHTASTAAG  V +AS LG A 
Sbjct  193   KKLIGARFFSKGFRMASGSNFLKNPKEVESPRDRDGHGTHTASTAAGSPVANASLLGYAS  252

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   AR+AAYK C++ GC   D+LA +D+A+ DGVD+LSLSLGG +  P+Y D I
Sbjct  253   GTARGMAEHARVAAYKVCWSSGCFGADILAGMDRAILDGVDVLSLSLGGGI-APYYRDTI  311

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AF A ++G+FV  SAGNSGP   S++N APWIMTV A +LDR FPA   LGNG+ + 
Sbjct  312   AIGAFTAMERGIFVSCSAGNSGPAKESLANVAPWIMTVGAGTLDRDFPAYALLGNGKRYA  371

Query  535   GESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  +    +P++Y + +   G + C  GSL+  L +G++V+C+RG +AR EKG 
Sbjct  372   GVSLYSGPGMGHNPVPVIYSKDSNISG-QLCLPGSLNPALTRGKVVLCDRGVNARVEKGQ  430

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMIL N    GEE+ AD H +PA A+G   G  ++KY+ S +S TA + F+G
Sbjct  431   VVRDAGGVGMILANTAANGEELVADSHLIPAVAVGRKMGDVIRKYVKSDRSPTAVLSFRG  490

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   R +PV+AAFSSRGP+ V+ +I+KPDV  PGVNILA W    GPT LE+D R   F
Sbjct  491   TVVNVRPSPVVAAFSSRGPNTVTQQILKPDVIGPGVNILAGWSEAAGPTGLESDTRKTLF  550

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NILSGTSMSCPH+SG+AALLKS H +WSP+AIKSALMTT+Y LD+  SP+ D+       
Sbjct  551   NILSGTSMSCPHISGVAALLKSAHPNWSPSAIKSALMTTAYNLDNTGSPLRDAAGGT--F  608

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             +TP+A GSGHVDP++A  PGL+YD+  +DY  +LCSL+Y    +  ++++ +   +    
Sbjct  609   STPWAHGSGHVDPQKALSPGLVYDLKAEDYIAFLCSLDYTIDHVKAIVKRPNVTCSRKFS  668

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG+LNYPSF+V+F+         +TR  TNVG   S+Y V V  P  V V VKP  L F
Sbjct  669   DPGELNYPSFSVVFNDKKVVR---YTRELTNVGAAGSMYNVSVTGPSTVGVTVKPMKLIF  725

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              K+G  + YTV+FV+++G   +     FGS+VW +    VRSP+A  W
Sbjct  726   PKVGDKMRYTVTFVSKKGTNPTTRSE-FGSIVWSNAQNKVRSPVAYAW  772



>ref|XP_009758000.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=773

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/595 (50%), Positives = 395/595 (66%), Gaps = 17/595 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F +GYE+ +G I+E+ E KSPRD +GHGTHT++TA G +V+ AS  G A G+
Sbjct  184   RKLIGARYFSRGYETTLGPIDESKESKSPRDDDGHGTHTSTTAGGSVVQGASLFGYAPGT  243

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A YK C+  GC S D+LAA+D+A+ D V++LSLSLGG +   +Y D++AI
Sbjct  244   ARGMATRARVAVYKVCWVGGCFSSDILAAMDKAIDDNVNVLSLSLGGGISD-YYRDSVAI  302

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A +KG+ V  SAGN+GP   S+SN APWI TV A +LDR FPA V LGNG+ F G 
Sbjct  303   GAFAAMEKGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNFSGV  362

Query  541   SLYSGKAV-NQKLPLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SLY G ++ N+ LP VY G  +       C  G+L    VKG+IV+C+RG +AR +KGS 
Sbjct  363   SLYKGNSLPNKMLPFVYAGNASNVTNGNLCMTGTLIPEKVKGKIVLCDRGINARVQKGSV  422

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GG GM+L N    GEE+ AD H LPATA+G   G A++ Y+ S  + TA+I F+GT
Sbjct  423   VKAAGGVGMVLTNTAANGEELVADAHLLPATAVGQKTGDAIRDYLTSDSNPTATILFEGT  482

Query  895   VYG-NRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
               G   +PV+AAFSSRGP++++PEI+KPD+ APGVNILA W   +GPT LE D+R V FN
Sbjct  483   KVGIEPSPVVAAFSSRGPNSITPEILKPDIIAPGVNILAGWTGAVGPTGLEEDDRRVGFN  542

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSGLAALLK  H +WSPAAI+SALMTT+YT       I D  +  P  +
Sbjct  543   IISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALMTTAYTAYKNGGAIQDVSTGKP--S  600

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TP   G+GHVDP  A +PGL+YDI+T DY N+LC+LNY  +QIS L R+   C     + 
Sbjct  601   TPLDHGAGHVDPVSALNPGLVYDITTDDYLNFLCALNYTPSQISSLARRNFTCNESKKYS  660

Query  1432  PGDLNYPSFAVIFDssssnssHT-------FTRTATNVGIPESVYAVHVMEP-DGVSVIV  1587
               DLNYPSFAV F + S+  + +       ++R  TNVG P   Y V V  P   V + V
Sbjct  661   VTDLNYPSFAVSFPAESAARTGSAGSSSIKYSRMLTNVG-PAGTYKVTVTSPTSSVKITV  719

Query  1588  KPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             +P+ L F++M +  SYTV+F A    ++S   + FG + W      V SP+A+ W
Sbjct  720   EPETLSFSQMNEKKSYTVTFTAP--SMSSSTTNVFGRIEWSDGKHVVGSPLAISW  772



>gb|AAM60964.1| subtilisin-like serine protease [Arabidopsis thaliana]
Length=775

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/600 (51%), Positives = 403/600 (67%), Gaps = 18/600 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGAR F  GYE+  GK+NET E++SPRDS+GHGTHTAS +AG  V  AS LG A G 
Sbjct  176   RKLVGARFFCGGYEATNGKMNETTEFRSPRDSDGHGTHTASISAGRYVFPASTLGYAHGV  235

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D IAI
Sbjct  236   AAGMAPKARLAAYKVCWNSGCYDSDILAAFDTAVADGVDVISLSVGGVV-VPYYLDAIAI  294

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA  +G+FV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNG++  G 
Sbjct  295   GAFGAIDRGIFVSASAGNGGPGALTVTNVAPWMTTVGAGTIDRDFPANVKLGNGKMISGV  354

Query  541   SLYSGKAVN--QKLPLVYGRTA-GGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             S+Y G  ++  +  PLVYG +  GG G  +  C  GSL   LV G+IV+C+RG ++RA K
Sbjct  355   SVYGGPGLDPGRMYPLVYGGSLLGGDGYSSSLCLEGSLDPNLVTGKIVLCDRGINSRATK  414

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSA------  867
             G  V+++GG GMI+ N   +GE + AD H LPAT++G S G  +++YI+ S  +      
Sbjct  415   GEIVRKNGGLGMIIANGVFDGEGLVADCHVLPATSVGASGGDEIRRYISESSKSRSSKHP  474

Query  868   TASIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLE  1044
             TA+I F+GT  G R APV+A+FS+RGP+  +PEI+KPDV APG+NILAAWP  IGP+ + 
Sbjct  475   TATIVFKGTRLGIRPAPVVASFSARGPNPETPEILKPDVIAPGLNILAAWPDRIGPSGVT  534

Query  1045  ADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITD  1224
             +DNR  EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+YT+D+   P+ D
Sbjct  535   SDNRRTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNSGEPMMD  594

Query  1225  SVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS  1404
               + N  S T   +GSGHV P RA  PGL+YDI++ DY N+LC+ NY  T I  + R+++
Sbjct  595   ESTGNTSSVT--DYGSGHVHPTRAMDPGLVYDITSYDYINFLCNSNYTGTNIVTITRRQA  652

Query  1405  ACP-THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVS  1578
              C         G+LNYPSF+V+F     +   T F RT TNVG  +SVY + +  P G +
Sbjct  653   DCDGARRAGHVGNLNYPSFSVVFQQYGESKMSTHFIRTVTNVGDSDSVYEIKIRPPRGTT  712

Query  1579  VIVKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             V V+P+ L F ++GQ LS+ V       K++ G  +   G +VW      V SP+ V  Q
Sbjct  713   VTVEPEKLSFRRVGQKLSFVVRVKTTEVKLSPGATNVETGHMVWSDGKRNVTSPLVVTLQ  772



>ref|XP_004234656.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=771

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/594 (50%), Positives = 400/594 (67%), Gaps = 17/594 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F KGYES +G I+ + E KSPRD +GHGTHT++TA G +V+ AS LG A G+
Sbjct  184   RKLIGARYFAKGYESTLGPIDVSKESKSPRDDDGHGTHTSTTATGSVVQGASLLGYASGN  243

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A YK C+  GC S D+LAA+D+A+ D V++LSLSLGG     +Y D++AI
Sbjct  244   ARGMATHARVAVYKVCWVGGCFSSDILAALDKAIDDNVNVLSLSLGGGNSD-YYRDSVAI  302

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A +KG+ V  SAGN+GP   S+SN APWI TV A +LDR FPA V LGNG+ F G 
Sbjct  303   GAFAAMEKGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNFSGV  362

Query  541   SLYSG-KAVNQKLPLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SLY G  ++++ LP VY G  +       C  G+L    VKG+IV+C+RG + R +KGS 
Sbjct  363   SLYKGASSLSKMLPFVYAGNASNMTNGNLCMSGTLIPEEVKGKIVLCDRGINPRVQKGSV  422

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GGAGM+L N    G+E+ AD H +PAT++G + G A+K Y+ S+ + TA+I F+GT
Sbjct  423   VKAAGGAGMVLANTAANGDELIADAHLIPATSVGQTTGEAIKNYLTSNPNPTATILFEGT  482

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
               G + +PV+AAFSSRGP++++ EI+KPD+ APGVNILA W    GPT L  D+R VEFN
Sbjct  483   KVGIKPSPVVAAFSSRGPNSITQEILKPDIIAPGVNILAGWTGAAGPTGLAEDDRRVEFN  542

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSGLAALLK  H DWSPAAI+SALMTT+YT+  +   + D V+  P  +
Sbjct  543   IISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALMTTAYTVYKKGGALQDVVTGKP--S  600

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TPF  G+GHVDP  A +PGL+YD+   DY N+LC+LNY S QI+ + R+  +C T+   +
Sbjct  601   TPFDHGAGHVDPVAALNPGLVYDLKADDYLNFLCALNYTSIQINSVARRPFSCATNKKFR  660

Query  1432  PGDLNYPSFAVIFDssssnssHT------FTRTATNVGIPESVYAVHVMEP-DGVSVIVK  1590
               DLNYPSFAV+F    + SS +       TRT TNVG P   Y V+V++P + V V+V+
Sbjct  661   VADLNYPSFAVVFPEQMTASSGSGSSSIKHTRTLTNVG-PAGTYKVNVIKPSNSVKVVVE  719

Query  1591  PKVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             P+ L F +M +  SYTV+F A          + +  + W      V SP+A+ W
Sbjct  720   PETLAFTRMNEQKSYTVTFTAPSMPSTE---NVYARIEWSDGKHVVSSPVAISW  770



>ref|XP_006280051.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
 gb|EOA12949.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
Length=764

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/588 (51%), Positives = 392/588 (67%), Gaps = 13/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F +GYES +G I+E+ E +SPRD +GHGTHT+STAAG +V+ AS LG A G+
Sbjct  185   RKLIGARFFARGYESTMGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGT  244

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A YK C+  GC S D+LAA+D+A+ D V++LS+SLGG +   +Y D +AI
Sbjct  245   ARGMAPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLGGGMSD-YYRDGVAI  303

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A ++G+ V  SAGN+GP + S+SN APWI TV A +LDR FPA+  LGNG+ F G 
Sbjct  304   GAFAAMERGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFTGV  363

Query  541   SLYSGKAVNQKL-PLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SL+ G+A+  KL P +Y G  +       C  G+L    VKG+IV+C+RG +AR +KG  
Sbjct  364   SLFKGEALPDKLLPFIYAGNASNATNGNLCMSGTLIPEKVKGKIVMCDRGVNARVQKGDV  423

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GG GMIL N    GEE+ AD H LPAT +G  AG  ++ Y+ +    TASI   GT
Sbjct  424   VKAAGGLGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVTTDPHPTASISILGT  483

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V G + +PV+AAFSSRGP++++P I+KPD+ APGVNILAAW    GPT L +D+R VEFN
Sbjct  484   VVGVKPSPVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRVEFN  543

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSGLAALLKSVH +WSPAAI+SALMTT+Y       P+ D  +  P  +
Sbjct  544   IISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYKTYKDGKPLLDIATGKP--S  601

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TPF  G+GH  P  A +PGLIYD++T+DY  +LC+LNY S+QI ++ R+   C     + 
Sbjct  602   TPFDHGAGHASPATATNPGLIYDLTTEDYLGFLCALNYTSSQIRIVSRRNYTCDPSKSYS  661

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVM-EPDGVSVIVKPKVLKF  1608
               DLNYPSFAV  D      ++ +TRT T+VG     Y+V V  E  GV + V+P VL F
Sbjct  662   VADLNYPSFAVNVD---GAGAYKYTRTVTSVG-GAGTYSVKVASETTGVKISVEPAVLDF  717

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
                 +  SYTV+F     K    G +SFGS+ W      V SP+A+ W
Sbjct  718   KAANEKKSYTVTFTVDSTK--GSGSNSFGSIEWSDGKHVVGSPVAISW  763



>ref|XP_009596091.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=764

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/588 (51%), Positives = 391/588 (66%), Gaps = 14/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYE-SIVGKI-NETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR F KGY+ S  G   N+  + +SPRD +GHGTHT+STAAG  V +AS LG A 
Sbjct  182   KKLIGARFFSKGYQMSASGSFTNQPRQPESPRDQDGHGTHTSSTAAGAPVANASLLGYAS  241

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G A GM   AR+A YK C+  GC   D+LA +++A+ DGVD+LSLSLGG    P+Y D I
Sbjct  242   GVARGMAPRARVATYKVCWPTGCFGSDILAGMERAILDGVDVLSLSLGGGS-GPYYHDTI  300

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AF A +KG+ V  SAGNSGP  +S++NTAPWIMTV A ++DR FPA   LGNG+   
Sbjct  301   AIGAFSAMEKGIVVSCSAGNSGPAKASLANTAPWIMTVGAGTIDRDFPAFATLGNGKKIT  360

Query  535   GESLYSGKAVNQKL-PLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSGK + +K+ PLVY   +    A  C  GSL  ++V+G+IV+C+RG +AR EKG 
Sbjct  361   GVSLYSGKGMGKKVVPLVYSTDSS---ASLCLPGSLDPKIVRGKIVLCDRGTNARVEKGL  417

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GG GMIL N    GEE+ AD H LPA A+G   G  +++Y+ S K+  A + F G
Sbjct  418   VVKEAGGVGMILANTAESGEELVADSHLLPAVAVGRKLGDFIRQYVKSEKNPAAVLSFGG  477

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   + +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILAAW   IGPT LE D R  +F
Sbjct  478   TVVNVKPSPVVAAFSSRGPNTVTPQILKPDVIGPGVNILAAWSEAIGPTGLEKDTRRTKF  537

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SGLAALLK+ H +WSP+AIKSALMTT+Y  D+  SP+ D+       
Sbjct  538   NIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYVHDTTNSPLRDAEGGQ--L  595

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             +TPFA GSGHVDP +A  PGLIYDI+ +DY  +LCSL+Y    I  ++++ +        
Sbjct  596   STPFAHGSGHVDPHKALSPGLIYDITPEDYIKFLCSLDYELNHIQAIVKRPNVTCAKKFA  655

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG +NYPSF+V+F  S       +TR  TNV    SVY V V  P  V V VKP  L F
Sbjct  656   DPGQINYPSFSVLFGKSRVVR---YTRAVTNVAAAGSVYEVVVDAPPSVLVTVKPSKLVF  712

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              ++G+ L YTV+FV+ +G +      +FGS+ W +    VRSP++  W
Sbjct  713   KRVGERLRYTVTFVSNKG-VNMMRKSAFGSISWNNAQNQVRSPVSYSW  759



>ref|XP_006383545.1| hypothetical protein POPTR_0005s18880g [Populus trichocarpa]
 gb|ERP61342.1| hypothetical protein POPTR_0005s18880g [Populus trichocarpa]
Length=766

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/588 (51%), Positives = 395/588 (67%), Gaps = 10/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F +GYE+ +G ++E+ E KSPRD +GHGTHT+STA G  V DAS  G A G+
Sbjct  184   RKLIGARFFARGYEATLGPVDESKESKSPRDDDGHGTHTSSTAGGSSVADASLFGYAAGT  243

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A YK C+  GC S D+LAA+D+A+ DGV++LS+SLGG +   +Y D++AI
Sbjct  244   ARGMAARARVAVYKVCWVGGCFSSDILAAMDKAIDDGVNVLSMSLGGSMSY-YYRDSVAI  302

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A +KG+FV  SAGN+GP + S+SN APWI TV A +LDR FPA V LGNG+ + G 
Sbjct  303   GAFAAMEKGIFVSCSAGNAGPSSYSLSNVAPWITTVGAGTLDRDFPAFVSLGNGKNYSGV  362

Query  541   SLYSGKAV--NQKLPLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             SLY G A+   + LP VY G  +       C  G+L    V G+IV+C+RG + R +KG+
Sbjct  363   SLYKGDAILPGKLLPFVYAGNASNATNGNLCMMGTLIPEQVAGKIVLCDRGVNPRVQKGA  422

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GG GM+L N +  GEE+ AD H LPATA+G   G  +K Y+ S    TA+I F+G
Sbjct  423   VVKAAGGIGMVLSNTDANGEELVADAHLLPATAVGKKGGDEIKNYLFSDPKPTATILFEG  482

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             T  G + +PV+AAFSSRGP++++P+I+KPD+ APGVNILA W  + GPT L  D R VEF
Sbjct  483   TKVGIQPSPVVAAFSSRGPNSITPDILKPDMIAPGVNILAGWVGSAGPTGLATDGRRVEF  542

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPHVSGLAAL+K+ H DWSPAAIKSALMTT+Y      + + D V+T   S
Sbjct  543   NIISGTSMSCPHVSGLAALIKAAHPDWSPAAIKSALMTTAYVTYKNGNKLQD-VATGKDS  601

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
              TPF  G+GHVDP  A +PGL+YD++  DY N+LC+LNY++T+I+ L R+K  C     +
Sbjct  602   -TPFDHGAGHVDPVSALNPGLVYDLTADDYLNFLCALNYSATEITSLARRKFTCDASKKY  660

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
                DLNYPSFAV F S  +++    +RT TNVG P +   +  ++  GV V V+P+ L F
Sbjct  661   SVTDLNYPSFAVNFGSGGADAVIKHSRTLTNVGAPGTYKVLITLQSPGVKVAVEPETLSF  720

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              +  +  SYTV+F    G       +SFG + W +    V SPIAV W
Sbjct  721   RQANEKKSYTVTFT---GSSMPADTNSFGRIEWSNGKQIVGSPIAVSW  765



>ref|XP_010261833.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=783

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/599 (51%), Positives = 386/599 (64%), Gaps = 20/599 (3%)
 Frame = +1

Query  4     KLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             K++GAR FY+GYE+ +G+ +N+TVE KSPRD+EGHGTHTASTAAG  V++A F   A G 
Sbjct  183   KIIGARAFYRGYEAALGRPMNDTVESKSPRDTEGHGTHTASTAAGAAVREAGFYKFAVGE  242

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggl-lPKPFYTDNIA  357
             A GM   ARIAAYK C+ LGC   D+LAA+D A+ DGV I+SLS+G      P+Y D+IA
Sbjct  243   ARGMATRARIAAYKVCWKLGCFDSDILAAMDHAIADGVHIISLSVGATGYAPPYYHDSIA  302

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AFGA QKGV V  SAGNSGP   +  N APWI+TV AS++DR FPA V LG+GRVF G
Sbjct  303   IGAFGAIQKGVLVSCSAGNSGPEPYTAVNIAPWIITVGASTIDREFPADVVLGDGRVFNG  362

Query  538   ESLYSGKAVNQK---LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
              SLYSG  +      LPLVY   A   G+  C  G L    V G+IVVC+RG +AR EKG
Sbjct  363   VSLYSGDPLGDSGHLLPLVY---AADCGSRLCYPGKLDPTKVAGKIVVCDRGGNARVEKG  419

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQ  888
             S +K SGGAGMI+ N    GEE+ AD H LPAT +G ++G  ++ YI S  S TA+I F+
Sbjct  420   SAIKISGGAGMIMANTAESGEELIADSHLLPATMVGQTSGDKIRDYIRSDPSPTATIVFR  479

Query  889   GTVYGN--RAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
             GTV G    AP +A+FSSRGP+  + EI+KPDV APGVNILA W    GPT L+ D R V
Sbjct  480   GTVIGASPSAPKVASFSSRGPNYQTAEILKPDVIAPGVNILAGWTGYNGPTDLDIDPRRV  539

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             EFNI+SGTSM+CPHVSGLAALL+  +  W+PAA+KSALMTT+Y LD+    I+D  +   
Sbjct  540   EFNIISGTSMACPHVSGLAALLRKAYPKWTPAALKSALMTTAYNLDNGGKNISDLATGK-  598

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA---CP  1413
               +TPF  G+GHVDP RA  PGL+YDIS  DY  +LCS+ Y+   I+L +R  +    C 
Sbjct  599   -ESTPFVHGAGHVDPNRALDPGLVYDISVNDYVEFLCSIGYDEKMIALFIRDGNTSVNCS  657

Query  1414  THHHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIP-ESVYAVHVMEPDGVSVIVK  1590
                   PGDLNYPSF+V+F  +       + R  TNVG   ++VY   V  PD V + V 
Sbjct  658   AQSLPSPGDLNYPSFSVVFKLNGGKDVVKYRRVVTNVGDSVDAVYEAKVWGPDSVEISVS  717

Query  1591  PKVLKFNKMGQNLSYTVSFVA----QRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             P  L F+   +  SY ++F +       +  +     FG + W   +  VRSPIA  WQ
Sbjct  718   PSKLVFSGEEERQSYEITFKSVVPPNETEERTASASKFGWIEWSDGSHRVRSPIAFWWQ  776



>ref|XP_008792868.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=766

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/589 (51%), Positives = 397/589 (67%), Gaps = 12/589 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGAR+F +G+ +  G  +   E  SPRD EGHGTHTASTAAG  V +AS LG A G+
Sbjct  185   RKLVGARSFSRGFRASRG--DAEGERASPRDREGHGTHTASTAAGAPVANASLLGYAPGT  242

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+T GC   D+LA +DQA++DGVDILSLSLGG    P+  D IA+
Sbjct  243   ARGMAPGARVAAYKVCWTSGCYGSDILAGIDQAIEDGVDILSLSLGGGS-APYSRDPIAV  301

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
               F A Q+G+F   SAGNSGP  SS++NTAPWI T+ A +LDR FPA  ELGNG+ F G 
Sbjct  302   GTFSAVQRGIFAACSAGNSGPSRSSLTNTAPWIATIGAGTLDRDFPAYAELGNGKRFTGV  361

Query  541   SLYSGKAVNQKL-PLVYGR--TAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             SLY G  + +K+ P+VYG+    G   ++FC  GSL+   VKG++V C+RG +AR EKG 
Sbjct  362   SLYGGDGMGKKMVPIVYGKGVQVGSNSSKFCLPGSLNPAEVKGKVVFCDRGINARVEKGE  421

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GG GMIL N    G+E+ AD H LPA A+G  +G  +++Y+ S     A + F+G
Sbjct  422   VVKEAGGVGMILANAAANGDELVADSHLLPAVAVGAKSGDLIREYVQSDADPMAVLSFEG  481

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   R +PV+AAFSSRGP+ V P ++KPDV  PGVNILAAW   IGPT L  D R  EF
Sbjct  482   TVLDVRPSPVVAAFSSRGPNMVVPRLLKPDVIGPGVNILAAWSGAIGPTGLVKDERRPEF  541

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SG+AALLK+ H DWSP+AIKSALMTT+YT+D+  S + D+   +  +
Sbjct  542   NIMSGTSMSCPHISGVAALLKAAHPDWSPSAIKSALMTTAYTVDNTGSLLRDAAGGS--N  599

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             A P+ +GSG+VDP++A  PGL+YDI+ +DY  +LCSL+Y++  I  + +  +   +    
Sbjct  600   ANPWIYGSGYVDPQKALSPGLVYDIAAEDYTAFLCSLDYSTNHILAISQSPNTTCSRRLS  659

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG+LNYPSF+VIF   S      ++R  TNVG+  SVY +    P  VSV V+P  L F
Sbjct  660   DPGNLNYPSFSVIFGRKSRRIVR-YSRELTNVGLSGSVYNLTYSGPPSVSVTVRPTKLVF  718

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
              ++G+ L YTV+F ++  K  +    +FG + WK+    VRSPI+ +WQ
Sbjct  719   KQVGEKLKYTVTFTSK--KQGNPTDMAFGWISWKNEQHQVRSPISYMWQ  765



>ref|XP_010109072.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC20872.1| Subtilisin-like protease [Morus notabilis]
Length=770

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/588 (51%), Positives = 393/588 (67%), Gaps = 13/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FY+GYE+  GKIN   EYKSPRD +GHGTHTA+T AG  VK A+ LG A G+
Sbjct  184   RKIVGARMFYRGYEAATGKINPQSEYKSPRDQDGHGTHTAATVAGSPVKGANLLGYAYGT  243

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C+  GC S D+L+AVD+AV DGV++LS+SLGG +   +Y D++++
Sbjct  244   ARGMAPGARIAAYKVCWVGGCFSSDILSAVDRAVADGVNVLSISLGGGVSS-YYRDSLSV  302

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A+FGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FPA V+LG G+   G 
Sbjct  303   ASFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTGKTISGV  362

Query  541   SLYSGKAV---NQKLPLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+     N++ P++Y    +     +  C  G+L  R V G+IV+C+RG S R +K
Sbjct  363   SLYKGRKTLGSNKQYPIIYMGSNSTSPDPSSLCLEGTLDRRKVAGKIVICDRGISPRVQK  422

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VK +GG GMIL N    GEE+ AD H +PA A+G S    +K Y  ++   TAS+ F
Sbjct  423   GQVVKDAGGVGMILANTAANGEELVADSHLIPAVAVGESKAKEIKHYALTNPKTTASLAF  482

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G R +PV+AAFSSRGP+ ++ EI+KPD+ APGVNILAAW  ++GP+ L  D R V
Sbjct  483   LGTRLGIRPSPVVAAFSSRGPNFLTLEILKPDMVAPGVNILAAWTGDLGPSSLPTDKRRV  542

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AALLK+ H DWSPAAIKSALMTT+Y  D+  +P+ D+ +  P
Sbjct  543   KFNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALMTTAYVHDNTLNPLKDASTAVP  602

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               + P+  G+GHV+P +A  PGL+YDI  QDY+ +LC+ +   TQ+ +  +  +    H 
Sbjct  603   --SNPYDHGAGHVNPRKALDPGLVYDIRPQDYYEFLCTQSLTPTQLKVFSKYANRTCKHS  660

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
                PG+LNYP+ +V+F   +S S  +  RT TNVG P S Y V V    G SV V+PK L
Sbjct  661   LAGPGELNYPAISVVFPEKASVSVISVRRTVTNVGPPVSNYHVSVSPFRGASVKVEPKSL  720

Query  1603  KFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAV  1746
              FNK GQ LSY V+F  +  + A      FG LVWK     VRSPIA+
Sbjct  721   SFNKAGQKLSYKVTFTTKSLQTAP----EFGDLVWKDGVHKVRSPIAI  764



>emb|CDP20511.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/595 (52%), Positives = 392/595 (66%), Gaps = 17/595 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVG-KINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KK++GAR +YKGYE+ +G  + E  E KSPRDSEGHGTHTASTAAG +VK+AS    ARG
Sbjct  182   KKIIGARAYYKGYEANLGMSLQEAGESKSPRDSEGHGTHTASTAAGSVVKNASLYEYARG  241

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT-DNI  354
              A GM   AR+AAYK C++ GC   D+LAA+DQA+ DGV ++SLS+G     P Y  D+I
Sbjct  242   EARGMAIKARVAAYKICWSAGCFDSDILAAMDQAIDDGVHVISLSVGANGYAPQYDHDSI  301

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AFGA + G+    SAGNSGP   +  N APWI+TV AS++DR FPA V LG+G ++ 
Sbjct  302   AIGAFGAAKYGIVTSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADVVLGDGSIYG  361

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGN-SARAEKG  708
             G SLY+G+ + + +LPLVY   AG  G+ +C  G L S  VKG+IV+C+RG  +AR  KG
Sbjct  362   GVSLYAGEPLGDTQLPLVY---AGDCGSSYCYEGRLDSSKVKGKIVICDRGGGNARMAKG  418

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQ  888
             + VK +GG GMIL N    GEE+ AD H +PAT +G  AG  +K Y+ S  S TA+I F+
Sbjct  419   TAVKLAGGGGMILANLADSGEELIADSHLIPATNVGQKAGDKIKSYLRSEPSPTATIVFR  478

Query  889   GTVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
             GTV G+   AP +AAFSSRGP+ ++PEI+KPDV APGVNILA W   +GP+ L+ D R V
Sbjct  479   GTVIGSSPSAPRVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGLVGPSQLDIDPRRV  538

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             EFNI SGTSMSCPHVSGLAALL+  H  W+PAAIKSALMTT+Y +D+    I D  +   
Sbjct  539   EFNIASGTSMSCPHVSGLAALLRKAHPKWTPAAIKSALMTTAYNVDNIGESIKDLATGE-  597

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA---CP  1413
               + PF  GSGHVDP RA +PGL+YD+ T DY  +LC++ Y+  +I++ +R       C 
Sbjct  598   -ESNPFVHGSGHVDPNRALNPGLVYDLGTSDYVAFLCAVGYSPGRIAVFVRDGPVPVDCG  656

Query  1414  THHHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGI-PESVYAVHVMEPDGVSVIVK  1590
                   PGDLNYPSF+V+F   +S     +TR   NVG   E+VY V V  P  V V V 
Sbjct  657   AQGMGTPGDLNYPSFSVVFSPGNSVV--KYTRVVKNVGSNAEAVYEVKVNAPPSVEVTVS  714

Query  1591  PKVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             P  L F++    LSY VSF    G +      +FGSL W      VRSPIAV+W+
Sbjct  715   PSQLVFSQGNDTLSYEVSFTTASGILVGALKPAFGSLEWSDGEHLVRSPIAVVWR  769



>ref|XP_002321861.2| subtilase family protein [Populus trichocarpa]
 gb|EEF05988.2| subtilase family protein [Populus trichocarpa]
Length=778

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/590 (50%), Positives = 395/590 (67%), Gaps = 13/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FY+GYE+  GKINE  EYKSPRD +GHGTHTA+T AG  V+ A+ LG A G+
Sbjct  191   RKIVGARVFYRGYEAATGKINEQNEYKSPRDQDGHGTHTAATVAGSPVRGANLLGYAYGT  250

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C+  GC S D+L+AVD+AV DGV++LS+SLGG +   +Y D+++I
Sbjct  251   ARGMAPGARIAAYKVCWAGGCFSSDILSAVDRAVADGVNVLSISLGGGVSS-YYRDSLSI  309

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA + GVFV  SAGN GP  +S++N +PWI TV ASS+DR FPA   +G G+   G 
Sbjct  310   AAFGAMEMGVFVSCSAGNGGPSPASLTNVSPWITTVGASSMDRDFPATAMIGTGKTISGV  369

Query  541   SLYSGKAV---NQKLPLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+ +    ++ PLVY    ++    +  C  G+L+ R+V G+IV+C+RG + R +K
Sbjct  370   SLYRGQRILSTRKQYPLVYMGSNSSSPDPSSLCLEGTLNPRVVSGKIVICDRGITPRVQK  429

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G   K +G  GMIL N    GEE+ AD H LPA A+G   G  +K Y  +S++ATA++ F
Sbjct  430   GQVAKEAGAVGMILSNTAANGEELVADCHLLPAVAVGEKEGKLIKTYALTSQNATATLAF  489

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G + +PV+AAFSSRGP+ ++ EI+KPDV APGVNILAAW  ++GP+ L  D+R V
Sbjct  490   LGTRLGIKPSPVVAAFSSRGPNFLTLEILKPDVLAPGVNILAAWTGDLGPSSLPTDHRRV  549

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
             +FNILSGTSMSCPHVSG+AALLK+ H +WSPAAIKSALMTT+Y  D+  +P+ D+ +T P
Sbjct  550   KFNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVHDNTHNPLKDASATTP  609

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               +TP+  G+GH++P +A  PGLIYDI  QDYF++LC+     TQ+ +  +  +    H 
Sbjct  610   --STPYDHGAGHINPMKALDPGLIYDIEPQDYFDFLCTQKLTPTQLKVFGKYANRSCRHS  667

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
                PGDLNYP+ +V+F   +S    T  RT TNVG+P S Y   +    G +V V+P++L
Sbjct  668   LANPGDLNYPAISVVFPDDTSIKVLTLHRTVTNVGLPTSKYHAVISPFKGATVKVEPEIL  727

Query  1603  KFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              F    Q LSY + F  +  +        FG LVWK     VRSP+ + W
Sbjct  728   NFTMKNQKLSYKIIFTTRTRQTIP----EFGGLVWKDGAHKVRSPVVITW  773



>ref|XP_011072593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=774

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/597 (52%), Positives = 395/597 (66%), Gaps = 19/597 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KK++GA+TFY GYE+  GK + E+ E KSPRD+EGHGTHTASTAAG  V +AS  G A+G
Sbjct  178   KKIIGAKTFYLGYEASRGKTMEESNESKSPRDTEGHGTHTASTAAGSRVVNASLFGYAKG  237

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT-DNI  354
              A GM   ARIA YK C+  GC   D+LAA++ A++DGVD++SLS+G     P Y  D+I
Sbjct  238   EARGMAVKARIAVYKICWAFGCYDSDILAAMEHAIEDGVDVISLSVGANGYAPQYDFDSI  297

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AFGA + G+ V  SAGNSGP + +  N APWI+TV AS+LDR FPA V LG+GR F 
Sbjct  298   AIGAFGAAEHGIVVSCSAGNSGPDSYTAVNIAPWILTVGASTLDREFPADVILGDGRTFG  357

Query  535   GESLYSGKAVNQKL-PLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLY G ++ +KL PLVYG   G +   +C  G L    V G+IV+C+RG +AR EKG+
Sbjct  358   GVSLYHGDSLGEKLLPLVYGADCGSR---YCYTGQLDPAKVAGKIVICDRGGNARVEKGN  414

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V  +GGAG+I+ N    GEE+ AD HF+PAT +G +AG  ++ Y  S  + TA+I F+G
Sbjct  415   AVHVAGGAGLIMANLADSGEELLADAHFIPATMVGQTAGDKIRAYARSDPNPTATIAFRG  474

Query  892   TVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             TV      AP +A+FSSRGPS  + EI+KPDV APGVNILA W   IGPT LE+D R VE
Sbjct  475   TVISTSPPAPRVASFSSRGPSYRTAEILKPDVIAPGVNILAGWTGYIGPTDLESDTRKVE  534

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSMSCPHVSGLAALL+  H  WSPAAIKSALMTT+Y LD+    ITD  + +  
Sbjct  535   FNIISGTSMSCPHVSGLAALLRKAHPKWSPAAIKSALMTTAYNLDNSGGNITDLATGS--  592

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA--CPTH  1419
              + PF  GSGHVDP RA  PGL+YD+   DY  +LC++ Y+S +IS+  ++ S+  C   
Sbjct  593   ESNPFVHGSGHVDPNRAVDPGLVYDLEITDYVAFLCTIGYDSRRISVFTKQASSVDCDAL  652

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIP-ESVYAVHVMEPDGVSVIVKPK  1596
                 PG+LNYPSF+V+F  S S     + RT  NVG    +VY V V  P GV V V P 
Sbjct  653   GFKTPGNLNYPSFSVVFSGSESVV--KYKRTVKNVGKEANAVYEVKVNTPLGVEVSVSPS  710

Query  1597  VLKFNKMGQNLSYTVSFVAQRGKIA---SGGGHSFGSLVWKS-TNFTVRSPIAVIWQ  1755
              L F++    LSY V+F +    +    +G   SFGS+ W    +  VRSPIAV+W+
Sbjct  711   KLVFSEKEDKLSYEVTFKSSANAVGFEITGSKSSFGSIEWSDGGSHLVRSPIAVLWR  767



>emb|CDX99895.1| BnaC09g28100D [Brassica napus]
Length=775

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/592 (50%), Positives = 399/592 (67%), Gaps = 15/592 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FY+GYE+  GKI++ +EY+SPRD +GHGTHTA+T AG  V+ A+ LG A G+
Sbjct  187   RKIVGARVFYRGYEAATGKIDQELEYRSPRDKDGHGTHTAATVAGSPVRGANLLGFAYGT  246

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC S D+L+AVDQAV DGV +LS+SLGG +   +  D++AI
Sbjct  247   ARGMAPKARVAAYKVCWVGGCFSSDILSAVDQAVADGVHVLSISLGGGI-STYSRDSLAI  305

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA + GVFV  SAGN GP   S++N +PWI TV AS++DR FPA V+LG  RVF+G 
Sbjct  306   ATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVKLGTTRVFKGV  365

Query  541   SLYSGKAV---NQKLPLVY-GRTAGGKG-AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+ V    ++ PLVY GR A       FC  G+L    V G+IV+C+RG + R +K
Sbjct  366   SLYKGRTVLSRAKQYPLVYLGRNASSPDPTSFCLDGALDQHNVAGKIVICDRGVTPRVQK  425

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VKR+GG G+IL N  T GEE+ AD H LPA A+G   G  +K+Y  +SK ATAS++ 
Sbjct  426   GQVVKRAGGVGIILTNTATNGEELVADCHLLPAVAVGEKEGKVIKEYAMTSKRATASLEI  485

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G + +PV+AAFSSRGP+ +S EI+KPD+ APGVNILAAW  ++ P+ L +D R V
Sbjct  486   LGTRVGIKPSPVVAAFSSRGPNFLSLEILKPDLLAPGVNILAAWSGDMAPSSLSSDKRRV  545

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
              FNILSGTSMSCPHVSG+AAL++S H DWSPAA+KSALMTT+Y  D+   P+TD+    P
Sbjct  546   NFNILSGTSMSCPHVSGVAALIRSRHPDWSPAAVKSALMTTAYVHDNMLEPLTDAAGAEP  605

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               ++P+  G+GH+DP +A  PGL+YDI  Q+YF++LC+   + +Q+ +  +  +    H 
Sbjct  606   --SSPYDHGAGHIDPLKAMDPGLVYDIGPQEYFDFLCTQELSPSQLKVFTKHSNRSCRHS  663

Query  1423  H--HQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPK  1596
                + PG+LNYP+ + +F  ++   + T  RT TNVG   S Y V +    G +V V+PK
Sbjct  664   LAGNNPGNLNYPAISALFPENTHVKAMTLRRTVTNVGPHVSSYKVSLSPFKGATVTVQPK  723

Query  1597  VLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              L F    Q LSYTV+F   R K+       FG L+WKS+   VRSP+ + W
Sbjct  724   TLNFTTKHQKLSYTVTF---RTKLRMKRPE-FGGLLWKSSTHKVRSPVIITW  771



>ref|XP_004141706.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004155913.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN45480.1| Subtilase family protein [Cucumis sativus]
Length=771

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/590 (53%), Positives = 393/590 (67%), Gaps = 19/590 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYES-IVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             +K++GAR ++ GYES + G +  + ++KS RD+EGHGTHTASTAAG  V +ASF   ARG
Sbjct  182   RKIIGARAYFYGYESNLRGSLKVSSDFKSARDTEGHGTHTASTAAGSFVNNASFFQYARG  241

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKP-FYTDNI  354
              A GM   ARIAAYK C+  GC   D+LAA+DQA+ DGVD++SLS+G     P +Y D+I
Sbjct  242   EARGMASRARIAAYKICWEFGCYDSDILAAMDQAISDGVDVISLSVGSSGRAPAYYRDSI  301

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AFGA Q GV V  SAGNSGP   +  N APWI+TV AS++DR F A V LG+GRVF 
Sbjct  302   AIGAFGAMQHGVVVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFLADVILGDGRVFS  361

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  + + KL LVYG   G  G+ +C  GSL S  V G+IVVC+RG +AR  KG 
Sbjct  362   GVSLYSGDPLGDSKLQLVYG---GDCGSRYCYSGSLDSSKVAGKIVVCDRGGNARVAKGG  418

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GG GM+L N E  GEE+ AD H +P T +G  AG  ++ YI++  + TA+I F+G
Sbjct  419   AVKSAGGLGMVLANTEENGEELLADSHLIPGTMVGAIAGNKLRDYIHTDPNPTATIVFRG  478

Query  892   TVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             TV G+   AP +AAFSSRGP+  + EI+KPDV APGVNILA W     PT L  D R VE
Sbjct  479   TVIGDSPPAPRVAAFSSRGPNYRTAEILKPDVIAPGVNILAGWSGYSSPTGLNIDPRRVE  538

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSMSCPHVSG+AALL+     WSPAAIKSAL+TTSY+LDS   PI D +ST+  
Sbjct  539   FNIISGTSMSCPHVSGVAALLRKAFPTWSPAAIKSALITTSYSLDSSGKPIKD-LSTSE-  596

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHH  1425
              + PF  G+GH++P +A +PGLIYD++ QDY ++LCS+ Y+S QI++ ++  S      H
Sbjct  597   ESNPFVHGAGHINPNQALNPGLIYDLTPQDYVSFLCSIGYDSKQIAVFVKGSSYFQLCEH  656

Query  1426  H--QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIP-ESVYAVHVMEPDGVSVIVKPK  1596
                 PG+LNYPSF+V+FD         +TRT TNVG   E VY V V  P GV + V P 
Sbjct  657   KLTNPGNLNYPSFSVVFDEEEVV---KYTRTVTNVGDETEVVYEVKVEAPQGVVISVVPN  713

Query  1597  VLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAV  1746
              L+FNK     SY ++F    G   S    SFGS+ W     +VRSPIAV
Sbjct  714   KLEFNKEKTTQSYEITFTKINGFKESA---SFGSIQWGDGIHSVRSPIAV  760



>ref|XP_008228179.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=810

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/593 (52%), Positives = 401/593 (68%), Gaps = 19/593 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKI-NETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             +K++GAR ++ GYES +G++ +ET E KSPRD+EGHGTHTASTAAG +V +ASF   A+G
Sbjct  219   RKIIGARAYFNGYESHIGRLMDETAEAKSPRDTEGHGTHTASTAAGAVVANASFFSYAQG  278

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT-DNI  354
              A GM   ARIA YK C++ GC   D+LAA+DQA+ DGVDI+SLS+G     P Y  D+I
Sbjct  279   EARGMATKARIAVYKICWSSGCFDSDILAAMDQAIADGVDIISLSVGAGGRAPPYDRDSI  338

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AFGA Q GV V +SAGNSGP   + +N APWI+TV AS++DR FPA V LG+ RV  
Sbjct  339   AIGAFGAAQHGVLVSASAGNSGPNPFTATNIAPWILTVGASTIDREFPADVVLGDNRVIS  398

Query  535   GESLYSGKA-VNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG+  V+ KLPLV+G   G  G+ +C  G+L    V+G+IVVC+RG +AR  KG 
Sbjct  399   GVSLYSGEPLVDYKLPLVHG---GDCGSRYCYEGALQPSKVQGKIVVCDRGGNARVAKGG  455

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GG GMIL N E  GEE+ AD H +PAT +G  A   +++YI  S+  TA+I F+G
Sbjct  456   AVKLAGGLGMILANTEESGEELLADGHLIPATEVGEIAANQIREYIRLSQYPTATIVFRG  515

Query  892   TVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             TV G+   +P +AAFSSRGP++++PEI+KPDV APGVNILA W     PT L+ D R VE
Sbjct  516   TVIGSSPSSPRVAAFSSRGPNSLTPEILKPDVIAPGVNILAGWTGATAPTDLDIDPRRVE  575

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSMSCPHVSG+AALL+  + +WS AAIKSAL+TT+YTLD+    I D  +    
Sbjct  576   FNIISGTSMSCPHVSGIAALLRKAYPNWSIAAIKSALITTAYTLDNAGKKINDLGTGE--  633

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA---CPT  1416
              +TPF  G+GHVDP RA +PGL+YD++  DY  +LCS+ Y+  QI++ + K +    C  
Sbjct  634   ESTPFVHGAGHVDPNRALNPGLVYDLNVNDYVAFLCSIGYSPRQIAVFVGKPTGSDICTR  693

Query  1417  HHHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIP-ESVYAVHVMEPDGVSVIVKP  1593
             +    PGDLNYPSF+V+  S        + R ATNVG   ++VY V V  P GV + V+P
Sbjct  694   NSLASPGDLNYPSFSVVLSSDQGLVK--YKRIATNVGADADAVYEVTVNAPAGVEISVEP  751

Query  1594  KVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             + L F+   Q  SY V+F  +RG +    G  +GS+ W      VRSP+AV W
Sbjct  752   RKLVFSAENQTQSYEVTF--KRG-VGYDSGERYGSIEWTDGRHLVRSPVAVRW  801



>ref|XP_006407103.1| hypothetical protein EUTSA_v10020111mg [Eutrema salsugineum]
 gb|ESQ48556.1| hypothetical protein EUTSA_v10020111mg [Eutrema salsugineum]
Length=779

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/601 (51%), Positives = 404/601 (67%), Gaps = 19/601 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGAR F  GYE+  GK+NET E++SPRDS+GHGTHTAS +AG  V  AS LG ARG 
Sbjct  179   RKLVGARFFCGGYEATNGKMNETTEFRSPRDSDGHGTHTASISAGRYVFPASTLGYARGV  238

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D IAI
Sbjct  239   ASGMAPKARLAAYKVCWNSGCYDSDILAAFDTAVSDGVDVVSLSVGGVV-VPYYLDAIAI  297

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA  +G+FV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNG+   G 
Sbjct  298   GAFGAIDRGIFVSASAGNGGPGALTVTNVAPWMTTVGAGTIDRDFPASVKLGNGKTIPGV  357

Query  541   SLYSGKAV--NQKLPLVYGRTA-GGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             S+Y G  +  N+  PLVYG +  GG G  +  C  GSL   LVKG+IV+C+RG ++RA K
Sbjct  358   SVYGGPDLDPNRMYPLVYGGSLLGGDGYSSSLCIEGSLDPNLVKGKIVLCDRGINSRATK  417

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSA------  867
             G  V+++GG GMI+ N   +GE + AD H LPAT++G S G  +++YI+ S  +      
Sbjct  418   GEIVRKNGGLGMIIANGVFDGEGLVADCHVLPATSVGASGGDEIRRYISESSKSRSSSKH  477

Query  868   -TASIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTML  1041
              TA+I F+GT  G R APV+A+FS+RGP+  +P+IIKPDV APG+NILAAWP  IGP+ +
Sbjct  478   PTATIVFKGTRLGIRPAPVVASFSARGPNPETPDIIKPDVIAPGLNILAAWPDRIGPSGV  537

Query  1042  EADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPIT  1221
              +DNR  EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+YT+D+R  P+ 
Sbjct  538   PSDNRRTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALMTTAYTVDNRDEPMR  597

Query  1222  DSVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKK  1401
             D  + N  +++   +GSGHV P +A  PGL+YDI++ DY N+LC+ NY    I  + R+K
Sbjct  598   DESTGN--TSSVMDYGSGHVHPTKAMDPGLVYDITSYDYINFLCNSNYTGANIVTITRRK  655

Query  1402  SACP-THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGV  1575
             + C         G+LNYPSF+V+F     +   T F RT TNVG  +SVY V +  P G 
Sbjct  656   ADCDGARRAGHVGNLNYPSFSVVFQQYGESKMSTHFIRTVTNVGDSDSVYEVKIRPPRGT  715

Query  1576  SVIVKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIW  1752
             +V V+P+ L F ++GQ L++ V       K++ G      G +VW      V SP+ V  
Sbjct  716   TVTVEPEKLSFRRVGQKLNFVVRVKTTEVKLSPGATSVETGYVVWSDGKRNVTSPLVVTL  775

Query  1753  Q  1755
             Q
Sbjct  776   Q  776



>emb|CAN75239.1| hypothetical protein VITISV_014205 [Vitis vinifera]
Length=768

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/597 (52%), Positives = 392/597 (66%), Gaps = 23/597 (4%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             +K++GARTF++GYES +G+ I+E+ E KSPRD+EGHGTHTASTAAG +V++AS    A G
Sbjct  176   RKIIGARTFHRGYESALGRQIDESEESKSPRDTEGHGTHTASTAAGSVVQNASMFEYANG  235

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT-DNI  354
              A GM   ARIA YK C+  GC   D+LAA+DQA+ DGV ++SLS+G     P Y  D+I
Sbjct  236   EARGMATKARIAVYKICWNQGCLDSDILAAMDQAIADGVHVISLSVGAKGLAPKYDRDSI  295

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AFGA + GV V  S GNSGP   +  N APWI+TV AS++DR FPA V LGNGR+FR
Sbjct  296   AIGAFGAMEHGVIVSCSVGNSGPKPFTAVNIAPWILTVGASTIDREFPADVVLGNGRIFR  355

Query  535   GESLYSGKAVNQ-KLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLY+G  +N   LPLV     G +    C  G L+  LV G+IVVC+RG   R EKG 
Sbjct  356   GVSLYTGDPLNAPHLPLVLADECGSR---LCVAGKLNPSLVSGKIVVCDRGGGKRVEKGR  412

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GGAGMIL N +T GEE+ AD H +PAT +G +AG  +K+Y +S  S TA+I F+G
Sbjct  413   AVKLAGGAGMILANTKTTGEELVADSHLIPATMVGKTAGDEIKRYADSKSSPTATIAFRG  472

Query  892   TVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             TV GN   AP +A+FSSRGP+ ++PEI+KPDV APGVNILA W  +  PT L+ D R VE
Sbjct  473   TVMGNSLLAPKVASFSSRGPNRLTPEILKPDVIAPGVNILAGWTGSNSPTGLDMDERRVE  532

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSM+CPHVSGLAALL+  H DWSPAAIKSALMTT+Y  D+  S ITD  S N  
Sbjct  533   FNIISGTSMACPHVSGLAALLRKAHPDWSPAAIKSALMTTAYNSDNSGSQITDLASGN--  590

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRK--KSACPTH  1419
              +TP   GSGHV+P  A  PGL+YDI   DY  +LCS+ Y S  I + +R   K  C + 
Sbjct  591   KSTPLIHGSGHVNPIGALDPGLVYDIGPDDYVTFLCSVGY-SENIEIFVRDGTKVNCDS-  648

Query  1420  HHHQPGDLNYPSFAVIFDssssnssH----TFTRTATNVG-IPESVYAVHVMEPDGVSVI  1584
                +PGDLNYPSF+V+F++ S+           R   NVG   ++VY+V V  P  V + 
Sbjct  649   QKMKPGDLNYPSFSVVFNADSAVIKRGGVVKHKRVVRNVGSSKDAVYSVKVNSPPSVKIN  708

Query  1585  VKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             V P  L F +  Q  SY V+F +    + +     FGS+ W   +  VRSP+AV W 
Sbjct  709   VSPSKLVFTEKNQVASYEVTFTSVGASLMT----VFGSIEWTDGSHRVRSPVAVRWH  761



>ref|XP_007154575.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
 gb|ESW26569.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
Length=761

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/587 (51%), Positives = 391/587 (67%), Gaps = 9/587 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
              KL+GAR+F KGY    G   +  +  SPRD  GHGTHTAS AAG  V +A+ LG A G+
Sbjct  178   NKLIGARSFSKGYRMASGNARKPRDLASPRDGNGHGTHTASIAAGSAVSNATLLGYATGT  237

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPK-PFYTDNIA  357
             A GM   AR+AAYK C+T GC + D+LA +DQA++DGVD+LSLSLGG     P+Y D IA
Sbjct  238   ARGMAPQARVAAYKVCWTDGCFASDILAGMDQAIQDGVDVLSLSLGGSSSSVPYYFDTIA  297

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             I AF A ++G+FV  SAGN+GP + SV+N APWIMTV A +LDR FPA V LGNG+ F G
Sbjct  298   IGAFAAMERGIFVSCSAGNTGPRSGSVANVAPWIMTVGAGTLDRDFPAYVTLGNGKRFAG  357

Query  538   ESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
              SLYSG+ +  K + L+Y        +  C  GSL    V+G++VVC+RG +AR EKG+ 
Sbjct  358   VSLYSGEGMGDKPVGLIYFSDRSNSSSSICMPGSLDPETVRGKVVVCDRGLNARVEKGTV  417

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             V+ +GG GMIL N    GE + AD H + A A+G SAG  +K+Y +   + TA + F GT
Sbjct  418   VRDAGGLGMILANTGMSGEGLVADSHLVAAVAVGESAGDEIKEYASLDPNPTAVLSFGGT  477

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V   R +PV+AAFSSRGP+ V+ +I+KPDV  PGVNILA W   +GP+  E D R   FN
Sbjct  478   VLNVRPSPVVAAFSSRGPNEVTAQILKPDVIGPGVNILAGWSGAVGPSGSE-DTRKTRFN  536

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPH+SGLAALLK+ H DWSP+AIKSALMTT+YT D+ +SP+ D+     +S 
Sbjct  537   IMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALMTTAYTHDNTESPLRDATGEEALS-  595

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TP+A+G+GHV+P++A  PGL+YD STQDY  +LCSLNY    + L+++   A  +     
Sbjct  596   TPWAYGAGHVNPQKALSPGLVYDASTQDYIAFLCSLNYTLDHLRLVVKHSDANCSTKFAD  655

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PGDLNYPSF+V+F S+       +TRT TNVG   SVY V V  P  V + V P  + F 
Sbjct  656   PGDLNYPSFSVVFGSNKVVQ---YTRTLTNVGKAASVYDVVVSTPSTVEITVNPNRVSFA  712

Query  1612  KMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             ++G+  +Y V+FV+ R  ++      FGS++W +    VRSP+A  W
Sbjct  713   EVGECQTYKVTFVSNR-SVSDSVASEFGSIMWSNEEHEVRSPVAFTW  758



>ref|XP_006381615.1| subtilase family protein [Populus trichocarpa]
 gb|ERP59412.1| subtilase family protein [Populus trichocarpa]
Length=768

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/589 (50%), Positives = 392/589 (67%), Gaps = 13/589 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK---INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLA  171
             KKL+GAR F KGY    G    + +  E +SPRD +GHGTHTASTAAG  V +AS LG A
Sbjct  185   KKLIGARYFSKGYHMASGGRGFLKKPKETESPRDQDGHGTHTASTAAGSQVVNASLLGYA  244

Query  172   RGSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDN  351
              G+A GM  +A +A+YK C+  GC   D+LA +D+A++DGVD++SLSLGG    P+Y D 
Sbjct  245   SGTARGMATSALVASYKVCWVSGCFGSDILAGMDRAIEDGVDVMSLSLGGGS-APYYRDT  303

Query  352   IAIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVF  531
             IAI AF A ++G+FV  SAGNSGP  +S++N APWIMTV A +LDR FPA   +GN + F
Sbjct  304   IAIGAFTAMERGIFVSCSAGNSGPNIASLANVAPWIMTVGAGTLDRDFPAYAVMGNKKRF  363

Query  532   RGESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
              G SLYSG  + +K + LVY +         C  GSL  +LV+G++V+C+RG + R EKG
Sbjct  364   AGVSLYSGAGMGKKPVGLVY-KKGSNSTCNLCMPGSLEPQLVRGKVVICDRGINPRVEKG  422

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQ  888
             + V+ +GG GMIL N    GEE+ AD H LPA A+G   G  +++Y+ S  + TA + F 
Sbjct  423   AVVRDAGGVGMILANTAESGEELVADSHLLPAVAVGRKVGDVIREYVKSDPNPTAVLSFG  482

Query  889   GTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             GTV   R +PV+AAFSSRGP+ V+ EI+KPD+  PGVNILAAW   IGPT LE D R  +
Sbjct  483   GTVLDVRPSPVVAAFSSRGPNLVTREILKPDLIGPGVNILAAWSETIGPTGLETDTRKTQ  542

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSMSCPH+SG+AALLK+ H  WSP+AIKSALMTT+Y  D+  SP+ D+      
Sbjct  543   FNIMSGTSMSCPHISGVAALLKAAHPTWSPSAIKSALMTTAYVSDNTNSPLQDAAGG--A  600

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHH  1425
              + P+A GSGHVDP++A  PGL+YDIS  +Y  +LCSL+Y    +  ++++ +   +   
Sbjct  601   LSNPWAHGSGHVDPQKALSPGLVYDISADEYVAFLCSLDYTIEHVQAIVKRPNITCSRKF  660

Query  1426  HQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLK  1605
             + PG+LNYPSF+V+F ++       +TR  TNVG   S+Y V V  P  V V VKP  L 
Sbjct  661   NNPGNLNYPSFSVVFTNNRVVR---YTRELTNVGAAGSIYEVAVTGPQAVQVTVKPSKLV  717

Query  1606  FNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             F  +G  L YTV+FVA++G   +G    FG++VW++    VRSP+A  W
Sbjct  718   FKNVGDKLRYTVTFVARKGASLTGRSE-FGAIVWRNAQHQVRSPVAFSW  765



>gb|KDP33922.1| hypothetical protein JCGZ_07493 [Jatropha curcas]
Length=765

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/589 (51%), Positives = 394/589 (67%), Gaps = 12/589 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYE--SIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR F KGY   S  G + +  E +SPRD +GHGTHTASTAAG  V +AS LG A 
Sbjct  180   KKLIGARYFSKGYRMASGGGYLRKPKEIESPRDQDGHGTHTASTAAGSQVANASLLGYAS  239

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   +R+AAYK C+  GC   D+LA +D+A+ DGVD+LSLSLGG    P+Y D +
Sbjct  240   GTARGMAPHSRVAAYKVCWNTGCFGSDILAGMDRAIADGVDVLSLSLGGGS-APYYRDTV  298

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI A+ A ++G+FV  SAGNSGP  ++++N APWIMTV A +LDR FPA   LG+   F 
Sbjct  299   AIGAYSAMERGIFVSCSAGNSGPNRATLANVAPWIMTVGAGTLDRDFPAYAVLGDKSRFS  358

Query  535   GESLYSGKAVNQKLP-LVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  +  KL  LVY +      +  C  GSL   +V+G++VVC+RG +AR EKG+
Sbjct  359   GVSLYSGTGMGNKLVGLVYNKR--NISSNLCLPGSLEPTMVRGKVVVCDRGINARVEKGA  416

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMIL N    GEE+ AD H LPA A+G  AG  +++Y+++  + TA + F G
Sbjct  417   VVRDAGGIGMILANTAASGEELVADSHLLPAVAVGRKAGDKIREYVSNHPNPTALLSFGG  476

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   R +PV+AAFSSRGP+ V+P+I+KPD+  PGVNILAAW  ++GPT LE D R  +F
Sbjct  477   TVLNVRPSPVVAAFSSRGPNMVTPQILKPDLIGPGVNILAAWSDSVGPTGLEKDTRKTQF  536

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SG+AALLK+ H  WSP+AIKSALMTT+Y +D+  SP+ D+ S    +
Sbjct  537   NIMSGTSMSCPHISGVAALLKAAHPSWSPSAIKSALMTTAYVVDNTNSPLRDAGSDVAGA  596

Query  1249  -ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHH  1425
              + P+A GSGHVDP +A  PGL+YDISTQ+Y  +LCSL Y    +  ++++ +   +   
Sbjct  597   FSNPWAHGSGHVDPHKALTPGLVYDISTQEYEAFLCSLGYTIDHVQAIVKRPNVTCSKKF  656

Query  1426  HQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLK  1605
               PG+LNYPSF+V+F S        +TR  TNVG   S+Y V V  P  V V VKP  L 
Sbjct  657   RDPGELNYPSFSVVFASKRVVR---YTRELTNVGEAGSIYEVAVNGPSTVGVTVKPTKLV  713

Query  1606  FNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             F  +G  L YTV+FVA++G         FGS+VW++    VRSPIA  W
Sbjct  714   FKNVGDKLRYTVTFVAKKGA-NQDARSEFGSIVWRNAQHQVRSPIAFTW  761



>ref|XP_003608462.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES90659.1| subtilisin-like serine protease [Medicago truncatula]
Length=757

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/589 (51%), Positives = 388/589 (66%), Gaps = 11/589 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR F KG E+++G I+ET E KSPRD +GHGTHT+STAAG +V DAS  G A G+
Sbjct  176   KKLIGARFFSKGVEAMLGPIDETTESKSPRDDDGHGTHTSSTAAGSVVPDASLFGYASGT  235

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A YK C+  GC S D+LAA+D+A+ D V++LSLSLGG +   ++ D++AI
Sbjct  236   ARGMATRARVAVYKVCWKGGCFSSDILAAIDKAISDNVNVLSLSLGGGMSD-YFRDSVAI  294

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A +KG+ V  SAGN+GP   S+SN APWI TV A +LDR FPA V LGNG  + G 
Sbjct  295   GAFSAMEKGILVSCSAGNAGPSAYSLSNVAPWITTVGAGTLDRDFPASVSLGNGLNYSGV  354

Query  541   SLYSGKAVNQK-LPLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SLY G A+ +  LPL+Y G          C  G+LS  LV G+IV+C+RG +AR +KG+ 
Sbjct  355   SLYRGNALPESPLPLIYAGNATNATNGNLCMTGTLSPELVAGKIVLCDRGMNARVQKGAV  414

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GG GM+L N    GEE+ AD H LPATA+G   G A+KKY+ S    T  I FQGT
Sbjct  415   VKAAGGLGMVLSNTAANGEELVADTHLLPATAVGEREGNAIKKYLFSEAKPTVKIVFQGT  474

Query  895   VYG-NRAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
               G   +PV+AAFSSRGP++++P+I+KPD+ APGVNILA W   +GPT L  D R V+FN
Sbjct  475   KVGVEPSPVVAAFSSRGPNSITPQILKPDLIAPGVNILAGWSKAVGPTGLAVDERRVDFN  534

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSGLAAL+KS H DWSPAA++SALMTT+Y      + + DS +    S+
Sbjct  535   IISGTSMSCPHVSGLAALIKSAHPDWSPAAVRSALMTTAYIAYKNGNKLQDSATGK--SS  592

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TPF  GSGHVDP  A +PGL+YD++  DY  +LC+LNY +TQI+ L R+K  C     + 
Sbjct  593   TPFDHGSGHVDPVAALNPGLVYDLTADDYLGFLCALNYTATQITSLARRKFQCDAGKKYS  652

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVM-EPDGVSVIVKPKVLKF  1608
               DLNYPSFAV+FD+    +    TR  TNVG P   Y   V  +   V + V+P+ L F
Sbjct  653   VSDLNYPSFAVVFDTMGGANVVKHTRILTNVG-PAGTYKASVTSDSKNVKITVEPEELSF  711

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
              K  +  S+TV+F +         G  FG L W +    V SPI++ W 
Sbjct  712   -KANEKKSFTVTFTSSGSTPQKLNG--FGRLEWTNGKNVVGSPISISWD  757



>ref|XP_009610930.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=779

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/596 (53%), Positives = 399/596 (67%), Gaps = 21/596 (4%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             +K++GAR FYKGYE+  G  I+E+ E KSPRD+EGHGTHTASTAAG +V +ASF   A+G
Sbjct  184   RKIIGARLFYKGYEADRGSPIDESKESKSPRDTEGHGTHTASTAAGSVVANASFFQYAKG  243

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFY-TDNI  354
              A GM   ARIAAYK C+  GC   D+LAA+DQAV DGV ++SLS+G     P Y  D+I
Sbjct  244   EARGMAVKARIAAYKICWKTGCFDSDILAAMDQAVADGVHVISLSVGADGYAPEYDVDSI  303

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AFGA++ GV V  SAGNSGP  S+  N APWI+TVAAS++DR FPA V LG+GR+F 
Sbjct  304   AIGAFGASEHGVVVSCSAGNSGPGASTAVNVAPWILTVAASTIDREFPADVILGDGRIFG  363

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  + + KLPLVY   +G  G++ C  G L    V G+IV+C+RG +AR EKGS
Sbjct  364   GVSLYSGDPLGDSKLPLVY---SGDCGSQLCYPGKLDPSKVAGKIVLCDRGGNARVEKGS  420

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GGAGM+L N    GEE+ AD H LPAT +G  AG  ++ Y+ S  S TA+I F+G
Sbjct  421   AVKLAGGAGMVLANLADSGEELVADSHLLPATMVGQKAGDKIRDYVKSDSSPTATIVFKG  480

Query  892   TVYGN--RAPVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             TV G    AP +AAFS RGP+ V+PEI+KPDVTAPGVNILA W  +IGPT LE D R VE
Sbjct  481   TVIGKPPSAPRIAAFSGRGPNYVTPEILKPDVTAPGVNILAGWTGSIGPTDLEIDTRRVE  540

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSMSCPHVSGLAALL+  +  W+ AAIKSALMTT+Y +D+     TD  +    
Sbjct  541   FNIISGTSMSCPHVSGLAALLRKAYPKWTTAAIKSALMTTAYNIDNSGKTFTDLATGQ--  598

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSA--CPTH  1419
              ++PF  GSGHVDP RA  PGL+YDI+T+DY ++LC++ Y+  +IS  ++  S+  C   
Sbjct  599   ESSPFVHGSGHVDPNRALDPGLVYDIATRDYVDFLCAIGYDPKRISPFVKDTSSVNCSEK  658

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGI-PESVYAVHVMEPDGVSVIVKPK  1596
                 PGDLNYPSF+V     SS S   + R   NVG    + Y V +  P  V V V P 
Sbjct  659   SLVSPGDLNYPSFSV---VFSSESVVKYKRVVKNVGRNTNAAYEVKINAPASVEVKVTPT  715

Query  1597  VLKFNKMGQNLSYTVSFVAQRGKIA----SGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              L F++  ++LSY +SF +  G +      G   +FGS+ W     +VRSPIAV W
Sbjct  716   KLSFSEENKSLSYEISF-SSNGSVGLERVKGLESAFGSIEWSDGIHSVRSPIAVHW  770



>ref|XP_009359724.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/588 (51%), Positives = 393/588 (67%), Gaps = 10/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYE--SIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR+F KGY   S    + +  E +SPRD +GHGTHT+STAAG LV +AS LG A 
Sbjct  178   KKLIGARSFSKGYHMASRGSYLRKPREVESPRDRDGHGTHTSSTAAGSLVANASLLGYAT  237

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   AR+A YK C++ GC   D+LA +D+A+ DGVD+LSLSLGG    P+Y D I
Sbjct  238   GTAHGMAPHARVATYKVCWSTGCFGSDILAGMDRAIVDGVDVLSLSLGGGS-APYYRDTI  296

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AF A ++G+FV  SAGNSGP  +S++NTAPWIMTV A +LDR FPA   LGN   F 
Sbjct  297   AIGAFTAMERGIFVSCSAGNSGPTRASLANTAPWIMTVGAGTLDRDFPAYALLGNKLRFT  356

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  + N+ + LVY R +    +  C  GSL+  LV+G++V+C+RG +AR EKG 
Sbjct  357   GVSLYSGSGMGNKPVQLVYNRRS-NSSSNLCMPGSLNPDLVRGKVVMCDRGINARVEKGG  415

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMIL N    GEE+ AD H LPA A+G   G  +++Y     + TA I F  
Sbjct  416   VVRAAGGIGMILANTAASGEELVADSHLLPAVAVGRRVGDQIREYAQHDPNPTAVITFGR  475

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   R +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILAAW   +G T LE D R  +F
Sbjct  476   TVLNVRPSPVVAAFSSRGPNMVNPQILKPDVIGPGVNILAAWSEAVGLTGLEEDKRKSQF  535

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SGLAALLK+ H +WSP+A+KSALMTT+YT D+ K+P+ D+   +   
Sbjct  536   NIISGTSMSCPHISGLAALLKAAHPEWSPSAVKSALMTTAYTHDNTKAPLRDAA--DGTI  593

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             + P+A GSGHVDP +A  PGL+YDI+T+DY  +LCSL Y +  +  ++++ +      + 
Sbjct  594   SNPWAHGSGHVDPSKALSPGLVYDIATEDYIAFLCSLEYTNEHVQAIVKRPNVTCARKYS  653

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG LNYPSF+V+F +       ++TR  TNVG   SVY V V  P  V  IVKP  L F
Sbjct  654   DPGQLNYPSFSVMFWNKKKRVV-SYTRELTNVGPAGSVYRVAVTSPSMVRTIVKPTRLVF  712

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             N +G+   YTV+FVA +G   +     FGS++W +    V+SP+A  W
Sbjct  713   NNVGEKQKYTVTFVASQGAEKTSRSE-FGSIMWSNPQHQVKSPVAFAW  759



>gb|KCW53526.1| hypothetical protein EUGRSUZ_J02805 [Eucalyptus grandis]
Length=778

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/594 (53%), Positives = 396/594 (67%), Gaps = 20/594 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             +K++GAR FYKGYE+ + + I+ET E KSPRD+EGHGTHT+STA G +V +ASF   A G
Sbjct  189   RKIIGARAFYKGYEAYLERPIDETKESKSPRDTEGHGTHTSSTAGGSVVSNASFYEYAVG  248

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT-DNI  354
              A GM   ARIAAYK C++LGC   D+LAA+DQAV DGV I+SLS+G     P Y  D+I
Sbjct  249   EARGMATKARIAAYKICWSLGCFDSDILAAMDQAVSDGVHIISLSVGANGYAPQYDHDSI  308

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AFGA + GV V  SAGNSGP   +  N APWI+TV AS++DR FPA V LG+GR+F+
Sbjct  309   AIGAFGAVKHGVLVSCSAGNSGPGPFTAVNIAPWILTVGASTIDREFPADVVLGDGRIFK  368

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG+ + + KLPLVY   AG  G+ +C   SL S  V G+IVVC+RG +AR  KGS
Sbjct  369   GVSLYSGEPLGDAKLPLVY---AGDCGSRYCYDDSLDSTKVAGKIVVCDRGGNARVAKGS  425

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GG GMIL N E  GEE+ AD H +PA  +G +AG  +++Y +S +  TA+IKF G
Sbjct  426   AVKLAGGVGMILANTEESGEELIADSHLIPANMVGETAGDKIREYASSDQFPTAAIKFIG  485

Query  892   TVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             TV G    AP +AAFSSRGP+ ++ EI+KPDV APGVNILAAW    GPT L+ D R VE
Sbjct  486   TVIGPSPPAPKVAAFSSRGPNHLTAEILKPDVIAPGVNILAAWTGFNGPTDLDIDPRRVE  545

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSMSCPH SGLAALL+  + DWSPAAIKSALMTT+Y LD+    I D  S +  
Sbjct  546   FNIISGTSMSCPHASGLAALLRKAYPDWSPAAIKSALMTTAYNLDNGGRNIKDLASGD--  603

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRK--KSACPTH  1419
              ++PF  G+GHVDP RA +PGL+YDI   DY  +LC++ Y   +I++ LR+   S    +
Sbjct  604   ESSPFVHGAGHVDPNRALNPGLVYDIDVDDYVGFLCAIGYEPRRIAVFLREPMSSTVCAN  663

Query  1420  HHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVG-IPESVYAVHVMEPDGVSVIVKPK  1596
                 PG+LNYPSF+V+  S+       + R   NVG   ++VY V V  P+ V V V P 
Sbjct  664   RMATPGELNYPSFSVVLTSNGDVV--KYRRVVKNVGSSADAVYEVKVDAPENVEVSVSPS  721

Query  1597  VLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
              L+F+   Q LSY ++F      IA G     FGS+ W      VRSPIAV W 
Sbjct  722   KLEFSAENQILSYEITF----SSIALGSSTPKFGSIEWTDGTHRVRSPIAVKWH  771



>gb|ABF70004.1| subtilisin-like serine proteinase, putative [Musa acuminata]
Length=757

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/588 (52%), Positives = 389/588 (66%), Gaps = 13/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGAR F +GYE+ +G IN T E +SPRD++GHGTHT+ST AG  V D  FLG A G+
Sbjct  178   RKLVGARFFSQGYEARMGPINLTRESRSPRDNDGHGTHTSSTVAGSAVPDVDFLGYAAGT  237

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIA YK C+  GC   D+LAA+D+A++DG  +LSLSLGG +   +Y DNIA+
Sbjct  238   ARGMSTRARIAVYKVCWLGGCFGSDILAAMDKAIEDGCGVLSLSLGGGMSD-YYRDNIAV  296

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A   GV V  SAGN+GP  S++SN APWI TV A +LDR FPA V L NG+ + G 
Sbjct  297   GAFSAMAMGVVVSCSAGNAGPGASTLSNVAPWITTVGAGTLDRDFPANVLLSNGKNYTGV  356

Query  541   SLYSGKAV-NQKLPLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SLYSGK + +  LP +Y G          C  G+L    V G+IV+C+RG +AR +KGS 
Sbjct  357   SLYSGKPLPSSPLPFIYAGNATNTTNGNLCMTGTLLPDKVAGKIVLCDRGINARVQKGSV  416

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             V+ +GGAGMIL N    GEE+ AD H LPATA+G  AG A+K Y+ S  + TA+I F+GT
Sbjct  417   VRDAGGAGMILANTAANGEELVADAHLLPATAVGEIAGDAIKSYLFSDPNPTATIAFRGT  476

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
               G + +PV+AAFSSRGPSA++P+I+KPD+ APGVNILAAW  ++GPT   AD R  EFN
Sbjct  477   KVGVKPSPVVAAFSSRGPSAITPDILKPDLIAPGVNILAAWTGSVGPTGQAADPRRTEFN  536

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSGL ALLK  H DWSP AIKSALMTT+Y        I D  +    +A
Sbjct  537   IISGTSMSCPHVSGLLALLKGAHPDWSPGAIKSALMTTAYAAYPGDGGILDVATGR--AA  594

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS-ACPTHHHH  1428
             TPF FG+GHVDP +A  PGL+YD++T+DY ++LC+LNY   QI+ L R  +  C     +
Sbjct  595   TPFDFGAGHVDPPKALDPGLVYDLTTEDYLDFLCALNYTPLQIARLSRLTNYTCDRQKAY  654

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
             +  DLNYPSFAV F ++S+   H  TRT TNVG P   Y   V  P+GV V+V+P  L F
Sbjct  655   EVSDLNYPSFAVAFATASTTVKH--TRTLTNVGAP-GTYKATVSAPEGVKVVVEPTALTF  711

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             + +G+  +YTV+F          G  +FG L W      V SP+A  W
Sbjct  712   SALGEKKNYTVTFSTAS---QPSGSTAFGRLEWSDAQHVVASPLAFSW  756



>ref|XP_004243704.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=762

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/588 (51%), Positives = 392/588 (67%), Gaps = 14/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYE--SIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKLVGAR F KGY   S     N+  + +SPRD +GHGTHTASTAAG  V +AS  G A 
Sbjct  180   KKLVGARFFAKGYRMSSSSSFANQPRQPESPRDQDGHGTHTASTAAGAPVGNASLFGYAS  239

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G A GM   AR+A YK C+  GC   D+LA +D+A+ DGVD+LSLSLGG    P+Y D I
Sbjct  240   GIARGMAPRARVATYKVCWPTGCFGSDILAGMDRAILDGVDVLSLSLGGGS-GPYYRDTI  298

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI  F A +KG+ V  SAGNSGP  +S++NTAPWIMTV A ++DR FPA   LGNG+   
Sbjct  299   AIGGFSAMEKGIVVSCSAGNSGPAKASLANTAPWIMTVGAGTIDRDFPAYAVLGNGKKIT  358

Query  535   GESLYSGKAVNQKL-PLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSGK + +KL  LVY   +    +  C  GSL+ + V+G+IVVC+RG +AR EKG 
Sbjct  359   GVSLYSGKGMGKKLVSLVYNTDSS---SSLCLPGSLNPKDVRGKIVVCDRGTNARVEKGL  415

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GG GMIL N    GEE+ AD H LPA A+G   G A+++Y+ S ++ TA + F G
Sbjct  416   VVKEAGGVGMILANTVESGEELVADSHLLPAVAVGRKLGNAIRQYVKSERNPTALLSFGG  475

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   + +PV+AAFSSRGP+ V+P+I+KPD+  PGVNILAAW   IGPT LE D R  +F
Sbjct  476   TVVNVKPSPVVAAFSSRGPNTVTPQILKPDLIGPGVNILAAWSEAIGPTGLEKDTRRTKF  535

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SGLAALLK+ H +WSP+AIKSALMTT+Y  D+  SP+ D+       
Sbjct  536   NIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYNRDTTNSPLRDAEGDQ--L  593

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             +TP+A G+GHVDP +A  PGL+YDI  ++Y  +LCSL+Y    I  ++++ +        
Sbjct  594   STPWAHGAGHVDPHKALSPGLVYDIRPKEYIKFLCSLDYEMEHIQAIVKRPNVTCAKKFS  653

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG +NYPSFAV+F  S       +TRT TNVG   S Y V +  P  V+V VKP  L F
Sbjct  654   DPGQINYPSFAVLFGKSRVVR---YTRTLTNVGAAGSTYEVVIDAPPSVTVTVKPSKLVF  710

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              K+G+ L YTV+FV+++G +++    +FGS+ W +    VRSP++  W
Sbjct  711   KKVGERLRYTVTFVSKKG-VSTMSKTTFGSISWNNAQNQVRSPVSYSW  757



>gb|KCW81959.1| hypothetical protein EUGRSUZ_C03325 [Eucalyptus grandis]
Length=840

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/588 (50%), Positives = 393/588 (67%), Gaps = 12/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK--INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR F KG+    G   +    E +SPRD +GHGTHTASTAAG  V +AS LG A 
Sbjct  193   KKLIGARFFSKGFRMASGSNFLKNPKEVESPRDRDGHGTHTASTAAGSPVANASLLGYAS  252

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   AR+AAYK C++ GC   D+LA +D+A+ DGVD+LSLSLGG +  P+Y D I
Sbjct  253   GTARGMAEHARVAAYKVCWSSGCFGADILAGMDRAILDGVDVLSLSLGGGI-APYYRDTI  311

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AF A ++G+FV  SAGNSGP   S++N APWIMTV A +LDR FPA   LGNG+ + 
Sbjct  312   AIGAFTAMERGIFVSCSAGNSGPAKESLANVAPWIMTVGAGTLDRDFPAYALLGNGKRYA  371

Query  535   GESLYSGKAVNQK-LPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  +    +P++Y + +   G + C  GSL+  L +G++V+C+RG +AR EKG 
Sbjct  372   GVSLYSGPGMGHNPVPVIYSKDSNISG-QLCLPGSLNPALTRGKVVLCDRGVNARVEKGQ  430

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMIL N    GEE+ AD H +PA A+G   G  ++KY+ S +S TA + F+G
Sbjct  431   VVRDAGGVGMILANTAANGEELVADSHLIPAVAVGRKMGDVIRKYVKSDRSPTAVLSFRG  490

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   R +PV+AAFSSRGP+ V+ +I+KPDV  PGVNILA W    GPT LE+D R   F
Sbjct  491   TVVNVRPSPVVAAFSSRGPNTVTQQILKPDVIGPGVNILAGWSEAAGPTGLESDTRKTLF  550

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NILSGTSMSCPH+SG+AALLKS H +WSP+AIKSALMTT+Y LD+  SP+ D+       
Sbjct  551   NILSGTSMSCPHISGVAALLKSAHPNWSPSAIKSALMTTAYNLDNTGSPLRDAAGGT--F  608

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             +TP+A GSGHVDP++A  PGL+YD+  +DY  +LCSL+Y    +  ++++ +   +    
Sbjct  609   STPWAHGSGHVDPQKALSPGLVYDLKAEDYIAFLCSLDYTIDHVKAIVKRPNVTCSRKFS  668

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG+LNYPSF+V+F+         +TR  TNVG   S+Y V V  P  V V VKP  L F
Sbjct  669   DPGELNYPSFSVVFNDKKVVR---YTRELTNVGAAGSMYNVSVTGPSTVGVTVKPMKLIF  725

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              K+G  + YTV+FV+++G   +     FGS+VW +    VRSP+A  W
Sbjct  726   PKVGDKMRYTVTFVSKKGTNPTTRSE-FGSIVWSNAQNKVRSPVAYAW  772



>ref|XP_008388846.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/588 (50%), Positives = 389/588 (66%), Gaps = 10/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVG--KINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR+F KGY+   G   + +  E  S RD +GHGTHT+STAAG LV +AS LG A 
Sbjct  178   KKLIGARSFSKGYQMASGGSNLRKPKEVVSXRDIDGHGTHTSSTAAGSLVANASLLGYAS  237

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   AR+AAYK C++ GC   D++A +D+A+ DGVD+LSLSLGG    P+Y D I
Sbjct  238   GTARGMAPHARVAAYKVCWSTGCFGSDIIAGMDRAIIDGVDVLSLSLGGGS-APYYRDTI  296

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AF A ++G+FV  SAGNSGP  +S++NTAPWIMTV A +LDR FPA   LGN   F 
Sbjct  297   AIGAFTAMERGIFVSCSAGNSGPTEASLANTAPWIMTVGAGTLDRDFPAYALLGNKLRFT  356

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  + N+ + LVY + + G  +  C  GSL+  LV+G++V+C+RG +AR EKG 
Sbjct  357   GVSLYSGTGMGNKPVQLVYNKGSNGS-SNLCLPGSLNPDLVRGKVVMCDRGVNARVEKGG  415

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMI+ N    GEE+ AD H LPA A+G   G  ++ Y     + TA I F G
Sbjct  416   VVRAAGGIGMIIANTAASGEELVADSHLLPAVAVGRKVGDQIRAYAQHDPNPTAVITFGG  475

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   R +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILAAW   IGPT LE D R  +F
Sbjct  476   TVLNVRPSPVVAAFSSRGPNTVNPQILKPDVIGPGVNILAAWSEAIGPTGLEEDKRKSQF  535

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SGLAALLK+ H +WSP+A+KSALMTT+YT D+  SP+ D+   +   
Sbjct  536   NIMSGTSMSCPHISGLAALLKAAHPEWSPSAVKSALMTTAYTHDNTNSPLRDAA--DGTL  593

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             + P+A GSGHVDP +A  PGL+YD + +DY  +LCSL Y +  +  ++++ +      + 
Sbjct  594   SNPWAHGSGHVDPSKALSPGLVYDTTAEDYIAFLCSLEYTNEHVQAIVKRPNVTCARKYS  653

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG LNYPSF+++F S +      +TR  TNVG   SVY   V  P  V  IVKP  L F
Sbjct  654   DPGQLNYPSFSIVFGSKNKRVVR-YTRELTNVGAAGSVYRASVTSPSTVRTIVKPTRLVF  712

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             N +G+   YTV+FVA  G   +     FGS+VW +    V+SP+   W
Sbjct  713   NNVGEKQKYTVTFVALPGAXKTARSE-FGSIVWANPQHQVKSPVTFAW  759



>ref|XP_010272631.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=785

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/592 (50%), Positives = 390/592 (66%), Gaps = 15/592 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +K+VGAR FY+GYE+  GKINE  EYKSPRD +GHGTHTA+T AG  V+ A+ LG ARG+
Sbjct  199   RKIVGARIFYRGYEAASGKINEQDEYKSPRDEDGHGTHTAATVAGSPVEGANLLGYARGT  258

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC S D+L+AVD+AV DGV++LS+SLGG +   +Y D+++I
Sbjct  259   ARGMAPKARVAAYKVCWAGGCFSSDILSAVDRAVADGVNVLSISLGGSVSS-YYRDSLSI  317

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             A FGA + GVFV  SAGN GP   S++N +PW+ TV AS++DR FP+MV+LGNG++  G 
Sbjct  318   ATFGAMEMGVFVSCSAGNGGPDPISLTNVSPWVTTVGASTMDRDFPSMVKLGNGQMLSGV  377

Query  541   SLYSGKAV---NQKLPLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+ +    Q+ PLVY    ++    +  C  G+L    V G+IV+C+RG S R +K
Sbjct  378   SLYKGRRILSTKQQYPLVYMGSNSSTPDPSSLCLEGTLDPHSVVGKIVICDRGVSPRVDK  437

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G  VK +GG GMIL N    GEE+ AD H LPA ALG  AG AVK+Y  ++   TA++  
Sbjct  438   GRVVKEAGGMGMILANTAANGEELVADSHLLPAVALGAKAGKAVKQYTLTNSHPTATLAI  497

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G R +PV+AAFSSRGP+ ++PEI+KPD+ APGVNILAAW    GP+ L +D+R V
Sbjct  498   LGTKLGIRPSPVVAAFSSRGPNFLTPEILKPDLVAPGVNILAAWTGKAGPSGLPSDHRRV  557

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
              FNILSGTSMSCPHVSG+AALLK+ H +WSPAAIKSALMTT+Y  D+   P+ D+ +  P
Sbjct  558   RFNILSGTSMSCPHVSGVAALLKARHPEWSPAAIKSALMTTAYVHDNAYHPLRDASTGAP  617

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               + PF  G+GH++P +A  PGL+YD+  QDYF +LC+      Q+ +  +  +    H 
Sbjct  618   --SNPFTHGAGHINPLKALDPGLVYDMGVQDYFEFLCTQKLTPLQLKVFTKSSNRSCRHI  675

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
                PGDLN P+ + +F   SS S  T  RT TNVG P S Y   V +  G SV V+P+ L
Sbjct  676   LANPGDLNNPAISAVFPEQSSVSVLTLHRTVTNVGPPISTYHAKVSQFKGASVEVEPRTL  735

Query  1603  KFNKMGQNLSYTVSFVAQ-RGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
              F    Q LSY ++F  + R  I       FG L+W      VRSPI + W 
Sbjct  736   HFTSKNQKLSYKITFTTKTRQPIP-----EFGGLMWSDEKRKVRSPIVITWM  782



>ref|XP_010070634.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW59525.1| hypothetical protein EUGRSUZ_H02279 [Eucalyptus grandis]
Length=767

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/588 (52%), Positives = 390/588 (66%), Gaps = 10/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F KGYE+ +G I+ + E KS RD +GHGTHTASTAAG  V  AS  G A G+
Sbjct  185   RKLIGARFFSKGYEATMGPIDVSKESKSARDDDGHGTHTASTAAGSAVDGASLFGYAPGT  244

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC S D+LAA+++AV DGV++LSLSLGG  P  FY D++AI
Sbjct  245   ARGMATRARVAAYKVCWLGGCFSSDILAAMEKAVVDGVNVLSLSLGGGSPD-FYRDSVAI  303

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A +KG+FV  SAGN+GP + S+SN APWI TV A +LDR FPA V LGNG+ F G 
Sbjct  304   GAFAAAEKGIFVSCSAGNAGPSSMSLSNVAPWIATVGAGTLDRDFPAYVTLGNGKNFSGV  363

Query  541   SLYSGKAVNQKLPLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLYSG +    LP VY G  +       C  G+L    VKG+IV+C+RG +AR +KGS V
Sbjct  364   SLYSGNSKGTLLPFVYAGNVSNATNGNLCMMGTLDPAKVKGKIVLCDRGVNARVQKGSVV  423

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTV  897
             + +GGAGM+L N    GEE+ AD H LPATA+G  +G A+K Y+ S  + TA+I F+GT 
Sbjct  424   QLAGGAGMVLANTAANGEELVADAHLLPATAVGEKSGDAIKSYLFSDPNPTATILFEGTK  483

Query  898   YGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
              G + +PV+AAFSSRGP++++P ++KPD+ APGVNILA W   IGPT L  D+R V FNI
Sbjct  484   VGIQPSPVVAAFSSRGPNSITPAVLKPDMIAPGVNILAGWTGGIGPTGLAVDDRRVAFNI  543

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISAT  1254
             +SGTSMSCPHVSGLAALLK+ H DWSPAAI+SALMTT+Y        + D V+T   S T
Sbjct  544   ISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALMTTAYVAYKNGGKLQD-VATGKDS-T  601

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQP  1434
             PF  G+GHVDP  A +PGL+YD++ +DY  +LC LNY S+QI+ L R+   C     +  
Sbjct  602   PFDHGAGHVDPVSALNPGLVYDLTVEDYLGFLCGLNYTSSQINTLARRNYTCDPSKSYSL  661

Query  1435  GDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVY-AVHVMEPDGVSVIVKPKVLKF  1608
              DLNYPSFA  FDS+S   +   +TRT TNVG     Y A       G+ + V P  L F
Sbjct  662   YDLNYPSFAASFDSTSGGPTTIKYTRTLTNVGAATGTYKATASSGSAGLKIAVVPDTLSF  721

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             +K G+  S+TV+     G       ++FG L W     TVRSP+A  W
Sbjct  722   SKAGEKKSFTVTVT---GSAMPASTNAFGQLEWSDGKQTVRSPMAFSW  766



>ref|XP_010937330.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=772

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/598 (50%), Positives = 391/598 (65%), Gaps = 26/598 (4%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKIN-----ETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLG  165
             +KLVGAR+F +G+ + V   +       +EY S RD +GHGTHTASTAAG  V +AS  G
Sbjct  187   RKLVGARSFSRGFHAGVAAEDGRSRGRLIEYASARDRDGHGTHTASTAAGFPVANASLFG  246

Query  166   LARGSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT  345
              A G+A GM   AR+AAYK C+  GC   D+LA +D A+ DGVDILSLS+GG    P++ 
Sbjct  247   YAAGTARGMATGARVAAYKVCWASGCFGSDILAGIDAALNDGVDILSLSIGGGA-SPYFR  305

Query  346   DNIAIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGR  525
             D IA+ AF A Q+GVFV  SAGNSGP  ++++N APWI TV A +LDR FPA   LG+G 
Sbjct  306   DTIAVGAFAAVQRGVFVACSAGNSGPDAATLANAAPWIATVGAGTLDRDFPAFARLGSGA  365

Query  526   VFRGESLYSGKAVNQKL-PLVYGRTAGGK--GAEFCSHGSLSSRLVKGRIVVCERGNSAR  696
              + G SLYSGK + ++L P++YG   GGK   ++ C  G+L S  V+G++V C+RG +AR
Sbjct  366   RYTGVSLYSGKGMGKRLTPIIYG---GGKDNSSKLCLAGTLDSSHVRGKLVFCDRGITAR  422

Query  697   AEKGSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATAS  876
              EKG  VK +GGAGMIL N    GEE+ AD H LPA A+G + G  ++ Y+ S       
Sbjct  423   VEKGEVVKAAGGAGMILANTAANGEELVADSHLLPAVAVGKTVGDKIRDYVKSDPRPRGV  482

Query  877   IKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADN  1053
             + F GTV G R +PV+AAFSSRGP+ V PEI+KPD   PGVNILA W   +GPT L  D 
Sbjct  483   LSFGGTVLGVRPSPVVAAFSSRGPNTVVPEILKPDFIGPGVNILAGWSGAVGPTGLGKDG  542

Query  1054  RSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVS  1233
             R   FNI+SGTSMSCPH+SG+AALLK  H +WSPAAI+SALMTT+Y +D   SP+ DS  
Sbjct  543   RRTAFNIMSGTSMSCPHISGVAALLKGKHPEWSPAAIRSALMTTAYNIDDTNSPLRDSAG  602

Query  1234  TNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACP  1413
              +   ATPFAFG+GHVDP +A  PGLIYDI+T+DY  +LCSL+Y    I +++++ +   
Sbjct  603   GS--VATPFAFGAGHVDPRKALSPGLIYDITTEDYIAFLCSLDYTIQHIQVIVKRPNVTC  660

Query  1414  THHHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKP  1593
             +     PG+LNYPSF+V+F   S N    + R  TNVG   SVY V +  P+ VSV VKP
Sbjct  661   SRSFSNPGELNYPSFSVVFKKKSRNVV-KYIRELTNVGSAGSVYNVRIRGPENVSVTVKP  719

Query  1594  KVLKFNKMGQNLSYTVSFVAQRGKIASGGGH----SFGSLVWKSTNFTVRSPIAVIWQ  1755
               L F  +GQ L Y++ F ++       GGH    +FG + W +    VRSP+A  W+
Sbjct  720   AKLIFKHVGQKLKYSIIFASKN------GGHLKTTAFGWITWSNKQHEVRSPVAYTWK  771



>ref|NP_566483.1| Subtilase family protein [Arabidopsis thaliana]
 dbj|BAB01030.1| subtilisin proteinase-like protein [Arabidopsis thaliana]
 gb|AEE75493.1| Subtilase family protein [Arabidopsis thaliana]
Length=775

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/600 (50%), Positives = 405/600 (68%), Gaps = 18/600 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGAR F  GYE+  GK+NET E++SPRDS+GHGTHTAS +AG  V  AS LG A G 
Sbjct  176   RKLVGARFFCGGYEATNGKMNETTEFRSPRDSDGHGTHTASISAGRYVFPASTLGYAHGV  235

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D IAI
Sbjct  236   AAGMAPKARLAAYKVCWNSGCYDSDILAAFDTAVADGVDVISLSVGGVV-VPYYLDAIAI  294

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA  +G+FV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNG++  G 
Sbjct  295   GAFGAIDRGIFVSASAGNGGPGALTVTNVAPWMTTVGAGTIDRDFPANVKLGNGKMISGV  354

Query  541   SLYSGKAVN--QKLPLVYGRTA-GGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             S+Y G  ++  +  PLVYG +  GG G  +  C  GSL   LVKG+IV+C+RG ++RA K
Sbjct  355   SVYGGPGLDPGRMYPLVYGGSLLGGDGYSSSLCLEGSLDPNLVKGKIVLCDRGINSRATK  414

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSA------  867
             G  V+++GG GMI+ N   +GE + AD H LPAT++G S G  +++YI+ S  +      
Sbjct  415   GEIVRKNGGLGMIIANGVFDGEGLVADCHVLPATSVGASGGDEIRRYISESSKSRSSKHP  474

Query  868   TASIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLE  1044
             TA+I F+GT  G R APV+A+FS+RGP+  +PEI+KPDV APG+NILAAWP  IGP+ + 
Sbjct  475   TATIVFKGTRLGIRPAPVVASFSARGPNPETPEILKPDVIAPGLNILAAWPDRIGPSGVT  534

Query  1045  ADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITD  1224
             +DNR  EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SAL+TT+YT+D+   P+ D
Sbjct  535   SDNRRTEFNILSGTSMACPHVSGLAALLKAAHPDWSPAAIRSALITTAYTVDNSGEPMMD  594

Query  1225  SVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS  1404
               + N  +++   +GSGHV P +A  PGL+YDI++ DY N+LC+ NY  T I  + R+++
Sbjct  595   ESTGN--TSSVMDYGSGHVHPTKAMDPGLVYDITSYDYINFLCNSNYTRTNIVTITRRQA  652

Query  1405  ACP-THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVS  1578
              C         G+LNYPSF+V+F     +   T F RT TNVG  +SVY + +  P G +
Sbjct  653   DCDGARRAGHVGNLNYPSFSVVFQQYGESKMSTHFIRTVTNVGDSDSVYEIKIRPPRGTT  712

Query  1579  VIVKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             V V+P+ L F ++GQ LS+ V       K++ G  +   G +VW      V SP+ V  Q
Sbjct  713   VTVEPEKLSFRRVGQKLSFVVRVKTTEVKLSPGATNVETGHIVWSDGKRNVTSPLVVTLQ  772



>ref|XP_010654422.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=788

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/597 (52%), Positives = 392/597 (66%), Gaps = 23/597 (4%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK-INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             +K++GARTF++GYES +G+ I+E+ E KSPRD+EGHGTHTASTAAG +V++AS    A G
Sbjct  196   RKIIGARTFHRGYESALGRQIDESEESKSPRDTEGHGTHTASTAAGSVVQNASMFEYANG  255

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYT-DNI  354
              A GM   ARIA YK C+  GC   D+LAA+DQA+ DGV ++SLS+G     P Y  D+I
Sbjct  256   EARGMATKARIAVYKICWNQGCLDSDILAAMDQAIADGVHVISLSVGAKGLAPKYDRDSI  315

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AFGA + GV V  S GNSGP   +  N APWI+TV AS++DR FPA V LGNGR+FR
Sbjct  316   AIGAFGAMEHGVIVSCSVGNSGPKPFTAVNIAPWILTVGASTIDREFPADVVLGNGRIFR  375

Query  535   GESLYSGKAVN-QKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLY+G  +N   LPLV     G +    C  G L+  LV G+IVVC+RG   R EKG 
Sbjct  376   GVSLYTGDPLNATHLPLVLADECGSR---LCVAGKLNPSLVSGKIVVCDRGGGKRVEKGR  432

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              VK +GGAGMIL N +T GEE+ AD H +PAT +G +AG  +K+Y +S  S TA+I F+G
Sbjct  433   AVKLAGGAGMILANTKTTGEELVADSHLIPATMVGKTAGDEIKRYADSKSSPTATIAFRG  492

Query  892   TVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVE  1065
             TV GN   AP +A+FSSRGP+ ++PEI+KPDV APGVNILA W  +  PT L+ D R VE
Sbjct  493   TVMGNSLLAPKVASFSSRGPNRLTPEILKPDVIAPGVNILAGWTGSNSPTGLDMDERRVE  552

Query  1066  FNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPI  1245
             FNI+SGTSM+CPHVSGLAALL+  H DWSPAAIKSALMTT+Y  D+  S ITD  + N  
Sbjct  553   FNIISGTSMACPHVSGLAALLRKAHPDWSPAAIKSALMTTAYNSDNSGSQITDLATGN--  610

Query  1246  SATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRK--KSACPTH  1419
              +TP   GSGHV+P  A  PGL+YDI   DY  +LCS+ Y S  I + +R   K  C + 
Sbjct  611   KSTPLIHGSGHVNPIGALDPGLVYDIGPDDYVTFLCSVGY-SENIEIFVRDGTKVNCDS-  668

Query  1420  HHHQPGDLNYPSFAVIFDssssnssH----TFTRTATNVGIPE-SVYAVHVMEPDGVSVI  1584
                +PGDLNYPSF+V+F++ S+           R   NVG  + +VY+V V  P  V + 
Sbjct  669   QKMKPGDLNYPSFSVVFNADSAVIKRGRVVKHKRVVRNVGSSKNAVYSVKVNPPPSVKIN  728

Query  1585  VKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIWQ  1755
             V P  L F +  Q  SY V+F +    + +     FGS+ W   +  VRSP+AV W 
Sbjct  729   VSPSKLVFTEKNQVASYEVTFTSVGASLMT----EFGSIEWTDGSHRVRSPVAVRWH  781



>ref|XP_004287641.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=765

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/588 (51%), Positives = 386/588 (66%), Gaps = 13/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGK--INETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR+F KGY    G   + +  E +SPRD +GHGTHT+STAAG LV +AS LG A 
Sbjct  184   KKLIGARSFSKGYRMASGGGFMKKPREAESPRDQDGHGTHTSSTAAGSLVANASLLGYAS  243

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   AR+A YK C+T GC   D+LA +D+A+ DGVD++SLSLGG    P++ D I
Sbjct  244   GTARGMAPHARVATYKVCWTSGCFGSDILAGMDRAILDGVDVMSLSLGGGS-APYFRDTI  302

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AF A ++G+FV  SAGNSGP  +S++NTAPW+MTV A +LDR FPA   LGN   F 
Sbjct  303   AIGAFTAMERGIFVSCSAGNSGPSRASLANTAPWVMTVGAGTLDRDFPAYAVLGNQNKFT  362

Query  535   GESLYSGKAVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             G SLYSG  +  K   ++        +  C  GSL    V+G++VVC+RG +AR EKG  
Sbjct  363   GVSLYSGTGMGTKPVGLFYNKGSNSSSNLCLPGSLRPEAVRGKVVVCDRGVNARVEKGGV  422

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             V+ +GG GMIL N    GEE+ AD H LPA A+G   G  +++Y  +  + TA I F GT
Sbjct  423   VRAAGGVGMILANTAASGEEMVADSHLLPAVAVGRKVGDMIREYAQTDPNPTAVISFGGT  482

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V   R +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILAAW   IGPT LE D R  +FN
Sbjct  483   VLNVRPSPVVAAFSSRGPNLVTPQILKPDVIGPGVNILAAWSEAIGPTGLEEDTRKSQFN  542

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPH+SGLAALLK+ H +WSP+AIKSALMTT+YT D+ K+P++D+       +
Sbjct  543   IMSGTSMSCPHISGLAALLKAAHPNWSPSAIKSALMTTAYTHDNTKAPLSDAAGGQ--FS  600

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
              P+A GSGHVDP RA  PGL+YDIS+ +Y  +LCSL Y   Q+  + +    C    +  
Sbjct  601   NPWAHGSGHVDPSRAVSPGLVYDISSVEYVAFLCSLGYTIQQVQSIAKSNVTC-ARKYSD  659

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFN  1611
             PG LNYPSF+V+F +        +TR  TNVG   S+Y V V  P GV  IVKP  L F 
Sbjct  660   PGQLNYPSFSVVFGNKRVVR---YTRELTNVGTARSLYKVIVSGPPGVRTIVKPSSLFFA  716

Query  1612  KMGQNLSYTVSFV-AQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              +G+   YTV+FV A+ G   S     FGS+VW +T   V+SP+A  W
Sbjct  717   TVGEKKKYTVTFVSAKSGSRTSRA--EFGSIVWANTLHLVKSPVAFAW  762



>ref|XP_006362066.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=766

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/594 (50%), Positives = 402/594 (68%), Gaps = 16/594 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F +GYE+  G I+ET+E KSPRD EGHGTHTA+TAAG +V  AS LG A G+
Sbjct  178   RKLIGARFFSQGYEAAFGAIDETIESKSPRDDEGHGTHTATTAAGSVVTGASLLGYATGT  237

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+T GC S D+LA +DQAV DGV++LSLSLGG +   ++ D +AI
Sbjct  238   ARGMASHARVAAYKVCWTGGCFSSDILAGMDQAVIDGVNVLSLSLGGTISD-YHRDIVAI  296

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A  +G+FV  SAGN GP + ++SN APWI TV A ++DR FPA + +GNG    G 
Sbjct  297   GAFSAASQGIFVSCSAGNGGPSSGTLSNVAPWITTVGAGTMDREFPAYIGIGNGEKLNGV  356

Query  541   SLYSGKAV-NQKLPLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SLYSGKA+ +  +PLVY G  +       C+ GSL    V G+IVVC+RG +ARA+KG  
Sbjct  357   SLYSGKALLSSVMPLVYAGNVSQSSNGNLCTSGSLIPEKVAGKIVVCDRGMNARAQKGLV  416

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GG GMIL N +T G+E+ AD H +P  A+G +AG  +K+YI S+ + TA+I F GT
Sbjct  417   VKDAGGIGMILANTDTYGDELVADAHLIPTAAVGQTAGNLIKQYIASNSNPTATIAFGGT  476

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
               G + +PV+AAFSSRGP+ ++P+I+KPD+ APGVNILA W   +GPT L+ D R+V FN
Sbjct  477   KLGVQPSPVVAAFSSRGPNPITPDILKPDLIAPGVNILAGWTGKVGPTGLQEDTRNVGFN  536

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSGLAALLK+ H +WSPAAI+SALMTTSY+       I D V+T  +S+
Sbjct  537   IISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALMTTSYSTYKNGKTIED-VATG-MSS  594

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TPF +G+GHV+P  A +PGL+YD++  DY N+LC+L+Y+ + I ++ ++  +C  +  ++
Sbjct  595   TPFDYGAGHVNPTAAVNPGLVYDLTVDDYINFLCALDYSPSMIKVIAKRDISCDKNKEYR  654

Query  1432  PGDLNYPSFAVIFDssssnssHT-------FTRTATNVGIPESVYAVHVMEPDGVSVIVK  1590
               DLNYPSF++  +++    + +       +TRT TNVG P +  A    E   V ++V+
Sbjct  655   VADLNYPSFSIPMETAWGEHADSSTPTVTRYTRTLTNVGNPATYKASVSSETQEVKILVE  714

Query  1591  PKVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             P+ L F++  +  +YTV+F A        G  SF  L W      V SPIA  W
Sbjct  715   PQTLTFSRKNEKKTYTVTFTASS---KPSGTTSFARLEWSDGQHVVASPIAFSW  765



>ref|XP_010501809.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=775

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/600 (50%), Positives = 403/600 (67%), Gaps = 18/600 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGAR F  GYE+  GK+NET E++SPRDS+GHGTHTAS +AG  V  AS LG ARG 
Sbjct  176   RKLVGARFFCGGYEATNGKMNETTEFRSPRDSDGHGTHTASISAGRYVFPASTLGYARGL  235

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D IAI
Sbjct  236   AAGMAPKARLAAYKVCWNSGCYDSDILAAFDTAVADGVDVISLSVGGVV-VPYYLDAIAI  294

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA  +G+FV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNG++  G 
Sbjct  295   GAFGAIDRGIFVSASAGNGGPGALTVTNVAPWMTTVGAGTIDRDFPANVKLGNGKMISGV  354

Query  541   SLYSGKAVN--QKLPLVYGRTA-GGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             S+Y G  ++  +  PLVYG +  GG G  +  C  GSL   LVKG+IV+C+RG ++RA K
Sbjct  355   SVYGGPGLDPGRMYPLVYGGSLLGGDGYSSSLCLEGSLDPNLVKGKIVLCDRGINSRATK  414

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSA------  867
             G  V+++GG GMI+ N   +GE + AD H LPAT++G S G  +++YI+ S  +      
Sbjct  415   GEIVRKNGGLGMIIANGVFDGEGLVADCHVLPATSVGASGGDEIRRYISESSKSRSSKKP  474

Query  868   TASIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLE  1044
             TA+I F+GT  G R APV+A+FS+RGP+  +P+I+KPDV APG+NILAAWP  IGP+ + 
Sbjct  475   TATIVFKGTRLGIRPAPVVASFSARGPNPETPDILKPDVIAPGLNILAAWPDRIGPSGVP  534

Query  1045  ADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITD  1224
             +DNR  EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+Y +D+R   + D
Sbjct  535   SDNRRTEFNILSGTSMACPHVSGLAALLKASHPDWSPAAIRSALMTTAYRVDNRGEAMMD  594

Query  1225  SVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS  1404
               + N  +++   +GSGHV P +A  PGL+YDI+  DY N+LC+ NY    I  + R+K+
Sbjct  595   ESTGN--TSSVMDYGSGHVHPTKAMDPGLVYDITPYDYINFLCNSNYTGANIVTITRRKA  652

Query  1405  ACP-THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVS  1578
              C         G+LNYPSF+V+F         T F RT TNVG  +SVY + +  P G +
Sbjct  653   DCDGARRAGHVGNLNYPSFSVVFQQYGEMKMSTHFIRTVTNVGDSDSVYEIKISPPRGTT  712

Query  1579  VIVKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             V V+P+ L F ++GQ LS+ V   A   K++ G  +   G +VW      V SP+ V  Q
Sbjct  713   VTVEPEKLSFRRVGQKLSFVVRVKATEVKLSPGATNVETGHIVWSDGKRNVTSPLVVTLQ  772



>ref|XP_002510884.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF51486.1| Cucumisin precursor, putative [Ricinus communis]
Length=775

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/590 (51%), Positives = 391/590 (66%), Gaps = 13/590 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KK+VGAR FYKGYE   GKINE  EYKSPRD +GHGTHTA+T AG  V DA+ LG A G+
Sbjct  189   KKIVGARVFYKGYEVATGKINEQNEYKSPRDQDGHGTHTAATVAGSPVHDANLLGYAYGT  248

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   ARIAAYK C+  GC S D+L+AVD+AV DGV++LS+SLGG +   +Y D+++I
Sbjct  249   ARGMAPGARIAAYKVCWAGGCFSSDILSAVDRAVSDGVNVLSISLGGGVSS-YYRDSLSI  307

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
             AAFGA + G+FV  SAGN GP  +S++N +PWI TV AS++DR FPA V LG GR   G 
Sbjct  308   AAFGAMEMGIFVSCSAGNGGPDPASLTNVSPWITTVGASTMDRDFPATVHLGTGRTLTGV  367

Query  541   SLYSGK---AVNQKLPLVY--GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             SLY G+     N++ PLVY    ++    +  C  G+L+  +V G+IV+C+RG S R +K
Sbjct  368   SLYKGRRTLLTNKQYPLVYMGSNSSSPDPSSLCLEGTLNPHIVAGKIVICDRGISPRVQK  427

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKF  885
             G   K +G  GMIL N    GEE+ AD H  PA ++G   G  +K Y  + ++A+A++ F
Sbjct  428   GQVAKDAGAVGMILTNTAANGEELVADCHLFPAVSVGEREGKLIKHYALTRRNASATLAF  487

Query  886   QGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSV  1062
              GT  G R +PV+AAFSSRGP+ +S EI+KPDV APGVNI+AAW    GP+ L  D+R V
Sbjct  488   LGTKVGIRPSPVVAAFSSRGPNFLSLEILKPDVVAPGVNIIAAWTGETGPSSLPTDHRRV  547

Query  1063  EFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNP  1242
              FNILSGTSMSCPHVSG+AALLK+ H +WSPAAIKSALMTT+Y  D+ + P+ D+ +  P
Sbjct  548   RFNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALMTTAYVHDNTQKPLQDASTDAP  607

Query  1243  ISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHH  1422
               ++P+  G+GH++P +A  PGLIYDI  QDYF +LC+   + TQ+ +  +  +      
Sbjct  608   --SSPYDHGAGHINPLKALDPGLIYDIEAQDYFEFLCTQRLSITQLRVFGKYANRTCQKS  665

Query  1423  HHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVL  1602
                PGDLNYP+ + +F  S++ SS T  RT TNVG P S Y   V    G +V ++PK L
Sbjct  666   LLSPGDLNYPAISAVFTDSNTISSLTLHRTVTNVGPPTSTYHAVVSRFKGATVKIEPKTL  725

Query  1603  KFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             KF    Q LSY ++F A+  +I       FG LVWK     VRSPI + W
Sbjct  726   KFTAKNQKLSYRITFTAKSRQIMP----EFGGLVWKDGVHKVRSPIVLTW  771



>gb|AAM10321.1| AT5g67360/K8K14_8 [Arabidopsis thaliana]
 gb|AAN46863.1| At5g67360/K8K14_8 [Arabidopsis thaliana]
Length=757

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/588 (51%), Positives = 394/588 (67%), Gaps = 13/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F +GYES +G I+E+ E +SPRD +GHGTHT+STAAG +V+ AS LG A G+
Sbjct  178   RKLIGARFFARGYESTMGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGT  237

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A YK C+  GC S D+LAA+D+A+ D V++LS+SLGG +   +Y D +AI
Sbjct  238   ARGMAPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLGGGMSD-YYRDGVAI  296

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A ++G+ V  SAGN+GP +SS+SN APWI TV A +LDR FPA+  LGNG+ F G 
Sbjct  297   GAFAAMERGILVSCSAGNAGPSSSSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFTGV  356

Query  541   SLYSGKAVNQKL-PLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SL+ G+A+  KL P +Y G  +       C  G+L    VKG+IV+C+RG +AR +KG  
Sbjct  357   SLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGINARVQKGDV  416

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GG GMIL N    GEE+ AD H LPAT +G  AG  ++ Y+ +  + TASI   GT
Sbjct  417   VKAAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVTTDPNPTASISILGT  476

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V G + +PV+AAFSSRGP++++P I+KPD+ APGVNILAAW    GPT L +D+R VEFN
Sbjct  477   VVGVKPSPVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRVEFN  536

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSGLAALLKSVH + SPAAI+SALMTT+Y       P+ D  +  P  +
Sbjct  537   IISGTSMSCPHVSGLAALLKSVHPECSPAAIRSALMTTAYKTYKDGKPLLDIATGKP--S  594

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TPF  G+GHV P  A +PGLIYD++T+DY  +LC+LNY S QI  + R+   C     + 
Sbjct  595   TPFDHGAGHVSPTTATNPGLIYDLTTEDYLGFLCALNYTSPQIRSVSRRNYTCDPSKSYS  654

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVM-EPDGVSVIVKPKVLKF  1608
               DLNYPSFAV  D      ++ +TRT T+VG     Y+V V  E  GV + V+P VL F
Sbjct  655   VADLNYPSFAVNVD---GVGAYKYTRTVTSVG-GAGTYSVKVTSETTGVKISVEPAVLNF  710

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              +  +  SYTV+F     K +  G +SFGS+ W      V SP+A+ W
Sbjct  711   KEANEKKSYTVTFTVDSSKPS--GSNSFGSIEWSDGKHVVGSPVAISW  756



>ref|XP_008337844.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/588 (50%), Positives = 390/588 (66%), Gaps = 10/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVG--KINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLAR  174
             KKL+GAR+F KGY    G   + +  E +SPRD +GHGTHT+STAAG LV +AS LG A 
Sbjct  178   KKLIGARSFSKGYHMASGGSYLRKPREVESPRDRDGHGTHTSSTAAGSLVANASLLGYAT  237

Query  175   GSAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNI  354
             G+A GM   AR+A YK C++ GC   D+LA +D+A+ DGVD++SLSLGG    P+Y D I
Sbjct  238   GTARGMAPHARVATYKVCWSTGCFGSDILAGMDRAIVDGVDVMSLSLGGGS-APYYRDTI  296

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AF A ++G+FV  SAGNSGP  +S++NTAPWIMTV A +LDR FPA   LGN   F 
Sbjct  297   AIGAFTAMERGIFVSCSAGNSGPTRASLANTAPWIMTVGAGTLDRDFPAYALLGNKLPFT  356

Query  535   GESLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
             G SLYSG  + N+ + LVY R +   G   C  GSL+  LV+G++V+C+RG +AR EKG 
Sbjct  357   GVSLYSGTGMGNKPVQLVYNRGSNSSG-NLCLPGSLNPDLVRGKVVMCDRGINARVEKGG  415

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMIL N    GEE+ AD H LPA A+G   G  +++Y     + TA I F  
Sbjct  416   VVRSAGGIGMILANTAASGEELVADSHLLPAVAVGRRVGDQIREYAQHDPNPTAVITFGR  475

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   R +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILAAW   +G T LE D R  +F
Sbjct  476   TVLNVRPSPVVAAFSSRGPNLVNPQILKPDVIGPGVNILAAWSEAVGLTGLEEDKRKSQF  535

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+ GLAALLK+ H +WSP+A+KSALMTT+YT D+ K+P+ D+   +   
Sbjct  536   NIISGTSMSCPHIIGLAALLKAAHPEWSPSAVKSALMTTAYTHDNTKAPLRDAA--DGTI  593

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             + P+A GSGH+DP +A  PGL+YDI+T+DY  +LCSL Y    +  ++++ +      + 
Sbjct  594   SNPWAHGSGHIDPSKALSPGLVYDIATEDYIAFLCSLEYTKEHVQAIVKRPNVTCARKYS  653

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG LNYPSF+V+F +       ++TR  TNVG   SVY V V  P  V  IVKP  L F
Sbjct  654   DPGQLNYPSFSVVFWNKKKRVV-SYTRELTNVGPAGSVYRVAVTSPSMVRTIVKPTRLVF  712

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             N +G+   Y V+FVA RG   +     FGS++W +    V+SP+A  W
Sbjct  713   NNVGEKQKYRVTFVASRGAEKTSRSE-FGSIMWSNPQHQVKSPVAFAW  759



>ref|XP_010542387.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=781

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/597 (51%), Positives = 400/597 (67%), Gaps = 20/597 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYES-IVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             +KL+GAR FYKGYES + G ++++ E KSPRD+EGHGTHTASTAAG +V +AS    ARG
Sbjct  184   RKLIGARAFYKGYESHLNGSMDDSKESKSPRDTEGHGTHTASTAAGSVVANASLYQYARG  243

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKP-FYTDNI  354
              A GM   ARIAAYK C++ GC   D+LAA+DQAV DGV ++SLS+G     P ++ D+I
Sbjct  244   EARGMASKARIAAYKICWSSGCYDSDILAAMDQAVSDGVQVISLSVGANGLAPAYHEDSI  303

Query  355   AIAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFR  534
             AI AFGA Q GV V  SAGNSGP   +  N APWI+TV AS++DR FPA   +G+GRVF 
Sbjct  304   AIGAFGAAQHGVVVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADAVIGDGRVFY  363

Query  535   GESLYSGK--AVNQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKG  708
             G SLY+G+    + ++PLVY   +G  G+  C  G L+S LVKG+IV+C+RG +AR EKG
Sbjct  364   GTSLYAGEDSLSDSQIPLVY---SGDCGSRLCYPGKLNSSLVKGKIVLCDRGGNARVEKG  420

Query  709   SEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYIN-SSKSATASIKF  885
             S VK++GG GMIL N +  GEE+ AD H +PAT +G +AG  ++ YI  SS+S TA+I+F
Sbjct  421   SAVKQAGGLGMILANTDESGEELTADSHLIPATMVGSAAGNQIRDYIKISSESPTATIRF  480

Query  886   QGTVYGNR--APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRS  1059
             +GTV G    AP +AAFSSRGP+ ++P+I+KPDV APGVNILA W  ++GPT L+ D R 
Sbjct  481   EGTVIGPSPSAPRVAAFSSRGPNHLTPQILKPDVIAPGVNILAGWTGSVGPTDLDIDPRR  540

Query  1060  VEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTN  1239
             V FNI+SGTSMSCPHVSGLAALL+  H +WSPA IKSAL+TT+Y +D+    I D  +  
Sbjct  541   VTFNIISGTSMSCPHVSGLAALLRKAHPNWSPAMIKSALVTTAYNVDNSGESIKDLATGK  600

Query  1240  PISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKK---SAC  1410
               S+ PF  G+GHVDP +A  PGL+YDI  ++Y  +LC++ Y+   IS+ +      +AC
Sbjct  601   --SSNPFIHGAGHVDPNKALDPGLVYDIDMKEYVAFLCAVGYDWPAISVFIHDPKLFNAC  658

Query  1411  PTHHHHQPGDLNYPSFAVIFDssssnssHTFTRTATNVGIP-ESVYAVHVMEPDGVSVIV  1587
              T     PGDLNYPS   +  SS       + R   NVG   ++VY V +  P  V + V
Sbjct  659   ETSKLRTPGDLNYPSLVAVLGSSGEVV--KYRRVVKNVGSKADAVYNVGINSPTNVEIEV  716

Query  1588  KPKVLKFNKMGQNLSYTVSF--VAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
              P  L+F+K  + L Y V+F  V   G++ +     FGS+ W   +  VRSP+A+ W
Sbjct  717   SPSRLEFSKEKRELEYEVTFRSVVLGGRVGAEPREEFGSIEWTDGDHVVRSPVAIRW  773



>ref|XP_010444660.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/588 (50%), Positives = 392/588 (67%), Gaps = 13/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F +GYES +G I+E+ E +SPRD +GHGTHT+STAAG +V+ AS LG A G+
Sbjct  180   RKLIGARFFARGYESTMGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGFASGT  239

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+A YK C+  GC S D+LAA+D+A+ D V++LS+SLGG   + +Y D +AI
Sbjct  240   ARGMSPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLGGGTSE-YYRDGVAI  298

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A ++G+ V  SAGN+GP + S+SN APWI TV A +LDR FPA+  LGNG+ F G 
Sbjct  299   GAFAAMERGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFTGV  358

Query  541   SLYSGKAVNQKL-PLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SL+ G+A+  KL P +Y G  +       C  G+L    VKG+IV+C+RG +AR +KG  
Sbjct  359   SLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGVNARVQKGDV  418

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GG GMIL N    GEE+ AD H LPAT +G  AG  ++ Y+ +    TA+I   GT
Sbjct  419   VKEAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDLIRHYVTTDPHPTATISILGT  478

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
             V G + +PV+AAFSSRGP++++P I+KPD+ APGVNILAAW    GPT L +D+R VEFN
Sbjct  479   VVGVKPSPVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTRAAGPTGLASDSRRVEFN  538

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSGLAALLK+VH +WSPAAI+SALMTT+Y       P+ D  +  P  +
Sbjct  539   IISGTSMSCPHVSGLAALLKAVHPEWSPAAIRSALMTTAYKTYKDGKPLLDIATGKP--S  596

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TPF  G+GHV P  A +PGLIYD++T+DY  +LC+LNY S+QI  + R+   C     + 
Sbjct  597   TPFEHGAGHVSPATATNPGLIYDLTTEDYLGFLCALNYTSSQIRSVSRRNYTCDPSKSYS  656

Query  1432  PGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVM-EPDGVSVIVKPKVLKF  1608
               DLNYPSFAV  +      ++ +TRT T+VG     Y+V +  E   V + V+P VL F
Sbjct  657   VADLNYPSFAVNVE---EAGAYKYTRTVTSVG-GAGTYSVKLTSETTAVKISVEPAVLNF  712

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
                 +  SYTV+F     K  + G +SFG++ W      V SP+A+ W
Sbjct  713   KAANEKQSYTVTFTVDSSK--ASGSNSFGTIEWSDGKHVVGSPVAISW  758



>ref|XP_008780900.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=769

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/594 (53%), Positives = 393/594 (66%), Gaps = 15/594 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F KGYE+ +G I+ET E +SPRDS+GHGTHT++TAAG  V DAS LG A G+
Sbjct  180   RKLIGARFFSKGYEASMGPIDETRELRSPRDSDGHGTHTSTTAAGSAVTDASLLGFAAGT  239

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC S D+LAA+D+AV DG  +LSLSLGG +   +Y D++AI
Sbjct  240   ARGMATRARVAAYKVCWVGGCFSSDILAAIDRAVDDGCHVLSLSLGGGMSD-YYRDSVAI  298

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A +KGV V  SAGNSGP  SS+SN APWI TV A +LDR FPA V LGNG+ + G 
Sbjct  299   GAFNAMEKGVLVSCSAGNSGPSASSLSNVAPWITTVGAGTLDRDFPAYVVLGNGKNYSGV  358

Query  541   SLYSGKAV-NQKLPLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SLYSGK + +  LP+VY G  +   G   C  G+L    V G+IV+CERG S R +KG  
Sbjct  359   SLYSGKPLPSSPLPIVYAGNASNATGGNLCMPGTLMPEKVAGKIVLCERGISPRVQKGYV  418

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             V+ +GGAGMIL N +  GEE+ AD H LPA  +G  AG A+K+Y+ S  S TA+I F GT
Sbjct  419   VRDAGGAGMILANTDANGEELVADAHLLPANGVGEKAGDAIKRYLLSEMSPTATIVFGGT  478

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
               G R +PV+AAFSSRGP+ V+PEI+KPD+ APGVNILA W   +GPT L  D+R VEF+
Sbjct  479   KVGVRPSPVVAAFSSRGPNVVTPEILKPDLIAPGVNILAGWTGAVGPTGLSVDSRRVEFS  538

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSGLAALLK  H DWSPAAI+SALMTT+Y      +     V+T   +A
Sbjct  539   IISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALMTTAYADYPGGNGGVLDVATGK-AA  597

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS-ACPTHHHH  1428
             TPF +G+GHVDP R   PGL+YD++  DY ++LC+LNY S QI+ + ++ +  C     +
Sbjct  598   TPFDYGAGHVDPRRGMDPGLVYDLTADDYIDFLCALNYTSLQIAAVAKRTNYTCDRKRTY  657

Query  1429  QPGDLNYPSFAVIFDssssnssHT----FTRTATNVGIPESVYAVHVMEPDG--VSVIVK  1590
                 LNYPSFAV F+++S +         TRT T+VG P +  A       G  V V V+
Sbjct  658   AVSGLNYPSFAVAFETASGDRVGVATVKHTRTMTSVGGPGTYKATVATAVTGGEVKVAVE  717

Query  1591  PKVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             P  L F K+G+  SYTVSF A      S G   FG L W      V SPIA  W
Sbjct  718   PAELSFTKVGEKQSYTVSFSAPSLPSGSSG---FGRLEWSDGKHVVASPIAFTW  768



>ref|XP_007138654.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
 gb|ESW10648.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
Length=761

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/586 (51%), Positives = 389/586 (66%), Gaps = 10/586 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             KKL+GAR+F +G+    G      E  SPRD +GHGTHTASTAAG  V +AS LG A G+
Sbjct  181   KKLIGARSFSRGFHMASGSGTREKEPASPRDKDGHGTHTASTAAGSHVGNASLLGYASGT  240

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM  TAR+A YK C+T GC + D+LA +D A++DGVD+LSLSLGG    P++ D IA+
Sbjct  241   ARGMAPTARVAVYKVCWTDGCFASDILAGMDNAIQDGVDVLSLSLGGGS-APYFHDTIAV  299

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A  +G+FV  SAGNSGP  ++++N APWIMTV A +LDR FPA   LGN + + G 
Sbjct  300   GAFAAVARGIFVSCSAGNSGPEKATLANVAPWIMTVGAGTLDRDFPAFALLGNKKRYSGV  359

Query  541   SLYSGKAV-NQKLPLVYGRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSEV  717
             SLYSG  + N+ + LVY +     G+  C  GSL   LV+G++VVC+RG +AR EKG  V
Sbjct  360   SLYSGTGMGNKPVGLVYNKGLNQSGS-ICMPGSLDPGLVRGKVVVCDRGINARVEKGKVV  418

Query  718   KRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGTV  897
             + +GG GMIL N E  GEE+ AD H LPA A+G   G  ++KY +S  + TA + F+GTV
Sbjct  419   RDAGGVGMILANTEASGEELAADSHLLPALAVGRIVGDEIRKYASSDPNPTAVLGFRGTV  478

Query  898   YGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFNI  1074
                R +PV+AAFSSRGP+ V+ +I+KPDV  PGVNILA W  +IGP+ L  D R  +FNI
Sbjct  479   LNVRPSPVVAAFSSRGPNMVTRQILKPDVIGPGVNILAGWSESIGPSGLPDDTRKTQFNI  538

Query  1075  LSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISAT  1254
             +SGTSMSCPH+SGLAALLK+ H +WSP+AIKSALMTT+Y  D+ KSP+ D+       +T
Sbjct  539   VSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALMTTAYVHDNTKSPLRDAAGG--AFST  596

Query  1255  PFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQP  1434
             P+A G+GHV+P RA  PGL+YD S  DY  +LCSL+Y    I L++++ +   T     P
Sbjct  597   PWAHGAGHVNPHRALSPGLVYDASITDYIKFLCSLDYTPEHIQLIVKRHAVNCTRKFSDP  656

Query  1435  GDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKFNK  1614
             G LNYPSF++ F          +TRT TNVG   SVY V V  P  V V V+P  L F K
Sbjct  657   GQLNYPSFSIHFGGKRVVR---YTRTLTNVGEAGSVYDVTVDAPSTVEVTVRPARLVFGK  713

Query  1615  MGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             +G+   YTV+FV+++      G + FGS++W +    VRSP+A  W
Sbjct  714   LGERKRYTVTFVSKKSG-GDSGRYGFGSIMWSNAQHQVRSPVAFSW  758



>ref|XP_006474722.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 ref|XP_006474723.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=765

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/588 (51%), Positives = 393/588 (67%), Gaps = 11/588 (2%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETV-EYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARG  177
             KKL+GAR F KGY    G  ++   E +SPRD +GHGTHTASTAAG  V +AS LG A G
Sbjct  180   KKLIGARFFSKGYHMAGGSFSKKPNEPESPRDYDGHGTHTASTAAGVPVANASLLGYASG  239

Query  178   SAGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIA  357
              A GM   AR+A YK C+  GC   D+LA +D+A++DGVD+LS+SLGG    P+Y D IA
Sbjct  240   VARGMATHARVATYKVCWKTGCFGSDILAGIDRAIQDGVDVLSMSLGGGS-APYYRDTIA  298

Query  358   IAAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRG  537
             + AF A +KG+ V  SAGNSGP  +S++N APWI+TV A +LDR FPA V LGN +   G
Sbjct  299   VGAFAAMEKGIVVSCSAGNSGPTKASLANVAPWILTVGAGTLDRDFPAYVFLGNKKKATG  358

Query  538   ESLYSGKAV-NQKLPLVYGRTAGGKGAE-FCSHGSLSSRLVKGRIVVCERGNSARAEKGS  711
              SLYSG  + N+ + LVY + + G  +   C  GSL   LV+G++V+C+RG +AR EKG+
Sbjct  359   VSLYSGNGMGNKPVSLVYNKGSNGSSSSNLCLPGSLQPELVRGKVVICDRGINARVEKGA  418

Query  712   EVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQG  891
              V+ +GG GMIL N    GEE+ AD H LPA A+G   G  V++Y  +  + TA + F G
Sbjct  419   VVRDAGGVGMILANTAASGEELVADSHLLPAVAIGRRMGDIVREYAKTVPNPTALLTFGG  478

Query  892   TVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEF  1068
             TV   R +PV+AAFSSRGP+ V+P+I+KPDV  PGVNILAAW    GPT LE D R  +F
Sbjct  479   TVLNVRPSPVVAAFSSRGPNMVTPQILKPDVIGPGVNILAAWTEASGPTELEKDTRRTKF  538

Query  1069  NILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPIS  1248
             NI+SGTSMSCPH+SG+AALLK+ H DWSP+AIKSALMTT+Y +D+ KSP+ D+       
Sbjct  539   NIMSGTSMSCPHLSGVAALLKAAHPDWSPSAIKSALMTTAYVVDNTKSPLHDAADGR--L  596

Query  1249  ATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHH  1428
             +TP+A GSGHV+P++A  PGL+YD ST+DY  +LCSL Y    +  ++++ +   T   +
Sbjct  597   STPWAHGSGHVNPQKAISPGLVYDASTEDYIAFLCSLGYTIEHVKAIVKRPNITCTRKFN  656

Query  1429  QPGDLNYPSFAVIFDssssnssHTFTRTATNVGIPESVYAVHVMEPDGVSVIVKPKVLKF  1608
              PG+LNYPSF+V+F          +TR  TNVG   S+Y V V  P  V + V+PK L F
Sbjct  657   TPGELNYPSFSVLFGDQRVVR---YTRELTNVGPARSLYNVTVDGPSTVGISVRPKRLLF  713

Query  1609  NKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
               +G+   YTV+FVA+ G    GG  +FGS+VW +    VRSP+A  W
Sbjct  714   RTVGEKKRYTVTFVAKNGDQKMGGA-AFGSIVWGNAQHQVRSPVAFSW  760



>ref|XP_010487224.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=777

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/600 (50%), Positives = 405/600 (68%), Gaps = 18/600 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KLVGAR F  GYE+  GK+NET E++SPRDS+GHGTHTAS +AG  V  AS LG ARG 
Sbjct  178   RKLVGARFFCGGYEATNGKMNETTEFRSPRDSDGHGTHTASISAGRYVFPASTLGYARGL  237

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+  GC   D+LAA D AV DGVD++SLS+GG++  P+Y D IAI
Sbjct  238   AAGMAPKARLAAYKVCWNSGCYDSDILAAFDTAVADGVDVISLSVGGVV-VPYYLDAIAI  296

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AFGA  +G+FV +SAGN GP   +V+N APW+ TV A ++DR FPA V+LGNG++  G 
Sbjct  297   GAFGAIDRGIFVSASAGNGGPGALTVTNVAPWMTTVGAGTIDRDFPANVKLGNGKMISGV  356

Query  541   SLYSGKAVN--QKLPLVYGRTA-GGKG--AEFCSHGSLSSRLVKGRIVVCERGNSARAEK  705
             S+Y G  ++  +  PLVYG +  GG G  +  C  GSL   LVKG+IV+C+RG ++RA K
Sbjct  357   SVYGGPGLDPGRMYPLVYGGSLLGGDGYSSSLCLEGSLDPNLVKGKIVLCDRGINSRATK  416

Query  706   GSEVKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSA------  867
             G  V+++GG GMI+ N   +GE + AD H LPAT++G S G  +++YI+ S  +      
Sbjct  417   GEIVRKNGGLGMIIANGVFDGEGLVADCHVLPATSVGASGGDEIRRYISESSKSRSSKKP  476

Query  868   TASIKFQGTVYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLE  1044
             TA+I F+GT  G R APV+A+FS+RGP+  +P+I+KPDV APG+NILAAWP  IGP+ + 
Sbjct  477   TATIVFKGTRLGIRPAPVVASFSARGPNPETPDILKPDVIAPGLNILAAWPDRIGPSGVS  536

Query  1045  ADNRSVEFNILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITD  1224
             +DNR  EFNILSGTSM+CPHVSGLAALLK+ H DWSPAAI+SALMTT+Y +D+R   + D
Sbjct  537   SDNRRTEFNILSGTSMACPHVSGLAALLKASHPDWSPAAIRSALMTTAYRVDNRGEAMMD  596

Query  1225  SVSTNPISATPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKS  1404
               + N  +++   +GSGHV P +A  PGL+YDI++ DY N+LC+ NY    I  + R+K+
Sbjct  597   ESTGN--TSSVMDYGSGHVHPTKAMDPGLVYDITSYDYINFLCNSNYTGANIVTITRRKA  654

Query  1405  ACP-THHHHQPGDLNYPSFAVIFDssssnssHT-FTRTATNVGIPESVYAVHVMEPDGVS  1578
              C         G+LNYPSF+V+F     +   T F RT TNVG  +SVY + +  P G +
Sbjct  655   DCDGARRAGHVGNLNYPSFSVVFQQYGESKMSTHFIRTVTNVGDSDSVYEIKIRPPRGTT  714

Query  1579  VIVKPKVLKFNKMGQNLSYTVSFVAQRGKIASGGGH-SFGSLVWKSTNFTVRSPIAVIWQ  1755
             V V+P+ L F ++GQ LS+ V     + K++ G  +   G +VW      V SP+ V  Q
Sbjct  715   VTVEPEKLSFRRVGQKLSFIVRVKTTKVKLSPGATNVKTGHIVWSDGKRNVTSPLVVTLQ  774



>ref|NP_001234282.1| SBT1 protein precursor [Solanum lycopersicum]
 emb|CAA67429.1| SBT1 [Solanum lycopersicum]
 emb|CAA06999.1| subtilisin-like protease [Solanum lycopersicum]
Length=766

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/594 (49%), Positives = 402/594 (68%), Gaps = 16/594 (3%)
 Frame = +1

Query  1     KKLVGARTFYKGYESIVGKINETVEYKSPRDSEGHGTHTASTAAGDLVKDASFLGLARGS  180
             +KL+GAR F +GYE+  G I+ET+E KSPRD EGHGTHTA+TAAG +V  AS LG A G+
Sbjct  178   RKLIGARFFSQGYEAAFGAIDETIESKSPRDDEGHGTHTATTAAGSVVTGASLLGYATGT  237

Query  181   AGGMKYTARIAAYKACYTLGCSSIDVLAAVDQAVKDGVDIlslslggllPKPFYTDNIAI  360
             A GM   AR+AAYK C+T GC S D+LA +DQAV DGV++LSLSLGG +   ++ D +AI
Sbjct  238   ARGMASHARVAAYKVCWTGGCFSSDILAGMDQAVIDGVNVLSLSLGGTISD-YHRDIVAI  296

Query  361   AAFGATQKGVFVCSSAGNSGPLTSSVSNTAPWIMTVAASSLDRRFPAMVELGNGRVFRGE  540
              AF A  +G+FV  SAGN GP + ++SN APWI TV A ++DR FPA + +GNG+   G 
Sbjct  297   GAFSAASQGIFVSCSAGNGGPSSGTLSNVAPWITTVGAGTMDREFPAYIGIGNGKKLNGV  356

Query  541   SLYSGKAV-NQKLPLVY-GRTAGGKGAEFCSHGSLSSRLVKGRIVVCERGNSARAEKGSE  714
             SLYSGKA+ +  +PLVY G  +       C+ GSL    V G+IVVC+RG +ARA+KG  
Sbjct  357   SLYSGKALPSSVMPLVYAGNVSQSSNGNLCTSGSLIPEKVAGKIVVCDRGMNARAQKGLV  416

Query  715   VKRSGGAGMILINRETEGEEVYADPHFLPATALGFSAGIAVKKYINSSKSATASIKFQGT  894
             VK +GG GMIL N +T G+E+ AD H +P  A+G +AG  +K+YI S+ + TA+I F GT
Sbjct  417   VKDAGGIGMILANTDTYGDELVADAHLIPTAAVGQTAGNLIKQYIASNSNPTATIAFGGT  476

Query  895   VYGNR-APVMAAFSSRGPSAVSPEIIKPDVTAPGVNILAAWPPNIGPTMLEADNRSVEFN  1071
               G + +PV+AAFSSRGP+ ++P+++KPD+ APGVNILA W   +GPT L+ D R+V FN
Sbjct  477   KLGVQPSPVVAAFSSRGPNPITPDVLKPDLIAPGVNILAGWTGKVGPTGLQEDTRNVGFN  536

Query  1072  ILSGTSMSCPHVSGLAALLKSVHGDWSPAAIKSALMTTSYTLDSRKSPITDSVSTNPISA  1251
             I+SGTSMSCPHVSGLAALLK+ H +WSPAAI+SALMTTSY+       I D V+T  +S+
Sbjct  537   IISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALMTTSYSTYKNGKTIED-VATG-MSS  594

Query  1252  TPFAFGSGHVDPERAAHPGLIYDISTQDYFNYLCSLNYNSTQISLLLRKKSACPTHHHHQ  1431
             TPF +G+GHV+P  A  PGL+YD++  DY N+LC+L+Y+ + I ++ ++  +C  +  ++
Sbjct  595   TPFDYGAGHVNPTAAVSPGLVYDLTVDDYINFLCALDYSPSMIKVIAKRDISCDENKEYR  654

Query  1432  PGDLNYPSFAVIFDssssnssHT-------FTRTATNVGIPESVYAVHVMEPDGVSVIVK  1590
               DLNYPSF++  +++    + +       +TRT TNVG P +  A    E   V ++V+
Sbjct  655   VADLNYPSFSIPMETAWGEHADSSTPTVTRYTRTLTNVGNPATYKASVSSETQDVKILVE  714

Query  1591  PKVLKFNKMGQNLSYTVSFVAQRGKIASGGGHSFGSLVWKSTNFTVRSPIAVIW  1752
             P+ L F++  +  +YTV+F A        G  SF  L W      V SPIA  W
Sbjct  715   PQTLTFSRKNEKKTYTVTFTATS---KPSGTTSFARLEWSDGQHVVASPIAFSW  765



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5763899892528