BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1538_g1_i1 len=736 path=[1:0-150 152:151-735]

Length=736
                                                                      Score     E

ref|XP_009779948.1|  PREDICTED: 18 kDa seed maturation protein-like     162   5e-46   
ref|XP_009779428.1|  PREDICTED: 18 kDa seed maturation protein          159   8e-45   
ref|XP_009606043.1|  PREDICTED: 18 kDa seed maturation protein-like     154   4e-43   
ref|XP_009614696.1|  PREDICTED: LOW QUALITY PROTEIN: 18 kDa seed ...    136   5e-36   
gb|AAG37443.1|  seed maturation protein LEA 4                           132   2e-34   Glycine tomentella [wooly glycine]
gb|AAG15416.1|  seed maturation protein                                 130   8e-34   Glycine tomentella [wooly glycine]
gb|AAG37438.1|  seed maturation protein LEA 4                           130   1e-33   Glycine canescens
gb|AAL02402.1|  seed maturation protein LEA 4                           129   2e-33   Glycine canescens
gb|AAG15412.1|  seed maturation protein                                 129   2e-33   Glycine tomentella [wooly glycine]
gb|AAF91486.1|AF287476_1  seed maturation protein                       129   4e-33   Glycine tomentella [wooly glycine]
gb|AAG37451.1|  seed maturation protein LEA 4                           128   6e-33   Glycine tomentella [wooly glycine]
gb|AAG15418.1|  seed maturation protein                                 128   1e-32   Glycine tomentella [wooly glycine]
gb|AAG37441.1|  seed maturation protein LEA 4                           127   1e-32   Glycine tabacina
gb|AAG15415.1|  seed maturation protein                                 127   3e-32   Glycine tabacina
ref|XP_011078826.1|  PREDICTED: 18 kDa seed maturation protein-like     123   3e-31   
gb|AAG37448.1|  seed maturation protein LEA 4                           124   4e-31   Glycine tomentella [wooly glycine]
emb|CDP10134.1|  unnamed protein product                                122   7e-31   
ref|XP_007202673.1|  hypothetical protein PRUPE_ppa012476mg             121   3e-30   
ref|XP_007162333.1|  hypothetical protein PHAVU_001G143100g             121   3e-30   
ref|NP_001236128.1|  soybean seed maturation polypeptides               120   4e-30   
ref|XP_009606041.1|  PREDICTED: 18 kDa seed maturation protein-like     112   3e-27   
ref|XP_008240938.1|  PREDICTED: LOW QUALITY PROTEIN: 18 kDa seed ...    110   3e-26   
ref|NP_001238562.1|  18 kDa seed maturation protein                     110   4e-26   
gb|AAD09209.1|  late embryogenesis abundant protein                     110   6e-26   Glycine soja [wild soybean]
gb|AAG37450.1|  seed maturation protein LEA 4                           105   3e-24   Glycine tomentella [wooly glycine]
gb|AAG37447.1|  seed maturation protein LEA 4                           104   6e-24   Glycine tomentella [wooly glycine]
ref|NP_001266059.1|  18 kDa seed maturation protein-like                103   1e-23   
gb|AHF21585.1|  late embryogenesis abundant protein                     104   1e-23   
gb|AAG37454.1|  seed maturation protein LEA 4                           103   1e-23   Glycine tomentella [wooly glycine]
ref|XP_009376127.1|  PREDICTED: 18 kDa seed maturation protein-like     102   3e-23   
ref|XP_003625258.1|  Seed maturation protein                            102   4e-23   
gb|AAG37439.1|  seed maturation protein LEA 4                         99.8    4e-22   Glycine canescens
gb|EYU39928.1|  hypothetical protein MIMGU_mgv11b013195mg             99.4    4e-22   
gb|KHF99366.1|  18 kDa seed maturation protein                        96.3    7e-21   
gb|ADQ91841.1|  late embryogenesis abundant protein group 4 protein   95.9    1e-20   
gb|ADQ91840.1|  late embryogenesis abundant protein group 4 protein   95.1    3e-20   
gb|AFN53709.1|  hypothetical protein                                  94.7    3e-20   
ref|XP_008380131.1|  PREDICTED: 18 kDa seed maturation protein-like   94.0    6e-20   
ref|XP_002322667.2|  hypothetical protein POPTR_0016s04670g           94.4    8e-20   Populus trichocarpa [western balsam poplar]
gb|AAG37442.1|  seed maturation protein LEA 4                         93.6    9e-20   Glycine tabacina
ref|XP_006373739.1|  hypothetical protein POPTR_0016s04570g           94.4    1e-19   
ref|XP_006399153.1|  hypothetical protein EUTSA_v10014897mg           93.2    1e-19   
gb|AAL02403.1|  seed maturation protein LEA 4                         92.4    2e-19   Glycine canescens
gb|AAG15413.1|  seed maturation protein                               92.4    2e-19   Glycine tomentella [wooly glycine]
ref|XP_008387256.1|  PREDICTED: 18 kDa seed maturation protein-like   92.0    2e-19   
ref|XP_010672665.1|  PREDICTED: 18 kDa seed maturation protein        92.4    3e-19   
ref|XP_004304367.1|  PREDICTED: 18 kDa seed maturation protein-like   92.0    3e-19   
ref|XP_002873277.1|  hypothetical protein ARALYDRAFT_325294           91.7    3e-19   
ref|XP_010423305.1|  PREDICTED: 18 kDa seed maturation protein-like   90.5    1e-18   
ref|NP_196294.1|  late embryogenesis abundant protein 4-5             89.7    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452616.1|  PREDICTED: 18 kDa seed maturation protein-li...  90.1    2e-18   
gb|KCW48100.1|  hypothetical protein EUGRSUZ_K01836                   89.4    2e-18   
ref|XP_010491257.1|  PREDICTED: 18 kDa seed maturation protein-like   89.4    2e-18   
emb|CAA63008.1|  LEA D113 homologue type1                             89.4    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130961.1|  PREDICTED: 18 kDa seed maturation protein-like   89.0    3e-18   
ref|XP_009369595.1|  PREDICTED: 18 kDa seed maturation protein        89.0    4e-18   
ref|XP_010036485.1|  PREDICTED: 18 kDa seed maturation protein        89.0    5e-18   
gb|AAG37449.1|  seed maturation protein LEA 4                         87.8    9e-18   Glycine tomentella [wooly glycine]
emb|CDY65929.1|  BnaA03g55670D                                        87.4    1e-17   
ref|XP_011033219.1|  PREDICTED: 18 kDa seed maturation protein        87.8    1e-17   
ref|XP_006288803.1|  hypothetical protein CARUB_v10002135mg           87.4    1e-17   
gb|AAG15417.1|  seed maturation protein                               86.7    2e-17   Glycine tomentella [wooly glycine]
emb|CDY64600.1|  BnaCnng44320D                                        86.7    2e-17   
gb|KDO70933.1|  hypothetical protein CISIN_1g031500mg                 86.3    3e-17   
ref|XP_006492865.1|  PREDICTED: 18 kDa seed maturation protein-like   86.3    3e-17   
ref|XP_006429871.1|  hypothetical protein CICLE_v10012978mg           85.9    4e-17   
gb|AAG15414.1|  seed maturation protein                               84.3    1e-16   Glycine tabacina
gb|AAY26119.1|  group 1 LEA protein                                   83.2    3e-16   Sisymbrium irio
ref|XP_008367380.1|  PREDICTED: LOW QUALITY PROTEIN: 18 kDa seed ...  81.6    8e-16   
ref|XP_007028983.1|  Late Embryogenesis Abundant 4-5, putative        82.0    9e-16   
ref|XP_010520037.1|  PREDICTED: 18 kDa seed maturation protein        81.6    1e-15   
ref|XP_009122290.1|  PREDICTED: 18 kDa seed maturation protein        80.5    3e-15   
emb|CDX98954.1|  BnaC09g48810D                                        80.5    3e-15   
gb|AAT77223.1|  group I late embryogenesis abundant protein           80.5    3e-15   Brassica napus [oilseed rape]
ref|XP_004234770.1|  PREDICTED: 18 kDa seed maturation protein-like   78.2    7e-15   
ref|XP_006659308.1|  PREDICTED: 18 kDa seed maturation protein-like   78.6    1e-14   
ref|XP_010928814.1|  PREDICTED: 11 kDa late embryogenesis abundan...  79.0    1e-14   
gb|AAC49862.1|  group 4-late embryogenesis abundant protein PvLEA...  77.4    1e-14   Phaseolus vulgaris [French bean]
gb|AAT77224.1|  group I late embryogenesis abundant protein           79.0    1e-14   Brassica carinata [Abyssinian mustard]
gb|AFG26320.1|  late embryogenesis abundant group 4                   77.4    4e-14   
ref|XP_007162320.1|  hypothetical protein PHAVU_001G142000g           75.9    6e-14   
ref|XP_004146409.1|  PREDICTED: 18 kDa seed maturation protein-like   76.6    9e-14   
gb|AFG26321.1|  late embryogenesis abundant group 4                   75.1    2e-13   
ref|XP_004156026.1|  PREDICTED: 18 kDa seed maturation protein-like   73.6    1e-12   
gb|KFK25064.1|  hypothetical protein AALP_AA8G061800                  72.8    1e-12   
ref|XP_004973219.1|  PREDICTED: 18 kDa seed maturation protein-like   72.4    2e-12   
gb|AAG37453.1|  seed maturation protein LEA 4                         72.4    2e-12   Glycine tomentella [wooly glycine]
ref|XP_010088172.1|  18 kDa seed maturation protein                   72.0    3e-12   
ref|NP_001061558.1|  Os08g0327700                                     70.9    6e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004497898.1|  PREDICTED: 18 kDa seed maturation protein-like   71.2    6e-12   
ref|XP_008442129.1|  PREDICTED: 18 kDa seed maturation protein        71.2    7e-12   
gb|EAZ06557.1|  hypothetical protein OsI_28805                        68.2    5e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_010452617.1|  PREDICTED: 18 kDa seed maturation protein-li...  68.2    6e-11   
ref|XP_008782853.1|  PREDICTED: LOW QUALITY PROTEIN: 11 kDa late ...  67.8    8e-11   
ref|XP_009411691.1|  PREDICTED: 11 kDa late embryogenesis abundan...  67.0    1e-10   
ref|XP_002445279.1|  hypothetical protein SORBIDRAFT_07g007690        66.6    2e-10   Sorghum bicolor [broomcorn]
ref|NP_001150746.1|  seed maturation protein                          65.5    5e-10   Zea mays [maize]
ref|XP_006362227.1|  PREDICTED: 11 kDa late embryogenesis abundan...  63.5    9e-10   
ref|XP_008662787.1|  PREDICTED: 11 kDa late embryogenesis abundan...  64.7    1e-09   
gb|AGZ80327.1|  group 4-late embryogenesis abundant protein           62.4    2e-09   
ref|XP_006850002.1|  hypothetical protein AMTR_s00022p00173750        63.5    2e-09   
ref|XP_003568768.1|  PREDICTED: 11 kDa late embryogenesis abundan...  62.4    5e-09   
gb|AGZ80326.1|  group 4-late embryogenesis abundant protein           60.5    7e-09   
gb|AFN53649.1|  putative seed maturation protein                      62.4    8e-09   
gb|KDP24620.1|  hypothetical protein JCGZ_25536                       60.8    2e-08   
gb|AAG12982.1|  seed maturation protein                               57.8    6e-08   Glycine tomentella [wooly glycine]
gb|AAG12980.1|  seed maturation protein                               57.4    7e-08   Glycine tomentella [wooly glycine]
gb|AAG12979.1|  seed maturation protein                               57.4    8e-08   Glycine tomentella [wooly glycine]
gb|KGN59308.1|  hypothetical protein Csa_3G808370                     57.4    2e-07   
ref|XP_003625255.1|  Seed maturation protein                          57.4    2e-07   
ref|XP_004249726.1|  PREDICTED: 11 kDa late embryogenesis abundan...  57.0    2e-07   
gb|KHN07426.1|  18 kDa seed maturation protein                        57.8    3e-07   
ref|XP_003625257.1|  Seed maturation protein LEA                      56.6    4e-07   
ref|XP_004514000.1|  PREDICTED: 18 kDa seed maturation protein-like   56.6    4e-07   
ref|XP_002279220.1|  PREDICTED: 11 kDa late embryogenesis abundan...  55.8    1e-06   Vitis vinifera
gb|KEH41703.1|  seed maturation protein                               55.5    3e-06   
gb|EPS61795.1|  hypothetical protein M569_12999                       52.8    5e-06   
emb|CAN63336.1|  hypothetical protein VITISV_032257                   56.2    6e-06   Vitis vinifera
gb|EAZ42326.1|  hypothetical protein OsJ_26900                        53.5    9e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011078825.1|  PREDICTED: 11 kDa late embryogenesis abundan...  53.9    9e-06   
emb|CDY71981.1|  BnaCnng75390D                                        55.1    1e-05   
ref|XP_004956444.1|  PREDICTED: 18 kDa seed maturation protein-like   52.4    3e-05   
ref|XP_010557946.1|  PREDICTED: 11 kDa late embryogenesis abundan...  52.0    3e-05   
ref|XP_008664453.1|  PREDICTED: 11 kDa late embryogenesis abundan...  51.6    3e-05   
gb|EMT19082.1|  18 kDa seed maturation protein                        52.0    4e-05   
dbj|BAK07925.1|  predicted protein                                    51.6    6e-05   
gb|EYU39929.1|  hypothetical protein MIMGU_mgv1a016953mg              49.7    1e-04   
ref|XP_007145682.1|  hypothetical protein PHAVU_007G259400g           51.6    1e-04   
ref|XP_004249727.1|  PREDICTED: 18 kDa seed maturation protein-like   51.6    1e-04   
ref|XP_006362225.1|  PREDICTED: mucin-19-like                         51.2    2e-04   
gb|ABC46710.1|  seed maturation protein LEA 4                         48.1    2e-04   Arachis hypogaea [goober]
ref|XP_003533922.1|  PREDICTED: 18 kDa seed maturation protein-like   50.8    2e-04   
ref|XP_010257470.1|  PREDICTED: 11 kDa late embryogenesis abundan...  48.1    4e-04   
gb|AAO33589.1|AF479307_1  putative lea 4                              47.4    8e-04   Arachis hypogaea [goober]



>ref|XP_009779948.1| PREDICTED: 18 kDa seed maturation protein-like [Nicotiana sylvestris]
Length=156

 Score =   162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M+AMKETA+N  ASA +G EKTKAV QEKMERMTA +P EKEMAT+KK+ERIN+AE+NK+
Sbjct  1    MQAMKETASNFAASAKSGMEKTKAVAQEKMERMTADNPTEKEMATEKKKERINEAEMNKQ  60

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVE  453
            EA+++NAAARQG STTGT K HSYSTTG TG+P GAHQMSA+PGHG+G P GQV EGVV+
Sbjct  61   EARDKNAAARQGYSTTGTEKTHSYSTTGATGHPTGAHQMSALPGHGSGEPAGQVVEGVVQ  120

Query  454  SRPIGTATGTQRTTVAHNTH  513
            S PIGTATGTQR++ AHNTH
Sbjct  121  SHPIGTATGTQRSSAAHNTH  140



>ref|XP_009779428.1| PREDICTED: 18 kDa seed maturation protein [Nicotiana sylvestris]
Length=156

 Score =   159 bits (401),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 127/154 (82%), Gaps = 2/154 (1%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M+++KE A+NV ASA +G EKTKAVVQEK+ERMTAHDP +KEMAT KKEERINQAE+NK+
Sbjct  1    MQSVKEKASNVAASAKSGMEKTKAVVQEKVERMTAHDPTQKEMATGKKEERINQAEMNKQ  60

Query  274  eakeqnaaaRQGASTTGTNKPH-SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVV  450
               ++NAA  QG  T GT +PH S STTG TG+  GAHQMSA+PGHGTG PMGQVT+GVV
Sbjct  61   ATHDRNAAIHQGGGT-GTGRPHYSNSTTGATGHSTGAHQMSALPGHGTGEPMGQVTDGVV  119

Query  451  ESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
            +S PIGTATGTQR + AHNTH G  VN+G+GTGG
Sbjct  120  QSHPIGTATGTQRASAAHNTHVGGGVNQGFGTGG  153



>ref|XP_009606043.1| PREDICTED: 18 kDa seed maturation protein-like [Nicotiana tomentosiformis]
Length=156

 Score =   154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M+++KE A+NV ASA +G EKTKAVVQEK+ERMTAHDP +KEMAT KKEERINQAE++K+
Sbjct  1    MQSVKEKASNVAASAKSGVEKTKAVVQEKVERMTAHDPTQKEMATGKKEERINQAEMSKQ  60

Query  274  eakeqnaaaRQGASTTGTNKPH-SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVV  450
               ++NAA  QG  T GT +PH S STTG TG   GAHQMSA+PGHGTG PMGQVT+GVV
Sbjct  61   ATHDRNAAIHQGGGT-GTGRPHYSNSTTGATGYSTGAHQMSALPGHGTGEPMGQVTDGVV  119

Query  451  ESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
            +S PIGTAT TQR + AHNTH G  VN+GYG GG
Sbjct  120  QSHPIGTATRTQRASAAHNTHVGGGVNQGYGIGG  153



>ref|XP_009614696.1| PREDICTED: LOW QUALITY PROTEIN: 18 kDa seed maturation protein-like 
[Nicotiana tomentosiformis]
Length=150

 Score =   136 bits (342),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 120/154 (78%), Gaps = 6/154 (4%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M+AMKETA+N+ ASA +G EKTKAV QEKMERMTA +P EKEMAT+KKEERIN+AE+NK+
Sbjct  1    MQAMKETASNIAASAKSGMEKTKAVAQEKMERMTADNPTEKEMATEKKEERINEAEMNKQ  60

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVE  453
            E +++NA     A+  GT K HSYSTTG TG P GAHQMSA+PGHG+G         VV+
Sbjct  61   ETRDKNA----AAARQGTEKTHSYSTTGATGQPTGAHQMSALPGHGSGXGQVVEG--VVQ  114

Query  454  SRPIGTATGTQRTTVAHNTHAGREVNKGYGTGGA  555
            S PIGTATGTQR++ AHNTH G  VN GYGTGG+
Sbjct  115  SHPIGTATGTQRSSAAHNTHVGGTVNSGYGTGGS  148



>gb|AAG37443.1| seed maturation protein LEA 4 [Glycine tomentella]
 gb|AAG37444.1| seed maturation protein LEA 4 [Glycine tomentella]
Length=170

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 119/163 (73%), Gaps = 8/163 (5%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DPM+KE+AT+KKE +I+QAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPMQKELATQKKEAKISQAELDKQA  68

Query  277  akeqnaaaRQGASTTGTNKPH------SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            A++ N AA+Q A+     + H      +YSTTG  G PMGAHQ SAMPGHGTG PMG VT
Sbjct  69   ARQHNTAAKQVATAGHMGQGHHTPGTATYSTTGEHGQPMGAHQTSAMPGHGTGQPMGHVT  128

Query  439  EGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGGATYN  564
            EGVV S PIGT  G   T  AHNT AG   N  GYGTGG TYN
Sbjct  129  EGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG-TYN  170



>gb|AAG15416.1| seed maturation protein [Glycine tomentella]
Length=168

 Score =   130 bits (328),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 115/159 (72%), Gaps = 7/159 (4%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DPM+KE+AT+KKE +I+QAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPMQKELATQKKEAKISQAELDKQA  68

Query  277  akeqnaaaRQGASTTGTNKPH------SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            A+  N AA+Q A+     + H      +YSTTG  G PMGAHQ SAMPGHGTG PMG VT
Sbjct  69   ARRHNTAAKQAATAGHMGQGHHTPGTATYSTTGEHGQPMGAHQTSAMPGHGTGQPMGHVT  128

Query  439  EGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
            EGVV S PIGT  G   T  AHNT AG   N  GYGTGG
Sbjct  129  EGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG  167



>gb|AAG37438.1| seed maturation protein LEA 4 [Glycine canescens]
Length=168

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 117/159 (74%), Gaps = 7/159 (4%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DP++KE+AT+KKE +++QAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPIQKELATQKKEAKMSQAELDKQA  68

Query  277  akeqnaaaRQGAST----TGTNKP--HSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            A++ N AA+Q A+      G N P   +YSTTG  G PMGAHQ SAMPGHGTG PMG VT
Sbjct  69   ARQHNTAAKQAATAGHMGQGHNTPGTATYSTTGEHGQPMGAHQTSAMPGHGTGQPMGHVT  128

Query  439  EGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
            EGVV S PIGT  G   T  AHNT AG   N  GYGTGG
Sbjct  129  EGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG  167



>gb|AAL02402.1| seed maturation protein LEA 4 [Glycine canescens]
Length=168

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 116/159 (73%), Gaps = 7/159 (4%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DPM+KE+AT+KK+ +++QAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPMQKELATQKKDAKMSQAELDKQA  68

Query  277  akeqnaaaRQGASTTGTNKPH------SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            A++ N AA+Q A+     + H      +YSTTG  G PMGAHQ SAMPGHGTG PMG VT
Sbjct  69   ARQHNTAAKQAATAGHMGQGHHTPGTATYSTTGEHGQPMGAHQTSAMPGHGTGQPMGHVT  128

Query  439  EGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
            EGVV S PIGT  G   T  AHNT AG   N  GYGTGG
Sbjct  129  EGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG  167



>gb|AAG15412.1| seed maturation protein [Glycine tomentella]
Length=170

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 118/163 (72%), Gaps = 8/163 (5%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DPM+KE+AT+KK+ +++QAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPMQKELATQKKDAKMSQAELDKQA  68

Query  277  akeqnaaaRQGASTTGTNKPH------SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            A++ N AA+Q A+     + H      +YSTTG  G PMGAHQ SAMPGHGTG P G VT
Sbjct  69   ARQHNTAAKQAATAGHMGQGHHTPGTATYSTTGEHGQPMGAHQTSAMPGHGTGQPTGHVT  128

Query  439  EGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGGATYN  564
            EGVV S PIGT  G   T  AHNT AG   N  GYGTGG TYN
Sbjct  129  EGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG-TYN  170



>gb|AAF91486.1|AF287476_1 seed maturation protein [Glycine tomentella]
 gb|AAG37445.1| seed maturation protein LEA 4 [Glycine tomentella]
 gb|AAG37446.1| seed maturation protein LEA 4 [Glycine tomentella]
Length=168

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 115/159 (72%), Gaps = 7/159 (4%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DPM+KE+AT+KKE +I+QAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPMQKELATQKKEAKISQAELDKQA  68

Query  277  akeqnaaaRQGASTTGTNKPH------SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            A++ N AA+Q A+     + H      +YSTTG  G PMGAHQ SAMPGHGTG PMG VT
Sbjct  69   ARQHNTAAKQAATAGHMGQGHHTPGTATYSTTGEHGQPMGAHQTSAMPGHGTGQPMGHVT  128

Query  439  EGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
            EGVV S PIGT      T  AHNT AG   N  GYGTGG
Sbjct  129  EGVVGSHPIGTNRSPGGTATAHNTRAGGNPNDYGYGTGG  167



>gb|AAG37451.1| seed maturation protein LEA 4 [Glycine tomentella]
Length=170

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 118/163 (72%), Gaps = 8/163 (5%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DPM+KE+AT+KKE +++QAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPMQKELATQKKEAKMSQAELDKQA  68

Query  277  akeqnaaaRQGASTTGTNKPH------SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            A++ N AA+Q A+     + H      +YSTTG  G PMGAHQ SA+PGHGTG P G VT
Sbjct  69   ARQHNTAAKQAATAGHMGQGHHTPGTATYSTTGEHGQPMGAHQTSALPGHGTGQPTGHVT  128

Query  439  EGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGGATYN  564
            EGVV S PIGT  G   T  AHNT AG   N  GYGTGG TYN
Sbjct  129  EGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG-TYN  170



>gb|AAG15418.1| seed maturation protein [Glycine tomentella]
Length=168

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 115/159 (72%), Gaps = 7/159 (4%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DP+++E+AT+KKE +I+QAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPVQRELATQKKEAKISQAELDKQA  68

Query  277  akeqnaaaRQGASTTGTNKPH------SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            A++ N AA+Q A+     + H      +YSTTG  G PMGAHQ SAMPGHGTG P G VT
Sbjct  69   ARQHNTAAKQAATAGHMGQGHHTPGTATYSTTGEHGQPMGAHQTSAMPGHGTGQPTGHVT  128

Query  439  EGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
            EGVV S PIGT  G   T  AHNT AG   N  GYGTGG
Sbjct  129  EGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG  167



>gb|AAG37441.1| seed maturation protein LEA 4 [Glycine tabacina]
Length=168

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 116/159 (73%), Gaps = 7/159 (4%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DPM+KE+AT+KKE +++QAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPMQKELATQKKEAKMSQAELDKQA  68

Query  277  akeqnaaaRQGAST----TGTNKP--HSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            A++ N AA+Q A+      G N P   +YSTTG  G PMGAHQ SAMPGHGTG P G VT
Sbjct  69   ARQHNTAAKQAATAGHMGQGHNTPGTATYSTTGEHGQPMGAHQTSAMPGHGTGQPTGHVT  128

Query  439  EGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
            EGVV S PIGT  G   T  AHNT AG   N  GYGTGG
Sbjct  129  EGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG  167



>gb|AAG15415.1| seed maturation protein [Glycine tabacina]
Length=168

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 115/159 (72%), Gaps = 7/159 (4%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DPM+KE+AT+KKE +++QAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPMQKELATQKKEAKMSQAELDKQA  68

Query  277  akeqnaaaRQGASTTGTNKPH------SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            A++ N AA+Q A+     + H      +YSTTG  G PMGAHQ SAMPGHGTG P G VT
Sbjct  69   ARQHNTAAKQAATAGHMGQGHHTPETATYSTTGEHGQPMGAHQTSAMPGHGTGQPTGHVT  128

Query  439  EGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
            EGVV S PIGT  G   T  AHNT AG   N  GYGTGG
Sbjct  129  EGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG  167



>ref|XP_011078826.1| PREDICTED: 18 kDa seed maturation protein-like [Sesamum indicum]
Length=151

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 107/154 (69%), Gaps = 6/154 (4%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M+ MKETAANV A+A +G EKT+A VQEKMERMTA  P EKEMAT  KE+  + A+L K+
Sbjct  1    MQTMKETAANVAAAAKSGMEKTRATVQEKMERMTADSPQEKEMATATKEDIFHNADLKKQ  60

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVE  453
            +A        Q A+   +   +SYSTTG  G P G HQMSA+PGHG+G P GQV EG ++
Sbjct  61   DAF------EQNAAAKESGGSYSYSTTGDVGQPTGGHQMSALPGHGSGEPAGQVVEGTIK  114

Query  454  SRPIGTATGTQRTTVAHNTHAGREVNKGYGTGGA  555
            S PIG ATGT R T AHNTH G   N+GYGTGGA
Sbjct  115  SHPIGKATGTGRPTTAHNTHVGAGANQGYGTGGA  148



>gb|AAG37448.1| seed maturation protein LEA 4 [Glycine tomentella]
Length=168

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 114/159 (72%), Gaps = 7/159 (4%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DPM+KE+AT+KKE +++QAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPMQKELATQKKEAKMSQAELDKQA  68

Query  277  akeqnaaaRQGASTTGTNKPH------SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            A++ N AA+Q A+     + H      +YSTTG  G PMGAHQ SAMPGHGTG P G VT
Sbjct  69   ARQHNTAAKQAATAGHMGQGHHTPGTATYSTTGEHGQPMGAHQTSAMPGHGTGQPTGHVT  128

Query  439  EGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
            E VV S PIGT  G   T  AHNT AG   N  GYGTGG
Sbjct  129  EEVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG  167



>emb|CDP10134.1| unnamed protein product [Coffea canephora]
Length=146

 Score =   122 bits (306),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 109/148 (74%), Gaps = 6/148 (4%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M+A+KE AANV ASA +G EKTKA +QEK++R TA++P EKEMAT++KE+R+NQAE +K 
Sbjct  1    MQAIKEKAANVAASAKSGMEKTKATMQEKVDRATANNPTEKEMATERKEQRVNQAEFDKR  60

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVE  453
             A+E NAAAR     TG  +PH+YSTTG  G+P G HQ SA+PG     P GQVTEGVVE
Sbjct  61   AAQEHNAAARNATKNTG--QPHTYSTTGAPGHPTGTHQQSALPGQ----PTGQVTEGVVE  114

Query  454  SRPIGTATGTQRTTVAHNTHAGREVNKG  537
            S PIGTA GT RT  AHNTH G   N G
Sbjct  115  SHPIGTAAGTGRTNAAHNTHVGAATNIG  142



>ref|XP_007202673.1| hypothetical protein PRUPE_ppa012476mg [Prunus persica]
 gb|EMJ03872.1| hypothetical protein PRUPE_ppa012476mg [Prunus persica]
Length=168

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 112/158 (71%), Gaps = 9/158 (6%)
 Frame = +1

Query  100  AMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkeea  279
            ++KETAANV ASA +G +KTKA VQEK+E+MTAHDP+EK+MAT+K+EER+ +AELNK  A
Sbjct  10   SVKETAANVAASAKSGMDKTKATVQEKVEKMTAHDPVEKDMATQKREERMVEAELNKCAA  69

Query  280  keqnaaaRQGASTTGTNKPHS-------YSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            K  NA AR  AS  G     +       YS TG TG P GAHQMSA+PGHGTG P GQVT
Sbjct  70   KAHNATARHEASVGGPTGYTTSGTGTHTYSPTGATGQPTGAHQMSALPGHGTGQPTGQVT  129

Query  439  EGVVESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
            EGVVES PIG  TGT   T AHNT  G     GYGTGG
Sbjct  130  EGVVESHPIGINTGTGW-TAAHNTRVGGN-PPGYGTGG  165



>ref|XP_007162333.1| hypothetical protein PHAVU_001G143100g [Phaseolus vulgaris]
 gb|ESW34327.1| hypothetical protein PHAVU_001G143100g [Phaseolus vulgaris]
Length=155

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 114/157 (73%), Gaps = 11/157 (7%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETA+N+GASA AG EKTKA VQEK ER+TA DP++KE+AT+KKE R+NQAEL+K+ 
Sbjct  9    ESVKETASNMGASAKAGMEKTKATVQEKAERLTARDPLQKEVATQKKEARVNQAELDKQA  68

Query  277  akeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVES  456
             +E NAAA+Q A+         +S TG  G+  G HQ SAMPGHGTG P G VTEGVV S
Sbjct  69   VREHNAAAKQSAT---------HSATGEHGHHTGLHQTSAMPGHGTGQPTGHVTEGVVGS  119

Query  457  RPIGTATGTQRTTVAHNTHAGREVNK-GYGTGGATYN  564
             PIGT  G   TT AHNTHAG   N  GYGTGG TYN
Sbjct  120  HPIGTNRGPGGTTTAHNTHAGGNPNDYGYGTGG-TYN  155



>ref|NP_001236128.1| soybean seed maturation polypeptides [Glycine max]
 emb|CAA45126.1| soybean seed maturation polypeptides [Glycine max]
 gb|AAA33961.1| maturation protein [Glycine max]
 gb|AAD09208.1| late embryogenesis abundant protein, partial [Glycine soja]
 prf||1909377A maturation protein GmPM9
Length=152

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 110/157 (70%), Gaps = 14/157 (9%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DPM+KE+AT+KKE +++QAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPMQKELATQKKEAKMSQAELDKQA  68

Query  277  akeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVES  456
            A++ N AA+Q A            T G  G PMG HQ SAMPGHGTG P G VTEGVV S
Sbjct  69   ARQHNTAAKQAA------------TAGHMGQPMGTHQTSAMPGHGTGQPTGHVTEGVVGS  116

Query  457  RPIGTATGTQRTTVAHNTHAGREVNK-GYGTGGATYN  564
             PIGT  G   T  AHNT AG   N  GYGTGG TYN
Sbjct  117  HPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG-TYN  152



>ref|XP_009606041.1| PREDICTED: 18 kDa seed maturation protein-like [Nicotiana tomentosiformis]
Length=124

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 97/122 (80%), Gaps = 2/122 (2%)
 Frame = +1

Query  190  MTAHDPmekematkkkeeRInqaelnkeeakeqnaaaRQGASTTGTNKPH-SYSTTGRTG  366
            MTAHDP +KEMAT KKEERINQAE+NK+   ++N A  QG  T GT +PH S STTG TG
Sbjct  1    MTAHDPTQKEMATGKKEERINQAEMNKQATHDRNTAIHQGGGT-GTGRPHYSNSTTGATG  59

Query  367  NPMGAHQMSAMPGHGTGAPMGQVTEGVVESRPIGTATGTQRTTVAHNTHAGREVNKGYGT  546
            +  G+HQMSA+PGHGTG PMGQVT+GVV+S PIGTATGTQR + AH TH G  VN+GYGT
Sbjct  60   HSTGSHQMSALPGHGTGEPMGQVTDGVVQSHPIGTATGTQRASAAHYTHVGGGVNQGYGT  119

Query  547  GG  552
            GG
Sbjct  120  GG  121



>ref|XP_008240938.1| PREDICTED: LOW QUALITY PROTEIN: 18 kDa seed maturation protein 
[Prunus mume]
Length=167

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 112/161 (70%), Gaps = 16/161 (10%)
 Frame = +1

Query  100  AMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkeea  279
            ++K+TAAN+ ASA +G +KTKA VQEK+E+MTAHD +EK+MA +K+EER+ +AELNK EA
Sbjct  10   SVKDTAANIAASAKSGMDKTKATVQEKVEKMTAHDTVEKDMAARKREERMVEAELNKREA  69

Query  280  keqnaaaRQGAST----------TGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMG  429
               N AAR  AS           TGT   H+YST+G TG P GAHQMSA P  GTG P G
Sbjct  70   MAHNTAARHKASVGGPTGYTASGTGT---HTYSTSGATGQPTGAHQMSAPP-XGTGQPAG  125

Query  430  QVTEGVVESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
            QVTEGVVES PIG  TGT R T AHNT  G     GYGTGG
Sbjct  126  QVTEGVVESHPIGINTGTGR-TAAHNTRVGGNP-PGYGTGG  164



>ref|NP_001238562.1| 18 kDa seed maturation protein [Glycine max]
 sp|Q01417.1|PM1_SOYBN RecName: Full=18 kDa seed maturation protein [Glycine max]
 gb|AAA33984.1| putative 18 kDa late embryogenesis abundant protein [Glycine 
max]
 gb|AAG37440.1| seed maturation protein LEA 4 [Glycine max]
 prf||1906381A 18kD late embryogenesis abundant protein
Length=173

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 112/164 (68%), Gaps = 12/164 (7%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETA N+GASA AG EKTKA VQEK ERMTA DP++KE+AT+KKE ++NQAEL+K+ 
Sbjct  9    ESIKETATNIGASAKAGMEKTKATVQEKAERMTARDPVQKELATQKKEAKMNQAELDKQA  68

Query  277  akeqnaaaRQGASTTGTNKPHSYSTTG-----------RTGNPMGAHQMSAMPGHGTGAP  423
            A++ N AA+Q A+T G      ++T               G PMGAHQ SAMPGHGTG P
Sbjct  69   ARQHNTAAKQSATTAGHMGHGHHTTGTGTGTATYSTTGEYGQPMGAHQTSAMPGHGTGQP  128

Query  424  MGQVTEGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
             G VTEGVV S PIGT  G   T  AHNT AG + N  GYGTGG
Sbjct  129  TGHVTEGVVGSHPIGTNRGPGGTATAHNTRAGGKPNDYGYGTGG  172



>gb|AAD09209.1| late embryogenesis abundant protein, partial [Glycine soja]
Length=173

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 111/164 (68%), Gaps = 12/164 (7%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETA N+GASA AG EKTKA VQEK ERMTA DP++KE+AT+KKE ++NQAEL+K+ 
Sbjct  9    ESIKETATNIGASAKAGMEKTKATVQEKAERMTARDPVQKELATQKKEAKMNQAELDKQA  68

Query  277  akeqnaaaRQGASTTGTNKPHSYSTTG-----------RTGNPMGAHQMSAMPGHGTGAP  423
            A++ N AA+Q A+T G      ++T               G PMGAHQ SAMPGHGTG P
Sbjct  69   ARQHNTAAKQSATTAGHMGHGHHTTGTGTGTATYSTTGEYGQPMGAHQTSAMPGHGTGQP  128

Query  424  MGQVTEGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
             G VTEGVV S PIGT  G   T  AHNT AG   N  GYGTGG
Sbjct  129  TGHVTEGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG  172



>gb|AAG37450.1| seed maturation protein LEA 4 [Glycine tomentella]
Length=161

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 108/159 (68%), Gaps = 14/159 (9%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DPM+KE+AT+KKE ++++AEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPMQKELATQKKEAKMSRAELDKQA  68

Query  277  akeqnaaaRQGASTTGTNKPH------SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            A++ N AA+Q A+     + H      +YSTTG  G PMGA Q SAM       P G VT
Sbjct  69   ARQHNTAAKQAATAGHMGQGHHTPGTATYSTTGEYGQPMGAQQTSAM-------PTGHVT  121

Query  439  EGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
            EGVV S PIGT  G   T  AHNT AG   N  GYGTGG
Sbjct  122  EGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG  160



>gb|AAG37447.1| seed maturation protein LEA 4 [Glycine tomentella]
Length=165

 Score =   104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 108/163 (66%), Gaps = 18/163 (11%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DP++KE+AT+KKE ++NQAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPVQKELATQKKEAKMNQAELDKQA  68

Query  277  akeqnaaaRQGA----------STTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPM  426
            A++ N AA+Q A          +T       +YSTTG  G PMGAHQ SAM       P 
Sbjct  69   ARQHNTAAKQSATAGHMGHGHHTTGTGAGTATYSTTGEYGQPMGAHQTSAM-------PT  121

Query  427  GQVTEGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
            G VTEGVV S PIGT  G   T  AHNT AG   N  GYGTGG
Sbjct  122  GHVTEGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG  164



>ref|NP_001266059.1| 18 kDa seed maturation protein-like [Cicer arietinum]
 gb|ADU20206.1| LEA 4 protein [Cicer arietinum]
 gb|ADU20207.1| LEA 4 protein [Cicer arietinum]
Length=152

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 104/154 (68%), Gaps = 13/154 (8%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAANVGASA +G EKTKAVVQEK E+M   DP+EKEMAT KK+ ++ QAEL+K+ 
Sbjct  9    ESIKETAANVGASAKSGMEKTKAVVQEKTEKMKTRDPVEKEMATHKKDVKMTQAELDKQA  68

Query  277  akeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVES  456
            A+E NAA +Q             +T G+ G+  GAH MSA+PGHGTG PMG  TEGVV S
Sbjct  69   AREHNAAVKQS------------TTEGQMGHTTGAHPMSALPGHGTGHPMGHTTEGVVGS  116

Query  457  RPIGTATGTQRTTVAHNTHAGREVNK-GYGTGGA  555
             PIGT  G   T  AHNT  G   N  GY TGG+
Sbjct  117  HPIGTNRGPDGTATAHNTRVGGNPNATGYTTGGS  150



>gb|AHF21585.1| late embryogenesis abundant protein [Tamarix hispida]
Length=171

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 103/145 (71%), Gaps = 6/145 (4%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            +++++E  +N+ ASA +G EKTKA++QEK+E+MT HD  EKEMAT+KKE+ I QAELNK+
Sbjct  8    VDSVREGVSNIAASARSGMEKTKAIMQEKVEKMTTHDEAEKEMATQKKEQLIQQAELNKQ  67

Query  274  eake------qnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQV  435
            +A+E        A+    A T GTN   SYS TG  G+  G HQMSA+PGHGTG P GQV
Sbjct  68   QAREHNAAANTTASTTPAAGTAGTNATQSYSATGAHGHTTGLHQMSALPGHGTGQPAGQV  127

Query  436  TEGVVESRPIGTATGTQRTTVAHNT  510
            TEG VE+ PIG  TGTQ  + +HNT
Sbjct  128  TEGTVEAHPIGKMTGTQMNSASHNT  152



>gb|AAG37454.1| seed maturation protein LEA 4 [Glycine tomentella]
Length=170

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 109/163 (67%), Gaps = 8/163 (5%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            +++KE AA +GASA    E+ +     + ERMTA DPM+KE+AT+KK+ +++QAEL+K+ 
Sbjct  9    KSIKEPAATIGASAKVWHEENQGHCPREAERMTARDPMQKELATQKKDAKMSQAELDKQA  68

Query  277  akeqnaaaRQGASTTGTNKPH------SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            A++ N AA+Q A+     + H      +YSTTG  G PMGAHQ SAMPGHGTG P G VT
Sbjct  69   ARQHNTAAKQAATAGHMGQGHHTPGTATYSTTGEHGQPMGAHQTSAMPGHGTGQPTGHVT  128

Query  439  EGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGGATYN  564
            EGVV S PIGT  G   T  AHNT AG   N  GYGTGG TYN
Sbjct  129  EGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG-TYN  170



>ref|XP_009376127.1| PREDICTED: 18 kDa seed maturation protein-like [Pyrus x bretschneideri]
Length=168

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 115/164 (70%), Gaps = 10/164 (6%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            ME++KE AAN+ ASA +G EKTK  VQEK+E+M + DP+EK+MA  KKEERI  AE+NK 
Sbjct  8    MESIKEAAANIAASANSGMEKTKPTVQEKVEKMKSSDPIEKDMAAGKKEERIVDAEINKR  67

Query  274  eakeqnaaaRQ------GASTTGTNK-PHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQ  432
             A EQNAAAR+      G + TG     H+YSTTG TG P G HQMSA+PGHGTG P GQ
Sbjct  68   NAMEQNAAARRDGAGATGYTATGAGTGTHTYSTTGATGQPTGTHQMSALPGHGTGQPAGQ  127

Query  433  VTEGVVESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGGATYN  564
            VTEG V + P+G  TGT RTT AHNT  G  V   YGTGG TYN
Sbjct  128  VTEGAVGAHPVGINTGTGRTT-AHNTRVGGNV-PNYGTGG-TYN  168



>ref|XP_003625258.1| Seed maturation protein [Medicago truncatula]
 gb|AES81476.1| seed maturation protein [Medicago truncatula]
Length=177

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 114/169 (67%), Gaps = 15/169 (9%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E +KETAAN+GASA +G EKTKA +QEK E+MTA DP++KEMAT KKE ++NQAEL+K  
Sbjct  9    ETIKETAANIGASAKSGMEKTKATLQEKTEKMTARDPVQKEMATHKKEAKMNQAELDKLA  68

Query  277  akeqnaaaRQ--GASTTGTNKPH-----------SYSTTGRTGNPMGAHQMSAMPGHGTG  417
            A+E NAA +Q   A+     +PH           +YSTTG  G+P GAHQMSAMPGHGTG
Sbjct  69   AREHNAAVKQTTTAAAGHMGQPHHTTGTTGTGTATYSTTGNYGHPTGAHQMSAMPGHGTG  128

Query  418  APMGQVTEGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGGATY  561
             P G V +GVV S PIGT  GT  T  AHNT  G   N  GY TGG TY
Sbjct  129  QPTGHVVDGVVGSHPIGTNRGTDGTATAHNTRVGGNPNATGYTTGG-TY  176



>gb|AAG37439.1| seed maturation protein LEA 4 [Glycine canescens]
Length=167

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 107/166 (64%), Gaps = 22/166 (13%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DP++KE AT+KKE ++NQAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPVQKEFATQKKEAKMNQAELDKQA  68

Query  277  akeqnaaaRQGAS------------TTGTNKPHSYSTTGRTGNPMGAHQMSAMP-GHGTG  417
            A++ N AA+Q A+            T       +YSTT   G PMGAHQ SAMP GHG  
Sbjct  69   ARQHNTAAKQSATAGHMGHGHHATGTGTGTGTATYSTTEEYGQPMGAHQTSAMPTGHG--  126

Query  418  APMGQVTEGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
                  TEGVV S PIGT  G   T  AHNT AG   N  GYGTGG
Sbjct  127  ------TEGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG  166



>gb|EYU39928.1| hypothetical protein MIMGU_mgv11b013195mg [Erythranthe guttata]
Length=146

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 110/140 (79%), Gaps = 11/140 (8%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M+++KE+AANV ASA +G EKTKA VQEKME+MTAH+P EK++AT +K+E+I+ AE+NK+
Sbjct  1    MQSLKESAANVAASAKSGMEKTKATVQEKMEKMTAHNPTEKDIATARKQEKIHNAEMNKQ  60

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVE  453
            EA+E NAAA+Q A T G+   +++STTG       AHQMSA+PGHGTG P G VTEG ++
Sbjct  61   EAREHNAAAKQAAQTGGS---YTHSTTG-------AHQMSALPGHGTGQPTGHVTEGTMK  110

Query  454  SRPIGTATGTQRTTVAHNTH  513
            S PIGTATGT   T AHNTH
Sbjct  111  SHPIGTATGT-GGTTAHNTH  129



>gb|KHF99366.1| 18 kDa seed maturation protein [Gossypium arboreum]
Length=164

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 113/167 (68%), Gaps = 13/167 (8%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKE AANV ASA +G EKTKA ++EK+E+  ++D MEK++A ++KEERI+QAELNK 
Sbjct  1    MQSMKEKAANVAASAKSGLEKTKATMEEKVEKARSNDQMEKQIAKERKEERIHQAELNKL  60

Query  274  eakeqnaaaRQ-----GASTTGTNK-----PHSYSTTGRTGNPMGAHQMSAMPGHGTGAP  423
            EA++ NAAA+Q     G + TGT        HSYSTTG  G   GAHQMSA+PGHG+G P
Sbjct  61   EARQHNAAAKQAGAEGGFTATGTGAYKATGTHSYSTTGERGQSTGAHQMSALPGHGSGQP  120

Query  424  MGQVTEGVVESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGGATYN  564
             GQV EG   + PIG+  G      +HNT  G     GYGTGG TY+
Sbjct  121  AGQVVEGTAAAHPIGSNPGV-GGAKSHNTR-GEGNPHGYGTGG-TYS  164



>gb|ADQ91841.1| late embryogenesis abundant protein group 4 protein [Arachis 
hypogaea]
Length=166

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 93/125 (74%), Gaps = 3/125 (2%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            +++KE AANVGASA AG EKTKA VQEK ERM+  DP++K+MAT+KKE + NQAE+ K+ 
Sbjct  9    QSIKEKAANVGASAQAGLEKTKATVQEKAERMSTRDPVQKQMATQKKEHKTNQAEMEKQA  68

Query  277  akeqnaaaRQGASTTGTNKPH---SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGV  447
            A  QNAA ++ A        +   ++STTG+ G+P G HQMSA+PGHGTG P GQVTEGV
Sbjct  69   AYNQNAAQKEAARADNVAPGYGTATHSTTGQHGHPTGGHQMSALPGHGTGQPTGQVTEGV  128

Query  448  VESRP  462
            + SRP
Sbjct  129  IGSRP  133



>gb|ADQ91840.1| late embryogenesis abundant protein group 4 protein [Arachis 
hypogaea]
Length=172

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 94/128 (73%), Gaps = 4/128 (3%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            +++KE AANVGASA AG EKTKA VQEK E+M+  DP++K+MAT+KKE + NQAE+ K+ 
Sbjct  9    QSIKEKAANVGASAQAGLEKTKATVQEKAEKMSTRDPIQKQMATQKKEHKTNQAEMEKQA  68

Query  277  akeqnaaaRQGASTT----GTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEG  444
            A  QNAA ++ A       G     ++STTG+ G+P G HQMSA+PGHGTG P GQVTEG
Sbjct  69   AYNQNAAHKEAARAEDIAPGYYGTATHSTTGQHGHPTGGHQMSALPGHGTGQPTGQVTEG  128

Query  445  VVESRPIG  468
            V+ S PIG
Sbjct  129  VIGSHPIG  136



>gb|AFN53709.1| hypothetical protein [Linum usitatissimum]
Length=163

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 95/141 (67%), Gaps = 16/141 (11%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKETA+N+GASA AG EKTKA VQEK+E+++A DP++K++AT+KKE R+ +AE  K+
Sbjct  1    MQSMKETASNIGASAKAGMEKTKAAVQEKVEKVSARDPVQKDLATQKKEARMLEAEAMKQ  60

Query  274  eakeqnaaaRQ-----GASTTGTN----------KPHSYSTTGRTGNPMGAHQMSAMPGH  408
            + K  NAA +Q     G+   GTN            +S+STTGR G P G HQMSAMPGH
Sbjct  61   DVKTHNAATKQGEQVFGSGNAGTNYTSGGTGGVMDTYSHSTTGRPGYPTGTHQMSAMPGH  120

Query  409  GTGAPM-GQVTEGVVESRPIG  468
            GTG P  G V EGV    P G
Sbjct  121  GTGQPYGGHVDEGVARVHPSG  141



>ref|XP_008380131.1| PREDICTED: 18 kDa seed maturation protein-like [Malus domestica]
Length=165

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 113/162 (70%), Gaps = 10/162 (6%)
 Frame = +1

Query  100  AMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkeea  279
            AMKE AANV ASA++G EKTKA VQEK+E+M + DP+EK+MA +KKEERI +AE+NK EA
Sbjct  7    AMKEAAANVAASAMSGMEKTKATVQEKVEKMKSSDPVEKDMAARKKEERIVEAEVNKHEA  66

Query  280  keqnaaaRQ------GASTTGTNK-PHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
             EQNAAAR+      G + TG     H+YSTTG  G P G HQMSA+PGHGTG P GQVT
Sbjct  67   MEQNAAARRDVAVATGYTATGAGTGTHTYSTTGAAGQPTGTHQMSALPGHGTGQPAGQVT  126

Query  439  EGVVESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGGATYN  564
            EGV E+ PI         T AHNT+ G    K YGTGG TY+
Sbjct  127  EGVAEAHPI-GTNTGTGRTTAHNTNVGGNATK-YGTGG-TYS  165



>ref|XP_002322667.2| hypothetical protein POPTR_0016s04670g [Populus trichocarpa]
 gb|EEF04428.2| hypothetical protein POPTR_0016s04670g [Populus trichocarpa]
Length=196

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 109/154 (71%), Gaps = 14/154 (9%)
 Frame = +1

Query  88   QKMEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaeln  267
            +KM+ MKETAANV ASA AG EKTKA VQEK+E+M+AHDP++KEMA +KK+ER+ QAELN
Sbjct  19   EKMKGMKETAANVAASATAGMEKTKATVQEKVEKMSAHDPVQKEMAREKKQERMTQAELN  78

Query  268  keeakeqnaaaRQGAS---------TTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGA  420
            K++AK+ NAA++  AS         T+G +  H++S TG TG PMG HQMSAMPGHGTG 
Sbjct  79   KQDAKQHNAASKHAASATGGTGGYMTSGGHDTHTHSATGVTGYPMGTHQMSAMPGHGTGQ  138

Query  421  PM-GQVTEGVVESRPIGTATGTQRTTVAHNTHAG  519
            P  GQV EGV  + P G        T  HNT AG
Sbjct  139  PYGGQVEEGVARTHPGGLPG----DTTGHNTRAG  168



>gb|AAG37442.1| seed maturation protein LEA 4 [Glycine tabacina]
Length=165

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 108/163 (66%), Gaps = 18/163 (11%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DP++KE+AT+KKE ++NQAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPVQKELATQKKEAKMNQAELDKQA  68

Query  277  akeqnaaaRQGA----------STTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPM  426
            A++ N AA+Q A          +T       +YSTTG  G PMGAHQ SAM       P 
Sbjct  69   ARQHNTAAKQSATAGHMGHGHHTTGTGTGTATYSTTGEYGQPMGAHQTSAM-------PT  121

Query  427  GQVTEGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
            G VTEGVV S PIGT  G   T  AHNT AG   N  GYGTGG
Sbjct  122  GHVTEGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG  164



>ref|XP_006373739.1| hypothetical protein POPTR_0016s04570g [Populus trichocarpa]
 gb|ERP51536.1| hypothetical protein POPTR_0016s04570g [Populus trichocarpa]
Length=208

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 116/171 (68%), Gaps = 21/171 (12%)
 Frame = +1

Query  58   PEK---GKTIGK*Q--KMEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekem  222
            PEK    + IG+ Q  KM+ MKETAANV ASA AG EKTKA VQEK+E+M+AHDP++KEM
Sbjct  14   PEKKTSDQLIGRKQEEKMKGMKETAANVAASATAGMEKTKATVQEKVEKMSAHDPVQKEM  73

Query  223  atkkkeeRInqaelnkeeakeqnaaaRQGAS-----------TTGTNKPHSYSTTGRTGN  369
            A +KK+ER+ QAELNK+EAK+ NAA++  AS           T+G +  H++S TG TG 
Sbjct  74   AREKKQERMTQAELNKQEAKQHNAASKHAASATGGQATGGYMTSGGHDTHTHSATGVTGY  133

Query  370  PMGAHQMSAMPGHGTGAPM-GQVTEGVVESRPIGTATGTQRTTVAHNTHAG  519
            PMG HQMSAMPGHGTG P  GQV EGV  + P G        T  HNT AG
Sbjct  134  PMGTHQMSAMPGHGTGQPYGGQVEEGVARTHPGGLPG----DTTGHNTRAG  180



>ref|XP_006399153.1| hypothetical protein EUTSA_v10014897mg [Eutrema salsugineum]
 gb|ABY86896.1| LEA-like protein [Eutrema halophilum]
 gb|ESQ40606.1| hypothetical protein EUTSA_v10014897mg [Eutrema salsugineum]
Length=160

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 98/144 (68%), Gaps = 5/144 (3%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKETA+N+ ASA +G +KTKA ++EK E+M   DP+EK+MAT++KE +INQAE+ K 
Sbjct  1    MQSMKETASNIAASAKSGMDKTKATLEEKAEKMKTQDPVEKQMATQRKEGKINQAEMQKR  60

Query  274  eakeqnaaaRQGASTTGTNKPH----SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTE  441
            E  E NAA ++ A             +++TTG  G+  G HQMSA+PGHGTG P G V E
Sbjct  61   EVYEHNAAMKEAAGAGTGTGLGLGSATHATTGHLGHGTGTHQMSALPGHGTGQPTGHVVE  120

Query  442  GVVESRPIGTATGTQRTTVAHNTH  513
            G   S PIG  TGT RTT AHNTH
Sbjct  121  GTAVSHPIGRNTGTGRTT-AHNTH  143



>gb|AAL02403.1| seed maturation protein LEA 4 [Glycine canescens]
Length=165

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 107/164 (65%), Gaps = 20/164 (12%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DP++KE AT+KKE ++NQAEL+K+ 
Sbjct  9    ESLKETAANIGASAKAGMEKTKATVQEKAERMTARDPVQKEFATQKKEAKMNQAELDKQA  68

Query  277  akeqnaaaRQGAST----------TGTNKPHSYSTTGRTGNPMGAHQMSAMP-GHGTGAP  423
            A++ N AA+Q A+                  +YSTTG  G PMGAHQ SAMP GHG    
Sbjct  69   ARQHNTAAKQSATAGHMGHGHHSTGTGTGTATYSTTGEYGQPMGAHQTSAMPTGHG----  124

Query  424  MGQVTEGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
                TEGVV S PIGT  G   T  AHNT AG   N  GYGTGG
Sbjct  125  ----TEGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG  164



>gb|AAG15413.1| seed maturation protein [Glycine tomentella]
 gb|AAG37452.1| seed maturation protein LEA 4 [Glycine tomentella]
Length=165

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 107/163 (66%), Gaps = 18/163 (11%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA +G EKTKA VQEK ERMTA DP++KE AT+KKE ++NQAEL+K+ 
Sbjct  9    ESIKETAANIGASAKSGMEKTKATVQEKAERMTARDPVQKEFATQKKEAKMNQAELDKQA  68

Query  277  akeqnaaaRQGAS----------TTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPM  426
            A++ N AA+Q A+          T       +YSTTG  G PMGAHQ SAM       P 
Sbjct  69   ARQHNTAAKQSATAGHMGHGHHATGTGTGTATYSTTGEYGQPMGAHQTSAM-------PT  121

Query  427  GQVTEGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
            G VTEGVV S PIGT  G   T  AHNT AG   N  GYGTGG
Sbjct  122  GHVTEGVVGSHPIGTNRGPGGTATAHNTRAGGNPNDYGYGTGG  164



>ref|XP_008387256.1| PREDICTED: 18 kDa seed maturation protein-like [Malus domestica]
Length=165

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 112/162 (69%), Gaps = 10/162 (6%)
 Frame = +1

Query  100  AMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkeea  279
            AMKE AANV ASA++G EKTKA VQEK+E+M + DP+EK+MA +KKEERI +AE+NK EA
Sbjct  7    AMKEAAANVAASAMSGMEKTKATVQEKVEKMKSSDPVEKDMAARKKEERIVEAEVNKHEA  66

Query  280  keqnaaaRQ------GASTTGTNK-PHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
             EQNAAAR+      G + TG     H+YSTTG  G P G HQMSA+PGHGTG P GQV 
Sbjct  67   MEQNAAARRDVAVATGYTATGAGTGTHTYSTTGAAGQPTGTHQMSALPGHGTGQPAGQVX  126

Query  439  EGVVESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGGATYN  564
            EGV E+ PI         T AHNT+ G    K YGTGG TY+
Sbjct  127  EGVAEAHPI-GTNTGTGRTTAHNTNVGGNATK-YGTGG-TYS  165



>ref|XP_010672665.1| PREDICTED: 18 kDa seed maturation protein [Beta vulgaris subsp. 
vulgaris]
Length=178

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 107/168 (64%), Gaps = 16/168 (10%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            +E++KETA+N+ ASA +G +KTKA VQEK+++M A D  +K +A++KK++R+ +AEL K+
Sbjct  8    VESVKETASNIAASAKSGMDKTKATVQEKVDKMKADDDYDKALASEKKQDRVTEAELRKQ  67

Query  274  eakeqnaaaRQGASTTGTNK------------PHSYSTTGRTGNPMGAHQMSAMPGHGTG  417
            +A   NAA +   +    +              +S+STTG TG P GAHQMSA+PGHGTG
Sbjct  68   QAMSHNAAEKDAKAAIAGHTGTGGTGYGTTGPQYSHSTTGATGYPTGAHQMSAVPGHGTG  127

Query  418  APM-GQVTEG-VVESRPIGTATGTQ-RTTVAHNTHAGREVNKGY-GTG  549
             P  G VT+G  V S PIG  TGT  R++ A N H G   N  Y GTG
Sbjct  128  EPAGGHVTDGTAVGSHPIGRGTGTNTRSSTAQNRHGGGGTNTDYTGTG  175



>ref|XP_004304367.1| PREDICTED: 18 kDa seed maturation protein-like [Fragaria vesca 
subsp. vesca]
Length=169

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 107/167 (64%), Gaps = 15/167 (9%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M+++KE AANV ASA +G EKTKA +QEKME++ AHDP++K+MAT+KKE RI +AE  K 
Sbjct  1    MQSIKEAAANVSASANSGMEKTKATMQEKMEQVKAHDPIQKDMATQKKEARIAEAEQQKR  60

Query  274  eakeqnaaaRQGASTTGTNKPHS--------------YSTTGRTGNPMGAHQMSAMPGHG  411
            EA + NAAA+ GA+ TG+    S              YSTTG TG+  G +QMSA+PGHG
Sbjct  61   EAMDHNAAAKHGATPTGSTGYGSGPTNYSTGGAGTATYSTTGATGHHTGLNQMSALPGHG  120

Query  412  TGAPMGQVTEGVVESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
            TGAP GQV EGV  + PI         T AHN H G      YGTGG
Sbjct  121  TGAPTGQVVEGVANAHPI-GTNTGTGRTTAHNPHVGGNAPGSYGTGG  166



>ref|XP_002873277.1| hypothetical protein ARALYDRAFT_325294 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49536.1| hypothetical protein ARALYDRAFT_325294 [Arabidopsis lyrata subsp. 
lyrata]
Length=156

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 98/142 (69%), Gaps = 2/142 (1%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKETA+N+ ASA +G +KTKA ++EK E+M   DP++K+MAT+ KE++INQAE+ K 
Sbjct  1    MQSMKETASNIAASAKSGMDKTKATLEEKAEKMKTRDPVQKQMATQVKEDKINQAEMQKR  60

Query  274  eakeqnaaaRQGASTTGTNKPHS--YSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGV  447
            E +E NAA ++ A         +  +STTG+ G+  G HQMSA+PGHGTG    +V EG 
Sbjct  61   ETREYNAAMKEAAGAGTGLGLGTATHSTTGQVGHGTGTHQMSALPGHGTGQLTDRVVEGT  120

Query  448  VESRPIGTATGTQRTTVAHNTH  513
              + PIG  TGT  TT AHNTH
Sbjct  121  AVTDPIGRNTGTGLTTTAHNTH  142



>ref|XP_010423305.1| PREDICTED: 18 kDa seed maturation protein-like [Camelina sativa]
Length=169

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 96/148 (65%), Gaps = 9/148 (6%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKETA+N+ ASA +G +KTKA ++EK E+M   DP++K MAT+ KE++IN AE+ K 
Sbjct  1    MQSMKETASNIAASAKSGMDKTKATLEEKAEKMKTRDPLQKHMATQVKEDKINLAEMQKR  60

Query  274  eakeqnaaaRQGASTTGTNKPH--------SYSTTGRTGNPMGAHQMSAMPGHGTGAPMG  429
            E  E NAA ++ A                 ++STTG+ G+  G HQMSA+PGHGTG    
Sbjct  61   ETYEHNAAMKEAAGPGIGTGTGTGLGLGSATHSTTGQVGHGTGTHQMSALPGHGTGQLTD  120

Query  430  QVTEGVVESRPIGTATGTQRTTVAHNTH  513
            +V EG   + PIG  TGT RTT AHNTH
Sbjct  121  RVVEGTAATNPIGRDTGTGRTT-AHNTH  147



>ref|NP_196294.1| late embryogenesis abundant protein 4-5 [Arabidopsis thaliana]
 dbj|BAB09810.1| late embryogenesis abundant protein LEA like [Arabidopsis thaliana]
 gb|AAK93613.1| putative late embryogenesis abundant protein LEA [Arabidopsis 
thaliana]
 gb|AAM14110.1| putative late embryogenesis abundant protein LEA [Arabidopsis 
thaliana]
 gb|AED91062.1| late embryogenesis abundant protein 4-5 [Arabidopsis thaliana]
Length=158

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 99/142 (70%), Gaps = 3/142 (2%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKETA+N+ ASA +G +KTKA ++EK E+M   DP++K+MAT+ KE++INQAE+ K 
Sbjct  1    MQSMKETASNIAASAKSGMDKTKATLEEKAEKMKTRDPVQKQMATQVKEDKINQAEMQKR  60

Query  274  eakeqnaaaRQGASTTGTNKPHS--YSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGV  447
            E ++ NAA ++ A         +  +STTG+ G+  G HQMSA+PGHGTG    +V EG 
Sbjct  61   ETRQHNAAMKEAAGAGTGLGLGTATHSTTGQVGHGTGTHQMSALPGHGTGQLTDRVVEGT  120

Query  448  VESRPIGTATGTQRTTVAHNTH  513
              + PIG  TGT RTT AHNTH
Sbjct  121  AVTDPIGRNTGTGRTT-AHNTH  141



>ref|XP_010452616.1| PREDICTED: 18 kDa seed maturation protein-like isoform X1 [Camelina 
sativa]
Length=173

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 96/148 (65%), Gaps = 9/148 (6%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKETA+N+ ASA +G +KTKA ++EK E+M   DP++K MAT+ KE++IN AE+ K 
Sbjct  1    MQSMKETASNIAASAKSGMDKTKATLEEKAEKMKTRDPLQKHMATQVKEDKINLAEMQKR  60

Query  274  eakeqnaaaRQGASTTGTNKPH--------SYSTTGRTGNPMGAHQMSAMPGHGTGAPMG  429
            E  E NAA ++ A                 ++STTG+ G+  G HQMSA+PGHGTG    
Sbjct  61   ETYEHNAAMKEAAGPGIGTGTGTGLGLGSATHSTTGQVGHGTGTHQMSALPGHGTGQMTD  120

Query  430  QVTEGVVESRPIGTATGTQRTTVAHNTH  513
            +V EG   + PIG  TGT RTT AHNTH
Sbjct  121  RVVEGTAATNPIGRDTGTGRTT-AHNTH  147



>gb|KCW48100.1| hypothetical protein EUGRSUZ_K01836, partial [Eucalyptus grandis]
Length=165

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 99/144 (69%), Gaps = 15/144 (10%)
 Frame = +1

Query  121  NVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkeeakeqnaaa  300
            NVGASA AG EKTKAV QEKME+MTAHDP+EK+MAT+KK ERI+QAELNK+ A+E+NAA+
Sbjct  22   NVGASAKAGMEKTKAVAQEKMEKMTAHDPVEKQMATEKKHERIDQAELNKQMAREENAAS  81

Query  301  RQGASTTG--------------TNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            +Q  + TG              T    +YSTTG TG P GAHQMSA+PGHGTG P GQV 
Sbjct  82   KQSTAATGHLANTTTGPGTTTTTGTTATYSTTGATGRPTGAHQMSALPGHGTGQPAGQVV  141

Query  439  EGVVESRPIGTATGTQRTTVAHNT  510
            EGV  S PI         T AHNT
Sbjct  142  EGVAGSHPI-GTNTGTGQTTAHNT  164



>ref|XP_010491257.1| PREDICTED: 18 kDa seed maturation protein-like [Camelina sativa]
Length=169

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 95/148 (64%), Gaps = 9/148 (6%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKETA+N+ ASA +G +KTKA ++EK E+M   DP++K MAT+ KE++IN AE+ K 
Sbjct  1    MQSMKETASNIAASAKSGMDKTKATLEEKAEKMKTRDPLQKHMATQVKEDKINLAEMQKR  60

Query  274  eakeqnaaaRQGASTTGTNKPH--------SYSTTGRTGNPMGAHQMSAMPGHGTGAPMG  429
            E  E NAA ++ A                 ++STTG+ G+  G HQMSA+PGHGTG    
Sbjct  61   ETYEHNAAMKEAAGPGIGTGTGTGLGLGSATHSTTGQVGHGTGTHQMSALPGHGTGQLTD  120

Query  430  QVTEGVVESRPIGTATGTQRTTVAHNTH  513
             V EG   + PIG  TGT RTT AHNTH
Sbjct  121  LVVEGTAATNPIGRDTGTGRTT-AHNTH  147



>emb|CAA63008.1| LEA D113 homologue type1 [Arabidopsis thaliana]
Length=158

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 100/142 (70%), Gaps = 3/142 (2%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKETA+N+ ASA +G +KTKA ++EK E+M   DP++K+MAT+ KE++INQAE++K 
Sbjct  1    MQSMKETASNIAASAKSGMDKTKATLEEKAEKMKTRDPVQKQMATQVKEDKINQAEMHKR  60

Query  274  eakeqnaaaRQGASTTGTNKPHS--YSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGV  447
            E ++ NAA ++ A         +  +STTG+ G+  G HQMSA+PGHGTG    +V EG 
Sbjct  61   ETRQHNAAMKEAAGAGTGLGLGTGTHSTTGQVGHGTGTHQMSALPGHGTGQLTDRVVEGT  120

Query  448  VESRPIGTATGTQRTTVAHNTH  513
              + PIG  TGT RTT AHNTH
Sbjct  121  AVTDPIGRNTGTGRTT-AHNTH  141



>ref|XP_009130961.1| PREDICTED: 18 kDa seed maturation protein-like [Brassica rapa]
Length=159

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 96/144 (67%), Gaps = 5/144 (3%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKETA+N+ ASA +G +KTKA ++EK E+MT  DP++K+MAT+KKE +INQAE+ K 
Sbjct  1    MQSMKETASNIAASAKSGMDKTKATLEEKAEKMTTRDPVQKQMATQKKEAKINQAEMQKR  60

Query  274  eakeqnaaaRQGASTTGTNKPH----SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTE  441
            E +E NAA ++ A             ++STTG  G+  G HQMS +PGHGTG   G V E
Sbjct  61   EVREHNAAMKEAAGGGTGTGLVLGSATHSTTGHVGHGTGTHQMSDLPGHGTGQATGHVVE  120

Query  442  GVVESRPIGTATGTQRTTVAHNTH  513
                + PIGT TGT R T AHN H
Sbjct  121  RTTLTEPIGTNTGTGR-TAAHNAH  143



>ref|XP_009369595.1| PREDICTED: 18 kDa seed maturation protein [Pyrus x bretschneideri]
Length=169

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 117/168 (70%), Gaps = 17/168 (10%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            ME+MKE AANV ASA +G EKTKA VQEK+E+M + DP+EK+MA +KKEERI +AE+NK 
Sbjct  8    MESMKEAAANVAASATSGMEKTKATVQEKVEKMKSSDPVEKDMAARKKEERIVEAEVNKR  67

Query  274  eakeqnaaaRQGAST----------TGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAP  423
            EA EQNAAAR+  +           TGT    +YSTTG  G P G HQMSA+PGHGTG P
Sbjct  68   EAMEQNAAARRDVAVSTGYTATGAGTGT---RTYSTTGAAGQPTGTHQMSALPGHGTGQP  124

Query  424  MGQVTEGVV-ESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGGATYN  564
             GQVTEGVV E+ PIGT TGT RTT  +    G   N  YGTGG TY+
Sbjct  125  AGQVTEGVVAEAHPIGTNTGTGRTTGHNTNVGGNATN--YGTGG-TYS  169



>ref|XP_010036485.1| PREDICTED: 18 kDa seed maturation protein [Eucalyptus grandis]
Length=175

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 106/144 (74%), Gaps = 15/144 (10%)
 Frame = +1

Query  121  NVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkeeakeqnaaa  300
            NVGASA AG EKTKAV QEKME+MTAHDP+EK+MAT+KK ERI+QAELNK+ A+E+NAA+
Sbjct  17   NVGASAKAGMEKTKAVAQEKMEKMTAHDPVEKQMATEKKHERIDQAELNKQMAREENAAS  76

Query  301  RQGASTTG--------------TNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            +Q  + TG              T    +YSTTG TG P GAHQMSA+PGHGTG P GQV 
Sbjct  77   KQSTAATGHLANTTTGPGTTTTTGTTATYSTTGATGRPTGAHQMSALPGHGTGQPAGQVV  136

Query  439  EGVVESRPIGTATGTQRTTVAHNT  510
            EGV  S PIGT TGT +TT AHNT
Sbjct  137  EGVAGSHPIGTNTGTGQTT-AHNT  159



>gb|AAG37449.1| seed maturation protein LEA 4 [Glycine tomentella]
Length=165

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 105/163 (64%), Gaps = 18/163 (11%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DP++KE AT+KKE ++NQAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPVQKEFATQKKEAKMNQAELDKQA  68

Query  277  akeqnaaaRQGAS----------TTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPM  426
            A++ N AA+Q A+          T       +YSTTG  G PMGA Q SAM       P 
Sbjct  69   ARQHNTAAKQSATAGHMGHGHHATGTGTGTATYSTTGEYGQPMGAQQTSAM-------PT  121

Query  427  GQVTEGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
            G VTEGVV S PIGT      T  AHNT AG   N  GYGTGG
Sbjct  122  GHVTEGVVGSHPIGTNRRPGGTATAHNTRAGGNPNDYGYGTGG  164



>emb|CDY65929.1| BnaA03g55670D [Brassica napus]
Length=159

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 95/144 (66%), Gaps = 5/144 (3%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M +MKETA+N+ ASA +G +KTKA ++EK E+MT  DP++K+MAT+KKE +INQAE+ K 
Sbjct  1    MLSMKETASNIAASAKSGMDKTKATLEEKAEKMTTRDPVQKQMATQKKEAKINQAEMQKR  60

Query  274  eakeqnaaaRQGASTTGTNKPH----SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTE  441
            E +E NAA ++ A             ++STTG  G+  G HQMS +PGHGTG   G V E
Sbjct  61   EVREHNAAMKEAAGGGTGTGLGLGSATHSTTGHVGHGTGTHQMSDLPGHGTGQATGHVVE  120

Query  442  GVVESRPIGTATGTQRTTVAHNTH  513
                + PIGT TGT R T AHN H
Sbjct  121  RTTLTEPIGTNTGTGR-TAAHNAH  143



>ref|XP_011033219.1| PREDICTED: 18 kDa seed maturation protein [Populus euphratica]
Length=183

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 105/156 (67%), Gaps = 21/156 (13%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M+ MKETAANV ASA AG EKTKA VQEK+E+M+AHDP++KEMA +KK+ER+ QAEL+K+
Sbjct  1    MQGMKETAANVAASAKAGMEKTKASVQEKVEKMSAHDPVQKEMAREKKQERMTQAELDKQ  60

Query  274  eakeqnaaaRQGASTTG----------------TNKPHSYSTTGRTGNPMGAHQMSAMPG  405
            EAK+ NAA++  AS TG                 +  H++S TG TG PMG HQMSAMPG
Sbjct  61   EAKQHNAASKHAASATGGQGHCTGEGTGGYMTIGHDSHTHSATGVTGYPMGTHQMSAMPG  120

Query  406  HGTGAPM-GQVTEGVVESRPIGTATGTQRTTVAHNT  510
            HGTG P  GQV EGVV + P G        T  HNT
Sbjct  121  HGTGQPYGGQVEEGVVRTHPGGLPG----DTTGHNT  152



>ref|XP_006288803.1| hypothetical protein CARUB_v10002135mg [Capsella rubella]
 gb|EOA21701.1| hypothetical protein CARUB_v10002135mg [Capsella rubella]
Length=164

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 96/146 (66%), Gaps = 7/146 (5%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKETA+N+ ASA +G +KTKA ++EK E+M   DP++K+MAT+ KE++IN AE+ K 
Sbjct  1    MQSMKETASNIAASAKSGMDKTKATLEEKAEKMKTRDPVQKQMATQVKEDKINLAEMQKR  60

Query  274  eakeqnaaaRQGASTTGTNKPH------SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQV  435
            E  E NAA +  A               ++STTG+ G+  G HQMSA+PGHGTG    +V
Sbjct  61   ETYEHNAAMKGAAGAGTGTGTGLGLGSATHSTTGQVGHGTGTHQMSALPGHGTGQLTDRV  120

Query  436  TEGVVESRPIGTATGTQRTTVAHNTH  513
             EG   + PIG  TGT RTT AHNTH
Sbjct  121  VEGTAVTDPIGRNTGTGRTT-AHNTH  145



>gb|AAG15417.1| seed maturation protein [Glycine tomentella]
Length=165

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 106/164 (65%), Gaps = 20/164 (12%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DPM+KE AT+KKE +INQAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPMQKEFATQKKEAKINQAELDKQA  68

Query  277  akeqnaaaRQGAS----------TTGTNKPHSYSTTGRTGNPMGAHQMSAMP-GHGTGAP  423
            A++ N AA+Q A+          T       +YSTTG  G  MGA Q SAMP GHG    
Sbjct  69   ARQHNTAAKQSATAGHMGHGHHATGTGTGTATYSTTGEYGQSMGAQQTSAMPTGHG----  124

Query  424  MGQVTEGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
                TEGVV S PIGT  G   T  AHNT AG   N  GYGTGG
Sbjct  125  ----TEGVVGSHPIGTNRGPGGTGTAHNTRAGGNPNDYGYGTGG  164



>emb|CDY64600.1| BnaCnng44320D [Brassica napus]
Length=161

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 97/144 (67%), Gaps = 5/144 (3%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKETA+N+ ASA +G +KTKA ++EK+  +   DP++K+MAT+KKE +INQAE+ K 
Sbjct  1    MQSMKETASNIAASAKSGMDKTKATLEEKVGLLATRDPVQKQMATQKKEAKINQAEMQKR  60

Query  274  eakeqnaaaRQGA----STTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTE  441
            E +E NAA ++ A     T       ++STTG  G+  G HQMSA+PGHGTG   G V E
Sbjct  61   EVREHNAAMKEAARGGTGTGLGLGSATHSTTGHVGHGTGTHQMSALPGHGTGQATGHVVE  120

Query  442  GVVESRPIGTATGTQRTTVAHNTH  513
            G   + PIGT TGT R T AHN H
Sbjct  121  GTTLTEPIGTNTGTGR-TAAHNAH  143



>gb|KDO70933.1| hypothetical protein CISIN_1g031500mg [Citrus sinensis]
Length=158

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 103/141 (73%), Gaps = 3/141 (2%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKE+AANV ASA AG EKTKA  QEK+++M AHDP+EKEMAT+KKEER  QAEL K+
Sbjct  1    MQSMKESAANVAASAKAGMEKTKATAQEKVDKMKAHDPVEKEMATEKKEERRMQAELEKQ  60

Query  274  eakeqnaaaRQGASTTG--TNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGV  447
            EA+E N+AA+Q     G  T   +S+STTG  G P G  QMSA+ GHGTG P GQ+TEGV
Sbjct  61   EAREHNSAAKQATGGLGYTTADSYSHSTTGMHGRPTGGQQMSALAGHGTGQPAGQMTEGV  120

Query  448  VESRPIGTATGTQRTTVAHNT  510
            V S P+G  TGT     AHNT
Sbjct  121  VGSHPMGVNTGTGHNP-AHNT  140



>ref|XP_006492865.1| PREDICTED: 18 kDa seed maturation protein-like [Citrus sinensis]
Length=158

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 103/141 (73%), Gaps = 3/141 (2%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKE+AANV ASA AG EKTKA  QEK+++M AHDP+EKEMAT+KKEER  QAEL K+
Sbjct  1    MQSMKESAANVAASAKAGMEKTKATAQEKVDKMKAHDPVEKEMATEKKEERRMQAELEKQ  60

Query  274  eakeqnaaaRQGASTTG--TNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGV  447
            EA+E NAAA+Q     G  T   +S+STTG  G P G  QMSA+ GHGTG P GQ+TEGV
Sbjct  61   EAREHNAAAKQATGGLGYTTADSYSHSTTGMHGRPTGGQQMSALAGHGTGQPAGQMTEGV  120

Query  448  VESRPIGTATGTQRTTVAHNT  510
            V S P+G  TGT     AHNT
Sbjct  121  VGSHPMGVNTGTGHNP-AHNT  140



>ref|XP_006429871.1| hypothetical protein CICLE_v10012978mg [Citrus clementina]
 gb|ESR43111.1| hypothetical protein CICLE_v10012978mg [Citrus clementina]
Length=158

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 99/141 (70%), Gaps = 3/141 (2%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKE+AANV ASA AG EKTKA  QEK+++M AHDP+EKEMAT+KKEER  QAEL K+
Sbjct  1    MQSMKESAANVAASAKAGMEKTKATAQEKVDKMKAHDPVEKEMATEKKEERRMQAELEKQ  60

Query  274  eakeqnaaaRQGASTTGTNKPHSYS--TTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGV  447
            EA+E NAAA+Q     G     SYS  TTG  G P G HQMSA+ GHGTG P  QV EGV
Sbjct  61   EAREHNAAAKQATGGLGYTTADSYSQSTTGMHGRPTGGHQMSALAGHGTGQPAAQVIEGV  120

Query  448  VESRPIGTATGTQRTTVAHNT  510
            V S PIG   GT     AHNT
Sbjct  121  VGSHPIGVNAGTGHNP-AHNT  140



>gb|AAG15414.1| seed maturation protein [Glycine tabacina]
Length=165

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 104/164 (63%), Gaps = 20/164 (12%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DP++KE AT+KKE +INQAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKASVQEKAERMTARDPVQKEFATQKKEAKINQAELDKQA  68

Query  277  akeqnaaaRQGAST----------TGTNKPHSYSTTGRTGNPMGAHQMSAMP-GHGTGAP  423
            A++ N AA+Q A+                  +YSTTG  G  MGA Q SAMP GHG    
Sbjct  69   ARQHNTAAKQSATAGHMGHGHHATGTGTGTATYSTTGEYGQSMGAQQTSAMPTGHG----  124

Query  424  MGQVTEGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
                TEGVV S PIGT  G      AHNT AG   N  GYGTGG
Sbjct  125  ----TEGVVGSHPIGTNRGPGGIGTAHNTRAGGNPNDYGYGTGG  164



>gb|AAY26119.1| group 1 LEA protein [Sisymbrium irio]
Length=159

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 101/144 (70%), Gaps = 5/144 (3%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKETA+N+ ASA +G ++TKA ++EK E+MT  DP++K+MAT+ KE +INQAE+ K 
Sbjct  1    MQSMKETASNIAASAKSGMDRTKATLEEKAEKMTTRDPVQKQMATQNKEGKINQAEMQKR  60

Query  274  eakeqnaaaRQGASTTGTNKPH----SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTE  441
            EA+E NA  ++ +             ++STTG  G+  G HQMSA+PGHGTG P G V E
Sbjct  61   EAREHNAVMKEASGAGTGTGLGLGSATHSTTGHVGHGTGTHQMSALPGHGTGQPTGHVVE  120

Query  442  GVVESRPIGTATGTQRTTVAHNTH  513
            G   ++PIGT TGT RTT AHNTH
Sbjct  121  GTAVTKPIGTNTGTGRTT-AHNTH  143



>ref|XP_008367380.1| PREDICTED: LOW QUALITY PROTEIN: 18 kDa seed maturation protein-like 
[Malus domestica]
Length=137

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 92/166 (55%), Gaps = 34/166 (20%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M +MKE AA +  SA +G   TKA VQEK+E+M + DP+E +M  +KKEERI  AE+N  
Sbjct  1    MVSMKEAAAYIATSANSGMXNTKATVQEKVEKMKSSDPIENDMVARKKEERIVDAEIN--  58

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVE  453
                     + GA T GT   H+YST G TG P G HQM A+PGHGT             
Sbjct  59   ---------KSGAGT-GT---HTYSTIGATGQPTGTHQMWALPGHGT-------------  92

Query  454  SRPIGTATGTQRTTVAHNTHAGREVNKGYGTGGAT--YN*IKIFHI  585
               IG  TGT RTT AHNTH G      YGTGG    +  +K+F +
Sbjct  93   --AIGINTGTGRTT-AHNTHVGGNA-PNYGTGGTCNGFGRLKLFIL  134



>ref|XP_007028983.1| Late Embryogenesis Abundant 4-5, putative [Theobroma cacao]
 gb|EOY09485.1| Late Embryogenesis Abundant 4-5, putative [Theobroma cacao]
Length=163

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 110/170 (65%), Gaps = 27/170 (16%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M+++KE AAN+ ASA AG EKTKA V+EK+E++TAHDP++KEMAT+KKEERI+QAEL+K+
Sbjct  1    MQSIKERAANIAASAKAGLEKTKATVEEKVEKLTAHDPVQKEMATQKKEERIHQAELDKQ  60

Query  274  eakeqnaaaRQ-----GASTTGTNKPHSYSTTG-------RTGNPMGAHQMSAMPGHGTG  417
            EA+  NA A+Q     G + TGT   H+Y+ TG         G P GA QMSA PGHGTG
Sbjct  61   EARLHNAVAKQAGREDGYTATGT---HTYTATGTHVFDDWDRGQPTGARQMSAFPGHGTG  117

Query  418  APMGQVTEGVVESRPIGTATG-----TQRTTVAHNTHAGREVNKGYGTGG  552
             P  QV  G  E+ PIG  TG     T  T V  + H       GYGTGG
Sbjct  118  QPTVQVDVGRAEAHPIGIKTGAGGSKTHNTRVEGDPH-------GYGTGG  160



>ref|XP_010520037.1| PREDICTED: 18 kDa seed maturation protein [Tarenaya hassleriana]
Length=166

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 99/152 (65%), Gaps = 12/152 (8%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKETA+N+ ASA AG EKTKA V+EK E+M   DP++KEMAT+KKE+RINQAEL K 
Sbjct  1    MQSMKETASNIAASARAGMEKTKATVEEKAEKMKTRDPVQKEMATQKKEDRINQAELEKR  60

Query  274  eakeqnaaaRQG-----------ASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGA  420
            EA+E NAAA++            A  +G     ++STTGR G+  GAHQMSA+PGHG G 
Sbjct  61   EAREHNAAAKEAAGAGLGTPGYTAKGSGGLGSATHSTTGRIGHGTGAHQMSALPGHGAGQ  120

Query  421  PMGQVTEGVVESRPIGTATGTQRTTVAHNTHA  516
            P G V EG   + PI         T AHNT A
Sbjct  121  PTGDVVEGTETAAPI-GTNTGTGRTTAHNTRA  151



>ref|XP_009122290.1| PREDICTED: 18 kDa seed maturation protein [Brassica rapa]
 emb|CDX70069.1| BnaA10g24180D [Brassica napus]
Length=159

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 92/143 (64%), Gaps = 5/143 (3%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKETA+N+ ASA +G +KTKA ++EK E+MT  DP++KEMAT+KKE RIN+AE+ K 
Sbjct  1    MQSMKETASNIAASAKSGMDKTKATLEEKAEKMTTRDPLQKEMATQKKEGRINEAEMQKR  60

Query  274  eakeqnaaaRQGASTTGTNKPHS----YSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTE  441
            EA+E NA  ++ +              +STTG  G+  G HQMSA+PGHGTG P G V +
Sbjct  61   EAREHNAVMKEASGAGTGTGLGMGTATHSTTGHVGHGTGTHQMSALPGHGTGQPAGHVVD  120

Query  442  GVVESRPIGTATGTQRTTVAHNT  510
            G   + PI         T AHNT
Sbjct  121  GTAVTEPI-GTNTGTGRTTAHNT  142



>emb|CDX98954.1| BnaC09g48810D [Brassica napus]
Length=159

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 92/143 (64%), Gaps = 5/143 (3%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKETA+N+ ASA +G +KTKA ++EK E+MT  DP++KEMAT+KKE RIN+AE+ K 
Sbjct  1    MQSMKETASNIAASAKSGMDKTKATLEEKAEKMTTRDPLQKEMATQKKEGRINEAEMQKR  60

Query  274  eakeqnaaaRQGASTTGTNKPHS----YSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTE  441
            EA+E NA  ++ +              +STTG  G+  G HQMSA+PGHGTG P G V +
Sbjct  61   EAREHNAVMKEASGAGTGTGLGMGTATHSTTGHVGHGTGTHQMSALPGHGTGQPAGHVVD  120

Query  442  GVVESRPIGTATGTQRTTVAHNT  510
            G   + PI         T AHNT
Sbjct  121  GTAVTEPI-RTNTGTGRTTAHNT  142



>gb|AAT77223.1| group I late embryogenesis abundant protein [Brassica napus]
Length=159

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 98/143 (69%), Gaps = 5/143 (3%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKETA+N+ ASA +G +KTKA ++EK E+MT  DP++KEMAT+KKE RIN+AE+ K 
Sbjct  1    MQSMKETASNIAASAKSGMDKTKATLEEKAEKMTTRDPLQKEMATQKKEGRINEAEMQKR  60

Query  274  eakeqnaaaRQGASTTGTNKPHS----YSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTE  441
            E +E NA  ++ +              +STTG  G+  G HQMSA+PGHGTG P G V +
Sbjct  61   EVREHNAVMKEASGAGTGTGLGMGTATHSTTGHVGHGTGTHQMSALPGHGTGQPAGHVVD  120

Query  442  GVVESRPIGTATGTQRTTVAHNT  510
            G   + PIGT TGT RTT AHNT
Sbjct  121  GTAVTEPIGTNTGTGRTT-AHNT  142



>ref|XP_004234770.1| PREDICTED: 18 kDa seed maturation protein-like [Solanum lycopersicum]
Length=108

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 71/143 (50%), Gaps = 43/143 (30%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M+AMKETA+N+     +G EKTKAV QEKM   T + P                      
Sbjct  1    MQAMKETASNI----KSGIEKTKAVAQEKM---TGNKP----------------------  31

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVE  453
                         S     K HSYST+G +G P GAHQMSA+PGHG+G P G      V 
Sbjct  32   -------------SEATEGKTHSYSTSGVSGEPSGAHQMSALPGHGSGQPTGGGVVEGVV  78

Query  454  -SRPIGTATGTQRTTVAHNTHAG  519
             S PIG  TGTQR +VAHNT  G
Sbjct  79   PSHPIGKVTGTQRPSVAHNTRVG  101



>ref|XP_006659308.1| PREDICTED: 18 kDa seed maturation protein-like [Oryza brachyantha]
Length=150

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 91/153 (59%), Gaps = 13/153 (8%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            ME+ KE AANVGASA AG +KT+A VQ  +E+ TAH+  +++ A  +++ER+  AE  K+
Sbjct  8    MESAKEAAANVGASARAGMDKTRAAVQGGVEKATAHNASDRDAAEVRRQERVRDAEEEKQ  67

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVE  453
             A   NA A+   +T G    H  S+ G  G       ++A P   TG   G V EGV E
Sbjct  68   RAVRANADAKARVTTGGGGAYHQTSSQGAPG-------VAAEP---TG---GHVQEGVAE  114

Query  454  SRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
            SRP+G ATGT R + AHN H G + ++  GTGG
Sbjct  115  SRPVGMATGTARPSAAHNPHVGSDFSQARGTGG  147



>ref|XP_010928814.1| PREDICTED: 11 kDa late embryogenesis abundant protein-like [Elaeis 
guineensis]
Length=161

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 94/154 (61%), Gaps = 4/154 (3%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M ++KETA+N+ ASA +G EKTKA ++EK+E+MTAH P EKEMA +KK+++I +AE+ K 
Sbjct  8    MASVKETASNIAASAKSGMEKTKATLEEKVEKMTAHHPAEKEMAEEKKQDKIREAEIAKR  67

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPM-GQVTEGVV  450
            E KEQNAAAR+ A    T  P    TT         H  +  PG   G P  G V  G V
Sbjct  68   ETKEQNAAAREQARAGHTGGP---ITTAHPSAAAAGHHTTGAPGQVAGDPTGGHVISGTV  124

Query  451  ESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
            ES PIG  TGT R   AHN +AG     G GTGG
Sbjct  125  ESHPIGKETGTARPATAHNPYAGTANPAGRGTGG  158



>gb|AAC49862.1| group 4-late embryogenesis abundant protein PvLEA4-25, partial 
[Phaseolus vulgaris]
Length=91

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = +1

Query  340  SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVESRPIGTATGTQRTTVAHNTHAG  519
            ++ST G  G+  G HQ SAMPGHGTG P G VTEGVV S PIGT  G   TT AHNTHAG
Sbjct  17   THSTAGEHGHHTGLHQTSAMPGHGTGQPTGHVTEGVVGSHPIGTNRGPGGTTTAHNTHAG  76

Query  520  REVNK-GYGTGGATYN  564
               N  GYGTGG +YN
Sbjct  77   GNPNDYGYGTGG-SYN  91



>gb|AAT77224.1| group I late embryogenesis abundant protein [Brassica carinata]
Length=159

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 92/143 (64%), Gaps = 5/143 (3%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++M ETA+N+ ASA +G +KTKA ++EK E+MT  DP++KEMAT+KKE RINQAE+ K 
Sbjct  1    MQSMNETASNIAASAKSGMDKTKATLEEKAEKMTTRDPIQKEMATQKKEGRINQAEMQKR  60

Query  274  eakeqnaaaRQGASTTGTNKPHS----YSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTE  441
            EA+E NAA ++ +              +STTG  G+  G HQMSA+PGHGTG P G V +
Sbjct  61   EAREHNAAMKEASGAGTGTGLGLGTATHSTTGHVGHGTGTHQMSALPGHGTGEPTGHVVD  120

Query  442  GVVESRPIGTATGTQRTTVAHNT  510
            G   + PI         T AHNT
Sbjct  121  GTAVTEPI-GTNTGTGRTTAHNT  142



>gb|AFG26320.1| late embryogenesis abundant group 4 [Elaeis guineensis]
Length=161

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 94/154 (61%), Gaps = 4/154 (3%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M ++KETA+N+ ASA +G EKTKA ++EK+E+MTAH P EKEMA +KK+++I +AE+ K 
Sbjct  8    MASVKETASNIAASAKSGMEKTKATLEEKVEKMTAHHPAEKEMAEEKKQDKIREAEIAKR  67

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPM-GQVTEGVV  450
            E KEQNAAAR+ A    T  P    TT         H  +  PG   G P  G V  G +
Sbjct  68   ETKEQNAAAREQARAGYTGGP---ITTAHPSAAAAGHHTTGAPGQVAGDPTGGHVISGTM  124

Query  451  ESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
            ES PIG  TGT R   AHN +AG     G GTGG
Sbjct  125  ESHPIGKETGTARPATAHNPYAGTANPAGRGTGG  158



>ref|XP_007162320.1| hypothetical protein PHAVU_001G142000g [Phaseolus vulgaris]
 gb|ESW34314.1| hypothetical protein PHAVU_001G142000g [Phaseolus vulgaris]
Length=121

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 80/114 (70%), Gaps = 9/114 (8%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E  KETA+N+GASA AG EKTKA V+EK ER+T  DP+EKEMAT+KK+ ++NQAEL+K  
Sbjct  9    ECAKETASNMGASAKAGMEKTKANVEEKAERLTTRDPLEKEMATQKKDVKVNQAELDKLA  68

Query  277  akeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            A+  NAA+++ A         +Y TTG  GN    HQ SAMPGHGTG P G VT
Sbjct  69   ARAHNAASKEAA---------TYPTTGEHGNHTELHQTSAMPGHGTGQPTGHVT  113



>ref|XP_004146409.1| PREDICTED: 18 kDa seed maturation protein-like [Cucumis sativus]
 gb|KGN54793.1| hypothetical protein Csa_4G499300 [Cucumis sativus]
Length=174

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 105/147 (71%), Gaps = 9/147 (6%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            +E+MKE+AANV ASA AG +KTKA VQEKME++TA DP+ KE+A +KKE +I++AELNK+
Sbjct  8    VESMKESAANVAASAKAGMDKTKATVQEKMEKVTARDPLAKEIAEEKKEAKIHEAELNKQ  67

Query  274  eakeqnaaaRQGASTTG---------TNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPM  426
            EA++ NAA RQ A+            T+   +YSTTG  G   G  Q SA+PGHGTG P 
Sbjct  68   EARQHNAAVRQAATGAAAATHGTHPTTHSTATYSTTGAHGYTTGTQQTSALPGHGTGQPT  127

Query  427  GQVTEGVVESRPIGTATGTQRTTVAHN  507
            G VTEGVV + PIGT TGT RTT AHN
Sbjct  128  GLVTEGVVGAHPIGTETGTGRTTTAHN  154



>gb|AFG26321.1| late embryogenesis abundant group 4 [Elaeis guineensis]
Length=161

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 94/154 (61%), Gaps = 4/154 (3%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M ++KETA+N+ ASA +G EKTKA ++EK+E+MTAH P EKEMA +KK+++I +AE+ K 
Sbjct  8    MASVKETASNIAASAKSGMEKTKATLEEKVEKMTAHHPAEKEMAEEKKQDKIREAEIAKR  67

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPM-GQVTEGVV  450
            E KEQNAAAR+ A    T  P    TT         H  +  PG   G P  G V  G +
Sbjct  68   ETKEQNAAAREQARAGYTGGP---ITTAHPSAAAAGHHTTGAPGQVAGDPTGGHVISGTM  124

Query  451  ESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
            ES P G  TGT R   AHN++AG     G GTGG
Sbjct  125  ESHPNGKETGTARPATAHNSYAGTANPAGRGTGG  158



>ref|XP_004156026.1| PREDICTED: 18 kDa seed maturation protein-like [Cucumis sativus]
Length=186

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 108/159 (68%), Gaps = 21/159 (13%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            +E+MKE+AANV ASA AG +KTKA VQEKME++TA DP+ KE+A +KKE +I++AELNK+
Sbjct  8    VESMKESAANVAASAKAGMDKTKATVQEKMEKVTARDPLAKEIAEEKKEAKIHEAELNKQ  67

Query  274  eakeqnaaaRQGAS--------------TTGTNKPH-------SYSTTGRTGNPMGAHQM  390
            EA++ NAA RQ A+              +T T+  H       +YSTTG  G   G  Q 
Sbjct  68   EARQHNAAVRQAATGAAAATHGTHPTTHSTATHGTHPTTHSTATYSTTGAHGYTTGTQQT  127

Query  391  SAMPGHGTGAPMGQVTEGVVESRPIGTATGTQRTTVAHN  507
            SA+PGHGTG P G VTEGVV + PIGT TGT RTT AHN
Sbjct  128  SALPGHGTGQPTGLVTEGVVGAHPIGTETGTGRTTTAHN  166



>gb|KFK25064.1| hypothetical protein AALP_AA8G061800 [Arabis alpina]
Length=160

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++ KE  +N+ ASA +G +KTKA ++EK E+M   DP++KEMAT++KE +INQAE+ K 
Sbjct  1    MQSAKEAVSNIAASAKSGMDKTKATLEEKAEKMKTRDPVQKEMATQRKEGKINQAEMQKR  60

Query  274  eakeqnaaaRQGASTTGTNKPHS----YSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTE  441
            E +E NAA +Q A              +STTG+ G+  G HQMSA+PGHGTG P G V E
Sbjct  61   ETQEYNAAMKQAAGGGTGTGVGLGTATHSTTGQVGHGTGTHQMSALPGHGTGHPTGHVVE  120

Query  442  GVVESRPI  465
            G   + PI
Sbjct  121  GTAVTEPI  128



>ref|XP_004973219.1| PREDICTED: 18 kDa seed maturation protein-like [Setaria italica]
Length=153

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 92/164 (56%), Gaps = 15/164 (9%)
 Frame = +1

Query  61   EKGKTIGK*QKMEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkke  240
            + GK++     MEA KE AAN+GASA AG +KT+A VQ ++E+ TAH+  +K  A   + 
Sbjct  2    QAGKSV-----MEATKEAAANLGASANAGMQKTRAAVQGQVEKATAHNASDKAAAEANQR  56

Query  241  eRInqaelnkeeakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGA  420
            ER+  AE  K+ A   NAAA++ A  TG     ++ + G  G    AH      GHG   
Sbjct  57   ERVRAAEEEKQGAMRANAAAKERA--TG-----AHPSQGAPGIVDAAHHQQ---GHGAAP  106

Query  421  PMGQVTEGVVESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
              G V  GV E+RP+  ATG  R + AHN H G + ++  GTGG
Sbjct  107  AGGHVEAGVGETRPVARATGAARPSAAHNPHVGSDFSQARGTGG  150



>gb|AAG37453.1| seed maturation protein LEA 4 [Glycine tomentella]
Length=168

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 92/159 (58%), Gaps = 7/159 (4%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkee  276
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DPM KE+AT+KK+ +++QAEL+K+ 
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDPMRKELATQKKDAKMSQAELDKQA  68

Query  277  akeqnaaaRQGASTTGTNKPH------SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVT  438
            A++ N AARQ A+     + H      +YSTTG T NP G  +    P     +P     
Sbjct  69   ARQHNTAARQAATAGHMGQGHRTPGTATYSTTGNTDNPWGPIRRQLCPVMEPDSPRAMSP  128

Query  439  EGVVESRPIGTATGTQRTTVAHNTHAGREVNK-GYGTGG  552
                    +           AHNT AG   N  GYGTGG
Sbjct  129  REWWAPTLLEPTEARVGLLPAHNTRAGGNPNDYGYGTGG  167



>ref|XP_010088172.1| 18 kDa seed maturation protein [Morus notabilis]
 gb|EXB32138.1| 18 kDa seed maturation protein [Morus notabilis]
Length=172

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 106/179 (59%), Gaps = 36/179 (20%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEK----------------MERMTAHDPmekema  225
            M++MKETAANV ASA +G EKTKA +QEK                ME+MTAHDP+EKEMA
Sbjct  1    MQSMKETAANVAASAKSGMEKTKATLQEKANLLDLDFYDEANESKMEKMTAHDPVEKEMA  60

Query  226  tkkkeeRInqaelnkeeakeqnaaaRQG----------ASTTGTNKPHSYSTTGRTGNPM  375
            T+KK+ RI+QAEL+K+EA+E NAAAR+            +T       +YSTTG T  P 
Sbjct  61   TEKKKARISQAELDKQEAREHNAAAREARKAGVGHTGYTATGTGTGTATYSTTGTTSQPT  120

Query  376  GAHQMSAMPGHGTGAPMGQVTEGVVESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
            G H+MSA          GQV EG V + PIG  T T RT+ A NT       +GYGTGG
Sbjct  121  GTHKMSA----------GQVVEGAVGAHPIGINTSTGRTSAARNTRVEGTGAQGYGTGG  169



>ref|NP_001061558.1| Os08g0327700 [Oryza sativa Japonica Group]
 dbj|BAD03453.1| putative seed maturation protein [Oryza sativa Japonica Group]
 dbj|BAD03626.1| putative seed maturation protein [Oryza sativa Japonica Group]
 dbj|BAF23472.1| Os08g0327700 [Oryza sativa Japonica Group]
 dbj|BAG98210.1| unnamed protein product [Oryza sativa Japonica Group]
Length=150

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 93/153 (61%), Gaps = 13/153 (8%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++ KE AANVGASA AG +K++A VQ ++E+ TA +  +K+ A  +++ER+  AE  K+
Sbjct  8    MQSTKEAAANVGASARAGMDKSRAAVQGQVEKATARNAADKDAAEVRRQERLQAAEEEKQ  67

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVE  453
             A   NAAA++ A T G    H        G P G    +A P   TG   G V +GV E
Sbjct  68   HAMAANAAAKERA-TGGAGAYHPSQ-----GAP-GVDPRAAQP---TG---GHVQDGVAE  114

Query  454  SRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
            SRP+GTATGT R + AHN H G + ++ +GTGG
Sbjct  115  SRPVGTATGTARPSAAHNPHVGSDFSQAHGTGG  147



>ref|XP_004497898.1| PREDICTED: 18 kDa seed maturation protein-like [Cicer arietinum]
Length=177

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 102/164 (62%), Gaps = 21/164 (13%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            +E +KETAAN+GASA +G EKTKA VQEK ERM+A DPM+K+MAT+KKEERIN AE+ K+
Sbjct  8    VETIKETAANIGASAKSGLEKTKATVQEKSERMSARDPMQKQMATEKKEERINHAEMGKQ  67

Query  274  eakeqnaaaRQGAS----TTGTNKPHS----------YSTTGRTGNPMGA---HQMSAMP  402
            EA+E NAA +  A+    T G     S          YST+G  G+       H MS MP
Sbjct  68   EAREHNAATKMSANAGHVTGGQQYTASGPATETAAAGYSTSGTYGSGQQLATDHNMSTMP  127

Query  403  --GHGTGAPMGQVTEGVVESRPIGTATGTQRTTVAHNTHAGREV  528
              GHG G  +G+  + ++ S PI T TG   TT AHN HAG  V
Sbjct  128  AHGHGIGYGLGREKD-MLGSHPIETNTGMD-TTAAHNIHAGETV  169



>ref|XP_008442129.1| PREDICTED: 18 kDa seed maturation protein [Cucumis melo]
Length=177

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 107/147 (73%), Gaps = 9/147 (6%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            ME++KE+AANV ASA AG +KTKA VQEKME++TA DP+ KE+A +KKE +I++AELNK+
Sbjct  8    MESVKESAANVAASAKAGMDKTKATVQEKMEKVTARDPLAKEIAEEKKEAKIHEAELNKQ  67

Query  274  eakeqnaaaRQGAST---------TGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPM  426
            EA++ NAA RQ A+            T+   ++STTG  G   G HQMSA+PGHGTG P 
Sbjct  68   EARQHNAAVRQAATVGAATTHGTHPTTHSTATHSTTGAHGYTTGTHQMSALPGHGTGQPT  127

Query  427  GQVTEGVVESRPIGTATGTQRTTVAHN  507
            G VTEGVV   PIGTATGT RTT AHN
Sbjct  128  GPVTEGVVGVHPIGTATGTGRTTTAHN  154



>gb|EAZ06557.1| hypothetical protein OsI_28805 [Oryza sativa Indica Group]
Length=150

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 92/153 (60%), Gaps = 13/153 (8%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++ KE AANVGASA AG +K++A VQ ++E+ TA +  +K+ A  +++ER+  AE  K+
Sbjct  8    MQSTKEAAANVGASARAGMDKSRAAVQGQVEKATARNAADKDAAEVRRQERVQAAEEEKQ  67

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVE  453
             A   NAAA++ A T G    H        G P G    +A P   TG   G V +GV E
Sbjct  68   HAMAANAAAKERA-TGGAGAYHPSQ-----GAP-GVDPRAAQP---TG---GHVQDGVAE  114

Query  454  SRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
            S P+GTATGT R + AHN H G + ++ +GTGG
Sbjct  115  SWPVGTATGTARPSAAHNPHVGSDFSQAHGTGG  147



>ref|XP_010452617.1| PREDICTED: 18 kDa seed maturation protein-like isoform X2 [Camelina 
sativa]
Length=155

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 80/129 (62%), Gaps = 9/129 (7%)
 Frame = +1

Query  151  EKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkeeakeqnaaaRQGASTTGTN  330
            +KTKA ++EK E+M   DP++K MAT+ KE++IN AE+ K E  E NAA ++ A      
Sbjct  2    DKTKATLEEKAEKMKTRDPLQKHMATQVKEDKINLAEMQKRETYEHNAAMKEAAGPGIGT  61

Query  331  KPH--------SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVESRPIGTATGTQ  486
                       ++STTG+ G+  G HQMSA+PGHGTG    +V EG   + PIG  TGT 
Sbjct  62   GTGTGLGLGSATHSTTGQVGHGTGTHQMSALPGHGTGQMTDRVVEGTAATNPIGRDTGTG  121

Query  487  RTTVAHNTH  513
            RTT AHNTH
Sbjct  122  RTT-AHNTH  129



>ref|XP_008782853.1| PREDICTED: LOW QUALITY PROTEIN: 11 kDa late embryogenesis abundant 
protein [Phoenix dactylifera]
Length=161

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 94/156 (60%), Gaps = 5/156 (3%)
 Frame = +1

Query  100  AMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkeea  279
            ++KETA+N+ ASA +G EKTKA ++EK+E+MTA  P EKEMA +KK+++I +AE+ K E 
Sbjct  10   SVKETASNIAASAKSGMEKTKATLEEKVEKMTAQHPAEKEMAEQKKQDKIREAEIAKREV  69

Query  280  keqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPM-GQVTEGVVES  456
            KEQNAAAR+ A    T  P   + T         H  +  PG   G P  G V  G V+S
Sbjct  70   KEQNAAAREQARAGYTGGP---TATAYPSAAAAGHHTTGAPGQVAGDPTGGHVISGAVKS  126

Query  457  RPIGTATGTQRTTVAHNTHAGREVNKGYGTGGATYN  564
             P+GT  GT R  +A N + G     G+GTGG  YN
Sbjct  127  HPVGTEXGTARPAIARNPYTGTASPAGHGTGGG-YN  161



>ref|XP_009411691.1| PREDICTED: 11 kDa late embryogenesis abundant protein-like [Musa 
acuminata subsp. malaccensis]
Length=155

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 90/154 (58%), Gaps = 10/154 (6%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M ++KETA NV ASA AG +KT A VQEK+E+MTAH P EK MA ++K+E++ +AE+NK+
Sbjct  8    MASVKETAGNVAASAKAGMDKTTATVQEKVEKMTAHTPTEKAMAEERKQEKVREAEINKQ  67

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPM-GQVTEGVV  450
            E  +QNAAA+Q        +  +    G    P G + +   PG   G P  G +  G V
Sbjct  68   ETMQQNAAAQQ--------RTLAAHDGGHVAEP-GVYPVGGAPGEVAGHPTGGHLISGAV  118

Query  451  ESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
             SRPIG  TGT R   AHN + G       GTGG
Sbjct  119  RSRPIGRDTGTARPDAAHNPYVGSTEPAARGTGG  152



>ref|XP_002445279.1| hypothetical protein SORBIDRAFT_07g007690 [Sorghum bicolor]
 gb|EES14774.1| hypothetical protein SORBIDRAFT_07g007690 [Sorghum bicolor]
Length=158

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 88/153 (58%), Gaps = 5/153 (3%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            MEA KE AANVGASA AG +KT+A VQ ++E+ TAH+  ++  A   + ER+  AEL K+
Sbjct  8    MEATKEAAANVGASANAGMQKTRAAVQGQVEKATAHNASDRAAAEANQRERVRAAELEKQ  67

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVE  453
            +A   NAAA++ A+   T   + + + G  G    + Q       G     G V +GV E
Sbjct  68   DAMRANAAAKERATGAAT---YQHPSQGAPGIVDASRQGYGA--GGAAPAGGHVEDGVGE  122

Query  454  SRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
            +RP+  ATGT R + AHN H G +  +  GTGG
Sbjct  123  TRPVARATGTARPSAAHNPHVGSDFPQARGTGG  155



>ref|NP_001150746.1| seed maturation protein [Zea mays]
 gb|ACG40190.1| seed maturation protein [Zea mays]
Length=159

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 91/154 (59%), Gaps = 6/154 (4%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            +EA KE AANVGASA AG +KT+A VQ ++E+ TA +  +K  A +++ ER+  AEL K+
Sbjct  8    VEATKEAAANVGASANAGMQKTRAAVQGQVEKATARNASDKAAAEERQRERVRAAELQKQ  67

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPM-GQVTEGVV  450
            +A   NAAA++ A+       H + + G  G  +GA Q     G G  AP  G V  GV 
Sbjct  68   DAVRANAAAKERATGGAATYQHQHPSQGAPG--IGAQQHY---GGGRVAPAGGHVEAGVG  122

Query  451  ESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
            E+RP+   TGT R + AHN   G + ++  GTGG
Sbjct  123  ETRPVARGTGTARPSAAHNPLVGSDFSQARGTGG  156



>ref|XP_006362227.1| PREDICTED: 11 kDa late embryogenesis abundant protein-like [Solanum 
tuberosum]
Length=96

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 2/94 (2%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M+++KE A+NV ASA +G EKTKA VQEK+E+M AHDP EK MAT+KK+ERI +AE+NK+
Sbjct  1    MQSLKEKASNVAASAKSGMEKTKATVQEKVEKMKAHDPTEKAMATEKKDERIYEAEMNKQ  60

Query  274  eakeqnaaaRQGASTTGTNKPH-SYSTTGRTGNP  372
              +++NAA   GA  TGT +PH S +T G TG+P
Sbjct  61   VTQDRNAALHHGAG-TGTGRPHYSNATAGSTGHP  93



>ref|XP_008662787.1| PREDICTED: 11 kDa late embryogenesis abundant protein-like [Zea 
mays]
 gb|AFW57107.1| seed maturation protein [Zea mays]
Length=163

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 90/154 (58%), Gaps = 6/154 (4%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            +EA KE AANVGASA AG +KT+A VQ ++E+ TA +  +K  A +++ ER+  AEL K+
Sbjct  12   VEATKEAAANVGASANAGMQKTRAAVQGQVEKATARNASDKVAAEERQRERVRAAELEKQ  71

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPM-GQVTEGVV  450
            +A   NAAA++ A        H + + G  G  +GA Q     G G  AP  G V  GV 
Sbjct  72   DAVRANAAAKERAIGGAATYQHQHPSQGAPG--IGAQQEY---GGGRVAPAGGHVEAGVG  126

Query  451  ESRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
            E+RP+   TGT R + AHN   G + ++  GTGG
Sbjct  127  ETRPVARGTGTARPSAAHNPLVGSDFSQARGTGG  160



>gb|AGZ80327.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80328.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80329.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80330.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80331.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80333.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80334.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80335.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80336.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80337.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80338.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80339.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80340.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80341.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80342.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80343.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
Length=74

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVESRPIGTATGTQRTTVAH  504
            ++STTG  G+  G HQ SAMPGHGTG P G VTEGVV S PIGT  G   TT AH
Sbjct  20   THSTTGEHGHHTGLHQTSAMPGHGTGQPTGHVTEGVVGSHPIGTNRGPGGTTTAH  74



>ref|XP_006850002.1| hypothetical protein AMTR_s00022p00173750 [Amborella trichopoda]
 gb|ERN11583.1| hypothetical protein AMTR_s00022p00173750 [Amborella trichopoda]
Length=144

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 80/123 (65%), Gaps = 18/123 (15%)
 Frame = +1

Query  100  AMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnkeea  279
            +MKETA NV ASA AG +KTKA +QEK+E+M+AHDPM+K+MA +KKE R+N+AE+NK+EA
Sbjct  10   SMKETAGNVAASAKAGMDKTKATMQEKVEKMSAHDPMQKQMAQQKKEARVNEAEINKQEA  69

Query  280  keqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVESR  459
            K +NAA ++     G         TG           SA+PGHGTG P  Q+ +    S 
Sbjct  70   KAENAAQKEQVRAAGHG-------TG-----------SALPGHGTGQPHDQLLDRTAGSH  111

Query  460  PIG  468
            PIG
Sbjct  112  PIG  114



>ref|XP_003568768.1| PREDICTED: 11 kDa late embryogenesis abundant protein [Brachypodium 
distachyon]
Length=147

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 82/153 (54%), Gaps = 16/153 (10%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            MEA KE AANVGASA +G EKTKA VQ ++E+ TAHD   K  A  +++ER+  AE  K+
Sbjct  8    MEATKEAAANVGASAYSGMEKTKATVQGQVEKATAHDAAGKAAAEARRQERVRGAEEEKQ  67

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVE  453
             A   NAAA++ AS    +         + G P G                G V +GV E
Sbjct  68   NAMLANAAAKERASAGMYHPSQGAPGIAQGGRPAG----------------GLVEDGVAE  111

Query  454  SRPIGTATGTQRTTVAHNTHAGREVNKGYGTGG  552
            S PIG ATGT R + AHN   G +  +  GTGG
Sbjct  112  SGPIGRATGTGRPSAAHNPRVGSDFPQARGTGG  144



>gb|AGZ80326.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80332.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80344.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80345.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80346.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
 gb|AGZ80347.1| group 4-late embryogenesis abundant protein, partial [Phaseolus 
vulgaris]
Length=74

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  340  SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVESRPIGTATGTQRTTVAH  504
            ++S TG  G+  G HQ SAMPGHGTG P G VTEGVV S PIGT  G   TT AH
Sbjct  20   THSATGEHGHHTGLHQTSAMPGHGTGQPTGHVTEGVVGSHPIGTNRGPGGTTTAH  74



>gb|AFN53649.1| putative seed maturation protein [Linum usitatissimum]
Length=174

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 76/110 (69%), Gaps = 11/110 (10%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKETAAN+GASA AG EKTKAVVQEK+E+++AH+P++KEMA +KKE+RI +AE  K 
Sbjct  1    MQSMKETAANIGASAKAGMEKTKAVVQEKVEKVSAHNPVQKEMAKEKKEQRIAEAEAMKH  60

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPM-GAHQMSAMPGHGTGA  420
             AK  NAAA+QG    G +      TTG T     G HQ     G+ TGA
Sbjct  61   SAKAHNAAAKQGGQVLGAD-----YTTGSTDYITPGHHQ-----GYSTGA  100



>gb|KDP24620.1| hypothetical protein JCGZ_25536 [Jatropha curcas]
Length=152

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 94/140 (67%), Gaps = 15/140 (11%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            ME++KETAANVGASA AG EKT+A  QEK+ERM+  DP++KEMA +KKEER  +AEL K 
Sbjct  1    MESLKETAANVGASAKAGMEKTRAEAQEKVERMSTRDPVQKEMAREKKEERKTEAELRKL  60

Query  274  eakeqnaaaRQ-------------GASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHGT  414
            EA+E NAAARQ             G    GT + +++STTG TG P G  QMSAMPGHGT
Sbjct  61   EAREDNAAARQAAKAGGHVQYTTAGPGAQGTTETYTHSTTGTTGYPTGTQQMSAMPGHGT  120

Query  415  GAPMGQVTE--GVVESRPIG  468
            G P G   +  G+  +RP G
Sbjct  121  GQPYGGEVDPTGLTRTRPSG  140



>gb|AAG12982.1| seed maturation protein [Glycine tomentella]
Length=57

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDP  207
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DP
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDP  45



>gb|AAG12980.1| seed maturation protein [Glycine tomentella]
Length=57

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDP  207
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DP
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDP  45



>gb|AAG12979.1| seed maturation protein [Glycine tomentella]
 gb|AAG12981.1| seed maturation protein [Glycine tomentella]
Length=57

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDP  207
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DP
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDP  45



>gb|KGN59308.1| hypothetical protein Csa_3G808370 [Cucumis sativus]
Length=103

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRI  249
            EAMKE+AANVGASA AG EKTKA  QEK+++M AHDP EK+MA ++K+ERI
Sbjct  9    EAMKESAANVGASAKAGMEKTKATAQEKVDKMRAHDPFEKDMARERKDERI  59



>ref|XP_003625255.1| Seed maturation protein [Medicago truncatula]
 gb|AES81473.1| late embryogenesis abundant protein [Medicago truncatula]
Length=105

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRI  249
            E++KETAAN+GASA +G EKTKA +QEK E+MTAHDP++KEMAT+KKEER+
Sbjct  10   ESIKETAANIGASAKSGMEKTKATLQEKTEKMTAHDPLQKEMATQKKEERV  60



>ref|XP_004249726.1| PREDICTED: 11 kDa late embryogenesis abundant protein-like [Solanum 
lycopersicum]
Length=93

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M+++KE A+NV ASA +G EKTKA VQEK+++M A+DP EK +AT+KK+ RI +AE+NK 
Sbjct  1    MQSLKEKASNVAASAKSGMEKTKATVQEKVDKMKANDPTEKAVATEKKDGRIYEAEMNKH  60

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNP  372
              +++NAA   GA  TGT +PH  +TT  TG+P
Sbjct  61   ATQDRNAALHHGAG-TGTGRPHYSNTT--TGHP  90



>gb|KHN07426.1| 18 kDa seed maturation protein [Glycine soja]
Length=156

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDP  207
            E++KETAAN+GASA AG EKTKA VQEK ERMTA DP
Sbjct  9    ESIKETAANIGASAKAGMEKTKATVQEKAERMTARDP  45



>ref|XP_003625257.1| Seed maturation protein LEA [Medicago truncatula]
 gb|AES81475.1| seed maturation protein [Medicago truncatula]
Length=101

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRI  249
            E++KETAAN+GASA +G EKTKA  QEK E+MTAHDP++KEMAT+KKEER+
Sbjct  10   ESIKETAANIGASAKSGMEKTKATFQEKTEKMTAHDPLQKEMATQKKEERV  60



>ref|XP_004514000.1| PREDICTED: 18 kDa seed maturation protein-like [Cicer arietinum]
Length=100

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 5/61 (8%)
 Frame = +1

Query  67   GKTIGK*QKMEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeR  246
            GK +G     E +KETAAN+GASA +G EKTKA VQEK E+MTAHDP++KEMAT+KKEER
Sbjct  4    GKKVG-----ENIKETAANIGASAKSGMEKTKANVQEKTEKMTAHDPLQKEMATQKKEER  58

Query  247  I  249
            +
Sbjct  59   V  59



>ref|XP_002279220.1| PREDICTED: 11 kDa late embryogenesis abundant protein-like [Vitis 
vinifera]
Length=131

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDP  207
            EAMKE A+NV ASA AG EKTKA  QEK ERMTAHDP
Sbjct  9    EAMKEKASNVAASARAGMEKTKATAQEKKERMTAHDP  45



>gb|KEH41703.1| seed maturation protein [Medicago truncatula]
Length=181

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRI  249
            +E +KETAAN+GASA +G EKTKA VQEK ERM+A DPM+KEMAT KKEERI
Sbjct  8    VETIKETAANIGASAKSGLEKTKATVQEKNERMSASDPMQKEMATDKKEERI  59



>gb|EPS61795.1| hypothetical protein M569_12999, partial [Genlisea aurea]
Length=51

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +1

Query  328  NKPHSYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVESRPIGTAT  477
            N   SYSTTG  G   G  QMS +PGHGTG P  +VTEG   + PIG  T
Sbjct  2    NASFSYSTTGEKGESTGLRQMSDLPGHGTGQPEARVTEGTAAAHPIGRNT  51



>emb|CAN63336.1| hypothetical protein VITISV_032257 [Vitis vinifera]
Length=327

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDP  207
            EAMKE A+NV ASA AG EKTKA  QEK ERMTAHDP
Sbjct  205  EAMKEKASNVAASARAGMEKTKATAQEKKERMTAHDP  241



>gb|EAZ42326.1| hypothetical protein OsJ_26900 [Oryza sativa Japonica Group]
Length=134

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 43/71 (61%), Gaps = 8/71 (11%)
 Frame = +1

Query  340  SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVESRPIGTATGTQRTTVAHNTHAG  519
            +Y   GR   P G +  +A P   TG   G V +GV ESRP+GTATGT R + AHN H G
Sbjct  69   AYHPVGRA--PPGWNPRAAQP---TG---GHVQDGVAESRPVGTATGTARPSAAHNPHVG  120

Query  520  REVNKGYGTGG  552
             + ++ +GTGG
Sbjct  121  SDFSQAHGTGG  131



>ref|XP_011078825.1| PREDICTED: 11 kDa late embryogenesis abundant protein-like [Sesamum 
indicum]
Length=158

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRI  249
            M++ KETA+NV ASA AG EKTKA VQEK ERMT  DP++K+MAT+KKE+RI
Sbjct  1    MQSAKETASNVAASAKAGMEKTKATVQEKAERMTTRDPIQKDMATQKKEDRI  52



>emb|CDY71981.1| BnaCnng75390D, partial [Brassica napus]
Length=262

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +1

Query  340  SYSTTGRTGNPMGAHQMSAMPGHGTGAPMGQVTEGVVESRPIGTATGTQRTTVAHNTHA  516
            ++STTG  G+  G H+MSA+PG GTG   G + EG   + PIGT TGT RT  AHN H 
Sbjct  190  THSTTGHVGHGTGTHKMSALPGQGTGQATGHIVEGTTLTEPIGTNTGTGRTA-AHNAHV  247



>ref|XP_004956444.1| PREDICTED: 18 kDa seed maturation protein-like [Setaria italica]
Length=168

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRI  249
            +E+ KE AANVGASA AGKEKTKAVVQEK  +  A DP EK  A  + EER+
Sbjct  10   VESAKEAAANVGASAWAGKEKTKAVVQEKAAKARARDPAEKAAADARMEERV  61



>ref|XP_010557946.1| PREDICTED: 11 kDa late embryogenesis abundant protein-like [Tarenaya 
hassleriana]
Length=146

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRInqaelnke  273
            M++MKE A+N+ ASA AG EKTKA ++EK E+MT  DP++KEMAT+KKE+RINQAEL K 
Sbjct  1    MQSMKEKASNIAASAKAGMEKTKATLEEKAEKMTTRDPVQKEMATQKKEDRINQAELEKR  60

Query  274  eakeqnaaaRQGASTTGTNKPHSYSTTGRTGNPMGAHQMSAMPGHG  411
            EA+E NAAA+  A     +  ++   TG  G+  G H   A+PGHG
Sbjct  61   EAREHNAAAKHAAGAGLGSPGYTTKGTGHLGSTTG-HGTGALPGHG  105



>ref|XP_008664453.1| PREDICTED: 11 kDa late embryogenesis abundant protein-like [Zea 
mays]
Length=125

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRI  249
            +EA KE A NVGASA A KEKTKAVVQEK  +  AHDP EK +A  + +ER+
Sbjct  10   VEAAKEAATNVGASAWASKEKTKAVVQEKAAKARAHDPAEKAVAEARMQERV  61



>gb|EMT19082.1| 18 kDa seed maturation protein [Aegilops tauschii]
Length=157

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  100  AMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDP  207
            A KE  ANVGASA AGKEKTKAVVQE + +  AHDP
Sbjct  12   AAKEAVANVGASAWAGKEKTKAVVQETVNKAKAHDP  47



>dbj|BAK07925.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=175

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  100  AMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDP  207
            A KE  ANVGASA AGKEKTKAVVQE +++  AHDP
Sbjct  12   AAKEAVANVGASAWAGKEKTKAVVQETVKKAKAHDP  47



>gb|EYU39929.1| hypothetical protein MIMGU_mgv1a016953mg [Erythranthe guttata]
Length=99

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDP  207
            M++ KETA+NV ASA AG EKTKA +QEK ERMT  DP
Sbjct  1    MQSAKETASNVAASAKAGMEKTKATMQEKGERMTTRDP  38



>ref|XP_007145682.1| hypothetical protein PHAVU_007G259400g [Phaseolus vulgaris]
 gb|ESW17676.1| hypothetical protein PHAVU_007G259400g [Phaseolus vulgaris]
Length=205

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHD  204
            +E++KETAAN+GASA +G EKTKA + EK ER+++HD
Sbjct  8    VESVKETAANIGASAKSGLEKTKATIHEKSERISSHD  44



>ref|XP_004249727.1| PREDICTED: 18 kDa seed maturation protein-like [Solanum lycopersicum]
Length=221

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRI  249
            MEA K+TAANV ASA +G EKTKAVV EK E++T  DP++++MAT+KKE+RI
Sbjct  1    MEAAKQTAANVAASAKSGMEKTKAVVTEKTEKLTTSDPVQRQMATEKKEQRI  52



>ref|XP_006362225.1| PREDICTED: mucin-19-like [Solanum tuberosum]
Length=271

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRI  249
            MEA K+TAANV ASA +G EKTKAVV EK E++T  DP++++MAT+KKE+RI
Sbjct  1    MEATKKTAANVAASAKSGMEKTKAVVTEKAEKLTTSDPVQRQMATEKKEQRI  52



>gb|ABC46710.1| seed maturation protein LEA 4 [Arachis hypogaea]
Length=55

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  97   EAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDP  207
            +++KE AANVGASA AG EKTKA VQEK ERM+   P
Sbjct  9    QSIKEKAANVGASAQAGLEKTKATVQEKAERMSTRAP  45



>ref|XP_003533922.1| PREDICTED: 18 kDa seed maturation protein-like [Glycine max]
Length=222

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHD  204
            +E  KETAAN+GASA +G EKTKA +QEK E+M A D
Sbjct  8    IETFKETAANIGASAKSGLEKTKATIQEKNEKMNAED  44



>ref|XP_010257470.1| PREDICTED: 11 kDa late embryogenesis abundant protein [Nelumbo 
nucifera]
Length=98

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDPmekematkkkeeRI  249
            M++MKE A+NV ASA +G EKTKA VQEK+++M AH   EKEMA ++KEERI
Sbjct  1    MQSMKEAASNVAASAKSGMEKTKATVQEKVDKMAAHSAAEKEMAKQRKEERI  52



>gb|AAO33589.1|AF479307_1 putative lea 4 [Arachis hypogaea]
Length=89

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  94   MEAMKETAANVGASAIAGKEKTKAVVQEKMERMTAHDP  207
            +E  KETAAN+GASA +G EKTKA V EK E+++ HDP
Sbjct  8    VENAKETAANIGASAKSGLEKTKATVTEKAEKISTHDP  45



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1235160523400