BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c15389_g2_i1 len=792 path=[818:0-596 1415:597-791]

Length=792
                                                                      Score     E

ref|XP_009776543.1|  PREDICTED: uncharacterized protein LOC104226288  59.3    1e-07   
ref|XP_009602192.1|  PREDICTED: uncharacterized protein LOC104097340  53.5    2e-05   



>ref|XP_009776543.1| PREDICTED: uncharacterized protein LOC104226288 [Nicotiana sylvestris]
Length=180

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 71/168 (42%), Gaps = 28/168 (17%)
 Frame = -3

Query  697  IVALPVVYLIFASHSHVDAS---NNFCATAVDKQLCENTVKGATNWEEAITEAIVKAIYQ  527
            +V+L + +L+FAS ++       N FC  A+DK  C   VK A  W+EAITE + + I Q
Sbjct  11   LVSLALTFLLFASIANAQPGVNINPFCVKALDKAFCSEVVKPADTWQEAITEVLSETIMQ  70

Query  526  QANA------------STWG-------NPACEKPYRDTEENLVESLEIVGMTRQSDEDKS  404
               A            ST           AC K Y D  + L E  E +        DK+
Sbjct  71   AKMAEPIMANLLTTLPSTLDAKFKDNIGLACRKSYDDVLDFLKEVEEAL-----KTGDKT  125

Query  403  KGLKAKLPKALTSLEDCFKILKDLKQDASAEKRLMHGAEQAIGVCLAV  260
            K    KL  A T LEDC       +  A        G+++ +  CLAV
Sbjct  126  KVANIKLSAAYTRLEDCADEFSKTQMPAEFST-FYEGSKKLLSTCLAV  172



>ref|XP_009602192.1| PREDICTED: uncharacterized protein LOC104097340 [Nicotiana tomentosiformis]
Length=182

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 69/168 (41%), Gaps = 28/168 (17%)
 Frame = -3

Query  697  IVALPVVYLIFASHSHVDAS---NNFCATAVDKQLCENTVKGATNWEEAITEAIVKAIYQ  527
            +V+L +  L+FAS ++       N FC  A+DK  C   VK A  W+EAITE + + I Q
Sbjct  13   LVSLALTSLVFASIANAQPGVNMNPFCVKALDKAFCSEVVKPADTWQEAITEVLSETIMQ  72

Query  526  QANA------------STWG-------NPACEKPYRDTEENLVESLEIVGMTRQSDEDKS  404
               A            ST           AC K Y D  + L E  E +        DK+
Sbjct  73   AKMAEPIMANLLITLPSTLDAKFKDNIGLACRKSYDDVVDLLKEVEEAL-----KTGDKT  127

Query  403  KGLKAKLPKALTSLEDCFKILKDLKQDASAEKRLMHGAEQAIGVCLAV  260
            K    KL  A   L+DC       +  A        G+++ +  CLAV
Sbjct  128  KIANIKLSAAYARLDDCADEFSKTQMPAEFST-FYEGSKKLLSTCLAV  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1450662993712