BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1535_g1_i1 len=2123 path=[1:0-1083 1085:1084-2122]

Length=2123
                                                                      Score     E

ref|XP_009776376.1|  PREDICTED: probable WRKY transcription facto...    535   2e-179   
emb|CDP04425.1|  unnamed protein product                                533   1e-178   
ref|XP_009776375.1|  PREDICTED: probable WRKY transcription facto...    530   1e-177   
gb|ABC86709.1|  putative WRKY1a transcription factor                    529   9e-177   Coffea arabica [arabica coffee]
ref|XP_011096037.1|  PREDICTED: WRKY transcription factor 6             527   5e-176   
gb|ABC86708.1|  putative WRKY1b transcription factor                    522   5e-174   Coffea arabica [arabica coffee]
gb|ACI90292.1|  WRKY transcription factor                               508   1e-168   Picrorhiza kurrooa
ref|XP_009776377.1|  PREDICTED: WRKY transcription factor 6-like ...    504   5e-168   
ref|XP_009598818.1|  PREDICTED: probable WRKY transcription facto...    505   1e-167   
ref|XP_009598817.1|  PREDICTED: probable WRKY transcription facto...    501   6e-166   
gb|ACT80136.1|  transcription factor WRKY                               495   1e-163   Capsicum annuum
ref|XP_007026134.1|  WRKY family transcription factor                   489   8e-161   
ref|XP_004232693.1|  PREDICTED: probable WRKY transcription facto...    475   4e-156   
ref|XP_010316577.1|  PREDICTED: probable WRKY transcription facto...    472   1e-154   
gb|ABN69038.1|  WRKY protein                                            470   4e-154   Solanum tuberosum [potatoes]
gb|EYU27761.1|  hypothetical protein MIMGU_mgv1a003939mg                468   4e-153   
ref|XP_009776126.1|  PREDICTED: WRKY transcription factor 6-like        464   3e-152   
ref|XP_011086199.1|  PREDICTED: probable WRKY transcription facto...    462   7e-151   
ref|XP_006348144.1|  PREDICTED: WRKY transcription factor 6-like ...    462   7e-151   
ref|XP_002263115.1|  PREDICTED: probable WRKY transcription facto...    459   7e-150   Vitis vinifera
emb|CAN70362.1|  hypothetical protein VITISV_002247                     459   9e-150   Vitis vinifera
ref|XP_006348143.1|  PREDICTED: WRKY transcription factor 6-like ...    458   2e-149   
gb|AGV75939.1|  WRKY transcription factor 31                            451   1e-146   
gb|AIE43884.1|  WRKY transcription factor 76                            449   7e-146   
gb|AIY62467.1|  WRKY31                                                  448   3e-145   
ref|XP_010252466.1|  PREDICTED: probable WRKY transcription facto...    449   3e-145   
ref|XP_002518444.1|  WRKY transcription factor, putative                441   2e-142   Ricinus communis
ref|XP_009587051.1|  PREDICTED: probable WRKY transcription facto...    438   3e-142   
ref|XP_010244474.1|  PREDICTED: probable WRKY transcription facto...    440   1e-141   
emb|CBI23209.3|  unnamed protein product                                432   6e-140   
gb|AGQ04220.1|  WRKY transcription factor 31                            433   5e-139   
gb|KDP20717.1|  hypothetical protein JCGZ_21188                         431   3e-138   
ref|XP_004293312.1|  PREDICTED: WRKY transcription factor 6-like        425   3e-136   
ref|XP_011046963.1|  PREDICTED: probable WRKY transcription facto...    423   5e-135   
gb|AIE43908.1|  WRKY transcription factor 90                            417   4e-134   
ref|XP_010916103.1|  PREDICTED: probable WRKY transcription facto...    417   7e-134   
gb|AIE43886.1|  WRKY transcription factor 87                            415   1e-132   
ref|XP_008784385.1|  PREDICTED: probable WRKY transcription facto...    414   4e-132   
ref|XP_002305579.2|  WRKY transcription factor 6 family protein         412   4e-131   Populus trichocarpa [western balsam poplar]
ref|XP_007216988.1|  hypothetical protein PRUPE_ppa002619mg             413   2e-130   
gb|ACV92030.1|  WRKY transcription factor 28                            411   2e-130   (Populus tomentosa x Populus bolleana) x Populus tomentosa
ref|XP_010099182.1|  WRKY transcription factor 6                        412   2e-130   
ref|XP_003534609.1|  PREDICTED: probable WRKY transcription facto...    409   2e-130   
ref|XP_006449767.1|  hypothetical protein CICLE_v10014642mg             410   4e-130   
gb|AGX26048.1|  WRKY transcription factor                               406   2e-129   
ref|XP_006467403.1|  PREDICTED: probable WRKY transcription facto...    408   4e-129   
ref|XP_008440027.1|  PREDICTED: probable WRKY transcription facto...    407   1e-128   
gb|KDO78304.1|  hypothetical protein CISIN_1g007099mg                   407   1e-128   
ref|XP_003546160.1|  PREDICTED: probable WRKY transcription facto...    402   1e-127   
ref|XP_007049086.1|  WRKY family transcription factor                   404   2e-127   
ref|XP_002269696.2|  PREDICTED: probable WRKY transcription facto...    401   8e-127   Vitis vinifera
ref|XP_009347144.1|  PREDICTED: probable WRKY transcription facto...    397   2e-126   
ref|XP_008342028.1|  PREDICTED: probable WRKY transcription facto...    400   7e-126   
ref|XP_008364089.1|  PREDICTED: probable WRKY transcription facto...    399   9e-126   
ref|XP_008229974.1|  PREDICTED: probable WRKY transcription facto...    400   1e-125   
emb|CAN65218.1|  hypothetical protein VITISV_024690                     399   2e-125   Vitis vinifera
gb|KHN40870.1|  WRKY transcription factor 6                             395   2e-125   
ref|XP_006364165.1|  PREDICTED: WRKY transcription factor 6-like        397   3e-125   
ref|XP_008779787.1|  PREDICTED: probable WRKY transcription facto...    396   8e-125   
ref|XP_004289178.1|  PREDICTED: WRKY transcription factor 6-like        395   8e-125   
ref|XP_007147706.1|  hypothetical protein PHAVU_006G147800g             394   5e-124   
ref|XP_004134775.1|  PREDICTED: probable WRKY transcription facto...    394   8e-124   
gb|AGG23543.1|  WRKY transcription factor 42                            391   3e-123   
ref|XP_009358665.1|  PREDICTED: probable WRKY transcription facto...    392   3e-123   
ref|XP_010926194.1|  PREDICTED: probable WRKY transcription facto...    390   1e-122   
ref|XP_010035553.1|  PREDICTED: probable WRKY transcription facto...    390   5e-122   
gb|AGV75956.1|  WRKY transcription factor 58                            387   5e-122   
ref|XP_004231617.1|  PREDICTED: WRKY transcription factor 6             384   3e-121   
gb|KDO54715.1|  hypothetical protein CISIN_1g007546mg                   386   8e-121   
ref|XP_006447589.1|  hypothetical protein CICLE_v10014665mg             385   1e-120   
gb|KHN33008.1|  WRKY transcription factor 6                             384   1e-120   
ref|XP_009357474.1|  PREDICTED: probable WRKY transcription facto...    383   3e-120   
ref|XP_011047238.1|  PREDICTED: probable WRKY transcription facto...    385   4e-120   
gb|AGV75949.1|  WRKY transcription factor 45                            377   9e-120   
ref|XP_004243486.1|  PREDICTED: probable WRKY transcription facto...    384   1e-119   
gb|KHN36523.1|  WRKY transcription factor 6                             382   1e-119   
ref|XP_010926185.1|  PREDICTED: probable WRKY transcription facto...    382   2e-119   
ref|XP_008779832.1|  PREDICTED: probable WRKY transcription facto...    380   2e-119   
gb|AIE43879.1|  WRKY transcription factor 4                             380   4e-119   
ref|XP_002321134.2|  hypothetical protein POPTR_0014s15320g             382   6e-119   Populus trichocarpa [western balsam poplar]
ref|XP_003541953.1|  PREDICTED: probable WRKY transcription facto...    381   1e-118   
gb|KHN23479.1|  WRKY transcription factor 6                             380   1e-118   
ref|XP_007149982.1|  hypothetical protein PHAVU_005G116000g             380   2e-118   
ref|XP_009804478.1|  PREDICTED: probable WRKY transcription facto...    380   2e-118   
ref|XP_011047241.1|  PREDICTED: probable WRKY transcription facto...    380   3e-118   
ref|XP_011047237.1|  PREDICTED: probable WRKY transcription facto...    380   3e-118   
ref|XP_011047240.1|  PREDICTED: probable WRKY transcription facto...    379   4e-118   
ref|XP_011008022.1|  PREDICTED: probable WRKY transcription facto...    377   1e-117   
ref|XP_004486177.1|  PREDICTED: probable WRKY transcription facto...    377   1e-117   
ref|XP_009614876.1|  PREDICTED: probable WRKY transcription facto...    377   2e-117   
gb|ABS18425.1|  WRKY23                                                  373   4e-117   Glycine max [soybeans]
ref|XP_007132527.1|  hypothetical protein PHAVU_011G101900g             376   4e-117   
ref|XP_011008021.1|  PREDICTED: probable WRKY transcription facto...    375   6e-117   
ref|XP_008224752.1|  PREDICTED: probable WRKY transcription facto...    375   7e-117   
gb|AHD24521.1|  WRKY6                                                   377   7e-117   
ref|XP_010926195.1|  PREDICTED: probable WRKY transcription facto...    374   8e-117   
ref|XP_011008019.1|  PREDICTED: probable WRKY transcription facto...    375   9e-117   
gb|KDO78305.1|  hypothetical protein CISIN_1g007099mg                   369   2e-116   
ref|XP_006389578.1|  WRKY transcription factor 42 family protein        374   2e-116   
ref|XP_008797553.1|  PREDICTED: probable WRKY transcription facto...    373   3e-116   
emb|CDP10754.1|  unnamed protein product                                374   4e-116   
gb|ACD40316.1|  WRKY transcription factor WRKY100630                    372   5e-116   Medicago truncatula
gb|AGQ04221.1|  WRKY transcription factor 32                            375   5e-116   
ref|XP_011033773.1|  PREDICTED: probable WRKY transcription facto...    367   1e-115   
ref|XP_011024798.1|  PREDICTED: probable WRKY transcription facto...    371   3e-115   
ref|XP_002524838.1|  WRKY transcription factor, putative                372   4e-115   Ricinus communis
ref|XP_010686807.1|  PREDICTED: probable WRKY transcription facto...    372   8e-115   
ref|XP_010057908.1|  PREDICTED: probable WRKY transcription facto...    371   2e-114   
ref|XP_010686806.1|  PREDICTED: probable WRKY transcription facto...    371   2e-114   
ref|XP_011024799.1|  PREDICTED: probable WRKY transcription facto...    369   2e-114   
ref|XP_006350473.1|  PREDICTED: WRKY transcription factor 6-like        364   6e-114   
ref|XP_004144595.1|  PREDICTED: probable WRKY transcription facto...    363   8e-114   
ref|XP_011100410.1|  PREDICTED: WRKY transcription factor 6-like        364   1e-112   
ref|XP_010057907.1|  PREDICTED: probable WRKY transcription facto...    366   1e-112   
gb|KCW75259.1|  hypothetical protein EUGRSUZ_E04011                     364   1e-112   
gb|AGV75965.1|  WRKY transcription factor 80                            358   5e-112   
gb|KGN43509.1|  hypothetical protein Csa_7G043020                       360   6e-112   
ref|NP_001288955.1|  WRKY transcription factor 6                        361   7e-112   
ref|XP_009421491.1|  PREDICTED: probable WRKY transcription facto...    360   1e-111   
emb|CDY12937.1|  BnaA09g13370D                                          359   3e-111   
ref|XP_011006460.1|  PREDICTED: probable WRKY transcription facto...    361   4e-111   
ref|XP_002886480.1|  WRKY DNA-binding protein 6                         357   2e-110   
gb|ACI14403.1|  WRKY6-1 transcription factor                            357   2e-110   Brassica napus [oilseed rape]
ref|NP_564792.1|  WRKY transcription factor 6                           357   2e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302067.1|  hypothetical protein CARUB_v10020051mg             357   3e-110   
emb|CDY19535.1|  BnaC09g13680D                                          356   5e-110   
gb|KFK40614.1|  hypothetical protein AALP_AA2G019000                    356   8e-110   
gb|KHN03496.1|  WRKY transcription factor 6                             353   1e-109   
gb|KHN35721.1|  WRKY transcription factor 6                             353   2e-109   
ref|XP_003549709.1|  PREDICTED: WRKY transcription factor 6-like ...    353   2e-109   
ref|XP_003528693.2|  PREDICTED: WRKY transcription factor 6             353   2e-109   
gb|AGA37233.1|  WRKY transcription factor 6.1                           354   2e-109   
ref|XP_009381020.1|  PREDICTED: probable WRKY transcription facto...    353   1e-108   
ref|XP_009389998.1|  PREDICTED: probable WRKY transcription facto...    352   2e-108   
ref|XP_010533798.1|  PREDICTED: LOW QUALITY PROTEIN: WRKY transcr...    351   3e-108   
ref|XP_008455449.1|  PREDICTED: probable WRKY transcription facto...    347   9e-108   
ref|XP_010430271.1|  PREDICTED: WRKY transcription factor 6-like        350   1e-107   
gb|AHC54606.1|  WRKY1                                                   347   3e-107   
ref|XP_010473445.1|  PREDICTED: WRKY transcription factor 6             348   5e-107   
ref|XP_010418216.1|  PREDICTED: WRKY transcription factor 6-like        348   5e-107   
ref|XP_006391908.1|  hypothetical protein EUTSA_v10023390mg             348   9e-107   
ref|XP_002302873.1|  hypothetical protein POPTR_0002s21330g             349   1e-106   Populus trichocarpa [western balsam poplar]
ref|XP_004171898.1|  PREDICTED: probable WRKY transcription facto...    343   2e-106   
ref|XP_009388735.1|  PREDICTED: probable WRKY transcription facto...    346   4e-106   
gb|EEE54229.1|  hypothetical protein OsJ_01092                          345   2e-105   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003540834.1|  PREDICTED: probable WRKY transcription facto...    344   1e-104   
tpg|DAA05066.1|  TPA: WRKY transcription factor 1                       342   5e-104   
ref|XP_009390745.1|  PREDICTED: WRKY transcription factor 6-like        336   9e-103   
gb|EEC70308.1|  hypothetical protein OsI_01154                          338   1e-102   Oryza sativa Indica Group [Indian rice]
ref|XP_008800737.1|  PREDICTED: probable WRKY transcription facto...    335   1e-101   
gb|AAD38283.1|AC007789_9  putative WRKY DNA binding protein             332   1e-101   Oryza sativa Japonica Group [Japonica rice]
gb|AAT84159.1|  transcription factor OsWRKY99                           335   1e-101   Oryza sativa Indica Group [Indian rice]
ref|XP_003566323.1|  PREDICTED: probable WRKY transcription facto...    335   1e-101   
ref|NP_001042577.1|  Os01g0246700                                       335   1e-101   Oryza sativa Japonica Group [Japonica rice]
gb|KDO78306.1|  hypothetical protein CISIN_1g007099mg                   328   3e-101   
emb|CDM82460.1|  unnamed protein product                                334   3e-101   
ref|XP_003526336.1|  PREDICTED: probable WRKY transcription facto...    334   8e-101   
ref|XP_009404403.1|  PREDICTED: probable WRKY transcription facto...    332   9e-101   
gb|AFS64077.1|  WRKY transcription factor 12                            331   9e-101   
ref|XP_011079008.1|  PREDICTED: WRKY transcription factor 6-like ...    330   1e-100   
gb|KHN41239.1|  WRKY transcription factor 6                             334   1e-100   
dbj|BAJ96003.1|  predicted protein                                      332   1e-100   
ref|XP_008226855.1|  PREDICTED: probable WRKY transcription facto...    331   1e-100   
ref|XP_009616884.1|  PREDICTED: probable WRKY transcription facto...    330   5e-100   
ref|XP_006287494.1|  hypothetical protein CARUB_v10000703mg             328   1e-99    
ref|XP_010089474.1|  WRKY transcription factor 6                        329   3e-99    
gb|KHN21215.1|  WRKY transcription factor 6                             329   5e-99    
ref|XP_011079007.1|  PREDICTED: WRKY transcription factor 6-like ...    325   6e-99    
ref|XP_008226947.1|  PREDICTED: probable WRKY transcription facto...    327   7e-99    
emb|CDX82900.1|  BnaC01g13500D                                          325   1e-98    
gb|ABS18435.1|  WRKY36                                                  316   2e-97    Glycine max [soybeans]
ref|XP_010644477.1|  PREDICTED: probable WRKY transcription facto...    323   2e-97    
ref|XP_007212993.1|  hypothetical protein PRUPE_ppa022758mg             322   2e-97    
gb|AGA37242.1|  WRKY transcription factor 31.1                          322   4e-97    
gb|EYU34028.1|  hypothetical protein MIMGU_mgv1a004322mg                320   1e-96    
ref|XP_009135540.1|  PREDICTED: probable WRKY transcription facto...    320   1e-96    
ref|XP_010529453.1|  PREDICTED: probable WRKY transcription facto...    322   2e-96    
gb|EYU33884.1|  hypothetical protein MIMGU_mgv1a008427mg                314   2e-96    
ref|XP_010644476.1|  PREDICTED: probable WRKY transcription facto...    320   4e-96    
ref|XP_009403740.1|  PREDICTED: WRKY transcription factor 6-like        317   1e-95    
emb|CAN78720.1|  hypothetical protein VITISV_035804                     318   2e-95    Vitis vinifera
ref|XP_007020766.1|  WRKY transcription factor-like protein             318   4e-95    
ref|XP_010529450.1|  PREDICTED: probable WRKY transcription facto...    318   5e-95    
emb|CBI26664.3|  unnamed protein product                                315   5e-95    
ref|NP_192354.1|  putative WRKY transcription factor 42                 315   9e-95    Arabidopsis thaliana [mouse-ear cress]
gb|AFH01342.1|  WRKY4 transcription factor                              305   1e-94    
ref|XP_010455724.1|  PREDICTED: probable WRKY transcription facto...    314   2e-94    
ref|XP_010496182.1|  PREDICTED: probable WRKY transcription facto...    314   3e-94    
gb|ABK28621.1|  unknown                                                 313   4e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004506257.1|  PREDICTED: probable WRKY transcription facto...    312   8e-94    
ref|XP_009361023.1|  PREDICTED: probable WRKY transcription facto...    313   1e-93    
gb|KFK29599.1|  hypothetical protein AALP_AA7G155100                    313   1e-93    
ref|XP_010432828.1|  PREDICTED: probable WRKY transcription facto...    312   1e-93    
ref|XP_008385959.1|  PREDICTED: probable WRKY transcription facto...    310   1e-92    
gb|ABN08518.1|  DNA-binding WRKY                                        307   2e-92    Medicago truncatula
ref|XP_003596950.1|  WRKY transcription factor                          310   5e-92    
ref|XP_006413694.1|  hypothetical protein EUTSA_v10026864mg             308   5e-92    
gb|KFK30968.1|  hypothetical protein AALP_AA6G051000                    307   6e-92    
ref|NP_567644.1|  WRKY DNA-binding protein 31                           307   1e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010538731.1|  PREDICTED: probable WRKY transcription facto...    306   2e-91    
ref|XP_006283491.1|  hypothetical protein CARUB_v10004543mg             306   4e-91    
ref|XP_009114575.1|  PREDICTED: LOW QUALITY PROTEIN: probable WRK...    305   5e-91    
ref|XP_006645706.1|  PREDICTED: probable WRKY transcription facto...    303   2e-90    
ref|XP_010924340.1|  PREDICTED: probable WRKY transcription facto...    304   5e-90    
ref|XP_002867796.1|  WRKY DNA-binding protein 31                        302   1e-89    
gb|AGV75954.1|  WRKY transcription factor 54                            300   3e-89    
gb|EPS66178.1|  hypothetical protein M569_08600                         295   3e-89    
gb|AGV75928.1|  WRKY transcription factor 1                             300   4e-89    
gb|AEP04147.1|  WRKY6 transcription factor                              291   4e-89    
ref|XP_010448942.1|  PREDICTED: probable WRKY transcription facto...    300   7e-89    
ref|XP_010439371.1|  PREDICTED: probable WRKY transcription facto...    300   1e-88    
gb|AIE43881.1|  WRKY transcription factor 16                            298   2e-88    
gb|EMS55197.1|  WRKY transcription factor 6                             301   2e-88    
ref|XP_002872692.1|  WRKY DNA-binding protein 42                        298   2e-88    
ref|XP_006396694.1|  hypothetical protein EUTSA_v10028586mg             297   5e-88    
ref|XP_010434087.1|  PREDICTED: probable WRKY transcription facto...    297   1e-87    
ref|XP_010096871.1|  WRKY transcription factor 6                        297   4e-87    
ref|XP_010553450.1|  PREDICTED: WRKY transcription factor 6-like        294   9e-87    
emb|CDY21301.1|  BnaC03g29850D                                          293   1e-86    
ref|XP_008364680.1|  PREDICTED: probable WRKY transcription facto...    289   3e-86    
emb|CDX90863.1|  BnaA03g25430D                                          290   1e-85    
gb|ACQ76807.1|  WRKY transcription factor 42                            290   3e-85    Brassica napus [oilseed rape]
gb|ACI14401.1|  WRKY42-1 transcription factor                           290   4e-85    Brassica napus [oilseed rape]
ref|XP_007213947.1|  hypothetical protein PRUPE_ppa003574mg             291   4e-85    
ref|XP_006847281.1|  hypothetical protein AMTR_s00015p00181570          289   5e-85    
ref|NP_001288972.1|  probable WRKY transcription factor 42              288   1e-84    
ref|XP_009379659.1|  PREDICTED: probable WRKY transcription facto...    284   3e-84    
ref|XP_004507670.1|  PREDICTED: probable WRKY transcription facto...    285   4e-84    
gb|AGA37244.1|  WRKY transcription factor 42.1                          286   4e-84    
ref|XP_009403538.1|  PREDICTED: probable WRKY transcription facto...    285   9e-84    
ref|XP_003610463.1|  Transcription factor WRKY                          285   1e-83    
emb|CDY24892.1|  BnaA03g59960D                                          281   1e-81    
gb|ABS18433.1|  WRKY34                                                  271   2e-81    Glycine max [soybeans]
ref|XP_008673468.1|  PREDICTED: LOW QUALITY PROTEIN: WRKY transcr...    280   2e-81    
ref|XP_009394235.1|  PREDICTED: probable WRKY transcription facto...    275   1e-80    
ref|XP_007051308.1|  WRKY family transcription factor, putative         277   2e-80    
emb|CBI28821.3|  unnamed protein product                                276   3e-80    
emb|CDX94553.1|  BnaC09g22830D                                          275   6e-80    
ref|XP_002457035.1|  hypothetical protein SORBIDRAFT_03g000240          276   2e-79    Sorghum bicolor [broomcorn]
ref|XP_002529927.1|  WRKY transcription factor, putative                274   6e-79    Ricinus communis
ref|XP_007142321.1|  hypothetical protein PHAVU_008G270500g             268   1e-77    
emb|CDY16669.1|  BnaA09g20470D                                          268   2e-77    
gb|KHG18638.1|  putative WRKY transcription factor 42 -like protein     270   2e-77    
tpg|DAA52674.1|  TPA: putative WRKY DNA-binding domain superfamil...    261   1e-75    
ref|XP_004294408.1|  PREDICTED: WRKY transcription factor 6-like        263   6e-75    
gb|AIY62472.1|  WRKY54                                                  256   8e-75    
tpg|DAA52672.1|  TPA: putative WRKY DNA-binding domain superfamil...    253   2e-74    
gb|ABC87922.1|  WRKY1                                                   249   2e-74    Coffea racemosa
gb|ABC87932.1|  WRKY1                                                   249   3e-74    Coffea congensis
gb|AES92661.2|  WRKY1b transcription factor                             254   9e-74    
gb|KEH33882.1|  WRKY1b transcription factor                             258   9e-74    
ref|XP_006840372.1|  hypothetical protein AMTR_s00045p00128140          259   1e-73    
gb|ABC87936.1|  WRKY1                                                   247   2e-73    Coffea canephora [robusta coffee]
ref|XP_004963595.1|  PREDICTED: probable WRKY transcription facto...    259   3e-73    
gb|ABC87928.1|  WRKY1                                                   246   5e-73    Coffea humilis
emb|CDY08634.1|  BnaC04g19430D                                          256   5e-73    
ref|XP_004487422.1|  PREDICTED: probable WRKY transcription facto...    251   1e-72    
ref|XP_007142322.1|  hypothetical protein PHAVU_008G270500g             254   1e-72    
tpg|DAA05108.1|  TPA: WRKY transcription factor 43                      258   2e-72    
gb|EAY99060.1|  hypothetical protein OsI_21017                          258   3e-72    Oryza sativa Indica Group [Indian rice]
gb|AAU10664.1|  putative WRKY transcription factor                      257   5e-72    Oryza sativa Japonica Group [Japonica rice]
gb|ABK96541.1|  unknown                                                 251   4e-71    Populus trichocarpa x Populus deltoides
ref|XP_006444621.1|  hypothetical protein CICLE_v10019820mg             249   2e-70    
ref|XP_006492427.1|  PREDICTED: probable WRKY transcription facto...    249   2e-70    
ref|XP_006586574.1|  PREDICTED: WRKY transcription factor 6-like        249   2e-70    
ref|XP_007146514.1|  hypothetical protein PHAVU_006G047300g             247   3e-70    
gb|KHM99530.1|  WRKY transcription factor 6                             248   3e-70    
ref|XP_002320254.2|  hypothetical protein POPTR_0014s10750g             251   3e-70    Populus trichocarpa [western balsam poplar]
ref|XP_002515176.1|  WRKY transcription factor, putative                248   5e-70    Ricinus communis
gb|EMT28664.1|  WRKY transcription factor 6                             248   7e-70    
ref|XP_011040119.1|  PREDICTED: probable WRKY transcription facto...    248   9e-70    
ref|XP_010231012.1|  PREDICTED: probable WRKY transcription facto...    246   5e-69    
ref|XP_006492428.1|  PREDICTED: probable WRKY transcription facto...    245   7e-69    
gb|KCW66974.1|  hypothetical protein EUGRSUZ_F00740                     245   1e-68    
ref|XP_010060309.1|  PREDICTED: probable WRKY transcription facto...    245   2e-68    
gb|AIE43880.1|  WRKY transcription factor 8                             241   3e-68    
gb|AFW79208.1|  putative WRKY DNA-binding domain superfamily protein    243   2e-67    
tpg|DAA52673.1|  TPA: putative WRKY DNA-binding domain superfamil...    239   3e-67    
ref|XP_011095415.1|  PREDICTED: probable WRKY transcription facto...    240   4e-67    
ref|XP_010279671.1|  PREDICTED: probable WRKY transcription facto...    240   1e-66    
gb|AGV75974.1|  WRKY transcription factor 103                           238   1e-66    
pir||T49114  hypothetical protein AT4g22070 - Arabidopsis thaliana      238   2e-66 
gb|AIE43878.1|  WRKY transcription factor 6                             234   3e-66    
ref|XP_006602186.1|  PREDICTED: WRKY transcription factor 6-like        238   3e-66    
gb|KHN12526.1|  WRKY transcription factor 6                             238   3e-66    
gb|AGQ04218.1|  WRKY transcription factor 30.1                          238   4e-66    
ref|XP_010909377.1|  PREDICTED: probable WRKY transcription facto...    238   4e-66    
ref|XP_002281194.1|  PREDICTED: probable WRKY transcription facto...    237   9e-66    
ref|XP_002455489.1|  hypothetical protein SORBIDRAFT_03g011800          238   1e-65    
ref|XP_006452416.1|  hypothetical protein CICLE_v10007917mg             237   2e-65    
ref|XP_006475034.1|  PREDICTED: probable WRKY transcription facto...    237   4e-65    
emb|CBI37053.3|  unnamed protein product                                234   4e-65    
gb|KDO62075.1|  hypothetical protein CISIN_1g008964mg                   236   5e-65    
gb|AEO31517.2|  WRKY transcription factor 47-2                          234   1e-64    
gb|AIE43882.1|  WRKY transcription factor 51                            234   1e-64    
ref|XP_002440265.1|  hypothetical protein SORBIDRAFT_09g028750          236   2e-64    
gb|AGQ04222.1|  WRKY transcription factor 33                            233   2e-64    
gb|KDP39160.1|  hypothetical protein JCGZ_00917                         233   2e-64    
ref|XP_008650022.1|  PREDICTED: probable WRKY transcription facto...    234   3e-64    
ref|XP_002302808.1|  WRKY transcription factor 47 family protein        233   3e-64    
gb|AFW81162.1|  putative WRKY DNA-binding domain superfamily protein    234   7e-64    
ref|XP_004155675.1|  PREDICTED: WRKY transcription factor 6-like        228   1e-63    
gb|KGN49089.1|  hypothetical protein Csa_6G513530                       228   1e-63    
ref|XP_010045571.1|  PREDICTED: probable WRKY transcription facto...    231   2e-63    
ref|XP_004513896.1|  PREDICTED: probable WRKY transcription facto...    228   5e-63    
ref|XP_011025271.1|  PREDICTED: probable WRKY transcription facto...    229   8e-63    
gb|KDO78307.1|  hypothetical protein CISIN_1g007099mg                   226   8e-63    
ref|XP_006604764.1|  PREDICTED: probable WRKY transcription facto...    229   1e-62    
gb|AAB60774.1|  ESTs gb|U75592,gb|T13956,gb|T43869 come from from...    228   2e-62    
ref|XP_011025270.1|  PREDICTED: probable WRKY transcription facto...    226   9e-62    
ref|XP_006576123.1|  PREDICTED: probable WRKY transcription facto...    224   1e-61    
gb|KHN38256.1|  WRKY transcription factor 6                             223   2e-61    
ref|XP_008656042.1|  PREDICTED: probable WRKY transcription facto...    226   7e-61    
ref|XP_009413281.1|  PREDICTED: probable WRKY transcription facto...    223   1e-60    
gb|AIE43885.1|  WRKY transcription factor 79                            223   1e-60    
ref|XP_008227774.1|  PREDICTED: probable WRKY transcription facto...    224   2e-60    
ref|XP_009413279.1|  PREDICTED: probable WRKY transcription facto...    220   1e-59    
gb|AAK28312.1|AF224702_1  WRKY DNA-binding protein 6                    211   3e-59    
ref|XP_007221569.1|  hypothetical protein PRUPE_ppa018075mg             215   2e-57    
ref|XP_008655458.1|  PREDICTED: probable WRKY transcription facto...    211   4e-56    
ref|XP_006604765.1|  PREDICTED: probable WRKY transcription facto...    209   6e-56    
ref|XP_010546656.1|  PREDICTED: WRKY transcription factor 6-like        206   2e-55    
emb|CAN83141.1|  hypothetical protein VITISV_035325                     213   5e-55    
gb|AES88086.2|  WRKY1b transcription factor                             208   6e-55    
ref|XP_009388114.1|  PREDICTED: probable WRKY transcription facto...    206   8e-55    
gb|KEH29704.1|  WRKY1b transcription factor                             207   1e-54    
gb|KEH29706.1|  WRKY1b transcription factor                             207   2e-54    
ref|XP_007163249.1|  hypothetical protein PHAVU_001G218500g             206   2e-54    
ref|XP_009388109.1|  PREDICTED: probable WRKY transcription facto...    202   2e-53    
ref|XP_004494476.1|  PREDICTED: probable WRKY transcription facto...    197   1e-52    
gb|EYU27356.1|  hypothetical protein MIMGU_mgv1a007828mg                195   1e-51    
ref|XP_010233067.1|  PREDICTED: probable WRKY transcription facto...    197   5e-51    
ref|XP_008673952.1|  PREDICTED: probable WRKY transcription facto...    195   6e-51    
gb|EEE64720.1|  hypothetical protein OsJ_19576                          196   4e-50    
ref|XP_008673951.1|  PREDICTED: probable WRKY transcription facto...    194   5e-50    
gb|ACD69419.1|  WRKY29                                                  186   8e-50    
ref|XP_003605889.1|  WRKY transcription factor                          192   4e-49    
ref|XP_010523183.1|  PREDICTED: probable WRKY transcription facto...    184   1e-48    
ref|XP_006655596.1|  PREDICTED: probable WRKY transcription facto...    186   3e-48    
ref|XP_004967624.1|  PREDICTED: probable WRKY transcription facto...    188   5e-48    
ref|XP_004494477.1|  PREDICTED: probable WRKY transcription facto...    184   6e-48    
emb|CDX97845.1|  BnaC04g40940D                                          179   8e-48    
ref|XP_010543063.1|  PREDICTED: probable WRKY transcription facto...    184   1e-47    
ref|XP_006589097.1|  PREDICTED: probable WRKY transcription facto...    185   1e-47    
ref|XP_006577185.1|  PREDICTED: probable WRKY transcription facto...    186   2e-47    
ref|XP_003521621.1|  PREDICTED: probable WRKY transcription facto...    186   2e-47    
gb|KEH24448.1|  WRKY1b transcription factor                             181   6e-47    
ref|XP_003626073.1|  WRKY transcription factor                          182   7e-47    
ref|XP_010024882.1|  PREDICTED: probable WRKY transcription facto...    181   6e-46    
gb|KHN14233.1|  Putative WRKY transcription factor 42                   179   1e-45    
ref|XP_003519729.1|  PREDICTED: probable WRKY transcription facto...    179   2e-45    
gb|AAW83820.1|  WRKY6-like protein                                      167   2e-45    
ref|XP_003535298.2|  PREDICTED: probable WRKY transcription facto...    179   2e-45    
ref|XP_004288357.1|  PREDICTED: probable WRKY transcription facto...    177   3e-45    
gb|AAT99426.1|  WRKY6-1                                                 166   9e-45    
emb|CDY07121.1|  BnaCnng01360D                                          177   1e-44    
gb|EAY96479.1|  hypothetical protein OsI_18378                          177   1e-44    
ref|XP_003550582.1|  PREDICTED: WRKY transcription factor 6-like ...    173   4e-44    
gb|EPS69684.1|  hypothetical protein M569_05084                         165   8e-44    
gb|AAS98424.1|  WRKY transcription factor 5                             174   9e-44    
gb|AEO31484.1|  WRKY transcription factor 6-3                           162   1e-43    
ref|XP_006287597.1|  hypothetical protein CARUB_v10000809mg             173   2e-43    
tpg|DAA05070.1|  TPA: WRKY transcription factor 5                       173   2e-43    
ref|XP_006600417.1|  PREDICTED: WRKY transcription factor 6-like ...    171   3e-43    
ref|XP_006431098.1|  hypothetical protein CICLE_v10011501mg             172   6e-43    
ref|NP_192081.1|  putative WRKY transcription factor 47                 172   7e-43    
ref|XP_002874963.1|  WRKY DNA-binding protein 47                        171   9e-43    
ref|XP_009385182.1|  PREDICTED: probable WRKY transcription facto...    170   1e-42    
ref|XP_006842141.1|  hypothetical protein AMTR_s00078p00123870          172   2e-42    
ref|XP_006482673.1|  PREDICTED: probable WRKY transcription facto...    171   4e-42    
gb|KFK30745.1|  hypothetical protein AALP_AA6G021500                    169   5e-42    
ref|XP_004302348.1|  PREDICTED: probable WRKY transcription facto...    167   3e-41    
gb|KHN04669.1|  Putative WRKY transcription factor 42                   166   4e-41    
ref|XP_003546540.1|  PREDICTED: probable WRKY transcription facto...    166   5e-41    
ref|XP_010666199.1|  PREDICTED: probable WRKY transcription facto...    166   1e-40    
ref|XP_010666198.1|  PREDICTED: probable WRKY transcription facto...    165   2e-40    
ref|XP_007032468.1|  WRKY DNA-binding protein 72, putative              166   2e-40    
ref|XP_010422693.1|  PREDICTED: probable WRKY transcription facto...    164   2e-40    
ref|XP_010428690.1|  PREDICTED: probable WRKY transcription facto...    164   3e-40    
ref|XP_010456128.1|  PREDICTED: probable WRKY transcription facto...    164   4e-40    
ref|XP_010422692.1|  PREDICTED: probable WRKY transcription facto...    164   5e-40    
ref|XP_010422691.1|  PREDICTED: probable WRKY transcription facto...    164   5e-40    
dbj|BAA96574.1|  WRKY transcription factor 6 -like                      164   6e-40    
ref|XP_006396367.1|  hypothetical protein EUTSA_v10028616mg             162   8e-40    
ref|XP_004233924.1|  PREDICTED: probable WRKY transcription facto...    161   9e-40    
ref|XP_009408833.1|  PREDICTED: probable WRKY transcription facto...    162   2e-39    
ref|NP_001288912.1|  probable WRKY transcription factor 47              162   2e-39    
ref|XP_003610464.1|  Transcription factor WRKY                          157   2e-39    
ref|XP_003533819.1|  PREDICTED: probable WRKY transcription facto...    160   3e-39    
ref|XP_009408832.1|  PREDICTED: probable WRKY transcription facto...    161   7e-39    
ref|XP_011005079.1|  PREDICTED: probable WRKY transcription facto...    160   1e-38    
ref|XP_002323839.2|  WRKY transcription factor 72 family protein        160   1e-38    
emb|CDX81900.1|  BnaC08g37010D                                          159   3e-38    
ref|XP_008662933.1|  PREDICTED: probable WRKY transcription facto...    159   4e-38    
ref|XP_007138579.1|  hypothetical protein PHAVU_009G220700g             156   4e-38    
gb|ABK95681.1|  unknown                                                 150   4e-38    
gb|ACQ76811.1|  WRKY transcription factor 72                            158   5e-38    
ref|XP_009126032.1|  PREDICTED: probable WRKY transcription facto...    157   6e-38    
ref|XP_006654970.1|  PREDICTED: WRKY transcription factor 6-like        154   6e-38    
emb|CDP20785.1|  unnamed protein product                                157   9e-38    
ref|XP_010277690.1|  PREDICTED: probable WRKY transcription factor 9    157   1e-37    
emb|CDX70593.1|  BnaC03g06770D                                          157   1e-37    
ref|XP_004488183.1|  PREDICTED: probable WRKY transcription facto...    154   2e-37    
gb|AEO31479.2|  WRKY transcription factor 72-3                          156   3e-37    
emb|CDX85052.1|  BnaC05g20030D                                          156   3e-37    
ref|XP_006604965.1|  PREDICTED: probable WRKY transcription facto...    155   3e-37    
gb|KHN17790.1|  Putative WRKY transcription factor 42                   152   4e-37    
gb|KHN45016.1|  Putative WRKY transcription factor 42                   152   5e-37    
ref|XP_004488182.1|  PREDICTED: probable WRKY transcription facto...    153   5e-37    
ref|XP_009400527.1|  PREDICTED: probable WRKY transcription facto...    154   7e-37    
ref|XP_006593988.1|  PREDICTED: probable WRKY transcription facto...    152   8e-37    
gb|AGQ04219.1|  WRKY transcription factor 30.2                          150   9e-37    
ref|XP_009400525.1|  PREDICTED: probable WRKY transcription facto...    154   9e-37    
ref|XP_009400524.1|  PREDICTED: probable WRKY transcription facto...    154   9e-37    
gb|KHN45484.1|  Putative WRKY transcription factor 72                   154   1e-36    
ref|XP_009131440.1|  PREDICTED: probable WRKY transcription facto...    154   1e-36    
emb|CDY63770.1|  BnaCnng42630D                                          153   2e-36    
ref|XP_011098771.1|  PREDICTED: probable WRKY transcription facto...    152   3e-36    
ref|XP_010246360.1|  PREDICTED: probable WRKY transcription factor 9    152   3e-36    
gb|ACH99808.1|  WRKY72 transcription factor                             153   3e-36    
gb|EMT19032.1|  Putative WRKY transcription factor 42                   144   3e-36    
ref|XP_007145091.1|  hypothetical protein PHAVU_007G209000g             151   4e-36    
ref|NP_197017.1|  putative WRKY transcription factor 72                 153   4e-36    
ref|XP_004298443.1|  PREDICTED: probable WRKY transcription facto...    153   5e-36    
ref|XP_007217340.1|  hypothetical protein PRUPE_ppa020780mg             150   9e-36    
ref|XP_006357198.1|  PREDICTED: probable WRKY transcription facto...    150   9e-36    
gb|KHN39172.1|  Putative WRKY transcription factor 9                    151   1e-35    
ref|XP_009131441.1|  PREDICTED: probable WRKY transcription facto...    150   1e-35    
ref|XP_008230737.1|  PREDICTED: probable WRKY transcription facto...    150   1e-35    
gb|KFK25750.1|  hypothetical protein AALP_AA8G154700                    151   1e-35    
ref|XP_010925379.1|  PREDICTED: probable WRKY transcription facto...    152   1e-35    
ref|XP_010663394.1|  PREDICTED: probable WRKY transcription facto...    151   2e-35    
gb|KHN01179.1|  Putative WRKY transcription factor 72                   150   2e-35    
ref|XP_006428226.1|  hypothetical protein CICLE_v10030455mg             148   2e-35    
ref|XP_002267867.3|  PREDICTED: probable WRKY transcription facto...    151   2e-35    
gb|AGA37250.1|  WRKY transcription factor 72.1                          150   2e-35    
emb|CDX78611.1|  BnaA03g05230D                                          150   2e-35    
ref|XP_004299392.1|  PREDICTED: probable WRKY transcription facto...    152   3e-35    
ref|XP_006846618.1|  hypothetical protein AMTR_s00156p00038330          148   3e-35    
ref|XP_008775965.1|  PREDICTED: probable WRKY transcription facto...    145   3e-35    
ref|XP_008221664.1|  PREDICTED: probable WRKY transcription facto...    151   3e-35    
ref|XP_008221663.1|  PREDICTED: probable WRKY transcription facto...    151   3e-35    
gb|AES65682.2|  WRKY family transcription factor                        148   4e-35    
ref|XP_009800949.1|  PREDICTED: probable WRKY transcription factor 9    149   4e-35    
ref|XP_010678574.1|  PREDICTED: probable WRKY transcription facto...    150   5e-35    
gb|EMT14404.1|  Putative WRKY transcription factor 72                   149   5e-35    
tpg|DAA05138.1|  TPA: WRKY transcription factor 73                      149   5e-35    
gb|AGQ04223.1|  WRKY transcription factor 34                            149   5e-35    
ref|XP_007154503.1|  hypothetical protein PHAVU_003G124000g             147   6e-35    
ref|XP_008239828.1|  PREDICTED: probable WRKY transcription facto...    151   6e-35    
ref|XP_009601191.1|  PREDICTED: probable WRKY transcription facto...    150   6e-35    
emb|CBI19998.3|  unnamed protein product                                148   8e-35    
ref|XP_010102869.1|  putative WRKY transcription factor 72              149   9e-35    
gb|KHN22930.1|  Putative WRKY transcription factor 9                    148   9e-35    
ref|XP_006656632.1|  PREDICTED: probable WRKY transcription facto...    150   1e-34    
dbj|BAJ99245.1|  predicted protein                                      147   1e-34    
ref|XP_009393667.1|  PREDICTED: probable WRKY transcription factor 9    146   1e-34    
ref|XP_007159029.1|  hypothetical protein PHAVU_002G202500g             147   1e-34    
ref|XP_010245091.1|  PREDICTED: probable WRKY transcription facto...    147   1e-34    
ref|XP_006476643.1|  PREDICTED: probable WRKY transcription facto...    149   1e-34    
ref|XP_010657556.1|  PREDICTED: probable WRKY transcription facto...    147   1e-34    
ref|XP_010245089.1|  PREDICTED: probable WRKY transcription facto...    147   1e-34    
gb|AFK43790.1|  unknown                                                 140   1e-34    
ref|XP_006400030.1|  hypothetical protein EUTSA_v10013146mg             148   2e-34    
ref|XP_007226796.1|  hypothetical protein PRUPE_ppa017919mg             148   2e-34    
ref|XP_003517772.2|  PREDICTED: probable WRKY transcription facto...    149   2e-34    
gb|AIY62483.1|  WRKY107                                                 149   2e-34    
ref|XP_006416557.1|  hypothetical protein EUTSA_v10007461mg             147   2e-34    
emb|CDO97515.1|  unnamed protein product                                148   2e-34    
ref|XP_010245088.1|  PREDICTED: probable WRKY transcription facto...    147   2e-34    
ref|XP_002511536.1|  WRKY transcription factor, putative                149   2e-34    
ref|XP_006439640.1|  hypothetical protein CICLE_v10019383mg             148   3e-34    
ref|NP_001288849.1|  probable WRKY transcription factor 72              147   3e-34    
gb|EEC79992.1|  hypothetical protein OsI_21640                          150   3e-34    
emb|CDX69549.1|  BnaA10g18980D                                          147   3e-34    
ref|XP_006580016.1|  PREDICTED: LOW QUALITY PROTEIN: probable WRK...    146   4e-34    
ref|XP_004964541.1|  PREDICTED: probable WRKY transcription facto...    147   4e-34    
ref|XP_010453641.1|  PREDICTED: probable WRKY transcription facto...    146   5e-34    
ref|XP_010096349.1|  putative WRKY transcription factor 72              147   6e-34    
ref|XP_009369335.1|  PREDICTED: probable WRKY transcription facto...    147   6e-34    
ref|XP_009800929.1|  PREDICTED: probable WRKY transcription facto...    147   7e-34    
ref|XP_009410091.1|  PREDICTED: probable WRKY transcription factor 9    145   7e-34    
ref|XP_009800925.1|  PREDICTED: probable WRKY transcription facto...    147   7e-34    
ref|XP_010652374.1|  PREDICTED: probable WRKY transcription facto...    147   7e-34    
ref|XP_010934629.1|  PREDICTED: probable WRKY transcription facto...    145   7e-34    
emb|CDY21693.1|  BnaA09g44440D                                          145   8e-34    
gb|AIY62477.1|  WRKY75                                                  144   9e-34    
ref|XP_002871650.1|  WRKY DNA-binding protein 72                        145   1e-33    
gb|EPS67750.1|  hypothetical protein M569_07024                         144   1e-33    
gb|KCW63028.1|  hypothetical protein EUGRSUZ_G00619                     144   1e-33    
ref|XP_007041569.1|  WRKY DNA-binding protein 9, putative isoform 1     145   1e-33    
ref|XP_009369334.1|  PREDICTED: probable WRKY transcription facto...    147   1e-33    
emb|CDP02207.1|  unnamed protein product                                145   1e-33    
ref|XP_009600779.1|  PREDICTED: probable WRKY transcription facto...    144   1e-33    
ref|XP_008809713.1|  PREDICTED: probable WRKY transcription facto...    146   2e-33    
ref|XP_010498293.1|  PREDICTED: probable WRKY transcription facto...    145   2e-33    
ref|XP_006307358.1|  hypothetical protein CARUB_v10008977mg             144   2e-33    
ref|XP_009117582.1|  PREDICTED: probable WRKY transcription facto...    144   2e-33    
gb|KDO76066.1|  hypothetical protein CISIN_1g009794mg                   144   2e-33    
ref|XP_010420167.1|  PREDICTED: probable WRKY transcription facto...    144   2e-33    



>ref|XP_009776376.1| PREDICTED: probable WRKY transcription factor 31 isoform X2 [Nicotiana 
sylvestris]
Length=548

 Score =   535 bits (1378),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 364/553 (66%), Positives = 409/553 (74%), Gaps = 45/553 (8%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPINPAAEKR-GP  1851
             MDKGWGLTLE+   + GFF NKP FGFNLSPRLN I GG    GA      PA EKR G 
Sbjct  1     MDKGWGLTLESSSDKVGFFKNKPFFGFNLSPRLNNIKGGEMFSGAEF----PADEKRPGM  56

Query  1850  PNEVDFFSDKKA--DIVVKKEITLHGEPVTKADL--NTGLQLVIANsgsdkstvddsv-s  1686
              NEVDFFS+KK+  D+VVKKE +  G    + DL  +TGLQLV AN+G    +  D   S
Sbjct  57    VNEVDFFSEKKSIHDVVVKKENS-QGNNTMRTDLFVHTGLQLVTANTGISDQSTVDDGIS  115

Query  1685  sDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSR  1506
             S++EE+R KN+L+ LQVELE+MN ENQRL+GML+QV+ +Y+ALQ HL  LMQ Q Q  SR
Sbjct  116   SEVEEKRTKNELAQLQVELERMNTENQRLKGMLTQVTNSYSALQMHLVTLMQQQQQLISR  175

Query  1505  IGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTL  1326
               S  + EV + KSEEK  EK+   VPRQF+EL P    A     DE SQSH+TSEERT 
Sbjct  176   TESPHNHEVVEVKSEEKNQEKDGDIVPRQFMELGPSSAKADP--VDEPSQSHSTSEERTH  233

Query  1325  SAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskP-VDQAAEATMRKARVSV  1149
             S GSPRNN  E+SR K I  RE+SP+SESW PNK+PKL  S   V+Q  EATMRKARVSV
Sbjct  234   S-GSPRNN-MEMSRDKAI-GREESPESESWVPNKVPKLMNSSKPVEQTTEATMRKARVSV  290

Query  1148  RARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITT  969
             RARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITT
Sbjct  291   RARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITT  350

Query  968   YEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISA  789
             YEGTHNHPLPPAAMAMASTTSAAANMLLSG+MPSADG+MNTNFLAR ILPCSS++ATISA
Sbjct  351   YEGTHNHPLPPAAMAMASTTSAAANMLLSGSMPSADGLMNTNFLARTILPCSSNMATISA  410

Query  788   SAPFPTVTLDLTQTPNSLPNYQR--PPTQFQAPFTGAPQIPQ-----NYPQLPQVFGQGL  630
             SAPFPTVTLDLTQ PN++ NY +  P TQFQ P       P      + PQ+PQV GQ L
Sbjct  411   SAPFPTVTLDLTQNPNAMSNYHQRNPATQFQVPLPAGLNHPNFVGSMSAPQMPQVLGQAL  470

Query  629   YNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFT  450
             YNQS+FSGL VS  +I                      HP F+DTLSAATAAIT+DPNFT
Sbjct  471   YNQSRFSGLQVSQDNI---------------------HHPSFSDTLSAATAAITADPNFT  509

Query  449   AALAAAISSIMGG  411
             AALAAAISSI+GG
Sbjct  510   AALAAAISSIIGG  522



>emb|CDP04425.1| unnamed protein product [Coffea canephora]
Length=554

 Score =   533 bits (1374),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 385/553 (70%), Positives = 433/553 (78%), Gaps = 37/553 (7%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPINPAAEKRGPP  1848
             MDKGWG+T++NPD+  GFF NKPVFGFNLSPRLNP     +   +         EKR   
Sbjct  1     MDKGWGVTVDNPDK-IGFFGNKPVFGFNLSPRLNPSKDSHAAASSD-------GEKRVVV  52

Query  1847  NEVDFFSDKKA--DIVVKKEITLHGEPVTKADL---NTGLQLVIANsgsdkstvddsvss  1683
              EVDFFSDKK   DI++KKE   HGE   K ++   NTGLQLVIAN+GSD+STVDD VSS
Sbjct  53    GEVDFFSDKKKANDILIKKE-DCHGEDKMKTNMDVVNTGLQLVIANTGSDQSTVDDGVSS  111

Query  1682  DMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRI  1503
             D+E++RAK +L+ LQVELE+MNAEN+RLR MLSQVS NYTALQ HL  LM HQ QQ+++ 
Sbjct  112   DIEDKRAKLELAQLQVELERMNAENRRLREMLSQVSNNYTALQMHLMTLM-HQQQQNAKP  170

Query  1502  GSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLS  1323
              +TQD E+ +RKSEE KPE     VPRQFL+L P G A    + DE + S  +SEERTLS
Sbjct  171   QTTQDHEIGERKSEENKPENGGVVVPRQFLDLGPSGTA----EMDEPTNS--SSEERTLS  224

Query  1322  AGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnp-skPVDQA-AEATMRKARVSV  1149
              GSPRNN  ELSR+KG+  RE+SP+S+ WAPNK+ KLN  SK VD A AEATMRKARVSV
Sbjct  225   -GSPRNN-MELSRNKGV-GREESPESQGWAPNKVAKLNAPSKTVDHAQAEATMRKARVSV  281

Query  1148  RARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITT  969
             RARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT+LITT
Sbjct  282   RARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTVLITT  341

Query  968   YEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISA  789
             YEGTHNHPLPPAAMAMASTTSAAANMLLSG+M SADG+MN NFLAR ILPCSS++ATISA
Sbjct  342   YEGTHNHPLPPAAMAMASTTSAAANMLLSGSMSSADGLMNPNFLARTILPCSSNMATISA  401

Query  788   SAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNY-----PQLPQVFGQGLYN  624
             SAPFPTVTLDLTQTPN L   ++P T FQ PF G P  PQN+     PQ+ QVFGQ LYN
Sbjct  402   SAPFPTVTLDLTQTPNPLQFQRQPSTPFQLPF-GTP--PQNFPPVANPQMHQVFGQALYN  458

Query  623   QSKFSGLHVSHQDIaaaaaqaaqlaqqqq--hpapppqhpLFADTLSAATAAITSDPNFT  450
             QSKFSGL VS QDI AAAA AAQ+  Q Q          P FADTLSAATAAIT+DPNFT
Sbjct  459   QSKFSGLQVS-QDIEAAAAAAAQMQNQGQHPQVQQGQHQPSFADTLSAATAAITADPNFT  517

Query  449   AALAAAISSIMGG  411
             AALAAAISSI+GG
Sbjct  518   AALAAAISSIIGG  530



>ref|XP_009776375.1| PREDICTED: probable WRKY transcription factor 31 isoform X1 [Nicotiana 
sylvestris]
Length=549

 Score =   530 bits (1366),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 364/554 (66%), Positives = 409/554 (74%), Gaps = 46/554 (8%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPINPAAEKR-GP  1851
             MDKGWGLTLE+   + GFF NKP FGFNLSPRLN I GG    GA      PA EKR G 
Sbjct  1     MDKGWGLTLESSSDKVGFFKNKPFFGFNLSPRLNNIKGGEMFSGAEF----PADEKRPGM  56

Query  1850  PNEVDFFSDKKA--DIVVKKEITLHGEPVTKADL--NTGLQLVIANsgsdkstvddsv-s  1686
              NEVDFFS+KK+  D+VVKKE +  G    + DL  +TGLQLV AN+G    +  D   S
Sbjct  57    VNEVDFFSEKKSIHDVVVKKENS-QGNNTMRTDLFVHTGLQLVTANTGISDQSTVDDGIS  115

Query  1685  sDMEERRAKND-LSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSS  1509
             S++EE+R KN+ L+ LQVELE+MN ENQRL+GML+QV+ +Y+ALQ HL  LMQ Q Q  S
Sbjct  116   SEVEEKRTKNEQLAQLQVELERMNTENQRLKGMLTQVTNSYSALQMHLVTLMQQQQQLIS  175

Query  1508  RIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERT  1329
             R  S  + EV + KSEEK  EK+   VPRQF+EL P    A     DE SQSH+TSEERT
Sbjct  176   RTESPHNHEVVEVKSEEKNQEKDGDIVPRQFMELGPSSAKADP--VDEPSQSHSTSEERT  233

Query  1328  LSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskP-VDQAAEATMRKARVS  1152
              S GSPRNN  E+SR K I  RE+SP+SESW PNK+PKL  S   V+Q  EATMRKARVS
Sbjct  234   HS-GSPRNN-MEMSRDKAI-GREESPESESWVPNKVPKLMNSSKPVEQTTEATMRKARVS  290

Query  1151  VRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILIT  972
             VRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILIT
Sbjct  291   VRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILIT  350

Query  971   TYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATIS  792
             TYEGTHNHPLPPAAMAMASTTSAAANMLLSG+MPSADG+MNTNFLAR ILPCSS++ATIS
Sbjct  351   TYEGTHNHPLPPAAMAMASTTSAAANMLLSGSMPSADGLMNTNFLARTILPCSSNMATIS  410

Query  791   ASAPFPTVTLDLTQTPNSLPNYQR--PPTQFQAPFTGAPQIPQ-----NYPQLPQVFGQG  633
             ASAPFPTVTLDLTQ PN++ NY +  P TQFQ P       P      + PQ+PQV GQ 
Sbjct  411   ASAPFPTVTLDLTQNPNAMSNYHQRNPATQFQVPLPAGLNHPNFVGSMSAPQMPQVLGQA  470

Query  632   LYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNF  453
             LYNQS+FSGL VS  +I                      HP F+DTLSAATAAIT+DPNF
Sbjct  471   LYNQSRFSGLQVSQDNI---------------------HHPSFSDTLSAATAAITADPNF  509

Query  452   TAALAAAISSIMGG  411
             TAALAAAISSI+GG
Sbjct  510   TAALAAAISSIIGG  523



>gb|ABC86709.1| putative WRKY1a transcription factor [Coffea arabica]
Length=573

 Score =   529 bits (1363),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 389/565 (69%), Positives = 435/565 (77%), Gaps = 42/565 (7%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPIN---------  1875
             MDKGWG+T++NPD+  GFF NKPVFGFNLSPRLNP  G  S   A     N         
Sbjct  1     MDKGWGVTVDNPDK-IGFFGNKPVFGFNLSPRLNPSKGSLSMFPATEFLANQNRREDSHA  59

Query  1874  ---PAAEKRGPPNEVDFFSDKKA--DIVVKKEITLHGEPVTKADL---NTGLQLVIANsg  1719
                   EKR    EVDFFSDKK   DI++KKE   HGE   K ++   NTGLQLVIAN+G
Sbjct  60    AASSDGEKRVVVGEVDFFSDKKKANDILIKKE-DCHGEDKMKTNMDVVNTGLQLVIANTG  118

Query  1718  sdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSN  1539
             SD+STVDD VSSD+E++RAK +L+ LQVELE+MNAEN+RLR MLSQVS NYTALQ HL  
Sbjct  119   SDQSTVDDGVSSDIEDKRAKLELAQLQVELERMNAENRRLREMLSQVSNNYTALQMHLMT  178

Query  1538  LMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEAS  1359
             LM HQ QQ+++  +TQD E+ +RKSEE KPE     VPRQFL+L P G A    + DE +
Sbjct  179   LM-HQQQQNAKPQTTQDHEIGERKSEENKPENGGVVVPRQFLDLGPSGTA----EMDEPT  233

Query  1358  QSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnp-skPVDQA-  1185
              S  +SEERTLS GSPRNN  ELSR+KG+  RE+SP+S+ WAPNK+ KLN  SK VD A 
Sbjct  234   NS--SSEERTLS-GSPRNN-MELSRNKGV-GREESPESQGWAPNKVAKLNAPSKTVDHAQ  288

Query  1184  AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQ  1005
             AEATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQ
Sbjct  289   AEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQ  348

Query  1004  RCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAI  825
             RCAEDRT+LITTYEGTHNHPLPPAAMAMASTTSAAANMLLSG+M SADG+MN NFLAR I
Sbjct  349   RCAEDRTVLITTYEGTHNHPLPPAAMAMASTTSAAANMLLSGSMSSADGLMNPNFLARTI  408

Query  824   LPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNY-----P  660
             LPCSS++ATISASAPFPTVTLDLTQTPN L   ++P T FQ PF G P  PQN+     P
Sbjct  409   LPCSSNMATISASAPFPTVTLDLTQTPNPLQFQRQPSTPFQLPF-GTP--PQNFPPVANP  465

Query  659   QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqq--hpapppqhpLFADTLSA  486
             Q+ QVFGQ LYNQSKFSGL VS QDI AAAA AAQ+  Q Q          P FADTLSA
Sbjct  466   QMHQVFGQALYNQSKFSGLQVS-QDIEAAAAAAAQMQNQGQHPQVQQGQHQPSFADTLSA  524

Query  485   ATAAITSDPNFTAALAAAISSIMGG  411
             ATAAIT+DPNFTAALAAAISSI+GG
Sbjct  525   ATAAITADPNFTAALAAAISSIIGG  549



>ref|XP_011096037.1| PREDICTED: WRKY transcription factor 6 [Sesamum indicum]
Length=573

 Score =   527 bits (1358),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 374/559 (67%), Positives = 424/559 (76%), Gaps = 38/559 (7%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLN---------PINgggsgggaGMVPIN  1875
             MD+G GLTLEN D+  GFF NKPVFGFNLSPRL+         P+N       A  V   
Sbjct  1     MDRGCGLTLENSDQ-VGFFGNKPVFGFNLSPRLDHRRDGLIMFPVNSSAGEETAA-VSSP  58

Query  1874  PAAEKRGPPNEVDFFSDKKADI--VVKKEITLHGEPVTKAD---LNTGLQLVIANsgsdk  1710
             P  E+R    EVDFF++KK  +  VVKKE + H E  T  D   +NTGLQLV AN+GSD+
Sbjct  59    PGGEQRIVLGEVDFFAEKKKPVNGVVKKESS-HAEASTFRDADVINTGLQLVTANTGSDQ  117

Query  1709  stvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQ  1530
             STVDD +S D E++RA+N+L+ LQVELE+MNAENQ+L+GML+QVS NY+ALQ HL  LMQ
Sbjct  118   STVDDVMSPDAEDKRARNELAQLQVELERMNAENQKLKGMLTQVSNNYSALQMHLVTLMQ  177

Query  1529  HQNQQSSRIGSTQDREVADRKSeekkpekeeP-TVPRQFLELVPgggaaaaAQTDEASQS  1353
              Q  Q+SR  STQ++EV DRKSEE KP       VPRQFL+L P          DE   S
Sbjct  178   QQ--QNSRTDSTQEQEVVDRKSEENKPAVNGGPIVPRQFLDLAPAAATNQM--ADE--HS  231

Query  1352  HTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEAT  1173
             ++ SEERTLS GSP +NN E SR+K  I RE+SP+SE WAPNK  KLN +K VDQ+ EAT
Sbjct  232   NSLSEERTLS-GSP-HNNMEPSRNK-RIGREESPESEGWAPNKTLKLNSTKAVDQSTEAT  288

Query  1172  MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAE  993
             MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAE
Sbjct  289   MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAE  348

Query  992   DRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCS  813
             DRTILITTYEGTHNHPLPPAAMAMASTTSAAANMLLSG+MPSADG+MNTNFLAR ILPCS
Sbjct  349   DRTILITTYEGTHNHPLPPAAMAMASTTSAAANMLLSGSMPSADGVMNTNFLARTILPCS  408

Query  812   SSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNY-----PQLPQ  648
             S++ATISASAPFPTVTLDLTQTPN L  +QRPP QFQ PF   P  PQN+     P +PQ
Sbjct  409   SNMATISASAPFPTVTLDLTQTPNPL-QFQRPPAQFQVPF---PVPPQNFAPVPTPSVPQ  464

Query  647   VFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAIT  468
              FGQ LYNQSKFSGL +S +  +  AAQ    + +      P  HPLF+DTLSAATAAIT
Sbjct  465   GFGQALYNQSKFSGLQMSQE--SNDAAQLQGQSSKHPQLHQPQAHPLFSDTLSAATAAIT  522

Query  467   SDPNFTAALAAAISSIMGG  411
             +DPNFTAALAAAISSI+GG
Sbjct  523   ADPNFTAALAAAISSIIGG  541



>gb|ABC86708.1| putative WRKY1b transcription factor [Coffea arabica]
Length=572

 Score =   522 bits (1345),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 378/564 (67%), Positives = 422/564 (75%), Gaps = 41/564 (7%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPIN---------  1875
             MDKGWG+T++N D+  GFF NKPVFGFNLSPRLNP  G  S   A     N         
Sbjct  1     MDKGWGVTVDNSDK-IGFFGNKPVFGFNLSPRLNPSKGSLSMFPAAEFLANQNRREDSHA  59

Query  1874  ---PAAEKRGPPNEVDFFSDKKA--DIVVKKEITLHGEPVTKADL---NTGLQLVIANsg  1719
                   EKR    EVDFFSDKK   DI++KKE   HGE   K ++   NTGLQLVIAN+G
Sbjct  60    AASSDGEKRVVVGEVDFFSDKKKANDILIKKE-DCHGEDKMKTNMDVVNTGLQLVIANTG  118

Query  1718  sdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSN  1539
             SD+STVDD VSSD+E++RAK +L+ LQVELE MNAEN+RLR MLSQVS NYTALQ HL  
Sbjct  119   SDQSTVDDGVSSDIEDKRAKLELAQLQVELEGMNAENRRLREMLSQVSNNYTALQMHLMT  178

Query  1538  LMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEAS  1359
             L  HQ QQ+++  +TQD E+ +RKSEE KPE     VPRQFL+L P G A    + DE +
Sbjct  179   LT-HQQQQNAKPQTTQDHEIGERKSEENKPENGGVVVPRQFLDLGPSGTA----EMDEPT  233

Query  1358  QSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWA-pnklpklnpskPVDQA-  1185
              S  +SEERTLS GSP +NN ELSR+KG+  RE+SP+S+ WA          SK VD A 
Sbjct  234   NS--SSEERTLS-GSP-HNNMELSRNKGV-GREESPESQGWAPNKVAKLNASSKTVDHAQ  288

Query  1184  AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQ  1005
             AEATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQ
Sbjct  289   AEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQ  348

Query  1004  RCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAI  825
             RCAEDRT+LITTYEGTHNHPLPPAAMAMASTTSAAANMLLSG+M SADG+MN NFLAR I
Sbjct  349   RCAEDRTVLITTYEGTHNHPLPPAAMAMASTTSAAANMLLSGSMSSADGLMNPNFLARTI  408

Query  824   LPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNY-----P  660
             LPCSS++ATISASAPFPTVTLDLTQTPN L   ++P T FQ PF G P  PQN+     P
Sbjct  409   LPCSSNMATISASAPFPTVTLDLTQTPNPLQFQRQPSTPFQLPF-GTP--PQNFPPVANP  465

Query  659   QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqq-hpapppqhpLFADTLSAA  483
             Q+ QVFGQ LYNQSKFSGL VS QDI AA A A    Q Q         HP FADTLSAA
Sbjct  466   QMHQVFGQALYNQSKFSGLQVS-QDIEAAGAAAQMQNQGQHPQVQQGQHHPSFADTLSAA  524

Query  482   TAAITSDPNFTAALAAAISSIMGG  411
             TAAIT+DPNFTAALAAAISSI+GG
Sbjct  525   TAAITADPNFTAALAAAISSIIGG  548



>gb|ACI90292.1| WRKY transcription factor [Picrorhiza kurrooa]
Length=556

 Score =   508 bits (1308),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 356/559 (64%), Positives = 406/559 (73%), Gaps = 47/559 (8%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLN------PINgggsgggaGMVPINPAA  1866
             MDKGWG+T+EN DR+ G F  K VF F+LSPR N      P+N  G       V  +PAA
Sbjct  1     MDKGWGVTIENSDRQVGLFGRKTVFEFDLSPRFNQNLIMFPVNSSGGDEND--VVFSPAA  58

Query  1865  EKRGPP-NEVDFFSDKK-----ADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkst  1704
               RG    EVDFFS+K+         +KKE +   E     D+NTGLQLV AN+GSD+ST
Sbjct  59    GDRGVVLGEVDFFSEKRRPSNEVSAAMKKEHSNAEE----MDVNTGLQLVTANTGSDQST  114

Query  1703  vddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQ  1524
             VDD +SSD E++RAKN+L+ LQVELE+MNAENQRL+ ML+QV+ NYTALQ HL  LMQ Q
Sbjct  115   VDDGISSDAEDKRAKNELAQLQVELERMNAENQRLKEMLTQVTNNYTALQMHLVTLMQQQ  174

Query  1523  NQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTT  1344
                       Q+ E+ +RK EEKK E     +PRQF++L P         TDE  Q++++
Sbjct  175   ----------QEHEILERKPEEKKLENGGSMIPRQFMDLAPSAA------TDE--QTNSS  216

Query  1343  SEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRK  1164
             SEERTLS GSP +N  E+SR+K    REDSP+SE+W PNK PK++P KPVDQ+AEA+MRK
Sbjct  217   SEERTLS-GSP-HNTVEVSRNKRT-GREDSPESEAWGPNKAPKMSPPKPVDQSAEASMRK  273

Query  1163  ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT  984
              RVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDR 
Sbjct  274   VRVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRA  333

Query  983   ILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSV  804
             ILITTYEGTHNHPLPPAA+AMAS TSAAA+MLLSG+MPSADGMMN NFLAR I PCSS++
Sbjct  334   ILITTYEGTHNHPLPPAAVAMASITSAAASMLLSGSMPSADGMMNPNFLARTIFPCSSNM  393

Query  803   ATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQ----IPQNYPQLPQVFGQ  636
             ATISASAP PTVTLDLTQ PN L  +QRPP  FQ PF G+      IP      PQVFGQ
Sbjct  394   ATISASAP-PTVTLDLTQNPNPL-QFQRPPNPFQVPFPGSSHNFGPIPN--ANAPQVFGQ  449

Query  635   GLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPN  456
              LYNQSKFSGL +S     AA        Q Q H A    HP FADTLSAATAAIT+DPN
Sbjct  450   ALYNQSKFSGLQMSQDIDEAAQLLRQSSQQPQVHQAQAQAHPSFADTLSAATAAITADPN  509

Query  455   FTAALAAAISSIMGGGSQP  399
             F AALAAAISSI GGGSQP
Sbjct  510   FMAALAAAISSIFGGGSQP  528



>ref|XP_009776377.1| PREDICTED: WRKY transcription factor 6-like isoform X3 [Nicotiana 
sylvestris]
Length=515

 Score =   504 bits (1299),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 347/550 (63%), Positives = 386/550 (70%), Gaps = 72/550 (13%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPINPAAEKR-GP  1851
             MDKGWGLTLE+   + GFF NKP FGFNLSPRLN I GG    GA      PA EKR G 
Sbjct  1     MDKGWGLTLESSSDKVGFFKNKPFFGFNLSPRLNNIKGGEMFSGAEF----PADEKRPGM  56

Query  1850  PNEVDFFSDKKA--DIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvssDM  1677
              NEVDFFS+KK+  D+VVKKE +  G    + DL                          
Sbjct  57    VNEVDFFSEKKSIHDVVVKKENS-QGNNTMRTDLFV------------------------  91

Query  1676  EERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGS  1497
                   + L+ LQVELE+MN ENQRL+GML+QV+ +Y+ALQ HL  LMQ Q Q  SR  S
Sbjct  92    ------HQLAQLQVELERMNTENQRLKGMLTQVTNSYSALQMHLVTLMQQQQQLISRTES  145

Query  1496  TQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAG  1317
               + EV + KSEEK  EK+   VPRQF+EL P    A     DE SQSH+TSEERT S G
Sbjct  146   PHNHEVVEVKSEEKNQEKDGDIVPRQFMELGPSSAKADP--VDEPSQSHSTSEERTHS-G  202

Query  1316  SPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskP-VDQAAEATMRKARVSVRAR  1140
             SPRNN  E+SR K I  RE+SP+SESW PNK+PKL  S   V+Q  EATMRKARVSVRAR
Sbjct  203   SPRNN-MEMSRDKAI-GREESPESESWVPNKVPKLMNSSKPVEQTTEATMRKARVSVRAR  260

Query  1139  SEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG  960
             SEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG
Sbjct  261   SEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG  320

Query  959   ThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAP  780
             THNHPLPPAAMAMASTTSAAANMLLSG+MPSADG+MNTNFLAR ILPCSS++ATISASAP
Sbjct  321   THNHPLPPAAMAMASTTSAAANMLLSGSMPSADGLMNTNFLARTILPCSSNMATISASAP  380

Query  779   FPTVTLDLTQTPNSLPNYQR--PPTQFQAPFTGAPQIPQ-----NYPQLPQVFGQGLYNQ  621
             FPTVTLDLTQ PN++ NY +  P TQFQ P       P      + PQ+PQV GQ LYNQ
Sbjct  381   FPTVTLDLTQNPNAMSNYHQRNPATQFQVPLPAGLNHPNFVGSMSAPQMPQVLGQALYNQ  440

Query  620   SKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAAL  441
             S+FSGL VS  +I                      HP F+DTLSAATAAIT+DPNFTAAL
Sbjct  441   SRFSGLQVSQDNI---------------------HHPSFSDTLSAATAAITADPNFTAAL  479

Query  440   AAAISSIMGG  411
             AAAISSI+GG
Sbjct  480   AAAISSIIGG  489



>ref|XP_009598818.1| PREDICTED: probable WRKY transcription factor 31 isoform X2 [Nicotiana 
tomentosiformis]
Length=551

 Score =   505 bits (1300),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 363/555 (65%), Positives = 408/555 (74%), Gaps = 47/555 (8%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPINPAAEKRGPP  1848
             MDKGWGLTLEN   + GFF NKP FGFNLSPRLN I GG    GA      PA EKRG  
Sbjct  1     MDKGWGLTLENSSDKVGFFNNKPFFGFNLSPRLNNIKGGEMFSGAEF----PADEKRGMV  56

Query  1847  NEVDFFSDKKA---DIVVKKEITLHGEPVTKADL--NTGLQLVIANsgsdkstvddsv-s  1686
             NEVDFFS+KK+   D+VVKK  +  G    +  L  NTGLQLV AN+G    +  D   S
Sbjct  57    NEVDFFSEKKSIHDDVVVKKGNS-QGNNTMRTGLFVNTGLQLVTANTGISDQSTVDDGIS  115

Query  1685  sDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQS--  1512
             S++EE+R KN+L+ LQVELE+MN ENQRL+GML+QV+ +Y+ALQ HL  LMQ Q QQ   
Sbjct  116   SEVEEKRTKNELAQLQVELERMNTENQRLKGMLTQVTNSYSALQMHLVTLMQQQQQQQLI  175

Query  1511  SRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEER  1332
             SR  ST +  V + KSEEK  EK+   VPRQF+EL P    A     DE +QSH+TSEER
Sbjct  176   SRTESTHNHVVVEVKSEEKNQEKDGNIVPRQFMELGPSSTKADPM--DEPTQSHSTSEER  233

Query  1331  TLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskP-VDQAAEATMRKARV  1155
             TLS GSPRNN  ELSR K I  RE+SP+SESW PNK+PKL  S   V+Q  EATMRKARV
Sbjct  234   TLS-GSPRNN-MELSRDKAI-GREESPESESWVPNKVPKLMNSSKPVEQTTEATMRKARV  290

Query  1154  SVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILI  975
             SVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILI
Sbjct  291   SVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILI  350

Query  974   TTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATI  795
             TTYEG+HNHPLPPAAMAMASTTSAAANMLLSG+MPSADG+MNTNFLAR ILPCSS++ATI
Sbjct  351   TTYEGSHNHPLPPAAMAMASTTSAAANMLLSGSMPSADGLMNTNFLARTILPCSSNMATI  410

Query  794   SASAPFPTVTLDLTQTPNSLPNYQR--PPTQFQAPFTGAPQIPQ-----NYPQLPQVFGQ  636
             SASAPFPTVTLDLTQ PN++ NY +    TQFQ P       P      + PQ+PQV GQ
Sbjct  411   SASAPFPTVTLDLTQNPNAMSNYHQRNTATQFQVPLPAGLNHPNFVGSMSTPQIPQVLGQ  470

Query  635   GLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPN  456
              LYNQS+FSGL VS  +I                     Q P F+DTL+AATAAIT+DPN
Sbjct  471   ALYNQSRFSGLQVSQDNI---------------------QPPSFSDTLTAATAAITADPN  509

Query  455   FTAALAAAISSIMGG  411
             FTAALAAAISSI+GG
Sbjct  510   FTAALAAAISSIIGG  524



>ref|XP_009598817.1| PREDICTED: probable WRKY transcription factor 31 isoform X1 [Nicotiana 
tomentosiformis]
Length=552

 Score =   501 bits (1289),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 363/556 (65%), Positives = 408/556 (73%), Gaps = 48/556 (9%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPINPAAEKRGPP  1848
             MDKGWGLTLEN   + GFF NKP FGFNLSPRLN I GG    GA      PA EKRG  
Sbjct  1     MDKGWGLTLENSSDKVGFFNNKPFFGFNLSPRLNNIKGGEMFSGAEF----PADEKRGMV  56

Query  1847  NEVDFFSDKKA---DIVVKKEITLHGEPVTKADL--NTGLQLVIANsgsdkstvddsv-s  1686
             NEVDFFS+KK+   D+VVKK  +  G    +  L  NTGLQLV AN+G    +  D   S
Sbjct  57    NEVDFFSEKKSIHDDVVVKKGNS-QGNNTMRTGLFVNTGLQLVTANTGISDQSTVDDGIS  115

Query  1685  sDMEERRAKND-LSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQS-  1512
             S++EE+R KN+ L+ LQVELE+MN ENQRL+GML+QV+ +Y+ALQ HL  LMQ Q QQ  
Sbjct  116   SEVEEKRTKNEQLAQLQVELERMNTENQRLKGMLTQVTNSYSALQMHLVTLMQQQQQQQL  175

Query  1511  -SRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEE  1335
              SR  ST +  V + KSEEK  EK+   VPRQF+EL P    A     DE +QSH+TSEE
Sbjct  176   ISRTESTHNHVVVEVKSEEKNQEKDGNIVPRQFMELGPSSTKADPM--DEPTQSHSTSEE  233

Query  1334  RTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskP-VDQAAEATMRKAR  1158
             RTLS GSPRNN  ELSR K I  RE+SP+SESW PNK+PKL  S   V+Q  EATMRKAR
Sbjct  234   RTLS-GSPRNN-MELSRDKAI-GREESPESESWVPNKVPKLMNSSKPVEQTTEATMRKAR  290

Query  1157  VSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTIL  978
             VSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTIL
Sbjct  291   VSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTIL  350

Query  977   ITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVAT  798
             ITTYEG+HNHPLPPAAMAMASTTSAAANMLLSG+MPSADG+MNTNFLAR ILPCSS++AT
Sbjct  351   ITTYEGSHNHPLPPAAMAMASTTSAAANMLLSGSMPSADGLMNTNFLARTILPCSSNMAT  410

Query  797   ISASAPFPTVTLDLTQTPNSLPNYQR--PPTQFQAPFTGAPQIPQ-----NYPQLPQVFG  639
             ISASAPFPTVTLDLTQ PN++ NY +    TQFQ P       P      + PQ+PQV G
Sbjct  411   ISASAPFPTVTLDLTQNPNAMSNYHQRNTATQFQVPLPAGLNHPNFVGSMSTPQIPQVLG  470

Query  638   QGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDP  459
             Q LYNQS+FSGL VS  +I                     Q P F+DTL+AATAAIT+DP
Sbjct  471   QALYNQSRFSGLQVSQDNI---------------------QPPSFSDTLTAATAAITADP  509

Query  458   NFTAALAAAISSIMGG  411
             NFTAALAAAISSI+GG
Sbjct  510   NFTAALAAAISSIIGG  525



>gb|ACT80136.1| transcription factor WRKY [Capsicum annuum]
Length=553

 Score =   495 bits (1274),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 360/567 (63%), Positives = 410/567 (72%), Gaps = 62/567 (11%)
 Frame = -1

Query  2027  MDKGWGLTLENPDR--RAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPINPAAEKRG  1854
             MDKGWGLTLE+     + GFF NKPVFGFNLSPRLNP         A M P   + +KR 
Sbjct  1     MDKGWGLTLESSSSSDKVGFFMNKPVFGFNLSPRLNP---------AEMFP--SSDDKRA  49

Query  1853  PPNEVDFFSDKKADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvdd--svssD  1680
               NEVDFFS+KK   +VKKE +  G+   +  +NTGLQLVIAN+GSD+STVDD  S    
Sbjct  50    IVNEVDFFSEKKP--IVKKENS-QGDRTDQCVVNTGLQLVIANAGSDQSTVDDGISSELV  106

Query  1679  MEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQS----  1512
             +E++RAK  L+ LQVEL++MN+ENQRL+GML+QV+ +Y+ALQ HL  LMQ Q QQ     
Sbjct  107   LEDKRAKIQLAQLQVELQRMNSENQRLKGMLTQVNNSYSALQMHLVTLMQQQQQQQQQQQ  166

Query  1511  --SRIGSTQDREVADRKSeekkpekeePT-VPRQFLELVPgggaaaaAQTDEASQSHTTS  1341
               SR  ST   EV + K  ++K +++E T VPRQF+EL P G  A     DE S SHT+S
Sbjct  167   MISRTESTHAHEVVEAKFNDEKKQEKEGTIVPRQFMELGPSGSKADP--LDEPSNSHTSS  224

Query  1340  EERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskP-VDQAAEATMRK  1164
             EERTLS GSPRNN   LSR K I  RE+SP+SESWAPNK+PKL  S   V+Q  EATMRK
Sbjct  225   EERTLS-GSPRNNMELLSRDKAI-GREESPESESWAPNKVPKLMNSSKPVEQPTEATMRK  282

Query  1163  ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT  984
             ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT
Sbjct  283   ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT  342

Query  983   ILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSV  804
             ILITTYEGTHNHPLPPAAMAMASTTSAAANMLLSG+MPSADG+MNTNFLARA+LPCSS++
Sbjct  343   ILITTYEGTHNHPLPPAAMAMASTTSAAANMLLSGSMPSADGLMNTNFLARAMLPCSSNM  402

Query  803   ATISASAPFPTVTLDLT-QTPN-SLPNYQR-----PPTQFQAPFTGAPQIPQ-----NYP  660
             ATISASAPFPTVTLDLT Q  N +LPNY +        QFQ P       P      + P
Sbjct  403   ATISASAPFPTVTLDLTAQNSNAALPNYHQRVNHANNAQFQFPLPAGLNHPNFIASMSAP  462

Query  659   QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAAT  480
             Q+PQV GQ +YNQSKFSGL VS  +I   +                       DTLSAAT
Sbjct  463   QMPQVLGQAMYNQSKFSGLQVSQDNIHHPSISH--------------------DTLSAAT  502

Query  479   AAITSDPNFTAALAAAISSIMGGGSQP  399
             AAIT+DPNFTAALAAAISSI+G GS P
Sbjct  503   AAITADPNFTAALAAAISSIIGCGSHP  529



>ref|XP_007026134.1| WRKY family transcription factor [Theobroma cacao]
 gb|EOY28756.1| WRKY family transcription factor [Theobroma cacao]
Length=593

 Score =   489 bits (1259),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 357/592 (60%), Positives = 409/592 (69%), Gaps = 72/592 (12%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFG---FNLSPRLN----PINgg---gsgggaGMVPI  1878
             MDKGWGLTL++ D    FF NK   G   F L  + +    P++         G      
Sbjct  1     MDKGWGLTLDS-DPGTKFFPNKTNSGGPFFRLKQQRDMFQFPVSLAGFREDHQGTSSSSS  59

Query  1877  NPAAEKRGPP-NEVDFFSDKKADIVV-----------KKEITLHGE--PVTKADLNTGLQ  1740
                 EKR    +EVDFFSDKK  +VV           KKE T HGE  P +  D+NTGL 
Sbjct  60    PSGQEKRPVAVDEVDFFSDKKTRVVVGGDDKTGTVSVKKE-TSHGEAAPGSDLDVNTGLH  118

Query  1739  LVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTA  1560
             L+ AN+GSD+STVDD VSSDME++RAKN+L+ L VEL++MNAENQ+LR MLS VS NY+A
Sbjct  119   LLTANAGSDQSTVDDGVSSDMEDKRAKNELAQLHVELQRMNAENQKLRDMLSHVSNNYSA  178

Query  1559  LQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaa  1380
             LQ HL  LMQ Q  Q +   STQ+ EV   KSEEKK +     VPRQF++L P G     
Sbjct  179   LQMHLVTLMQQQRNQGTE--STQEHEVRQGKSEEKKHDV---IVPRQFMDLGPSG-----  228

Query  1379  AQTDEASQ-SHTTSEERTLSAGSPRN----------NNTELS---------RHKGIIARE  1260
               T EA + SH++SEERT S   P N          +  E+S         R    + RE
Sbjct  229   --TAEADEMSHSSSEERTQSGSPPSNAEIASKNYVKSKNEISQFDQETSSFRDGKRVGRE  286

Query  1259  DSPDSESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMA  1080
             +SP+SE W PNK  KLNP+KPVDQ+ EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMA
Sbjct  287   ESPESEGWGPNKAQKLNPAKPVDQSTEATMRKARVSVRARSEAPMITDGCQWRKYGQKMA  346

Query  1079  KGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaa  900
             KGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTT+AA
Sbjct  347   KGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTAAA  406

Query  899   anmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQR  720
             A+MLLSG+MPSADG+MN N LARAILPCSSSVATISASAPFPTVTLDLT +PN L  +QR
Sbjct  407   ASMLLSGSMPSADGIMNQNLLARAILPCSSSVATISASAPFPTVTLDLTHSPNPL-QFQR  465

Query  719   PPTQFQAPFTGAPQIPQNY-----PQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaq  555
             PPTQFQ PF G    PQN+     PQLPQV GQ LYNQSKFSGL +S QD+      A  
Sbjct  466   PPTQFQVPFPGQ---PQNFASVAAPQLPQVIGQALYNQSKFSGLQLS-QDM----GSAQL  517

Query  554   laqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQP  399
               Q        PQ P  ADT+SAATAAIT+DP+FTAALAAAI+SI+GGG+ P
Sbjct  518   GHQVPHPQLQQPQQPTLADTVSAATAAITADPSFTAALAAAITSIIGGGAHP  569



>ref|XP_004232693.1| PREDICTED: probable WRKY transcription factor 31 isoform X2 [Solanum 
lycopersicum]
Length=549

 Score =   475 bits (1223),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 348/561 (62%), Positives = 397/561 (71%), Gaps = 60/561 (11%)
 Frame = -1

Query  2027  MDKGWGLTLE----NPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPINPAAEK  1860
             MDKGWGLTLE    N DR AGFF NKPVFGFNLSP+ N                + + EK
Sbjct  1     MDKGWGLTLETSSSNSDR-AGFFKNKPVFGFNLSPKFNAAEM-----------FSSSDEK  48

Query  1859  RGPPNEVDFFSDKKADIVVKKEITLHGEPVTKAD---LNTGLQLVIANsgsdkstvdd-s  1692
             R   NEVDFF+DKK   +VKKE +     +   D   +NTGLQLVIAN+GSD+STVDD  
Sbjct  49    RSIVNEVDFFADKKP--IVKKENSQTDNSIRTDDQCVVNTGLQLVIANAGSDQSTVDDGV  106

Query  1691  vssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQS  1512
              S  +EE+RAK  L+ LQVELE+MN+ENQRL+GML+QVS +Y+ALQ HL  LMQ Q   +
Sbjct  107   SSEVLEEKRAKIQLAQLQVELERMNSENQRLKGMLTQVSNSYSALQMHLVTLMQQQ--LN  164

Query  1511  SRIGSTQDREVADRKSeekkpekeePT-VPRQFLELVPgggaaaaAQTDEASQSHTTSEE  1335
             SR  +T   EV    S+E+K +    T VPRQF+EL P G        DE S S ++SEE
Sbjct  165   SRTENTHPHEVVGANSDEEKKKANNGTIVPRQFMELGPSGSKVDP--MDEPSHSRSSSEE  222

Query  1334  RTLSAGSPRNNNTELSRHKGIIAREDSPDSESWA--pnklpklnpskPVDQAAEATMRKA  1161
             RTLS GSPRNN   +SR K I  RE+SP+SESWA         + SKPV+Q+ EATMRKA
Sbjct  223   RTLS-GSPRNNMELVSRDKAI-NREESPESESWAPNKAPKLMTSSSKPVEQSTEATMRKA  280

Query  1160  RVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTI  981
             RVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDR+I
Sbjct  281   RVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRSI  340

Query  980   LITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVA  801
             LITTYEGTHNHPLPPAAMAMASTTSAAANMLLSG+MPSADG+MNTNFLARA+LPCSS++A
Sbjct  341   LITTYEGTHNHPLPPAAMAMASTTSAAANMLLSGSMPSADGLMNTNFLARAMLPCSSNMA  400

Query  800   TISASAPFPTVTLDLT-QTPN-SLPNYQ----RPPTQFQAPFTGAPQIPQ-----NYPQL  654
             TISASAPFPTVTLDLT Q PN +LPNY     +   QFQ P       P      + PQ+
Sbjct  401   TISASAPFPTVTLDLTAQNPNAALPNYHQRINQANPQFQFPLPAGLNHPNFAASMSAPQM  460

Query  653   PQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAA  474
             P V GQ LYNQSKFSGL +S ++I       +                   DTLSAATAA
Sbjct  461   PHVLGQPLYNQSKFSGLQISQENIHHHHPSIS------------------HDTLSAATAA  502

Query  473   ITSDPNFTAALAAAISSIMGG  411
             IT+DPNFTAALAAAISSI+GG
Sbjct  503   ITADPNFTAALAAAISSIIGG  523



>ref|XP_010316577.1| PREDICTED: probable WRKY transcription factor 31 isoform X1 [Solanum 
lycopersicum]
Length=550

 Score =   472 bits (1214),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 348/562 (62%), Positives = 397/562 (71%), Gaps = 61/562 (11%)
 Frame = -1

Query  2027  MDKGWGLTLE----NPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPINPAAEK  1860
             MDKGWGLTLE    N DR AGFF NKPVFGFNLSP+ N                + + EK
Sbjct  1     MDKGWGLTLETSSSNSDR-AGFFKNKPVFGFNLSPKFNAAEM-----------FSSSDEK  48

Query  1859  RGPPNEVDFFSDKKADIVVKKEITLHGEPVTKAD---LNTGLQLVIANsgsdkstvdd-s  1692
             R   NEVDFF+DKK   +VKKE +     +   D   +NTGLQLVIAN+GSD+STVDD  
Sbjct  49    RSIVNEVDFFADKKP--IVKKENSQTDNSIRTDDQCVVNTGLQLVIANAGSDQSTVDDGV  106

Query  1691  vssDMEERRAK-NDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQ  1515
              S  +EE+RAK   L+ LQVELE+MN+ENQRL+GML+QVS +Y+ALQ HL  LMQ Q   
Sbjct  107   SSEVLEEKRAKIQQLAQLQVELERMNSENQRLKGMLTQVSNSYSALQMHLVTLMQQQ--L  164

Query  1514  SSRIGSTQDREVADRKSeekkpekeePT-VPRQFLELVPgggaaaaAQTDEASQSHTTSE  1338
             +SR  +T   EV    S+E+K +    T VPRQF+EL P G        DE S S ++SE
Sbjct  165   NSRTENTHPHEVVGANSDEEKKKANNGTIVPRQFMELGPSGSKVDP--MDEPSHSRSSSE  222

Query  1337  ERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWA--pnklpklnpskPVDQAAEATMRK  1164
             ERTLS GSPRNN   +SR K I  RE+SP+SESWA         + SKPV+Q+ EATMRK
Sbjct  223   ERTLS-GSPRNNMELVSRDKAI-NREESPESESWAPNKAPKLMTSSSKPVEQSTEATMRK  280

Query  1163  ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT  984
             ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDR+
Sbjct  281   ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRS  340

Query  983   ILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSV  804
             ILITTYEGTHNHPLPPAAMAMASTTSAAANMLLSG+MPSADG+MNTNFLARA+LPCSS++
Sbjct  341   ILITTYEGTHNHPLPPAAMAMASTTSAAANMLLSGSMPSADGLMNTNFLARAMLPCSSNM  400

Query  803   ATISASAPFPTVTLDLT-QTPN-SLPNYQ----RPPTQFQAPFTGAPQIPQ-----NYPQ  657
             ATISASAPFPTVTLDLT Q PN +LPNY     +   QFQ P       P      + PQ
Sbjct  401   ATISASAPFPTVTLDLTAQNPNAALPNYHQRINQANPQFQFPLPAGLNHPNFAASMSAPQ  460

Query  656   LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATA  477
             +P V GQ LYNQSKFSGL +S ++I       +                   DTLSAATA
Sbjct  461   MPHVLGQPLYNQSKFSGLQISQENIHHHHPSIS------------------HDTLSAATA  502

Query  476   AITSDPNFTAALAAAISSIMGG  411
             AIT+DPNFTAALAAAISSI+GG
Sbjct  503   AITADPNFTAALAAAISSIIGG  524



>gb|ABN69038.1| WRKY protein [Solanum tuberosum]
Length=540

 Score =   470 bits (1209),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 347/563 (62%), Positives = 400/563 (71%), Gaps = 64/563 (11%)
 Frame = -1

Query  2027  MDKGWGLTLE----NPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPINPAAEK  1860
             MDKGWGLTLE    N DR AGFF NKPVFGFNLSP+ N                + + EK
Sbjct  1     MDKGWGLTLETSPSNSDR-AGFFKNKPVFGFNLSPKYNAGEM-----------FSSSDEK  48

Query  1859  RGPPNEVDFFSDKKADIVVKKEITLHGEPVTKAD----LNTGLQLVIANsgsdkstvdd-  1695
             R   NEVDFFSDKK   +VKKE +  G+   + D    +NTGLQLV AN+GSD+STVDD 
Sbjct  49    RSIVNEVDFFSDKKP--IVKKENS-QGDNSIRTDDQFVVNTGLQLVTANAGSDQSTVDDG  105

Query  1694  svssDMEERRAK-NDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQ  1518
               S  +E++RAK   L+ LQVELE+MN+ENQRL+GML QV+ +Y+ALQ HL  LMQ Q Q
Sbjct  106   VSSEVLEDKRAKIQQLAQLQVELERMNSENQRLKGMLVQVNNSYSALQMHLVTLMQQQ-Q  164

Query  1517  QSSRIGSTQDREVADRKSeekkpekeePT-VPRQFLELVPgggaaaaAQTDEASQSHTTS  1341
              +S+  +T   EV   KS+E+K ++   T VPRQF+EL P G        DE S SH++S
Sbjct  165   LNSKTENTHPHEVVGAKSDEEKKKENNGTIVPRQFMELGPSGSKVDP--MDEPSHSHSSS  222

Query  1340  EERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWA--pnklpklnpskPVDQAAEATMR  1167
             EERTLS GSPRNN   +SR K I  RE+SP+SESWA         + SKPV+Q+ EATMR
Sbjct  223   EERTLS-GSPRNNVELVSRDKAI-NREESPESESWAPNKAPKLMNSSSKPVEQSTEATMR  280

Query  1166  KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDR  987
             KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA+DR
Sbjct  281   KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCADDR  340

Query  986   TILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSS  807
             TILITTYEGTHNHPLPPAAMAMASTTSAAANMLLSG+MPSADG+MNT+FLARA+LPCSS+
Sbjct  341   TILITTYEGTHNHPLPPAAMAMASTTSAAANMLLSGSMPSADGLMNTDFLARAMLPCSSN  400

Query  806   VATISASAPFPTVTLDLT-QTPN-SLPNYQRPPTQ----FQAPFTGAPQIPQ-----NYP  660
             +ATISASAPFPTVTLDLT Q PN +LPNY +   Q    FQ P       P      + P
Sbjct  401   MATISASAPFPTVTLDLTAQNPNGALPNYHQRINQANPHFQFPLPAGLNHPNFAASMSAP  460

Query  659   QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAAT  480
             Q+P + GQ LYNQSKFSGL +S  +I   +                       DTLSAAT
Sbjct  461   QMPHILGQPLYNQSKFSGLQISQDNIHHPSISH--------------------DTLSAAT  500

Query  479   AAITSDPNFTAALAAAISSIMGG  411
             AAIT+DPNFTAALAAAISSI+GG
Sbjct  501   AAITADPNFTAALAAAISSIIGG  523



>gb|EYU27761.1| hypothetical protein MIMGU_mgv1a003939mg [Erythranthe guttata]
Length=553

 Score =   468 bits (1204),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 341/562 (61%), Positives = 399/562 (71%), Gaps = 55/562 (10%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPINP--------  1872
             M++GWGL L+N   + GFF NK VFG +          G +  G  M P+N         
Sbjct  1     MERGWGLALDNSADQVGFFGNKQVFGDHHHHH----RSGTTSSGLIMFPVNSRVREDDDG  56

Query  1871  -AAEKRGPPNEVDFFSDKKADIVVKKEITLHGE---PVTKADLNTGLQLVIANsgsdkst  1704
              AA    P  EVDFF+++    V  K  + H E      + ++NTGLQLV AN+GSD+ST
Sbjct  57    GAAASSPPRGEVDFFAERNKPTV--KTESSHAETSAACREFNVNTGLQLVTANTGSDEST  114

Query  1703  vddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQ  1524
             VDD VS D+E++RAK +L+ LQVELE+MN ENQRL+GML+QV+ NY+ALQ H   LMQHQ
Sbjct  115   VDDGVSYDVEDKRAKIELAHLQVELERMNTENQRLKGMLTQVNENYSALQMHFMALMQHQ  174

Query  1523  NQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTT  1344
               Q+S   ST+  ++ +RKSEEKK       VPRQ L+L   GG      T+E  QS++ 
Sbjct  175   --QNSTTDSTKQNQIVERKSEEKKLA----IVPRQLLDL-GVGGCGDDLMTEE--QSNSL  225

Query  1343  SEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskP-VDQAAEATMR  1167
             SEERT+S GSP+NNN ELSR+K  I R++SP+S+SW  NK PKL+     V+Q A+ATMR
Sbjct  226   SEERTIS-GSPQNNNMELSRNK-RIGRDESPESDSWHRNKTPKLDNPAKPVEQTADATMR  283

Query  1166  KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDR  987
             KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA+DR
Sbjct  284   KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCADDR  343

Query  986   TILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSS  807
             TILITTYEGTHNHPLPPAAMAMASTTSAAA+MLLSG+MPSADG+MN NFLAR ILPCSS+
Sbjct  344   TILITTYEGTHNHPLPPAAMAMASTTSAAASMLLSGSMPSADGLMNPNFLARTILPCSSN  403

Query  806   VATISASAPFPTVTLDLTQTPNSLPNYQR-PPTQFQAPFTGAPQIPQNY------PQLPQ  648
             +ATISASAPFPTVTLDLTQTP  L  YQR PP QFQ PF      PQN+      P  PQ
Sbjct  404   MATISASAPFPTVTLDLTQTPTPL-QYQRPPPVQFQLPF------PQNFAGAVQTPAAPQ  456

Query  647   VFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAIT  468
              FGQGLYNQSKFSGL +S             ++ +            FAD+LSAATAAIT
Sbjct  457   GFGQGLYNQSKFSGLQMSR-----------AVSSEAAQVQGQSSQQSFADSLSAATAAIT  505

Query  467   SDPNFTAALAAAISSIMGGGSQ  402
             SDPNFTAALAAAISSI+GG  Q
Sbjct  506   SDPNFTAALAAAISSIIGGSHQ  527



>ref|XP_009776126.1| PREDICTED: WRKY transcription factor 6-like [Nicotiana sylvestris]
Length=516

 Score =   464 bits (1194),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 343/542 (63%), Positives = 387/542 (71%), Gaps = 60/542 (11%)
 Frame = -1

Query  2027  MDK-GWGLTLEN-PDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPINPAAEKRG  1854
             MDK GWGLTLEN  D + GFF NK VFGFNLSP LN +N       A     + A EKR 
Sbjct  1     MDKAGWGLTLENISDHQVGFFKNKAVFGFNLSPTLNNVNMNPREEQAF---FSSADEKRV  57

Query  1853  PPNEVDFFSDKK---ADIVVKKEITLHGEPVTKAD----LNTGLQLVIANsgsdkstvdd  1695
               NEVDFFSDK+    D+V+KKE + HGE  T A     +NTGLQLV  N+GSD+STVDD
Sbjct  58    MLNEVDFFSDKRIKPMDLVIKKEDS-HGENTTSARSELFVNTGLQLVSVNTGSDQSTVDD  116

Query  1694  svssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQ  1515
              +SS++E++RAK +L+ LQVEL +MNAENQRLRGML+QVS NYTALQ HL  LMQ Q  Q
Sbjct  117   GISSEIEDKRAKIELAQLQVELRRMNAENQRLRGMLTQVSNNYTALQMHLVTLMQQQ--Q  174

Query  1514  SSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDE--ASQSH-TT  1344
              SR  +  D E+ + K EEK        V RQFLEL P          DE  + +SH ++
Sbjct  175   ISR--TENDHEIVEAKPEEKDGN----MVRRQFLELGPSE------HMDEPYSLKSHYSS  222

Query  1343  SEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRK  1164
             SEERT+S  SPRN        KGI  RE++P+SES   NK+PKLN S P+DQA EATMRK
Sbjct  223   SEERTVSE-SPRN--------KGI-GREETPESES---NKVPKLNSSYPIDQATEATMRK  269

Query  1163  ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT  984
             ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT
Sbjct  270   ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT  329

Query  983   ILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSV  804
             ILITTYEGTHNHPLPPAAMAMASTTSAAANMLLSG+MPSADG+MN N +AR ILPCS SV
Sbjct  330   ILITTYEGTHNHPLPPAAMAMASTTSAAANMLLSGSMPSADGLMNPNLIARTILPCSPSV  389

Query  803   ATISASAPFPTVTLDLTQTPNSL-PNYQR--PPTQFQAPFTGAPQIPQNYPQL-PQVFGQ  636
             ATISASAPFPT+TLDLTQ  NS+ P +QR  P  QFQ PF   P  P     + P    Q
Sbjct  390   ATISASAPFPTITLDLTQNQNSVSPYHQRTHPTAQFQVPFPIGPHNPNFITSMPPPPMPQ  449

Query  635   GLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPN  456
             GL+NQSKFSGL VS QDI             +Q P      P F+DTL+AATAAIT+DPN
Sbjct  450   GLHNQSKFSGLQVS-QDI------------HRQPPQHALNQPSFSDTLNAATAAITADPN  496

Query  455   FT  450
             FT
Sbjct  497   FT  498



>ref|XP_011086199.1| PREDICTED: probable WRKY transcription factor 31 [Sesamum indicum]
Length=564

 Score =   462 bits (1190),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 353/556 (63%), Positives = 402/556 (72%), Gaps = 43/556 (8%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPINPAAEKR---  1857
             MDKGWGL LEN DR      N+PVFG  LS             G  M P++ +  ++   
Sbjct  1     MDKGWGLALENSDRVGFLIRNQPVFGLGLS---------HQNKGLIMFPVSSSGREQHPA  51

Query  1856  --GPPN---------EVDFFSDKK--ADIVVKKEITLHGEPVTKADLNTGLQLVIANsgs  1716
                PP+         EVDFFS+KK   D+V K+ I    E   + +L+TGLQL+ AN+GS
Sbjct  52    ASSPPSGGDPLLVIREVDFFSEKKRPVDVVKKEVINSPAETTARRELDTGLQLLTANTGS  111

Query  1715  dkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNL  1536
             D+STVDD +S D E+RRAK +L  LQVELE++NAENQRLRGML+QVS NYTALQ  L  L
Sbjct  112   DQSTVDDGMSCDAEDRRAKIELGQLQVELERVNAENQRLRGMLTQVSNNYTALQMQLVTL  171

Query  1535  MQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQ  1356
             M HQ QQSS   STQ +E+ DRKSEEKK E E   VPRQFL+L P        QT +  Q
Sbjct  172   M-HQ-QQSSTTDSTQLQEIVDRKSEEKKQENEGVLVPRQFLDLSPRLTN----QTAD-DQ  224

Query  1355  SHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEA  1176
             S+++SEERTLS GSP+ N  E SR+K I  RE+SP+SE  A NK PKLN +KPVDQ+ EA
Sbjct  225   SNSSSEERTLS-GSPQGN-VESSRNKRI-GREESPESEGLASNKAPKLNLAKPVDQSTEA  281

Query  1175  TMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA  996
             TMR+ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA
Sbjct  282   TMRRARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA  341

Query  995   EDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPC  816
             ED+TILITTYEGTHNHPLPPAAMAMASTTSAAA+MLLSG+MPS DG+MN NFLAR ILPC
Sbjct  342   EDQTILITTYEGTHNHPLPPAAMAMASTTSAAASMLLSGSMPSVDGLMNPNFLARTILPC  401

Query  815   SSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQI-PQNYPQLPQVFG  639
             SS++ATISASAPFPT+TLDLTQ PN L  + R   QFQ PF   P   P   P  PQVFG
Sbjct  402   SSNMATISASAPFPTITLDLTQNPNPL-QFPRAAAQFQVPFPPHPSFAPVPNPSAPQVFG  460

Query  638   QGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDP  459
             Q LYNQSKFSGL +S QD+       +     Q    P    P FADTLSAATAAIT+DP
Sbjct  461   QALYNQSKFSGLQMS-QDM-----NESTQLPGQSTQHPQLHQPTFADTLSAATAAITADP  514

Query  458   NFTAALAAAISSIMGG  411
             NFTAALAAAISSI+GG
Sbjct  515   NFTAALAAAISSIIGG  530



>ref|XP_006348144.1| PREDICTED: WRKY transcription factor 6-like isoform X2 [Solanum 
tuberosum]
Length=552

 Score =   462 bits (1188),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 347/564 (62%), Positives = 402/564 (71%), Gaps = 63/564 (11%)
 Frame = -1

Query  2027  MDKGWGLTLE----NPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPINPAAEK  1860
             MDKGWGLTLE    N DR AGFF NKPVFGFNLSP+ N                + + EK
Sbjct  1     MDKGWGLTLETSSSNSDR-AGFFKNKPVFGFNLSPKYNAGEM-----------FSSSDEK  48

Query  1859  RGPPNEVDFFSDKKADIVVKKEITLHGEPVTKAD----LNTGLQLVIANsgsdkstvdd-  1695
             R   NEVDFFSDKK   +VKKE +  G+   + D    +NTGLQLV AN+GSD+STVDD 
Sbjct  49    RSIVNEVDFFSDKKP--IVKKENS-QGDNSIRTDDQFVVNTGLQLVTANAGSDQSTVDDG  105

Query  1694  svssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQ  1515
               S  +E++RAK  L+ LQVELE+MN+ENQRL+GML+QV+++Y+ALQ HL  LMQ Q QQ
Sbjct  106   VSSEVLEDKRAKIQLAQLQVELERMNSENQRLKGMLTQVNSSYSALQMHLVTLMQQQQQQ  165

Query  1514  --SSRIGSTQDREVADRKSeekkpekeePT-VPRQFLELVPgggaaaaAQTDEASQSHTT  1344
               +S+  +T   EV   KS+E+K ++   T VPRQF+EL P G        DE S SH++
Sbjct  166   QLNSKTENTHPHEVVGAKSDEEKKKENNGTIVPRQFMELGPSGSKVDP--MDEPSHSHSS  223

Query  1343  SEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWA--pnklpklnpskPVDQAAEATM  1170
             SEERTLS GSPRNN   +SR K I  RE+SP+SESW          +PSKPV+Q+ EATM
Sbjct  224   SEERTLS-GSPRNNMELVSRDKAI-NREESPESESWVPNKAPKLMNSPSKPVEQSTEATM  281

Query  1169  RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAED  990
             RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA+D
Sbjct  282   RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCADD  341

Query  989   RTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSS  810
             RTILITTYEG HNHPLPPAAMAMASTTSAAANMLLSG+MPSADG+MNTNFLARA+LPCSS
Sbjct  342   RTILITTYEGAHNHPLPPAAMAMASTTSAAANMLLSGSMPSADGLMNTNFLARAMLPCSS  401

Query  809   SVATISASAPFPTVTLDLT-QTPN-SLPNYQRPPTQ----FQAPFTGAPQIPQ-----NY  663
             ++ATISASAPFPTVTLDLT Q PN +L NY +   Q    FQ P       P      + 
Sbjct  402   NMATISASAPFPTVTLDLTAQNPNGALSNYHQRINQANPHFQFPLPAGLNHPNFAASMSA  461

Query  662   PQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAA  483
             PQ+P + GQ LYNQSKFSGL +S  +I    + +                    DTLSAA
Sbjct  462   PQMPHILGQPLYNQSKFSGLQISQDNIHHHPSISH-------------------DTLSAA  502

Query  482   TAAITSDPNFTAALAAAISSIMGG  411
             TAAIT+DPNFTAALAAAISSI+GG
Sbjct  503   TAAITADPNFTAALAAAISSIIGG  526



>ref|XP_002263115.1| PREDICTED: probable WRKY transcription factor 31 [Vitis vinifera]
Length=535

 Score =   459 bits (1180),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 330/551 (60%), Positives = 390/551 (71%), Gaps = 55/551 (10%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLS-PRLNPINgggsgggaGMVPINPAAEKRGP  1851
             MDKGWGLTL++    +  F NK   G   S P L+             +P+    E+R  
Sbjct  1     MDKGWGLTLDSIAINS--FLNKRSRGILESGPMLD-------------MPV--GDERR--  41

Query  1850  PNEVDFFSDKKADIVVKKEITLHGEP-VTKADLNTGLQLVIANsgsdkstvddsvssDME  1674
               EVDFF++K   + VKKE +   E  +T  D+NTGL L+ AN+GSD+STV+D      E
Sbjct  42    --EVDFFAEKTRSVSVKKENSHVDEAAITDLDVNTGLNLLTANAGSDQSTVEDENPDR-E  98

Query  1673  ERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGST  1494
              +RAK +++ LQVELE+MNAENQ+LRGML+QV+ NY+ LQ HL  LMQ Q+QQ+    S 
Sbjct  99    NKRAKIEVAQLQVELERMNAENQKLRGMLNQVTNNYSTLQMHLVTLMQQQSQQNRGAESL  158

Query  1493  QDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLS-AG  1317
             Q+      KS+EKK E     VPRQF++L P   A     TDE SQS  +SEERT   +G
Sbjct  159   QEHGSVGGKSDEKKHEVAGAVVPRQFIDLGPTATA----DTDEPSQS--SSEERTRDLSG  212

Query  1316  SPRNNNTELSRHKGIIAREDSPDSES--WApnklpklnpskPVDQAAEATMRKARVSVRA  1143
             SP+N+       KG   RE+SP+SE+  W  NK  KL+P K +DQ+AEATMRKARVSVRA
Sbjct  213   SPQNHQ---ENGKGA-GREESPESETQGWVQNKASKLSPPKTIDQSAEATMRKARVSVRA  268

Query  1142  RSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYE  963
             RSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDR+ILITTYE
Sbjct  269   RSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRSILITTYE  328

Query  962   GThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASA  783
             GTHNHPLPPAAMAMASTTSAAANMLLSG+M SADG+MN NFLAR ILPCSS++ATISASA
Sbjct  329   GTHNHPLPPAAMAMASTTSAAANMLLSGSMSSADGLMNPNFLARTILPCSSNMATISASA  388

Query  782   PFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYP-----QLPQVFGQGLYNQS  618
             PFPTVTLDLT TP+ L  YQRP +QF  PF  AP   Q++P      LPQVF Q LYNQS
Sbjct  389   PFPTVTLDLTHTPSPL-QYQRPTSQFPVPF-AAPA--QSFPSAQTSSLPQVFSQALYNQS  444

Query  617   KFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALA  438
             KFSGL +S QD+        + A Q       PQ    ADT+SAATAAIT+DPNFTAALA
Sbjct  445   KFSGLQLS-QDM--------ESAHQAPPTLHQPQPASLADTVSAATAAITADPNFTAALA  495

Query  437   AAISSIMGGGS  405
             AAI+SI+GGG+
Sbjct  496   AAITSIIGGGA  506



>emb|CAN70362.1| hypothetical protein VITISV_002247 [Vitis vinifera]
Length=535

 Score =   459 bits (1180),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 330/551 (60%), Positives = 390/551 (71%), Gaps = 55/551 (10%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLS-PRLNPINgggsgggaGMVPINPAAEKRGP  1851
             MDKGWGLTL++    +  F NK   G   S P L+             +P+    E+R  
Sbjct  1     MDKGWGLTLDSIAINS--FLNKRSRGILESGPMLD-------------MPV--GDERR--  41

Query  1850  PNEVDFFSDKKADIVVKKEITLHGEP-VTKADLNTGLQLVIANsgsdkstvddsvssDME  1674
               EVDFF++K   + VKKE +   E  +T  D+NTGL L+ AN+GSD+STV+D      E
Sbjct  42    --EVDFFAEKTRSVSVKKENSHVDEAAITDLDVNTGLNLLTANAGSDQSTVEDENPDR-E  98

Query  1673  ERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGST  1494
              +RAK +++ LQVELE+MNAENQ+LRGML+QV+ NY+ LQ HL  LMQ Q+QQ+    S 
Sbjct  99    NKRAKIEVAQLQVELERMNAENQKLRGMLNQVTNNYSTLQMHLVTLMQQQSQQNRGAESL  158

Query  1493  QDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLS-AG  1317
             Q+      KS+EKK E     VPRQF++L P   A     TDE SQS  +SEERT   +G
Sbjct  159   QEHGSVGGKSDEKKHEVAGAVVPRQFIDLGPTATA----DTDEPSQS--SSEERTRDLSG  212

Query  1316  SPRNNNTELSRHKGIIAREDSPDSES--WApnklpklnpskPVDQAAEATMRKARVSVRA  1143
             SP+N+       KG   RE+SP+SE+  W  NK  KL+P K +DQ+AEATMRKARVSVRA
Sbjct  213   SPQNHQ---ENGKGA-GREESPESETQGWVQNKASKLSPPKTIDQSAEATMRKARVSVRA  268

Query  1142  RSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYE  963
             RSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDR+ILITTYE
Sbjct  269   RSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRSILITTYE  328

Query  962   GThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASA  783
             GTHNHPLPPAAMAMASTTSAAANMLLSG+M SADG+MN NFLAR ILPCSS++ATISASA
Sbjct  329   GTHNHPLPPAAMAMASTTSAAANMLLSGSMSSADGLMNPNFLARTILPCSSNMATISASA  388

Query  782   PFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYP-----QLPQVFGQGLYNQS  618
             PFPTVTLDLT TP+ L  YQRP +QF  PF  AP   Q++P      LPQVF Q LYNQS
Sbjct  389   PFPTVTLDLTHTPSPL-QYQRPTSQFPVPF-AAPA--QSFPSAQTSSLPQVFSQALYNQS  444

Query  617   KFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALA  438
             KFSGL +S QD+        + A Q       PQ    ADT+SAATAAIT+DPNFTAALA
Sbjct  445   KFSGLQLS-QDM--------ESAHQAPPTLHQPQPASLADTVSAATAAITADPNFTAALA  495

Query  437   AAISSIMGGGS  405
             AAI+SI+GGG+
Sbjct  496   AAITSIIGGGA  506



>ref|XP_006348143.1| PREDICTED: WRKY transcription factor 6-like isoform X1 [Solanum 
tuberosum]
Length=553

 Score =   458 bits (1179),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 347/565 (61%), Positives = 402/565 (71%), Gaps = 64/565 (11%)
 Frame = -1

Query  2027  MDKGWGLTLE----NPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPINPAAEK  1860
             MDKGWGLTLE    N DR AGFF NKPVFGFNLSP+ N                + + EK
Sbjct  1     MDKGWGLTLETSSSNSDR-AGFFKNKPVFGFNLSPKYNAGEM-----------FSSSDEK  48

Query  1859  RGPPNEVDFFSDKKADIVVKKEITLHGEPVTKAD----LNTGLQLVIANsgsdkstvdd-  1695
             R   NEVDFFSDKK   +VKKE +  G+   + D    +NTGLQLV AN+GSD+STVDD 
Sbjct  49    RSIVNEVDFFSDKKP--IVKKENS-QGDNSIRTDDQFVVNTGLQLVTANAGSDQSTVDDG  105

Query  1694  svssDMEERRAK-NDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQ  1518
               S  +E++RAK   L+ LQVELE+MN+ENQRL+GML+QV+++Y+ALQ HL  LMQ Q Q
Sbjct  106   VSSEVLEDKRAKIQQLAQLQVELERMNSENQRLKGMLTQVNSSYSALQMHLVTLMQQQQQ  165

Query  1517  Q--SSRIGSTQDREVADRKSeekkpekeePT-VPRQFLELVPgggaaaaAQTDEASQSHT  1347
             Q  +S+  +T   EV   KS+E+K ++   T VPRQF+EL P G        DE S SH+
Sbjct  166   QQLNSKTENTHPHEVVGAKSDEEKKKENNGTIVPRQFMELGPSGSKVDP--MDEPSHSHS  223

Query  1346  TSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWA--pnklpklnpskPVDQAAEAT  1173
             +SEERTLS GSPRNN   +SR K I  RE+SP+SESW          +PSKPV+Q+ EAT
Sbjct  224   SSEERTLS-GSPRNNMELVSRDKAI-NREESPESESWVPNKAPKLMNSPSKPVEQSTEAT  281

Query  1172  MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAE  993
             MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA+
Sbjct  282   MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAD  341

Query  992   DRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCS  813
             DRTILITTYEG HNHPLPPAAMAMASTTSAAANMLLSG+MPSADG+MNTNFLARA+LPCS
Sbjct  342   DRTILITTYEGAHNHPLPPAAMAMASTTSAAANMLLSGSMPSADGLMNTNFLARAMLPCS  401

Query  812   SSVATISASAPFPTVTLDLT-QTPN-SLPNYQRPPTQ----FQAPFTGAPQIPQ-----N  666
             S++ATISASAPFPTVTLDLT Q PN +L NY +   Q    FQ P       P      +
Sbjct  402   SNMATISASAPFPTVTLDLTAQNPNGALSNYHQRINQANPHFQFPLPAGLNHPNFAASMS  461

Query  665   YPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSA  486
              PQ+P + GQ LYNQSKFSGL +S  +I    + +                    DTLSA
Sbjct  462   APQMPHILGQPLYNQSKFSGLQISQDNIHHHPSISH-------------------DTLSA  502

Query  485   ATAAITSDPNFTAALAAAISSIMGG  411
             ATAAIT+DPNFTAALAAAISSI+GG
Sbjct  503   ATAAITADPNFTAALAAAISSIIGG  527



>gb|AGV75939.1| WRKY transcription factor 31 [Gossypium hirsutum]
Length=561

 Score =   451 bits (1161),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 327/580 (56%), Positives = 389/580 (67%), Gaps = 74/580 (13%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNK------PVFGFNLSPRL--NPINgggsggga--GMVPI  1878
             M+KGWGLTL N D  + FF NK      PVF     P +   P++  GS           
Sbjct  1     MEKGWGLTLGNSDPVSSFFHNKTNSTAGPVFRLKQHPDMLQFPVSLAGSREDRPGTSSSS  60

Query  1877  NPAAE-KRGPPNEVDFFSDKKADIV---------VKKEITLHGEPVTKAD---LNTGLQL  1737
             +PA++  R   +EVDFFSDKK  +V         VK E T HG     +D   +NTGL L
Sbjct  61    SPASDDNRVAVDEVDFFSDKKHGVVDEKKTGTVTVKTETTSHGRDGPSSDHLDVNTGLHL  120

Query  1736  VIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTAL  1557
             +  + G    T         E++R KN L+ LQ E +++NAENQ+LR M+S VS NYTAL
Sbjct  121   LTVDGGKSSET---------EDKREKNALAELQAEFKRVNAENQKLRNMISHVSNNYTAL  171

Query  1556  QQHLSNLMQ-HQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaa  1380
             Q HL  LMQ H+N+++    STQ+ E+ + KSE KK E     VPRQF+ELVP  G A  
Sbjct  172   QMHLVTLMQQHRNREAK---STQEHEIQEVKSEVKKDEV---VVPRQFMELVPHSGTA--  223

Query  1379  AQTDEASQSHTTSEERTLSAGSPRNNNTELSRHKGIIA---------------REDSPDS  1245
              +TDE   +H +SEERT S   P  NN E++    I                 RE+SP+S
Sbjct  224   -ETDE--MTHPSSEERTRSGSPP--NNVEVASKDSIKGKNEISQFNQEERAGKREESPES  278

Query  1244  ESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPC  1065
             + W PNK  KLNP+KP++Q+ EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPC
Sbjct  279   DGWGPNKAQKLNPAKPIEQSTEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPC  338

Query  1064  PRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmll  885
             PRAYYRCTMAVGCPVRKQVQRCAE+RTILITTYEG HNHPLPPAAMAMASTTSAAA+MLL
Sbjct  339   PRAYYRCTMAVGCPVRKQVQRCAEERTILITTYEGNHNHPLPPAAMAMASTTSAAASMLL  398

Query  884   SGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQF  705
             SG+MPSADG+MN N LAR ILP SSS+ATISASAPFPTVTLDLTQ+PN L  +QRPP QF
Sbjct  399   SGSMPSADGIMNPNLLARTILP-SSSMATISASAPFPTVTLDLTQSPNPL-KFQRPPPQF  456

Query  704   QAPFTGAPQ--IPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhp  531
               PF+G PQ     + PQLPQ FGQ  +NQSKFSGL +S +D+ ++     QL Q Q   
Sbjct  457   DGPFSGLPQNLASLSAPQLPQAFGQPPFNQSKFSGLQLS-KDMGSSQLGHPQLQQPQLPT  515

Query  530   apppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                      AD +SAATAAIT+DP+FTAALAAAI+SI+GG
Sbjct  516   --------LADKVSAATAAITTDPSFTAALAAAITSIIGG  547



>gb|AIE43884.1| WRKY transcription factor 76 [Gossypium hirsutum]
Length=564

 Score =   449 bits (1156),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 327/583 (56%), Positives = 387/583 (66%), Gaps = 77/583 (13%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNK------PVFGFNLSPRL--NPINgggsggga--GMVPI  1878
             M+KGWGLTL N D  + FF NK      PVF     P +   P++  GS           
Sbjct  1     MEKGWGLTLGNSDPVSSFFHNKTNSTAGPVFRLKQHPDMLQFPVSLAGSREDRPGTSSSS  60

Query  1877  NPAAE-KRGPPNEVDFFSDKKADIV---------VKKEITLHGEPVTKAD---LNTGLQL  1737
             +PA++  R   +EVDFFSDKK  +V         VK E T HG     +D   +NTGL L
Sbjct  61    SPASDDNRVAVDEVDFFSDKKHGVVDEKKTGTVTVKTETTSHGRDGPSSDHLDVNTGLHL  120

Query  1736  VIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTAL  1557
             +  + G    T         E++R KN L+ LQ E +++NAENQ+LR M+S VS NYTAL
Sbjct  121   LTVDGGKSSET---------EDKREKNALAELQAEFKRVNAENQKLRNMISHVSNNYTAL  171

Query  1556  QQHLSNLMQ-HQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaa  1380
             Q HL  LMQ H+N+++    STQ+ E+ + KSE KK E     VPRQF+ELVP  G A  
Sbjct  172   QMHLVTLMQQHRNREAK---STQEHEIQEVKSEVKKDEV---VVPRQFMELVPHSGTA--  223

Query  1379  AQTDEASQSHTTSEERTLSAGSPRNNNTELSRHKGI------------------IAREDS  1254
              +TD    +H +SEERT S   P  NN E++    I                  I RE+S
Sbjct  224   -ETD--VMTHPSSEERTRSGSPP--NNVEVASKDSIKGRNEISQFNQEERDGKRIDREES  278

Query  1253  PDSESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKG  1074
             P+S+ W PNK  KLNP+KP++Q+ E TMRKARVSVRARSEAPMISDGCQWRKYGQKMAKG
Sbjct  279   PESDGWGPNKAQKLNPAKPIEQSTEVTMRKARVSVRARSEAPMISDGCQWRKYGQKMAKG  338

Query  1073  NPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaan  894
             NPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTTSAAA+
Sbjct  339   NPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTSAAAS  398

Query  893   mllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPP  714
             MLLSG+MPS DGMMN N LAR ILP SSS+ATISASAPFPTVTLDLTQ+PN L  +QRPP
Sbjct  399   MLLSGSMPSTDGMMNPNLLARTILP-SSSMATISASAPFPTVTLDLTQSPNPL-KFQRPP  456

Query  713   TQFQAPFTGAPQ--IPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqq  540
              QF  PF+G PQ     + PQLPQ FGQ  +NQSKFSGL +S +D+ ++     QL Q Q
Sbjct  457   PQFDGPFSGLPQNLASLSAPQLPQAFGQPPFNQSKFSGLQLS-KDMGSSQLGHPQLQQPQ  515

Query  539   qhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                         AD +SAATAAIT+DP+FTAALAAAI+SI+GG
Sbjct  516   LPT--------LADKVSAATAAITTDPSFTAALAAAITSIIGG  550



>gb|AIY62467.1| WRKY31 [Gossypium aridum]
Length=565

 Score =   448 bits (1152),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 327/583 (56%), Positives = 388/583 (67%), Gaps = 77/583 (13%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNK------PVFGFNLSPRL--NPINgggsggg--aGMVPI  1878
             M+KGWGLTL N D  + FF NK      PVF     P +   P++  GS           
Sbjct  1     MEKGWGLTLGNSDPVSSFFHNKTNSTAGPVFRLKQHPDMLQFPVSLAGSREDLPGTSSSS  60

Query  1877  NPAAE-KRGPPNEVDFFSDKKADIV---------VKKEITLHGEPVTKAD---LNTGLQL  1737
             +PA++  R   +EVDFFS+KK  +V         VK E T HG     +D   +NTGL L
Sbjct  61    SPASDDNRVAVDEVDFFSNKKHGVVDEKKTGTVTVKTETTSHGGDGPSSDHLDVNTGLHL  120

Query  1736  VIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTAL  1557
             +  + G    T         E++R KN L+ LQ E +++N ENQ+LR M+S VS NYTAL
Sbjct  121   LTVDGGKSSET---------EDKREKNALAELQAEFKRVNVENQKLRNMISHVSNNYTAL  171

Query  1556  QQHLSNLMQ-HQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaa  1380
             Q HL  LMQ H+N+++    STQ+ E+ + KSE KK E     VPRQF+ELVP  G A  
Sbjct  172   QMHLVTLMQQHRNREAK---STQEHEIQEVKSEVKKDEV---VVPRQFMELVPHSGTA--  223

Query  1379  AQTDEASQSHTTSEERTLSAGSPRNNNTELSRHKGI------------------IAREDS  1254
              +TDE   +H +SEERT S   P  NN E++    I                  I RE+S
Sbjct  224   -ETDE--MTHPSSEERTRSGSPP--NNVEVASKDSIKGKNEISQFNQEERDGKRIDREES  278

Query  1253  PDSESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKG  1074
             P+S+ W PNK  KLNP+KP++Q+ EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKG
Sbjct  279   PESDGWGPNKAQKLNPAKPIEQSTEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKG  338

Query  1073  NPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaan  894
             NPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTTSAAA+
Sbjct  339   NPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTSAAAS  398

Query  893   mllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPP  714
             MLLSG+MPSADG+MN N LAR ILP SSS+ATISASAPFPTVTLDLTQ+PN L  +QRPP
Sbjct  399   MLLSGSMPSADGIMNPNLLARTILP-SSSMATISASAPFPTVTLDLTQSPNPL-KFQRPP  456

Query  713   TQFQAPFTGAPQ--IPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqq  540
              QF  PF G PQ     + PQLPQ FGQ  +NQSKFSGL +S +D+ ++     QL Q Q
Sbjct  457   PQFDGPFPGQPQNLASLSSPQLPQAFGQPPFNQSKFSGLQLS-KDMGSSQLGHPQLQQPQ  515

Query  539   qhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                         AD +SAATAAIT+DP+FTAALAAAI+SI+GG
Sbjct  516   LPT--------LADKVSAATAAITNDPSFTAALAAAITSIIGG  550



>ref|XP_010252466.1| PREDICTED: probable WRKY transcription factor 31 [Nelumbo nucifera]
Length=613

 Score =   449 bits (1156),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 331/592 (56%), Positives = 394/592 (67%), Gaps = 71/592 (12%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPV-----FGFNLSPRLN------PINgggsgggaGMVP  1881
             MDKG GLT+++ +   GFF  KP      F  +  P+        P+N       A  VP
Sbjct  1     MDKGGGLTIDSSE--IGFFVTKPTAIKSSFLTSNHPKWKHDLMDFPVNLNCRDETASPVP  58

Query  1880  INPAAEKRGPPNEVDFFSDKK---------ADIVVKKEITLHG-EPVTKADLNTGLQLVI  1731
              +   EKR   +E+DFFSDK          + I +KKE +  G  P    D+NTGL L+ 
Sbjct  59    SD---EKR--IDEMDFFSDKNRLKDFDAKASTIDIKKEDSHGGVAPRLNLDVNTGLHLLT  113

Query  1730  ANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQ  1551
             AN+GSD+STVDD VS +  +++AK++L+ LQ EL++MN ENQRL+ MLSQVS NY ALQ 
Sbjct  114   ANNGSDQSTVDDGVSPNSGDKKAKSELAALQSELDRMNEENQRLKAMLSQVSNNYNALQM  173

Query  1550  HLSNLMQHQNQQSSRIGSTQDREVADRK-SeekkpekeePTVPRQFLELVPgggaaaaAQ  1374
             HL  LMQ QN+++    +TQ+ E++D K   +K+     P VPRQF++L P   A     
Sbjct  174   HLVTLMQQQNRKAE---NTQEHEISDGKLEGKKQDAGGGPMVPRQFMDLGPAATA----D  226

Query  1373  TDEASQSHTTSEERTLSAGSPRNNNTEL-------------------SRHKGI------I  1269
             TDE SQS +    R  S GSP NN  E+                    + KG       I
Sbjct  227   TDEPSQSSSEGRSRDRS-GSPHNNAVEVVSKEYRQQKNNSSNEIVPFDQDKGDFGEGRGI  285

Query  1268  AREDSPDSESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQ  1089
              RE+SP+ + WA NK+PKLNPSK  DQ+ EATMRKARVSVRARSEAPMI+DGCQWRKYGQ
Sbjct  286   GREESPN-QGWAANKIPKLNPSKNADQSTEATMRKARVSVRARSEAPMITDGCQWRKYGQ  344

Query  1088  KMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamastt  909
             KMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMASTT
Sbjct  345   KMAKGNPCPRAYYRCTMAAGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMASTT  404

Query  908   saaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPN  729
             SAAA MLLSG+M SADG++N+NFL R +LPCSSS+ATISASAPFPTVTLDLT  PN L  
Sbjct  405   SAAACMLLSGSMSSADGLINSNFLTRTLLPCSSSMATISASAPFPTVTLDLTHNPNPL-Q  463

Query  728   YQRPPTQFQAPFTGAPQI--PQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaq  555
             +QRPPTQF  PF   PQ    Q  P L QVFGQ LYNQSKFSGL +S QD+      A  
Sbjct  464   FQRPPTQFHVPFPNQPQTFPSQPAPPLAQVFGQTLYNQSKFSGLQIS-QDV----EPAQF  518

Query  554   laqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQP  399
             + Q         Q   FADT+SAATAAIT+DPNFTAALAAAI+SI+GGG +P
Sbjct  519   VNQPPPPQLHQAQQTSFADTVSAATAAITADPNFTAALAAAITSIIGGGVRP  570



>ref|XP_002518444.1| WRKY transcription factor, putative [Ricinus communis]
 gb|EEF43831.1| WRKY transcription factor, putative [Ricinus communis]
Length=580

 Score =   441 bits (1135),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 323/594 (54%), Positives = 385/594 (65%), Gaps = 86/594 (14%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFF-----TNKPVFGFNLSPRLNPINgggsgggaGMVPIN----  1875
             MDKGWGLTL++      FF      NKP   F    ++N  N   +     M P +    
Sbjct  1     MDKGWGLTLDSDHPVFSFFPNSATANKPADSF---LKINKRNSFDASDPVRMFPFSVNLP  57

Query  1874  -PAAEKRGPPNEVDFFSDKKADIV---------------VKKEITLHGEPVTKADLNTGL  1743
              PA + R    EVDFFS+KK ++V               VKKE +         D+NTGL
Sbjct  58    SPADDNRLIVGEVDFFSEKKNNVVSDNHHSDDSKTTTISVKKENSYADIAPKSNDVNTGL  117

Query  1742  QLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYT  1563
              L+ AN+GSD+STVDD  SS+++++R+K +L+ LQ++L++MN ENQRLR ML+QV+ NY 
Sbjct  118   HLLTANTGSDQSTVDDGASSEVDDKRSKFELAQLQIDLQRMNNENQRLRDMLTQVTNNYN  177

Query  1562  ALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaa  1383
             ALQ HL  LMQ Q QQ+    +T + EV   KSEEKK E     VPRQFL+L P      
Sbjct  178   ALQMHLVALMQQQQQQNHGPEATHEHEVVQGKSEEKKHE----VVPRQFLDLGPSA----  229

Query  1382  aAQTDEASQSHTTSEERTLSAGSPRNN--------------------NTELSRHKGIIAR  1263
               +TDE S  H++S++    +G+P+ N                    N+     KGI  R
Sbjct  230   --ETDEIS--HSSSDDERTRSGTPQTNTETASVKNNGKIEMSTFDQENSSFRDGKGI-GR  284

Query  1262  EDSPDSES--W-ApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYG  1092
             E+SP+SE+  W           SK +DQ AEATMRKARVSVRARSEAPMI+DGCQWRKYG
Sbjct  285   EESPESETQGWNPNKVQKLNPASKGIDQNAEATMRKARVSVRARSEAPMITDGCQWRKYG  344

Query  1091  QKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamast  912
             QKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAED +ILITTYEG HNHPLPPAAMAMAST
Sbjct  345   QKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDTSILITTYEGNHNHPLPPAAMAMAST  404

Query  911   tsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLP  732
             T+AAA+MLLSG+M SADG+MN N LARAILPCSSS+ATISASAPFPTVTLDLT +PN L 
Sbjct  405   TTAAASMLLSGSMSSADGIMNPNLLARAILPCSSSMATISASAPFPTVTLDLTHSPNPL-  463

Query  731   NYQRPPTQFQAPFTGAPQ-----IPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaa  567
               QRPPT FQ PF G PQ      PQ   QLPQVFGQ LYNQSKFSGL +S +       
Sbjct  464   QVQRPPTHFQVPFPGQPQNFASVTPQ---QLPQVFGQALYNQSKFSGLQLSQE-------  513

Query  566   qaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGS  405
                     Q     P Q     D++SAATAAIT+DPNFTAALAAAI+SI+GGG+
Sbjct  514   ------LPQSQQLHPSQQHSLVDSVSAATAAITADPNFTAALAAAITSIIGGGN  561



>ref|XP_009587051.1| PREDICTED: probable WRKY transcription factor 31 [Nicotiana tomentosiformis]
Length=490

 Score =   438 bits (1126),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 320/493 (65%), Positives = 363/493 (74%), Gaps = 54/493 (11%)
 Frame = -1

Query  1871  AAEKRGPPNEVDFFSDKK---ADIVVKKEITLHGEPVTKAD----LNTGLQLVIANsgsd  1713
             A EK    NEVDFFSDK+    D+V+KKE + HGE  T       +NTGLQLV  N+GSD
Sbjct  15    ADEKGVMLNEVDFFSDKRIKPMDVVIKKEDS-HGENTTSTRSELLVNTGLQLVSVNTGSD  73

Query  1712  kstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLM  1533
             +STVDD +SS++E++R K +L+ LQVEL +MNAENQRLRGMLSQVS NYTALQ HL  LM
Sbjct  74    QSTVDDGISSEIEDKRVKIELAQLQVELGRMNAENQRLRGMLSQVSNNYTALQMHLVTLM  133

Query  1532  QHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDE---A  1362
             Q Q  Q SR  +  D E+ + K EEKK EK+   VPRQFLEL P          DE    
Sbjct  134   QQQ--QISR--TENDHEIVEAKLEEKKQEKDGNMVPRQFLELGPSE------HMDEPYSL  183

Query  1361  SQSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAA  1182
             +  +++SEERT+S  SPRNN  E++RHKGI  RE++P+SES   NK+PKLN S P+DQA 
Sbjct  184   NSHYSSSEERTVSE-SPRNN-IEVTRHKGI-GREETPESES---NKVPKLNSSNPIDQAT  237

Query  1181  EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQR  1002
             EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQR
Sbjct  238   EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQR  297

Query  1001  CAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAIL  822
             CAEDRTILITTYEGTHNHPLPPAAMAMASTTSAAANMLLSG+MPSADG+MN+NFLAR IL
Sbjct  298   CAEDRTILITTYEGTHNHPLPPAAMAMASTTSAAANMLLSGSMPSADGLMNSNFLARTIL  357

Query  821   PCSSSVATISASAPFPTVTLDLTQTPNSLPNYQR---PPTQFQAPFTGAPQIPQNY----  663
             P SSSVATISASAPFPT+TLDLTQ  NS+  Y +   P  QFQ PF   P  P N+    
Sbjct  358   PSSSSVATISASAPFPTITLDLTQNQNSISYYHQRTHPTAQFQVPFPIGPHNP-NFITSM  416

Query  662   --PQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLS  489
               P +PQV    L+NQSKFSGL VS QDI              Q P      P F+DTL+
Sbjct  417   PPPPMPQV----LHNQSKFSGLQVS-QDI------------HHQPPQHALNQPSFSDTLN  459

Query  488   AATAAITSDPNFT  450
             AATAAIT+DPNFT
Sbjct  460   AATAAITADPNFT  472



>ref|XP_010244474.1| PREDICTED: probable WRKY transcription factor 31 [Nelumbo nucifera]
Length=608

 Score =   440 bits (1132),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 326/591 (55%), Positives = 391/591 (66%), Gaps = 77/591 (13%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVF----------GFNLSPRLNPINgggsgggaGMVPI  1878
             MDKG GLT+++ +   GFF  KP             +   P   P+N          VP 
Sbjct  1     MDKGGGLTIDSSE--IGFFVTKPTAIKSFLTTNHPKWKHDPMDFPVNLNCRDDQDSPVPS  58

Query  1877  NPAAEKRGPPNEVDFFSDK--------KADIVVKKEITLHGEPVTKADL--NTGLQLVIA  1728
             +   EKR   +E+DFFSDK        KA I+  K+   HG    + DL  NTGL L+ A
Sbjct  59    D---EKRV--DEMDFFSDKNRLKDFDAKASIIDVKKEDSHGGVAPRLDLAVNTGLHLLTA  113

Query  1727  NsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQH  1548
             N+GSD+STVDD +S + +++RAK++L+ LQ EL++MN ENQRLR MLSQV+ NY+ALQ H
Sbjct  114   NTGSDQSTVDDGISPNADDKRAKSELAALQTELDRMNEENQRLRAMLSQVTNNYSALQMH  173

Query  1547  LSNLMQHQNQQSSRIGSTQDREVADRK-SeekkpekeePTVPRQFLELVPgggaaaaAQT  1371
             L  LMQ QN+++    S QD+E+ D K  E+K    E   VPRQF++L P   A    +T
Sbjct  174   LVTLMQQQNRKAE---SAQDQEMLDGKLEEKKHEAGEGLIVPRQFMDLGPAATA----ET  226

Query  1370  DEASQSHTTSEERTLSAGSPRNN-------------------------NTELSRHKGIIA  1266
             DE SQS +    R  S GSP NN                          ++    +GI  
Sbjct  227   DEPSQSSSEGRSRDHS-GSPHNNAEVVSKEYRQQKNSSNNEIVLFDQDKSDFGEDRGI-G  284

Query  1265  REDSPDSESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQK  1086
             RE+SPD + W  NK+PKLNPSK VDQ  EATMRKARVSVRARSEAPMI+DGCQWRKYGQK
Sbjct  285   REESPD-QGWVANKIPKLNPSKNVDQTTEATMRKARVSVRARSEAPMITDGCQWRKYGQK  343

Query  1085  MAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamastts  906
             MAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMASTTS
Sbjct  344   MAKGNPCPRAYYRCTMAAGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMASTTS  403

Query  905   aaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNY  726
             AAA+MLLSG+M S DG++N+NFLAR +LPCSSS+ATISASAPFPTVTLDLT TPN L  +
Sbjct  404   AAASMLLSGSMSSTDGLLNSNFLARTLLPCSSSMATISASAPFPTVTLDLTHTPNPL-QF  462

Query  725   QRPPTQFQAPFTGAPQIPQNYPQLP-----QVFGQGLYNQSKFSGLHVSHQDIaaaaaqa  561
             QRPP+QF  PF   P   Q++P  P     QVFGQ LYNQ+KFSGL +S QD+      +
Sbjct  463   QRPPSQFHVPF---PNQAQSFPSQPAPPLTQVFGQALYNQTKFSGLQLS-QDV----EPS  514

Query  560   aqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGG  408
               + Q         Q P  ADT+SAATAAIT+DPNFTAALAAAI+SI+GG 
Sbjct  515   QFVHQSPAPAPHQAQQPSLADTVSAATAAITADPNFTAALAAAITSIIGGA  565



>emb|CBI23209.3| unnamed protein product [Vitis vinifera]
Length=510

 Score =   432 bits (1111),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 316/546 (58%), Positives = 374/546 (68%), Gaps = 70/546 (13%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFG-FNLSPRLNPINgggsgggaGMVPINPAAEKRGP  1851
             MDKGWGLTL++    +  F NK   G     P L+             +P+    E+R  
Sbjct  1     MDKGWGLTLDSIAINS--FLNKRSRGILESGPMLD-------------MPV--GDERR--  41

Query  1850  PNEVDFFSDKKADIVVKKEITLHGEP-VTKADLNTGLQLVIANsgsdkstvddsvssDME  1674
               EVDFF++K   + VKKE +   E  +T  D+NTGL L+ AN+GSD+STV+D      E
Sbjct  42    --EVDFFAEKTRSVSVKKENSHVDEAAITDLDVNTGLNLLTANAGSDQSTVEDENPDR-E  98

Query  1673  ERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGST  1494
              +RAK +++ LQVELE+MNAENQ+LRGML+QV+ NY+ LQ HL  LMQ Q+QQ+    S 
Sbjct  99    NKRAKIEVAQLQVELERMNAENQKLRGMLNQVTNNYSTLQMHLVTLMQQQSQQNRGAESL  158

Query  1493  QDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLS-AG  1317
             Q+      KS+EKK E     VPRQF++L P   A     TDE SQS  +SEERT   +G
Sbjct  159   QEHGSVGGKSDEKKHEVAGAVVPRQFIDLGPTATA----DTDEPSQS--SSEERTRDLSG  212

Query  1316  SPRNNNTELSRHKGIIAREDSPDSES--WApnklpklnpskPVDQAAEATMRKARVSVRA  1143
             SP+N+       KG   RE+SP+SE+  W  NK  KL+P K +DQ+AEATMRKARVSVRA
Sbjct  213   SPQNHQ---ENGKGA-GREESPESETQGWVQNKASKLSPPKTIDQSAEATMRKARVSVRA  268

Query  1142  RSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYE  963
             RSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDR+ILITTYE
Sbjct  269   RSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRSILITTYE  328

Query  962   GThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASA  783
             GTHNHPLPPAAMAMASTTSAAANMLLSG+M SADG+MN NFLAR ILPCSS++ATISASA
Sbjct  329   GTHNHPLPPAAMAMASTTSAAANMLLSGSMSSADGLMNPNFLARTILPCSSNMATISASA  388

Query  782   PFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGL  603
             PFPTVTLDLT TP+ L  YQRP +                        Q LYNQSKFSGL
Sbjct  389   PFPTVTLDLTHTPSPL-QYQRPTSH-----------------------QALYNQSKFSGL  424

Query  602   HVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISS  423
              +S QD+        + A Q       PQ    ADT+SAATAAIT+DPNFTAALAAAI+S
Sbjct  425   QLS-QDM--------ESAHQAPPTLHQPQPASLADTVSAATAAITADPNFTAALAAAITS  475

Query  422   IMGGGS  405
             I+GGG+
Sbjct  476   IIGGGA  481



>gb|AGQ04220.1| WRKY transcription factor 31 [Jatropha curcas]
Length=594

 Score =   433 bits (1113),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 309/589 (52%), Positives = 372/589 (63%), Gaps = 65/589 (11%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGM-VPIN--------  1875
             MDKGWGLTL++ D    FF+N P    +   ++N      S        P+N        
Sbjct  1     MDKGWGLTLDS-DPPLTFFSNAPSLVVDSFHKINKRTFDMSDSVRMFPFPVNLPARDDRP  59

Query  1874  ---PAAEKRGPPNEVDFFSDKKA-------------------DIVVKKEITLHGE--PVT  1767
                P  + R    EVDFFSDKK                     + VKKE + +GE  P +
Sbjct  60    SHSPDDDDRVVVGEVDFFSDKKTRPIGDNTNNDNDNDDSKATSVTVKKENS-YGEAAPRS  118

Query  1766  KADLNTGLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGML  1587
              AD+NTGL L+   S         S    ++++R+K++L+ LQVEL++MN+ENQRLR ML
Sbjct  119   SADVNTGLHLLTTGSDQSTVDDGVSSD--VDDKRSKSELAQLQVELQRMNSENQRLRDML  176

Query  1586  SQVSTNYTALQQHLSNLMQHQNQQSSRIGS--TQDREVADRKSeekkpekeePTVPRQFL  1413
             SQV+ NY ALQ HL+ LMQ   QQ   +G+   Q+ EV   K      EK+   VPRQFL
Sbjct  177   SQVTNNYNALQMHLAALMQ---QQRHNLGTEAAQENEVVQGK----PDEKKHEVVPRQFL  229

Query  1412  ELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNT-ELS---------RHKGIIAR  1263
             +L P   A   + +    ++ +++ +  + A S RNN   E+          R    I R
Sbjct  230   DLGPSAEADEISNSSSDERTRSSTPQTNIDAASVRNNGKLEMGSYDQENSSFRDGKRIGR  289

Query  1262  EDSPDSES--WA--pnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKY  1095
             E+SP+SES  W     +    + +K +DQ+ EATMRKARVSVRARSEAPMI+DGCQWRKY
Sbjct  290   EESPESESQGWNPNKLQKLNSSANKGIDQSTEATMRKARVSVRARSEAPMITDGCQWRKY  349

Query  1094  GQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamas  915
             GQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMAS
Sbjct  350   GQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMAS  409

Query  914   ttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSL  735
             TT+AAA+MLLSG+M SADG+MN + LARAILPCSSS+ATISASAPFPTVTLDLT  PN L
Sbjct  410   TTTAAASMLLSGSMSSADGIMNPSLLARAILPCSSSMATISASAPFPTVTLDLTHNPNPL  469

Query  734   PNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaq  555
                QRPPT FQ PF G  Q     PQLPQVFGQ LYNQSKFSGL +S +      +    
Sbjct  470   -QAQRPPTHFQVPFGGQSQNNFAGPQLPQVFGQALYNQSKFSGLQLSQE----MGSSQLH  524

Query  554   laqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGG  408
                Q Q      Q P   DT+SAATAAIT+DPNFTAALAAAI+SI+GG 
Sbjct  525   HQSQPQLLHSSQQPPSLVDTVSAATAAITADPNFTAALAAAITSIIGGA  573



>gb|KDP20717.1| hypothetical protein JCGZ_21188 [Jatropha curcas]
Length=594

 Score =   431 bits (1107),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 308/589 (52%), Positives = 371/589 (63%), Gaps = 65/589 (11%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGM-VPIN--------  1875
             MDKGWGLTL++ D    FF+N P    +   ++N      S        P+N        
Sbjct  1     MDKGWGLTLDS-DPPLTFFSNAPSLVVDSFHKINKRTFDMSDSVRMFPFPVNLPARDDRP  59

Query  1874  ---PAAEKRGPPNEVDFFSDKKA-------------------DIVVKKEITLHGE--PVT  1767
                P  + R    EVDFFSDKK                     + VKKE + +GE  P +
Sbjct  60    SHSPDDDDRVVVGEVDFFSDKKTRPIGDNTNNDNDNDDSKATSVTVKKENS-YGEAAPRS  118

Query  1766  KADLNTGLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGML  1587
              AD+ TGL L+   S         S    ++++R+K++L+ LQVEL++MN+ENQRLR ML
Sbjct  119   SADVKTGLHLLTTGSDQSTVDDGVSSD--VDDKRSKSELAQLQVELQRMNSENQRLRDML  176

Query  1586  SQVSTNYTALQQHLSNLMQHQNQQSSRIGS--TQDREVADRKSeekkpekeePTVPRQFL  1413
             SQV+ NY ALQ HL+ LMQ   QQ   +G+   Q+ EV   K      EK+   VPRQFL
Sbjct  177   SQVTNNYNALQMHLAALMQ---QQRHNLGTEAAQENEVVQGK----PDEKKHEVVPRQFL  229

Query  1412  ELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNT-ELS---------RHKGIIAR  1263
             +L P   A   + +    ++ +++ +  + A S RNN   E+          R    I R
Sbjct  230   DLGPSAEADEISNSSSDERTRSSTPQTNIDAASVRNNGKLEMGSYDQENSSFRDGKRIGR  289

Query  1262  EDSPDSES--WA--pnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKY  1095
             E+SP+SES  W     +    + +K +DQ+ EATMRKARVSVRARSEAPMI+DGCQWRKY
Sbjct  290   EESPESESQGWNPNKLQKLNSSANKGIDQSTEATMRKARVSVRARSEAPMITDGCQWRKY  349

Query  1094  GQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamas  915
             GQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMAS
Sbjct  350   GQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMAS  409

Query  914   ttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSL  735
             TT+AAA+MLLSG+M SADG+MN + LARAILPCSSS+ATISASAPFPTVTLDLT  PN L
Sbjct  410   TTTAAASMLLSGSMSSADGIMNPSLLARAILPCSSSMATISASAPFPTVTLDLTHNPNPL  469

Query  734   PNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaq  555
                QRPPT FQ PF G  Q     PQLPQVFGQ LYNQSKFSGL +S +      +    
Sbjct  470   -QAQRPPTHFQVPFGGQSQNNFAGPQLPQVFGQALYNQSKFSGLQLSQE----MGSSQLH  524

Query  554   laqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGG  408
                Q Q      Q P   DT+SAATAAIT+DPNFTAALAAAI+SI+GG 
Sbjct  525   HQSQPQLLHSSQQPPSLVDTVSAATAAITADPNFTAALAAAITSIIGGA  573



>ref|XP_004293312.1| PREDICTED: WRKY transcription factor 6-like [Fragaria vesca subsp. 
vesca]
Length=571

 Score =   425 bits (1092),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 334/568 (59%), Positives = 387/568 (68%), Gaps = 50/568 (9%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFN----LSPRLNPINgggsgggaGMVPINPAAEK  1860
             MDKGWGLTLE+     GFF NKP  G      L+ R N        G    V   PA E 
Sbjct  1     MDKGWGLTLES--DSLGFFLNKPPPGAAAPPPLNKRTNLFGDRMFSGIEFPVKTRPADEN  58

Query  1859  RGPPNEVDFFSDKK----ADIVVKK---EITLHGEPVTKAD-LNTGLQLVIANsgsdkst  1704
             R    EVDFFSDKK     D  +K     +++  E  +  D +NTGL LV AN+GSD+ST
Sbjct  59    RTA--EVDFFSDKKNKSDDDHGLKSNNTSVSVKKENWSGLDAVNTGLHLVTANAGSDQST  116

Query  1703  vddsvssD-MEERRAKN-DLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQ  1530
             VDD VSSD  + +RAKN +L++LQVEL++MNAENQRL+ ML QV+ NYTALQ HL  +M 
Sbjct  117   VDDGVSSDPADSKRAKNHELALLQVELQRMNAENQRLKEMLGQVTNNYTALQTHLVAVMH  176

Query  1529  HQNQQSSRIGST-QDREVADRKSeekkpe--keePTVPRQFLELVPgggaaaaAQTDEAS  1359
              Q Q  +    T QDR+  + KSEEK+ E      TVPRQFL L P           E  
Sbjct  177   QQQQNQAAADQTSQDRDQNEEKSEEKRHEIGSSGATVPRQFLNLGPREETKT-----ENE  231

Query  1358  QSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSES--WApnklpklnpskP-VDQ  1188
              S+++SE RT S  SP+NN   +S +   + RE+SP+SE+  W PNK+ K +     +DQ
Sbjct  232   VSNSSSEARTRS-DSPQNN---VSANGKRVGREESPESETQGWVPNKVAKPDSPPKPIDQ  287

Query  1187  AAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQV  1008
             A EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQV
Sbjct  288   ATEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQV  347

Query  1007  QRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN-TNFLAR  831
             QRCA+DRTILITTYEG HNHPLPPAAMAMASTT+AAA+MLLSG+M SADG+MN  N LAR
Sbjct  348   QRCADDRTILITTYEGNHNHPLPPAAMAMASTTTAAASMLLSGSMSSADGIMNPNNLLAR  407

Query  830   AILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPT-QFQAPFTGAPQ---IPQNY  663
             AILPCSSSVATISASAPFPTVTLDLT +P     +QRP   QFQ PF G PQ      + 
Sbjct  408   AILPCSSSVATISASAPFPTVTLDLTTSPPL--QFQRPQQGQFQMPFPGQPQNFGSSGSS  465

Query  662   PQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAA  483
             PQLPQ FGQ LYNQSKFSGL +S + +          A Q Q      Q   FADT+SAA
Sbjct  466   PQLPQAFGQALYNQSKFSGLQLSQELL----------AHQAQQQQQQSQTSSFADTVSAA  515

Query  482   TAAITSDPNFTAALAAAISSIMGGGSQP  399
             TAAIT+DP FTAALAAAI+SI+GG S P
Sbjct  516   TAAITADPTFTAALAAAITSIIGGSSHP  543



>ref|XP_011046963.1| PREDICTED: probable WRKY transcription factor 31 [Populus euphratica]
Length=606

 Score =   423 bits (1087),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 327/596 (55%), Positives = 389/596 (65%), Gaps = 77/596 (13%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNK----PVFGF-----NLSPRLNPINgggsgggaGMVPIN  1875
             MDKGWGLTL + D  + F +N     PV  F     + S   N  +           P++
Sbjct  1     MDKGWGLTLAS-DPVSVFSSNNSNNSPVGSFLKVKRDFSSDHNMADSRNINNSMFQFPVS  59

Query  1874  PAAEKR----GPPNEVDFFSDK-----------KADIVVKKEITL-HGEPVTKA--DLNT  1749
              +A K         EVDFF +K              ++VKKE +L    P + A  D+NT
Sbjct  60    LSAGKEEVSSAAAQEVDFFKEKINRVDHGHDSKSTSVIVKKENSLAEVAPRSSAPLDVNT  119

Query  1748  GLQLVIANsgsdkstvddsvssDMEERRAKN-DLSVLQVELEKMNAENQRLRGMLSQVST  1572
             GL L+ AN+ SD+STVDD VSSD +++R+KN +L+ LQVEL+KMNAENQRL+ MLSQV+ 
Sbjct  120   GLHLLTANARSDQSTVDDGVSSDGDDKRSKNVELAQLQVELQKMNAENQRLKDMLSQVTN  179

Query  1571  NYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPggg  1392
             NY+ALQ H   L+Q Q Q++  + S + +E  D KS E+K  +    VPRQF++L P   
Sbjct  180   NYSALQMHFVALIQQQQQRNHGVESDKKQETVDAKSSEEKKHE---MVPRQFMDLGPSA-  235

Query  1391  aaaaAQTDEASQSHTTSEERTLS---------AGSPRNNNTELSRHK--------GIIAR  1263
                  +TDE S S  +SEERT S         A +  N   E++ H         G    
Sbjct  236   -----ETDEISNS--SSEERTRSVTPQNHFEVASTKNNGKLEMAPHDQENSSFRDGKRIG  288

Query  1262  EDSPDSES--W----ApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWR  1101
             ++SP+SES  W         P  + +K ++Q+AEATMRKARVSVRARSEAPMISDGCQWR
Sbjct  289   DESPESESQGWNPNKVQKLNPASSANKAIEQSAEATMRKARVSVRARSEAPMISDGCQWR  348

Query  1100  KYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamam  921
             KYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAED+TILITTYEG HNHPLPPAAM M
Sbjct  349   KYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDKTILITTYEGNHNHPLPPAAMTM  408

Query  920   asttsaaanmllSGAMPSADGMMNTNFLARAILP-CSSSVATISASAPFPTVTLDLTQTP  744
             ASTT+AAA MLLSG+M SADGMMN N LARAILP CSSS+ATISASAPFPTVTLDLTQ  
Sbjct  409   ASTTAAAATMLLSGSMSSADGMMNPNLLARAILPGCSSSMATISASAPFPTVTLDLTQNT  468

Query  743   NSLPNYQRPPTQFQAPFTGAPQIPQNY-----PQLPQVFGQGLYNQSKFSGLHVSHQDIa  579
             N L  +QRPPT FQ PF G    PQN+     PQLPQVFGQ LYNQSKFSGLH+S   ++
Sbjct  469   NPL-QFQRPPTHFQVPFPGQ---PQNFALVTAPQLPQVFGQALYNQSKFSGLHLSQDTVS  524

Query  578   aaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
             +     AQ         P   H    DTLSAATAAIT+DPNFTAALAAAISSI+GG
Sbjct  525   SQLGHQAQPQIFHSGQQPSLSH----DTLSAATAAITADPNFTAALAAAISSIIGG  576



>gb|AIE43908.1| WRKY transcription factor 90 [Gossypium hirsutum]
Length=503

 Score =   417 bits (1072),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 304/502 (61%), Positives = 354/502 (71%), Gaps = 40/502 (8%)
 Frame = -1

Query  1877  NPAAEKRGPPNEVDFFSDKKADIV--VKKEITLHGEPVTKADLNTGLQLVIANsgsdkst  1704
             +P+ + + P +EVDFFSDKK  +V  VKKE      P +  D+NTGL L+ A S      
Sbjct  24    SPSDDTKIPVDEVDFFSDKKVRVVDDVKKESI--ETPASDLDVNTGLLLLTAGSDQSTVD  81

Query  1703  vddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQ  1524
                S    ME++RAKN+L+ LQ EL++MNAENQ+L+ MLS VS NY+AL  HL  LMQ Q
Sbjct  82    DGVSSD--MEDKRAKNELAQLQDELKRMNAENQKLKDMLSHVSNNYSALHMHLVTLMQQQ  139

Query  1523  NQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELV-PgggaaaaAQTDEASQSHT  1347
              Q   R          +R+++  +  K E   P Q L+L  P    A AA+T     SH+
Sbjct  140   QQPPQR----------NRETQAIQKSKPEEVTPLQILDLSRPSAAGAEAAET----ISHS  185

Query  1346  TSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskP-VDQAAEATM  1170
             +SEERT S   P N           + RE+SP+SESW PN   +   S   VDQ+ EATM
Sbjct  186   SSEERTRSGTPPSNVEKR-------VNREESPESESWGPNCKVQKLNSGKPVDQSTEATM  238

Query  1169  RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAED  990
             RKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA+D
Sbjct  239   RKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCADD  298

Query  989   RTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSS  810
             RTILITTYEG HNHPLPPAAMAMASTT+AAA+MLLSG+MPSADG+MN N LARAILPCSS
Sbjct  299   RTILITTYEGNHNHPLPPAAMAMASTTAAAASMLLSGSMPSADGIMNPNLLARAILPCSS  358

Query  809   SVATISASAPFPTVTLDLTQTPNSLPNYQR---PPTQFQAPFTGAPQIPQNYPQLPQVFG  639
             S+ATISASAPFPTVTLDLT +PN L  +QR   PPTQFQ PF G P  P + PQLPQVFG
Sbjct  359   SMATISASAPFPTVTLDLTHSPNPL-QFQRPPPPPTQFQVPFPGQP-APVSAPQLPQVFG  416

Query  638   QGLY--NQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITS  465
             Q LY  NQSKFSGL +S +      +      QQQQH +PP Q P  ADT+SAATAAIT+
Sbjct  417   QPLYNNNQSKFSGLQLSQE----MGSSQLGRQQQQQHQSPPQQPPTLADTVSAATAAITN  472

Query  464   DPNFTAALAAAISSIMGGGSQP  399
             DPNFTAALAAAISSI+ GG+ P
Sbjct  473   DPNFTAALAAAISSIISGGTHP  494



>ref|XP_010916103.1| PREDICTED: probable WRKY transcription factor 31 [Elaeis guineensis]
Length=532

 Score =   417 bits (1073),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 301/520 (58%), Positives = 355/520 (68%), Gaps = 57/520 (11%)
 Frame = -1

Query  1883  PINPAAEKRGPPNEVDFFSDKKADIVVKK---EITLHGEPVTKADL--NTGLQLVIANsg  1719
             P+ PA EKR   +E+DFFSD+K     ++   ++ +    + K DL  NTGL L  AN+G
Sbjct  14    PVVPAGEKRV--DEMDFFSDEKKKRSREEPDLDLKVPSSSIKKEDLTINTGLNLRTANTG  71

Query  1718  sdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSN  1539
             SD+STVD+ +S   +++  + +L+ +Q EL +MN ENQRLRGML+QV+TNY ALQ H+  
Sbjct  72    SDQSTVDEGLSPPEDDKEGEGELAAMQAELARMNEENQRLRGMLNQVTTNYNALQMHVVA  131

Query  1538  LMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEAS  1359
             LMQ +NQ++   GS Q  E  D K++ K        VPRQF++L P         TDE S
Sbjct  132   LMQQRNQKN---GSPQGHEAVDEKTDGK-------IVPRQFIDLGPAS------NTDEPS  175

Query  1358  QSHTTSEERTLSAGSPRNN----NTELSRHKGIIA------------REDSPD--SESWA  1233
             QS T    R LS+ SP NN    + +   HK  +             REDSPD  SE W 
Sbjct  176   QSSTEGGSRHLSS-SPTNNVEAGSMDYRLHKNNMNKEIVPINDERSNREDSPDPSSEGWN  234

Query  1232  pnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAY  1053
             PNK PKL PSK  +Q  E TMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAY
Sbjct  235   PNKAPKLAPSKSAEQTQETTMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAY  294

Query  1052  YRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAM  873
             YRCTMA GCPVRKQVQRCAEDR+ILITTYEG+HNHPLPPAAMAMASTTSAAA+MLLSG+M
Sbjct  295   YRCTMATGCPVRKQVQRCAEDRSILITTYEGSHNHPLPPAAMAMASTTSAAASMLLSGSM  354

Query  872   PSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPF  693
              S DG+MN+ FLAR ILPCSSS+ATISASAPFPTVTLDLT TPN L  +QRPP  FQ PF
Sbjct  355   SSTDGLMNSGFLARTILPCSSSMATISASAPFPTVTLDLTHTPNPL-QFQRPPAPFQVPF  413

Query  692   TGAPQIPQNYPQ---LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapp  522
                P      PQ   LPQVFGQ L NQ+KFSGL +S           A +   Q H    
Sbjct  414   QNGPPSFGGPPQPLSLPQVFGQTLSNQTKFSGLQMS-----------ADMEGAQFHHPKT  462

Query  521   pqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
             P     ADT++AATAAIT+DPNFTAALAAAI+SI+GGG Q
Sbjct  463   PSATSLADTVNAATAAITADPNFTAALAAAITSIIGGGHQ  502



>gb|AIE43886.1| WRKY transcription factor 87 [Gossypium hirsutum]
Length=561

 Score =   415 bits (1067),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 300/510 (59%), Positives = 353/510 (69%), Gaps = 56/510 (11%)
 Frame = -1

Query  1865  EKRGPPNEVDFFSDKKADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvs  1686
             E R P +E+DFFS   A + VKKE   H +   + D+NTGL L+ AN+GSD+STVDD VS
Sbjct  61    ENRLPVDELDFFS--AATVNVKKE-NFHAD-CARLDVNTGLNLLTANAGSDQSTVDDGVS  116

Query  1685  sDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQ-HQNQQSS  1509
             SD++++R KN+++ LQVEL++MNAENQ+L+ M++ VS NY+ALQ HL NLMQ HQ  + +
Sbjct  117   SDVDDKRVKNEVAQLQVELKRMNAENQKLKDMVNDVSNNYSALQMHLVNLMQQHQRHEVN  176

Query  1508  RIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERT  1329
              + ++      D              VPRQF++L P G A    +TD    SH++SEERT
Sbjct  177   NLNTSVSSRSDDVSKASL-------IVPRQFMDLRPSGIA----ETDHEP-SHSSSEERT  224

Query  1328  LSAGSPRNNNTELS---------------------RHKGIIAREDSPDSESWApnklpkl  1212
              S GSP NN    S                     R    I RE+SP+SE+   NKL K+
Sbjct  225   PS-GSPPNNVQVTSPKDYLKTKNPVSQLDQESSSFRDGKRIGREESPESENLGRNKLQKM  283

Query  1211  npskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAV  1032
             NPSKP+DQA EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAV
Sbjct  284   NPSKPIDQATEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAV  343

Query  1031  GCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMM  852
             GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTT++AA MLLSG+M S DGMM
Sbjct  344   GCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTASAATMLLSGSMHSGDGMM  403

Query  851   NTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQ--  678
             N N   R +LPC SS+ATISASAPFPTVTLDLT +PN+L  +QRP TQF  PF G PQ  
Sbjct  404   NPNLFPRTMLPC-SSMATISASAPFPTVTLDLTHSPNAL-QFQRPNTQFHVPFPGQPQNS  461

Query  677   IPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFAD  498
                +  Q PQVFGQ LYNQSKFSGL +S QDI                    PQ    AD
Sbjct  462   TSTSATQFPQVFGQALYNQSKFSGLQLS-QDI------------VSSSQLQQPQQSTLAD  508

Query  497   TLSAATAAITSDPNFTAALAAAISSIMGGG  408
             T+SAATAAI +DP+FTAALAAAI+SI+ G 
Sbjct  509   TVSAATAAIANDPSFTAALAAAITSIIRGA  538



>ref|XP_008784385.1| PREDICTED: probable WRKY transcription factor 31 [Phoenix dactylifera]
Length=571

 Score =   414 bits (1065),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 301/520 (58%), Positives = 357/520 (69%), Gaps = 54/520 (10%)
 Frame = -1

Query  1886  VPINPAAEKRGPPNEVDFFSDKKADIVVKK---EITLHGEPVTKADL--NTGLQLVIANs  1722
             +P     EKR   +E+DFFSD+K     ++   +I +    + K DL  NTGL L  AN+
Sbjct  53    IPGGAGREKRV--DEMDFFSDEKKKRSREEPDLDIKVLSSSIKKEDLAINTGLNLRTANT  110

Query  1721  gsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLS  1542
             GSD+STVD+ +S   +++  K++L+ +Q E+ +MN ENQRLRGML+QV+TNY ALQ HL 
Sbjct  111   GSDQSTVDEGLSPTEDDKEDKSELAAMQAEVARMNEENQRLRGMLNQVTTNYNALQMHLV  170

Query  1541  NLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEA  1362
              L+Q +NQ++  IGS +  E  D K++ K        VPRQF++L P          DE 
Sbjct  171   ALIQQRNQKN--IGSPRGHEAVDEKTDGK-------IVPRQFIDLGPAA------NADEP  215

Query  1361  SQSHTTSEERTLSAGSPRN---NNTELSRH-----KGIIA-------REDSP--DSESWA  1233
             SQS T    R LS+ SP N    + +  RH     K I+        REDSP   SE W 
Sbjct  216   SQSSTEGGSRHLSSSSPNNVEAGSMDYRRHENNTNKEIVPPDHERSNREDSPGPSSEGWN  275

Query  1232  pnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAY  1053
             PNK PKL+PSK  +Q  EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAY
Sbjct  276   PNKAPKLSPSKTAEQTQEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAY  335

Query  1052  YRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAM  873
             YRCTMA GCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMASTTSAAA+MLLSG+M
Sbjct  336   YRCTMATGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMASTTSAAASMLLSGSM  395

Query  872   PSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPF  693
              S DGMMN++FLAR ILPCSSS+ATISASAPFPTVTLDLT++PN L  +QRPP  FQ PF
Sbjct  396   SSTDGMMNSSFLARTILPCSSSMATISASAPFPTVTLDLTRSPNPL-QFQRPPIPFQVPF  454

Query  692   -TGAPQI--PQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapp  522
               G+P    P     LPQVFGQ L NQSKFSGL +S             +   Q     P
Sbjct  455   QNGSPSFGSPAQPLSLPQVFGQTLSNQSKFSGLQMS-----------PDMEAAQFPHPKP  503

Query  521   pqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
             P     ADT+SAATAAIT+DPNFTAALAAAI+SI+GGG Q
Sbjct  504   PSATSLADTVSAATAAITADPNFTAALAAAITSIIGGGHQ  543



>ref|XP_002305579.2| WRKY transcription factor 6 family protein [Populus trichocarpa]
 gb|EEE86090.2| WRKY transcription factor 6 family protein [Populus trichocarpa]
Length=578

 Score =   412 bits (1058),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 322/586 (55%), Positives = 380/586 (65%), Gaps = 82/586 (14%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNK----PVFGF-----NLSPRLNPINgggsgggaGMVPIN  1875
             MDKGWGLTL + D  + F +N     PV  F     + S   N  +           P++
Sbjct  1     MDKGWGLTLAS-DPVSVFSSNNSNNSPVGSFLKVKRDFSSDHNMADSRNINNSMFQFPVS  59

Query  1874  PAAEKR----GPPNEVDFFSD----------KKADIVVKKEITL-HGEPVTKA--DLNTG  1746
              +A K        +EVDFF +          K   ++VKKE +L    P + A  D+NTG
Sbjct  60    LSAGKEEVSSAAAHEVDFFKEMINRVDGHDSKSTSVIVKKENSLAEVAPRSSAALDVNTG  119

Query  1745  LQLVIANsgsdkstvddsvssDMEERRAKN-DLSVLQVELEKMNAENQRLRGMLSQVSTN  1569
             L L+ A + SD+STVDD VSSD +++R+KN +L+ LQVEL+KMNAENQRL+ MLSQV+ N
Sbjct  120   LHLLTAYARSDQSTVDDGVSSDADDKRSKNVELAQLQVELQKMNAENQRLKDMLSQVTNN  179

Query  1568  YTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPggga  1389
             Y+ALQ H   L+Q   QQ    G   D +  ++K            VPRQF++L P    
Sbjct  180   YSALQMHFVALIQ---QQQRNHGVESDNKQEEKK---------HEMVPRQFMDLGPSA--  225

Query  1388  aaaAQTDEASQSHTTSEERTLS--------AGSPRNNNTELSRHKGIIAREDSPDSE--S  1239
                 +TDE S S  +SEERT S        A S +NN+ +       I  ++SP+SE   
Sbjct  226   ----ETDEISNS--SSEERTRSVTPQNHFEAASTKNNDGKR------IGGDESPESELQG  273

Query  1238  W----ApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGN  1071
             W         P  + +K ++Q+AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGN
Sbjct  274   WNPNKVQKLNPASSANKAIEQSAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGN  333

Query  1070  PCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanm  891
             PCPRAYYRCTMAVGCPVRKQVQRCAED+TILITTYEG HNHPLPPAAM MASTT+AAA M
Sbjct  334   PCPRAYYRCTMAVGCPVRKQVQRCAEDKTILITTYEGNHNHPLPPAAMTMASTTTAAATM  393

Query  890   llSGAMPSADGMMNTNFLARAILP-CSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPP  714
             LLSG+M SADGMMN N LARAILP CSSS+ATISASAPFPTVTLDLTQ  N L  +QRPP
Sbjct  394   LLSGSMSSADGMMNPNLLARAILPGCSSSMATISASAPFPTVTLDLTQNTNPL-QFQRPP  452

Query  713   TQFQAPFTGAPQIPQNY-----PQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqla  549
             TQFQ PF G    PQN+     PQLPQVFGQ LYNQSKFSGL +S QDI ++        
Sbjct  453   TQFQVPFPGQ---PQNFALVTAPQLPQVFGQALYNQSKFSGLQLS-QDIGSSQLGHQAQP  508

Query  548   qqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
             Q       P       DTLSAATAAIT+DPNFTAALAAAISSI+GG
Sbjct  509   QIFHPGQQPSLSH---DTLSAATAAITADPNFTAALAAAISSIIGG  551



>ref|XP_007216988.1| hypothetical protein PRUPE_ppa002619mg [Prunus persica]
 gb|EMJ18187.1| hypothetical protein PRUPE_ppa002619mg [Prunus persica]
Length=651

 Score =   413 bits (1061),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 304/517 (59%), Positives = 364/517 (70%), Gaps = 40/517 (8%)
 Frame = -1

Query  1883  PINPAAEKRGPPNEVDFFSDKKADIVVKK--------EITLHGEPVTKADLNTGLQLVIA  1728
             P  P+ EKR   +E DFF+D K+ +   K        ++ LHG    + ++NTGL L++ 
Sbjct  104   PEPPSNEKRKVIDERDFFADNKSHVDQDKSASADPADKMDLHGPTDMEFNVNTGLNLLLT  163

Query  1727  NsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQH  1548
             N+ SD+S VDD +SS++E++RAK++L+VLQ ELE+MNAENQRLRGML+QV+TNY ALQ H
Sbjct  164   NTSSDQSVVDDGISSNIEDKRAKSELAVLQAELERMNAENQRLRGMLNQVTTNYNALQVH  223

Query  1547  LSNLMQHQN-QQSSRIGSTQ-----DREVADRKSeekkpekeePTVPRQFLELVPgggaa  1386
             L  LMQ Q  +Q+S           + +V   + +          VPRQF++L   G AA
Sbjct  224   LLTLMQSQKAEQNSSAAEGHGVFDGNNKVVVEEKKLINSNGSPVVVPRQFMDL---GLAA  280

Query  1385  aaAQTDEASQSHTTSEERTLSAGSPRNNNTELSRHKGI---------IAREDSPD--SES  1239
               A TDE SQS  +SEE++         N +++ H            I RE+SPD  S+S
Sbjct  281   NNADTDEPSQS--SSEEKSRERSGSLGENVKVAGHSDDQEKKEFGRGIGREESPDQPSQS  338

Query  1238  WApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPR  1059
             W PNK+P+LN  K VDQ  EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPR
Sbjct  339   WGPNKVPRLNSPKEVDQT-EATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPR  397

Query  1058  AYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSG  879
             AYYRCTMA GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTTS+AA MLLSG
Sbjct  398   AYYRCTMAAGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTSSAARMLLSG  457

Query  878   AMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQA  699
             +MPSADG+M++NFL R ILPCSSS+ATISASAPFPTVTLDLTQ+PN L   QRPP QF  
Sbjct  458   SMPSADGLMDSNFLTRTILPCSSSMATISASAPFPTVTLDLTQSPNPL-QLQRPPGQFNI  516

Query  698   PFTGAPQIPQNYP--QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpap  525
             PF    Q   N P   LPQ+FGQ LYNQSKFSGL +S QD+     +  QL  QQQ    
Sbjct  517   PFPNPSQNFTNGPVSLLPQIFGQALYNQSKFSGLQMS-QDM-----ERGQLGHQQQPGHQ  570

Query  524   ppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMG  414
               Q    ADT++AATAAI +DPNFTAALAAAI+SI+G
Sbjct  571   GQQQNSLADTVTAATAAIAADPNFTAALAAAITSIIG  607



>gb|ACV92030.1| WRKY transcription factor 28 [(Populus tomentosa x Populus bolleana) 
x Populus tomentosa]
Length=602

 Score =   411 bits (1056),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 331/598 (55%), Positives = 391/598 (65%), Gaps = 81/598 (14%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNK----PVFGF-----NLSPRLNPINgggsgggaGMVPIN  1875
             MDKGWGLTL + D  + F +N     PV  F     + S   N  +      G    P++
Sbjct  1     MDKGWGLTLAS-DPVSVFSSNNSNNSPVGSFLKVKRDFSSDHNMADSRNINNGMFQFPVS  59

Query  1874  PAAEKR----GPPNEVDFFSDK--KADI---------VVKKEITL-HGEPVTKA--DLNT  1749
              +A K        +EVDFF +K  + DI          VKKE +L    P + A  D+NT
Sbjct  60    LSAGKEEVSSAAAHEVDFFKEKINRVDIGHDSKSTSVTVKKENSLAEAAPRSSAALDVNT  119

Query  1748  GLQLVIANsgsdkstvddsvssDMEERRAKN-DLSVLQVELEKMNAENQRLRGMLSQVST  1572
             GL L  AN+ SD+STVDD VSSD ++RR+KN +L+ LQVEL+KMNAENQRL+ MLSQV+ 
Sbjct  120   GLHLPTANARSDQSTVDDGVSSDGDDRRSKNVELAQLQVELQKMNAENQRLKDMLSQVTN  179

Query  1571  NYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPggg  1392
             NY+ALQ H   L+Q Q Q++  + S + +E  D KS E+K  +    VPRQF++L P   
Sbjct  180   NYSALQMHFVALIQQQ-QRNPGVESDKKQETVDAKSSEEKKHE---MVPRQFMDLGPSA-  234

Query  1391  aaaaAQTDEASQSHTTSEERTLSAGSPRN--------NNTELS-----------RHKGII  1269
                  +TDE S S  +SEERT S  +P+N        NN +L            R     
Sbjct  235   -----ETDEISNS--SSEERTRSV-TPQNHFEVASTKNNGKLEMVPHDQENSSFRGGKRF  286

Query  1268  AREDSPDSES--W----ApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQ  1107
               ++SP+SES  W         P    +K ++Q+AEATMRKARVSVRARSEAPMISDGCQ
Sbjct  287   GGDESPESESQGWNPNKVQKLNPATPANKAIEQSAEATMRKARVSVRARSEAPMISDGCQ  346

Query  1106  WRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaam  927
             WRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAED+TILITTYEG HNHPLPPAAM
Sbjct  347   WRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDKTILITTYEGNHNHPLPPAAM  406

Query  926   amasttsaaanmllSGAMPSADGMMNTNFLARAILP-CSSSVATISASAPFPTVTLDLTQ  750
              MASTT+AAA MLLSG+M SADGMMN N LARAILP CSSS+ATISASAPFPTVTLDLTQ
Sbjct  407   TMASTTTAAATMLLSGSMSSADGMMNPNLLARAILPGCSSSMATISASAPFPTVTLDLTQ  466

Query  749   TPNSLPNYQRPPTQFQAPFTGAPQIPQNY-----PQLPQVFGQGLYNQSKFSGLHVSHQD  585
               N L  +Q+PPTQFQ PF G    PQN+     PQLPQVFGQ LYNQS+FSGL +S QD
Sbjct  467   NTNPL-QFQKPPTQFQVPFPGQ---PQNFALVTAPQLPQVFGQALYNQSEFSGLQLS-QD  521

Query  584   IaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
             I ++        Q       P       DTLSAATAAIT+DPNFTAALAAAISSI+GG
Sbjct  522   IGSSQLGHQAQPQIFHSGQQPSLSH---DTLSAATAAITADPNFTAALAAAISSIIGG  576



>ref|XP_010099182.1| WRKY transcription factor 6 [Morus notabilis]
 gb|EXB77054.1| WRKY transcription factor 6 [Morus notabilis]
Length=619

 Score =   412 bits (1058),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 326/605 (54%), Positives = 396/605 (65%), Gaps = 80/605 (13%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPV-FGFNLSPRLNPINgggsgggaGMVPIN------PA  1869
             MDKGWG+ L++     GFF NKP    F+ + + + +  G     + +   +      P+
Sbjct  1     MDKGWGIALDSDS--LGFFLNKPPPSKFDHAAKRSIMFAGMEFPASKLACRDEQAAHQPS  58

Query  1868  AEKRGPPNEVDFFSDKK--------------------ADIVVKKEITLHGEPVTK--ADL  1755
              E R     VDFFSDKK                      ++VKKE +  G+  T+   D+
Sbjct  59    DENRTAVGVVDFFSDKKRLVNDDDDDDDCDDHSKTISTSVIVKKENS-QGDATTRPSLDV  117

Query  1754  NTGLQLVIANsgsdkstvdd-svssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQV  1578
             NTGL L+ AN+GSD+STVDD   S  +EE+RAK  ++ LQVEL++MNAENQ+LR MLSQV
Sbjct  118   NTGLHLLTANTGSDQSTVDDGVSSDHVEEKRAKTVMAQLQVELQRMNAENQKLRDMLSQV  177

Query  1577  STNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPg  1398
             S NY+ALQ HL  +MQ Q   ++R  STQ++E  D+  +  + E+++    RQFL+L P 
Sbjct  178   SHNYSALQMHLMAVMQQQQMTNNRPESTQEQENVDQVGKVAEQERKQE---RQFLDLGPS  234

Query  1397  ggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNTELS-RHKGIIA---------------  1266
                    + D  S + ++SEERT SA +P+NN  ELS R K I+A               
Sbjct  235   ADNQT--EIDRVS-NDSSSEERTRSA-TPQNNVNELSHRKKDIVAYNNNDQDEGSNLRDG  290

Query  1265  ----REDSPDSES--WApnklpklnpskP-VDQAAEATMRKARVSVRARSEAPMISDGCQ  1107
                 RE+SP+SES  W PNK+PKLN     ++Q+A+ATMRKARVSVRARSEAPMI+DGCQ
Sbjct  291   KRVGREESPESESQGWGPNKVPKLNNGSKPIEQSADATMRKARVSVRARSEAPMITDGCQ  350

Query  1106  WRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaam  927
             WRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAM
Sbjct  351   WRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAM  410

Query  926   amasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQT  747
             AMASTT+AAANMLLSG+M S DG+MN N LARAILP SSSVATISASAPFPTVTLDLT  
Sbjct  411   AMASTTAAAANMLLSGSMSSGDGLMNPNLLARAILPNSSSVATISASAPFPTVTLDLTNN  470

Query  746   PNSLPNYQRPPTQFQAPFTGAPQ------IP------QNYPQLPQVFGQGLYNQSKFSGL  603
             PN L  +QRP T FQ PF G         +P      Q +  LPQVFG  LYNQSKFSGL
Sbjct  471   PNPL-QFQRPQTPFQVPFAGGQAQNFGAVVPPPSSGAQAHSILPQVFGHALYNQSKFSGL  529

Query  602   HVS-HQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAIS  426
              +S  QD+    + +    Q         Q    AD++SAATAAIT+DPNFTAALAAAIS
Sbjct  530   QLSTGQDM---GSNSQLGHQVAAVQLHQTQQANLADSVSAATAAITADPNFTAALAAAIS  586

Query  425   SIMGG  411
             SI+GG
Sbjct  587   SIIGG  591



>ref|XP_003534609.1| PREDICTED: probable WRKY transcription factor 31 [Glycine max]
Length=541

 Score =   409 bits (1050),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 305/491 (62%), Positives = 357/491 (73%), Gaps = 36/491 (7%)
 Frame = -1

Query  1844  EVDFFSDKKADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvssDMEERR  1665
             EVDFFS      +VKKE+       T   +NTGLQL+ AN+ SD+STVDD +SSD E++R
Sbjct  47    EVDFFSHTPPPNIVKKELD-----QTPLHINTGLQLLTANTRSDQSTVDDGLSSDAEDKR  101

Query  1664  AKN-DLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQD  1488
             AK  +L+ LQVEL++MNAEN++L+ MLS V+ NYTALQ HL  LMQ QNQQ  R  ST++
Sbjct  102   AKTTELAQLQVELQRMNAENKKLKEMLSHVTGNYTALQMHLVTLMQ-QNQQ--RTESTEN  158

Query  1487  REVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPR  1308
               VA  K E+K        VPRQFL++ P G A       +   S ++S+ERT S+ +P+
Sbjct  159   -GVAQGKVEDKNHGVGGGKVPRQFLDIGPSGTAEV-----DDQVSDSSSDERTRSS-TPQ  211

Query  1307  NNNTELSRHKGI---------IAREDSPDSES--WApnklpklnpskPVDQA-AEATMRK  1164
             +NNTE     G          + RE+SPDSES  W PNKL K+NPS P+DQ+ AEATMRK
Sbjct  212   DNNTEAGTRDGARNNNGNKSELGREESPDSESQGWGPNKLQKVNPSNPMDQSTAEATMRK  271

Query  1163  ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT  984
             ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA+DRT
Sbjct  272   ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCADDRT  331

Query  983   ILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSV  804
             IL+TTYEGTHNHPLPPAAMAMASTT+AAA MLLSG+M SADG+MN N LARAILPCS+S+
Sbjct  332   ILVTTYEGTHNHPLPPAAMAMASTTAAAATMLLSGSMSSADGVMNPNLLARAILPCSTSM  391

Query  803   ATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYN  624
             AT+SASAPFPTVTLDLT  PN L  +QRP   FQ PF  A   PQN+        Q LYN
Sbjct  392   ATLSASAPFPTVTLDLTHNPNPL-QFQRPGAPFQVPFLQA--QPQNFGSGATPIAQALYN  448

Query  623   QSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAA  444
             QSKFSGL +S QD+      +    Q  + P  P QHP  ADT+SAA +AITSDPNFTA 
Sbjct  449   QSKFSGLQLS-QDV----GSSQLAPQAPRPPLQPSQHPSLADTVSAAASAITSDPNFTAV  503

Query  443   LAAAISSIMGG  411
             LAAAISSI+GG
Sbjct  504   LAAAISSIIGG  514



>ref|XP_006449767.1| hypothetical protein CICLE_v10014642mg [Citrus clementina]
 gb|ESR63007.1| hypothetical protein CICLE_v10014642mg [Citrus clementina]
Length=607

 Score =   410 bits (1054),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 310/611 (51%), Positives = 371/611 (61%), Gaps = 85/611 (14%)
 Frame = -1

Query  2027  MDKGWGLTLENPD---RRAGFFTN---KPVFGFNLSPRLNPINgggsgggaGMVPINPAA  1866
             MDKGWGLTL++         FFT+   KP      + R    +G        M  + PA+
Sbjct  1     MDKGWGLTLDSDHPIVSNLNFFTSNKPKPSLARFRTNRDMAASGAADSASVRMFQL-PAS  59

Query  1865  EKRGPP----------NEVDFFSDKKA-----------------DIVVKKEITLHGE--P  1773
             +    P          +EVDFFSD K                   + +KKE + H +   
Sbjct  60    DNSNAPSSSDDNRVAVDEVDFFSDDKNRVSISDHREDDRNKTTNSVHIKKENS-HDQLRH  118

Query  1772  VTKADLNTGLQLVIA--NsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRL  1599
              T  D+NTGL L+ A        +  D   S   +++R K +L+ LQVEL++MN ENQRL
Sbjct  119   RTGLDVNTGLHLLTAANTGSDQSTVDDGVSSDHADKKRTKIELTQLQVELQQMNTENQRL  178

Query  1598  RGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQ  1419
             R MLSQV+ NY ALQ H+  LMQ Q +      S Q  EV + K E KK + +   VPRQ
Sbjct  179   RDMLSQVTNNYNALQMHIVALMQQQQENRRAPESNQAHEVVEGKDEGKKHDDQVM-VPRQ  237

Query  1418  FLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNTELSRHKGI-----------  1272
             F+ L P        +TD    + ++ EERTLS   P  NN E +  + +           
Sbjct  238   FIGLGPSA------ETDHEVSNCSSDEERTLSGTPP--NNVEAASKEHVNSNGKNEIVSF  289

Query  1271  ---------------IAREDSPDSES--WA-pnklpklnpskPVDQAAEATMRKARVSVR  1146
                            I RE+SP+SE+  W   NK+ KL+ +K +DQ+ EATMRKARVSVR
Sbjct  290   DDQAAAAAENSNGKRIGREESPESETQGWGPNNKVQKLSSAKGIDQSNEATMRKARVSVR  349

Query  1145  ARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY  966
             ARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY
Sbjct  350   ARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY  409

Query  965   EGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISAS  786
             EG HNHPLPPAAMAMASTT+AAA+MLLSG+M SADG+MN N LARAILPCSSS+ATISAS
Sbjct  410   EGNHNHPLPPAAMAMASTTTAAASMLLSGSMSSADGIMNPNLLARAILPCSSSMATISAS  469

Query  785   APFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQ--IPQNYPQLPQVFGQGLYNQSKF  612
             APFPTVTLDLT +PN L   QR   QFQ  F G PQ        QLPQVFGQ LYNQSKF
Sbjct  470   APFPTVTLDLTHSPNPL-QLQRQAAQFQVQFPGQPQNLASVTNTQLPQVFGQALYNQSKF  528

Query  611   SGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAA  432
             SGL +S Q+I + +   +          P       ADT+SAATAAIT+DPNFTAALAAA
Sbjct  529   SGLQLS-QNIGSNSQSGSHQTLPPPLQQPQQL----ADTVSAATAAITADPNFTAALAAA  583

Query  431   ISSIMGGGSQP  399
             I+SI+GG   P
Sbjct  584   ITSIIGGAQNP  594



>gb|AGX26048.1| WRKY transcription factor [Gossypium hirsutum]
 gb|AGX26049.1| WRKY transcription factor [Gossypium hirsutum]
Length=551

 Score =   406 bits (1044),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 299/509 (59%), Positives = 349/509 (69%), Gaps = 64/509 (13%)
 Frame = -1

Query  1865  EKRGPPNEVDFFSDKKADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvs  1686
             E R P +E+DFFS   A + VKKE + H +   + D+N GL L+ AN+GSD+STVDD VS
Sbjct  61    ENRLPVDELDFFS--AATVNVKKE-SFHAD-CARLDVN-GLNLLTANAGSDQSTVDDGVS  115

Query  1685  sDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSR  1506
             SD++++R KN+++ LQVEL++MNAENQ+L  M++ VS NY+ALQ HL  LMQ    Q   
Sbjct  116   SDVDDKRVKNEVAQLQVELKRMNAENQKLNDMVNDVSNNYSALQMHLVTLMQQH--QRHE  173

Query  1505  IGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTL  1326
             I   +++E +               VPRQF++L P G A    +TD    SH++SEERT 
Sbjct  174   INEVKEQEAS-------------LIVPRQFMDLRPSGIA----ETDHEP-SHSSSEERTP  215

Query  1325  SAGSPRNNNTELS---------------------RHKGIIAREDSPDSESWApnklpkln  1209
             S GSP NN    S                     R    I RE+SP+SE+   NKL K+N
Sbjct  216   S-GSPPNNVQVTSPKDYLKTKNPVSQLDQESSSFRDGKRIGREESPESENLGRNKLQKMN  274

Query  1208  pskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVG  1029
             PSKP+DQA EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVG
Sbjct  275   PSKPIDQATEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVG  334

Query  1028  CPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN  849
             CPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTT++AA MLLSG+M S D MMN
Sbjct  335   CPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTASAATMLLSGSMHSGDRMMN  394

Query  848   TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQ--I  675
              N   RA LPC SSVATISASAPFPTVTLDLT +PN+L  +QRP TQF   F G PQ   
Sbjct  395   PNLFPRATLPC-SSVATISASAPFPTVTLDLTHSPNAL-QFQRPNTQFHVSFPGQPQNST  452

Query  674   PQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADT  495
               +  Q PQVFGQ LYNQSKFSGL +S QDI                    PQ    ADT
Sbjct  453   STSATQFPQVFGQALYNQSKFSGLQLS-QDI------------VSSSQLQQPQQSTLADT  499

Query  494   LSAATAAITSDPNFTAALAAAISSIMGGG  408
             +SAATAAI +DP+FTAALAAAI+SI+GG 
Sbjct  500   VSAATAAIANDPSFTAALAAAITSIIGGA  528



>ref|XP_006467403.1| PREDICTED: probable WRKY transcription factor 31-like [Citrus 
sinensis]
Length=609

 Score =   408 bits (1048),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 310/611 (51%), Positives = 370/611 (61%), Gaps = 83/611 (14%)
 Frame = -1

Query  2027  MDKGWGLTLENPD---RRAGFFTN---KPVFGFNLSPRLNPINgggsgggaGMVPINPAA  1866
             MDKGWGLTL++         FFT+   KP      + R    +G        M  + PA+
Sbjct  1     MDKGWGLTLDSDHPIVSNLNFFTSNKPKPSLARFRTNRDMAASGAADSASVRMFQL-PAS  59

Query  1865  EKRGPP----------NEVDFFSDKKA-----------------DIVVKKEITLHGE--P  1773
             +    P          +EVDFFSD K                   + +KKE + H +   
Sbjct  60    DNSNAPSSSDDNRVAVDEVDFFSDDKNRVSISDHREDDRNKTTNSVHIKKENS-HDQLRH  118

Query  1772  VTKADLNTGLQLVIA--NsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRL  1599
              T  D+NTGL L+ A        +  D   S   +E+R K +L+ LQVEL++MN ENQRL
Sbjct  119   RTGLDVNTGLHLLTAANTGSDQSTVDDGVSSDHADEKRTKIELTQLQVELQQMNTENQRL  178

Query  1598  RGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQ  1419
             R MLSQV+ NY ALQ H+  LMQ Q +      S Q  EV + K E KK + +   VPRQ
Sbjct  179   RDMLSQVTNNYNALQMHIIALMQQQQENRRAPESNQAHEVVEGKDEGKKHDDQVM-VPRQ  237

Query  1418  FLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPR------------NNNTEL-----  1290
             F+ L P        +TD    + ++ EERTLS   P             N   E+     
Sbjct  238   FIGLGPSA------ETDHEVSNCSSDEERTLSGTPPNIVEAASKEHVNSNGKNEIVSFDD  291

Query  1289  ---------SRHKGIIAREDSPDSES--WA-pnklpklnpskPVDQAAEATMRKARVSVR  1146
                      + +   I RE+SP+SE+  W   NK+ KL+ +K +DQ+ EATMRKARVSVR
Sbjct  292   QAAAAAAAENSNGKRIGREESPESETQGWGPNNKVQKLSSAKGIDQSNEATMRKARVSVR  351

Query  1145  ARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY  966
             ARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY
Sbjct  352   ARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY  411

Query  965   EGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISAS  786
             EG HNHPLPPAAMAMASTT+AAA+MLLSG+M SADG+MN N LARAILPCSSS+ATISAS
Sbjct  412   EGNHNHPLPPAAMAMASTTTAAASMLLSGSMSSADGIMNPNLLARAILPCSSSMATISAS  471

Query  785   APFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQ--IPQNYPQLPQVFGQGLYNQSKF  612
             APFPTVTLDLT +PN L   QR   QFQ  F G PQ        QLPQVFGQ LYNQSKF
Sbjct  472   APFPTVTLDLTHSPNPL-QLQRQAAQFQVQFPGQPQNLASVTNTQLPQVFGQALYNQSKF  530

Query  611   SGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAA  432
             SGL +S Q+I + +   +          P       ADT+SAATAAIT+DPNFTAALAAA
Sbjct  531   SGLQLS-QNIGSNSQSGSHQTLPPPLQQPQQL----ADTVSAATAAITADPNFTAALAAA  585

Query  431   ISSIMGGGSQP  399
             I+SI+GG   P
Sbjct  586   ITSIIGGAQNP  596



>ref|XP_008440027.1| PREDICTED: probable WRKY transcription factor 31 [Cucumis melo]
Length=622

 Score =   407 bits (1046),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 331/606 (55%), Positives = 387/606 (64%), Gaps = 86/606 (14%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRA-GFFTNKP--------------VF-GFNLSPRLNPINgggsggg  1896
             MDKGWGLTL + D ++ GFF+NK               +F G   S +L   +       
Sbjct  1     MDKGWGLTLRDSDHQSIGFFSNKQPPPPPPPTLNSFQRMFQGLEFSAKLGHTDSTSDDNN  60

Query  1895  aGMVPINPAAEKRGPPNEVDFFSDKKADIVVKKEITLHGEP-----VTKAD---------  1758
                V             EVDFFS KK  +V   E     +P     + K D         
Sbjct  61    RLAV-------------EVDFFSAKKR-LVDDLEADQDSKPTSTTSIIKDDKALTPPPPP  106

Query  1757  ------LNTGLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLR  1596
                   +NTGL L+ AN+GS +STVDD +SSD E++RAKN+L+ LQVEL++MNAEN +LR
Sbjct  107   TTSFNLVNTGLHLLTANTGSHQSTVDDGISSDGEDKRAKNELAQLQVELQRMNAENHKLR  166

Query  1595  GMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGS-TQDREVA-DRKSeekkpekeePTVPR  1422
              MLS VS NY++LQ HL  LMQ Q QQ +        RE+A ++KS E K E  +  VPR
Sbjct  167   DMLSHVSNNYSSLQMHLLTLMQQQQQQQNHSSEPANQREIAGEKKSTEIKHEVGKVMVPR  226

Query  1421  QFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSP---RNNNTEL-------------  1290
             QF++L P G      +++E    +++S+ERT S GSP    NNNTE              
Sbjct  227   QFMDLGPSGNNNNMGESEEL-LCNSSSDERTRS-GSPLNINNNNTETASKKRDHAEIMPP  284

Query  1289  -SRH---KGIIAREDSPDSES--WApnklp----klnpskPVDQAAEATMRKARVSVRAR  1140
              S H   K  I REDSP+SES  W PN         + SKP+DQ+ EATMRKARVSVRAR
Sbjct  285   NSDHENSKRSIPREDSPESESQGWGPNHKTPRFNNSSNSKPIDQSTEATMRKARVSVRAR  344

Query  1139  SEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG  960
             SEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG
Sbjct  345   SEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG  404

Query  959   ThnhplppaamamasttsaaanmllSGAMPSAD-GMMNTNFLARAILPCSSSVATISASA  783
              HNHPLPPAAMAMASTT+AAA MLLSG+M SAD  +MN N LARAILPCSSS+ATISASA
Sbjct  405   NHNHPLPPAAMAMASTTTAAATMLLSGSMSSADHNLMNPNLLARAILPCSSSMATISASA  464

Query  782   PFPTVTLDLTQTPNSLPNYQRPPTQ-FQAPFTGAPQIPQNYPQLPQVFGQGLY-NQSKFS  609
             PFPT+TLDLT +PN L  +QRP    F  PF G  Q P    QLPQV GQ LY NQSKFS
Sbjct  465   PFPTITLDLTHSPNPL-QFQRPTAAPFHVPFPGG-QPPSAAAQLPQVLGQALYNNQSKFS  522

Query  608   GLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAI  429
             GL +SH+ + A ++        Q      P    FADTLSAATAAIT+DPNFTAALAAAI
Sbjct  523   GLQLSHE-MGANSSPLGHHQITQPATPAQPGGASFADTLSAATAAITADPNFTAALAAAI  581

Query  428   SSIMGG  411
             SSI+GG
Sbjct  582   SSIIGG  587



>gb|KDO78304.1| hypothetical protein CISIN_1g007099mg [Citrus sinensis]
Length=618

 Score =   407 bits (1045),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 310/611 (51%), Positives = 370/611 (61%), Gaps = 83/611 (14%)
 Frame = -1

Query  2027  MDKGWGLTLENPD---RRAGFFTN---KPVFGFNLSPRLNPINgggsgggaGMVPINPAA  1866
             MDKGWGLTL++         FFT+   KP      + R    +G        M  + PA+
Sbjct  1     MDKGWGLTLDSDHPIVSNLNFFTSNKPKPSLARFRTNRDMAASGAADSASVRMFQL-PAS  59

Query  1865  EKRGPP----------NEVDFFSDKKA-----------------DIVVKKEITLHGE--P  1773
             +    P          +EVDFFSD K                   + +KKE + H +   
Sbjct  60    DNSNAPSSSDDNRVAVDEVDFFSDDKNRVSISDHREDDRNKTTNSVHIKKENS-HDQLRH  118

Query  1772  VTKADLNTGLQLVIA--NsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRL  1599
              T  D+NTGL L+ A        +  D   S   +E+R K +L+ LQVEL++MN ENQRL
Sbjct  119   RTGLDVNTGLHLLTAANTGSDQSTVDDGVSSDHADEKRTKIELTQLQVELQQMNTENQRL  178

Query  1598  RGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQ  1419
             R MLSQV+ NY ALQ H+  LMQ Q +      S Q  EV + K E KK + +   VPRQ
Sbjct  179   RDMLSQVTNNYNALQMHIIALMQQQQENRRAPESNQAHEVVEGKDEGKKHDDQVM-VPRQ  237

Query  1418  FLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPR------------NNNTEL-----  1290
             F+ L P        +TD    + ++ EERTLS   P             N   E+     
Sbjct  238   FIGLGPSA------ETDHEVSNCSSDEERTLSGTPPNIVEAASKEHVNSNGKNEIVSFDD  291

Query  1289  ---------SRHKGIIAREDSPDSES--WA-pnklpklnpskPVDQAAEATMRKARVSVR  1146
                      + +   I RE+SP+SE+  W   NK+ KL+ +K +DQ+ EATMRKARVSVR
Sbjct  292   QAAAAAAAENSNGKRIGREESPESETQGWGPNNKVQKLSSAKGIDQSNEATMRKARVSVR  351

Query  1145  ARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY  966
             ARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY
Sbjct  352   ARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY  411

Query  965   EGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISAS  786
             EG HNHPLPPAAMAMASTT+AAA+MLLSG+M SADG+MN N LARAILPCSSS+ATISAS
Sbjct  412   EGNHNHPLPPAAMAMASTTTAAASMLLSGSMSSADGIMNPNLLARAILPCSSSMATISAS  471

Query  785   APFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQ--IPQNYPQLPQVFGQGLYNQSKF  612
             APFPTVTLDLT +PN L   QR   QFQ  F G PQ        QLPQVFGQ LYNQSKF
Sbjct  472   APFPTVTLDLTHSPNPL-QLQRQAAQFQVQFPGQPQNLASVTNTQLPQVFGQALYNQSKF  530

Query  611   SGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAA  432
             SGL +S Q+I + +   +          P       ADT+SAATAAIT+DPNFTAALAAA
Sbjct  531   SGLQLS-QNIGSNSQSGSHQTLPPPLQQPQQL----ADTVSAATAAITADPNFTAALAAA  585

Query  431   ISSIMGGGSQP  399
             I+SI+GG   P
Sbjct  586   ITSIIGGAQNP  596



>ref|XP_003546160.1| PREDICTED: probable WRKY transcription factor 31-like [Glycine 
max]
Length=557

 Score =   402 bits (1033),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 322/570 (56%), Positives = 383/570 (67%), Gaps = 70/570 (12%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAG--FFTNK----PVFGFNLSPRLNPINgggsgggaGMVPINPAA  1866
             MDKGWGLTL+    ++   F +N     P+ GF       P+N   +             
Sbjct  1     MDKGWGLTLDTSSSQSLPLFPSNDNKMFPLLGF-------PVNLSRASKEDD--------  45

Query  1865  EKRGPPNEVDFFSDKKADI------------VVKKEITLHGEPVTKADLNTGLQLVIANs  1722
             E R    EVDFFSD+                +VKKEI       T   +NTGLQL+ AN+
Sbjct  46    ENRKVVGEVDFFSDRNKPTPPPSHDHNVKPNIVKKEID-----ETPLHINTGLQLLTANT  100

Query  1721  gsdkstvddsvssDMEERRAKN-DLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHL  1545
             GSD+STVDD VSSD E +RAK  +L+ LQVEL++MN+EN++L+ MLS V+ NYTALQ HL
Sbjct  101   GSDQSTVDDGVSSDAENKRAKTTELAQLQVELQRMNSENKKLKEMLSHVTGNYTALQMHL  160

Query  1544  SNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDE  1365
               LMQ QNQQ  R GST++ EV   K E+K        VPRQFL++ P G A       +
Sbjct  161   VTLMQ-QNQQ--RTGSTEN-EVVQGKVEDKNVGVGGGKVPRQFLDIGPSGTAEV-----D  211

Query  1364  ASQSHTTSEERTLSAGSPRNNNTELSRHKGI--------IAREDSPDSES--WApnklpk  1215
                S ++S+ERT S+ +P+N+N E     G         + RE+SPDSES  W+PNKL K
Sbjct  212   DQVSDSSSDERTRSS-TPQNHNIEAGARDGARNNNGKSQLGREESPDSESQGWSPNKLQK  270

Query  1214  lnpskPVDQA-AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTM  1038
             +NPS P+DQ+ AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTM
Sbjct  271   MNPSNPMDQSTAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTM  330

Query  1037  AVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADG  858
             AVGCPVRKQ QRC +DRTIL+TTYEGTHNHPLPPAAMAMASTT+AAA+MLLSG+M SADG
Sbjct  331   AVGCPVRKQAQRCTDDRTILVTTYEGTHNHPLPPAAMAMASTTTAAASMLLSGSMSSADG  390

Query  857   MMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQ  678
             +MN N LARAILPCS+S+AT+SASAPFPTVTLDLT  PN L  +QRP   FQ PF  A  
Sbjct  391   IMNPNLLARAILPCSTSMATLSASAPFPTVTLDLTHNPNPL-QFQRPGAPFQVPFLQA--  447

Query  677   IPQNYPQ--LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLF  504
              PQN+     P    Q LYNQSKFSGL +S QD+      +    Q  + P  P Q P  
Sbjct  448   QPQNFGSGAAPIAQAQALYNQSKFSGLQLS-QDV----GSSQLAPQAPRPPLQPSQQPSL  502

Query  503   ADTLSAATAAITSDPNFTAALAAAISSIMG  414
             ADT+SAA +AIT+DPNFTA LAAAISSI+G
Sbjct  503   ADTVSAAASAITADPNFTAVLAAAISSIIG  532



>ref|XP_007049086.1| WRKY family transcription factor [Theobroma cacao]
 gb|EOX93243.1| WRKY family transcription factor [Theobroma cacao]
Length=632

 Score =   404 bits (1038),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 294/513 (57%), Positives = 344/513 (67%), Gaps = 48/513 (9%)
 Frame = -1

Query  1862  KRGPPNEVDFFSDKKADIVVKKEITLHGEPVTKAD---------------LNTGLQLVIA  1728
             KR    E+DFF+ K    V   E      P+  +D               +NTGL L+  
Sbjct  91    KRTVIGEMDFFAQKNNKRVDSDEDG-DANPIHTSDADVKDSTERTALELNVNTGLNLLTT  149

Query  1727  NsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQH  1548
             N+ SD+STVDD +SS++E++RAKN+L+VLQ ELE+M AENQRLR  LSQV++NY A+Q H
Sbjct  150   NTTSDQSTVDDGISSNLEDKRAKNELAVLQAELERMMAENQRLRDTLSQVTSNYNAVQMH  209

Query  1547  LSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTD  1368
             L  LMQ Q+   +     QD  + ++  ++K        VPRQF++L     AAA A   
Sbjct  210   LVTLMQQQHDGKAEKAEEQDPMMEEKSEQKKPNGGV--IVPRQFMDLGLAAAAAADADEP  267

Query  1367  EASQSHTTSEERTLSAGSPRNNNTELSRHKGI-----------IAREDSPD--SESWApn  1227
               S S   S +R+   GSP NN    S+  G+             REDSPD  S+ W  N
Sbjct  268   SLSSSEGRSHDRS---GSPNNNTEVASKEFGLRKSGNSEEGRGTGREDSPDQGSQGWGAN  324

Query  1226  klpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYR  1047
             K+P+ N SK VDQ  EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYR
Sbjct  325   KVPRFNSSKNVDQT-EATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYR  383

Query  1046  CTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPS  867
             CTMA GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+M S
Sbjct  384   CTMAAGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMSS  443

Query  866   ADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTG  687
             ADG+MN+NFL R +LPCSSS+ATISASAPFPTVTLDLTQTPN L  + RPP QFQ PF  
Sbjct  444   ADGLMNSNFLTRTLLPCSSSMATISASAPFPTVTLDLTQTPNPL-QFPRPPGQFQVPFPN  502

Query  686   APQIPQNYPQ--LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqh  513
              P    N P   LPQ+FGQ LYNQSKFSGL +S QD+            Q  H  P  Q 
Sbjct  503   PPHNLANSPAALLPQIFGQALYNQSKFSGLQMS-QDM---------EQPQSVHQLPQGQQ  552

Query  512   pLFADTLSAATAAITSDPNFTAALAAAISSIMG  414
                ADT+SAATAAI +DPNFTAALA AI+SI+G
Sbjct  553   NSLADTVSAATAAIAADPNFTAALAVAITSIIG  585



>ref|XP_002269696.2| PREDICTED: probable WRKY transcription factor 31 [Vitis vinifera]
Length=593

 Score =   401 bits (1031),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 308/581 (53%), Positives = 374/581 (64%), Gaps = 70/581 (12%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPV----FGFNLSPRLNPINgggsgggaGM-VPIN----  1875
             M KG GL+         FF +KP+    F  + S R   ++   +     +  P+N    
Sbjct  1     MAKGSGLSF---GSDPIFFLHKPIVINSFPEDHSKRFAAMDATKNQSTTTIQFPVNLNCA  57

Query  1874  ------PAAEKRGPPNEVDFFSDKKADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsd  1713
                   P  EK    +E+DFF+DK  D   K   T +       ++NTGL L+ AN+ SD
Sbjct  58    HPDSPVPDDEKPRIVDEMDFFADKNRD--SKPPTTDNKNSPYYFNVNTGLHLLTANTSSD  115

Query  1712  kstvddsvss-DMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNL  1536
             +S VDD +S  +++++R KN+L VLQ E+E+M+AEN+RLR ML+QV+ NY ALQ H+  L
Sbjct  116   QSMVDDGMSPPNVDDKRVKNELVVLQAEIERMHAENERLRSMLNQVTNNYNALQVHMVAL  175

Query  1535  MQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQ  1356
             MQ Q          ++ E  D+K            VPRQF++L    G AA A+ +E S 
Sbjct  176   MQDQ--------KAENNEEHDQK--HSGNNNGGVVVPRQFIDL----GLAAKAEVEEPSL  221

Query  1355  SHTTSEERTLS-AGSPRNNN-----------TELSRHKGIIAREDSPDSES-WApnklpk  1215
             S  +SE R+   +GSP NN             E   +   I RE+SPD  S W  NK+P+
Sbjct  222   S--SSEGRSGDRSGSPINNGEVGSKELELRKNEKKEYSSGIGREESPDQGSQWGANKVPR  279

Query  1214  lnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMA  1035
             LNPSK VDQ  EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA
Sbjct  280   LNPSKNVDQT-EATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMA  338

Query  1034  VGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGM  855
              GCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+MPSADG+
Sbjct  339   AGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMPSADGL  398

Query  854   MNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQI  675
             MN+NFLAR +LPCSSS+ATISASAPFPTVTLDLTQ PN L  +QRPP+QF  P   +P  
Sbjct  399   MNSNFLARTVLPCSSSMATISASAPFPTVTLDLTQNPNPL-QFQRPPSQFYVP---SPNP  454

Query  674   PQNYPQ---------LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapp  522
              QN            LPQ+F Q LYNQSKFSGL +S QD+      A      Q      
Sbjct  455   TQNLAGPAAATPSSLLPQIFNQALYNQSKFSGLQMS-QDM----EAAQLPTHHQPSSQQQ  509

Query  521   pqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQP  399
              Q    A+T+SAATAAIT+DPNFTAALAAAI+SI+ GG+QP
Sbjct  510   SQQNSLAETVSAATAAITADPNFTAALAAAITSII-GGAQP  549



>ref|XP_009347144.1| PREDICTED: probable WRKY transcription factor 31 [Pyrus x bretschneideri]
Length=493

 Score =   397 bits (1019),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 275/468 (59%), Positives = 326/468 (70%), Gaps = 39/468 (8%)
 Frame = -1

Query  1751  TGLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVST  1572
             TGL L++ N+ SD S  +D + S++E++RAK++L+VLQ EL+++N ENQRLRGML+QV+T
Sbjct  16    TGLNLLLTNTSSDHSVAEDGIPSNIEDKRAKSELAVLQAELQRINVENQRLRGMLNQVTT  75

Query  1571  NYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPggg  1392
             NY ALQ  L NLMQ Q    +  G+   R VA  + +          VPRQF++L   G 
Sbjct  76    NYNALQVQLLNLMQSQKADQNSSGAEGHR-VALEEKKLMNGNGSSLVVPRQFMDL---GL  131

Query  1391  aaaaAQTDEASQSHTTSEERTLSAGSPRNNNTELSRH---KGI------------IARED  1257
             AA     DE SQS +    R   +GS   +N + + H   +GI            I RE+
Sbjct  132   AAKNGDADEHSQSSSDERSRGERSGS-LGDNVKAAGHSDDQGIGFDHEKKDFGKRIGREE  190

Query  1256  SPD--SESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKM  1083
             SPD  S+SW PNK+P+L+  K VDQ  EATMRKARVSVRARSEAPMI+DGCQWRKYGQKM
Sbjct  191   SPDQPSQSWGPNKVPRLSSPKEVDQT-EATMRKARVSVRARSEAPMITDGCQWRKYGQKM  249

Query  1082  AKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsa  903
             AKGNPCPRAYYRCTMA GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTTS+
Sbjct  250   AKGNPCPRAYYRCTMAAGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTSS  309

Query  902   aanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQ  723
             AA MLLSGAMPSAD +M++NFL+R ILP S+S+ATISASAPFPTVTLDLTQ+PN L  +Q
Sbjct  310   AARMLLSGAMPSADSLMDSNFLSRTILPYSTSMATISASAPFPTVTLDLTQSPNPLQQFQ  369

Query  722   RPPTQFQAPFTGAPQIPQNYPQ-----LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaa  558
             RPP QF  PF   P   QN+       LPQ+F Q LYNQSKFSGL +S QD         
Sbjct  370   RPPGQFNIPF---PNPNQNFTSGPSSLLPQIFSQALYNQSKFSGLQMS-QDT------DR  419

Query  557   qlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMG  414
                Q      P  Q    AD L+A TAAI +DPNFTAALAAAI+SI+G
Sbjct  420   AAVQLGHQSQPGQQQGSLAD-LTAVTAAIAADPNFTAALAAAITSIIG  466



>ref|XP_008342028.1| PREDICTED: probable WRKY transcription factor 31 [Malus domestica]
 ref|XP_008362262.1| PREDICTED: probable WRKY transcription factor 31 [Malus domestica]
Length=645

 Score =   400 bits (1029),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 299/517 (58%), Positives = 357/517 (69%), Gaps = 46/517 (9%)
 Frame = -1

Query  1874  PAAEKRGPPNEVDFFSDKKADIVVKKEITLHGEPVTKADL----------NTGLQLVIAN  1725
             P+ EKR   +E DFF+D K  +  +K + +  +P  K DL          NTGL L++ N
Sbjct  101   PSNEKRKVIDERDFFADSKNRLDHEKSV-VSTDPADKMDLHDPTDMEFNVNTGLNLLLTN  159

Query  1724  sgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHL  1545
             + SD+S VDD +SS+ E++RAK++L+VLQ EL++MNAEN RL+GML+QV+TNY ALQ HL
Sbjct  160   TSSDQSVVDDGISSNKEDKRAKSELAVLQAELKRMNAENHRLKGMLNQVTTNYNALQVHL  219

Query  1544  SNLMQHQNQQSSRIGST-QDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTD  1368
              NLMQ  +Q++ + GS  +   VA  + +     K    VPRQF++L   G AA     D
Sbjct  220   LNLMQ--SQKADQNGSAAEGHGVAVEEKKIMNGNKTSLVVPRQFMDL---GLAANNGDAD  274

Query  1367  EASQSHTTSEERTLSAGSPRNNNTELSRH---KGI------------IAREDSPD--SES  1239
             E SQS +    R   +GS   +N + + H   +GI            I RE+SPD  S+ 
Sbjct  275   EHSQSSSDERSRGEQSGS-LGDNVKAAGHSDDQGIAFDHEKKDFERRIRREESPDQPSQG  333

Query  1238  WApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPR  1059
             W PNK+P+LN  K VDQ  EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPR
Sbjct  334   WGPNKVPRLNSPKEVDQT-EATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPR  392

Query  1058  AYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSG  879
             AYYRCTMA GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTTS+AA MLLSG
Sbjct  393   AYYRCTMAAGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTSSAARMLLSG  452

Query  878   AMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQA  699
             +MPSADG+M++NFL R ILPCSSS+ATISASAPFPTVTLDLTQ+PN L   QRPP QF  
Sbjct  453   SMPSADGLMDSNFLTRTILPCSSSMATISASAPFPTVTLDLTQSPNPLQQLQRPPGQFNI  512

Query  698   PFTGAPQIPQNYPQ--LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpap  525
             PF    Q   N P   LPQ+F Q LYNQSKFSGL +S QD   AA Q    +Q  Q    
Sbjct  513   PFPNPNQNFTNGPASLLPQIFSQALYNQSKFSGLQMS-QDTDCAAGQQGHQSQPGQQQXS  571

Query  524   ppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMG  414
                       L+AATAAI +DPNFTAALAAAI+SI+G
Sbjct  572   LA-------DLTAATAAIAADPNFTAALAAAITSIIG  601



>ref|XP_008364089.1| PREDICTED: probable WRKY transcription factor 31 [Malus domestica]
Length=606

 Score =   399 bits (1025),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 316/604 (52%), Positives = 387/604 (64%), Gaps = 88/604 (15%)
 Frame = -1

Query  2027  MDKGWGLTLENP--------------------DRRAGFFTNKPVF-GFNLSPRLNPINgg  1911
             MDKGWGLTL++                     ++R+ FF  + +F G        P+  G
Sbjct  1     MDKGWGLTLDSDSFGYLLNKPPTAAVKLDHHNNKRSSFFGGERMFQGMEF-----PVKLG  55

Query  1910  gsgggaGMVPINPAAEKRGPPNEVDFFSDKK------------ADIVVKKEITLHGEPVT  1767
                      P N     R   +EVDFFSD+K             D      +++  E  T
Sbjct  56    RREEQDASQPSND--NNRMVVDEVDFFSDRKNKLNTNSTDDHHQDSKSNGAVSVKKENWT  113

Query  1766  KADLNTGLQLVIANsgsdkstvddsvssDME-ERRAKN-DLSVLQVELEKMNAENQRLRG  1593
               D+NTGLQLV AN+GSD+S VDD +SSD    +RAKN +L+ LQVE+++MNAENQRL+ 
Sbjct  114   GLDVNTGLQLVTANTGSDQSMVDDGISSDHGVNKRAKNHELAQLQVEVQRMNAENQRLKE  173

Query  1592  MLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeeP-TVPRQF  1416
             ML QV+ NY+ALQ HL+ ++Q QN  ++     + +   D+ +E K  ++++   VPRQF
Sbjct  174   MLGQVTNNYSALQMHLAAVVQRQNHTTAAPADXRSQLDHDQNAEAKSDQEKKQGLVPRQF  233

Query  1415  LELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNTELSRHKGI------------  1272
             L L P   A    +T +   S+++SE RT SA  P+N N E++++  I            
Sbjct  234   LNLGPRATA----ETTDDQVSNSSSEARTGSASPPQNIN-EVAKNDQIGPLDPPNSNNFR  288

Query  1271  ----IAREDSPDSES--WApnklpklnpskP---VDQAAEATMRKARVSVRARSEAPMIS  1119
                 +  ++SP+S+S  W PNK+PKLN S     +DQ+ EATMRKARVSVRARSEAPMI+
Sbjct  289   DGKRVGGDESPESQSQGWVPNKVPKLNNSAAPKPIDQSTEATMRKARVSVRARSEAPMIT  348

Query  1118  DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplp  939
             DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLP
Sbjct  349   DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLP  408

Query  938   paamamasttsaaanmllSGAMPSADGM-MN-TNFLARAILPCSSSVATISASAPFPTVT  765
             PAAMAMASTT+AAA+MLLSG+M SADGM MN  N LARAILPCSSSVATISASAPFPTVT
Sbjct  409   PAAMAMASTTTAAASMLLSGSMASADGMNMNPNNLLARAILPCSSSVATISASAPFPTVT  468

Query  764   LDLTQTPNSLPNYQRPPTQFQAP-FTGAPQ-IPQNYPQLPQVFGQGLYNQSKFSGLHVSH  591
             LDLT +P     +QRP T FQ P F G PQ       QLPQ FGQ LYNQSKFSGL +S 
Sbjct  469   LDLTTSP---LQFQRPNTPFQIPNFPGQPQSFGAASQQLPQGFGQALYNQSKFSGLQLS-  524

Query  590   QDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
             QD+             QQ      Q   FADT+S    AIT+DP+FTAALAAAI+SI+GG
Sbjct  525   QDL-------MGSTSSQQQQMQQTQSSSFADTVS----AITADPSFTAALAAAITSIIGG  573

Query  410   GSQP  399
             G+ P
Sbjct  574   GAHP  577



>ref|XP_008229974.1| PREDICTED: probable WRKY transcription factor 31 [Prunus mume]
Length=649

 Score =   400 bits (1028),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 304/519 (59%), Positives = 360/519 (69%), Gaps = 44/519 (8%)
 Frame = -1

Query  1883  PINPAAEKRGPPNEVDFFSDKKADIVVKK--------EITLHGEPVTKADLNTGLQLVIA  1728
             P  P+ EKR   +E DFF+D K+ +   K        ++ LHG    + ++NTGL L++ 
Sbjct  102   PEPPSNEKRKVIDERDFFADNKSHVDQDKSASADPADKMDLHGPTDMEFNVNTGLNLLLT  161

Query  1727  NsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQH  1548
             N+ SD+S VDD +SS++E++RAK++L+VLQ ELE+MNAENQRLRGML+QV+TNY ALQ H
Sbjct  162   NTSSDQSVVDDGISSNIEDKRAKSELAVLQAELERMNAENQRLRGMLNQVTTNYNALQVH  221

Query  1547  LSNLMQHQN--QQSSR-----IGSTQDREVADRKSeekkpekeePTVPRQFLELVPggga  1389
             L  LMQ Q   Q SS      +    ++ V + K            VPRQF++L   G A
Sbjct  222   LLTLMQSQKAEQNSSAAEGHGVFDGNNKMVVEEKKLINGNGSPV-VVPRQFMDL---GLA  277

Query  1388  aaaAQTDE----------ASQSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPD--S  1245
             A  A  DE            +S +  E   ++  S      E  R    I RE+SPD  S
Sbjct  278   ANNADADEPSQSSSEERSRERSGSLGENVKVAGHSDDQEKKEFGRG---IGREESPDQPS  334

Query  1244  ESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPC  1065
             +SWAPNK+P+LN  K VDQ  EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPC
Sbjct  335   QSWAPNKVPRLNSPKEVDQT-EATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPC  393

Query  1064  PRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmll  885
             PRAYYRCTMA GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTTS+AA MLL
Sbjct  394   PRAYYRCTMAAGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTSSAARMLL  453

Query  884   SGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQF  705
             SG+MPSADG+M++NFL R ILPCSSS+ATISASAPFPTVTLDLTQ+PN L   QRPP QF
Sbjct  454   SGSMPSADGLMDSNFLTRTILPCSSSMATISASAPFPTVTLDLTQSPNPL-QLQRPPGQF  512

Query  704   QAPFTGAPQIPQNYP--QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhp  531
               PF    Q   N P   LPQ+FGQ LYNQSKFSGL +S QD+     + AQL  QQQ  
Sbjct  513   NIPFPNPSQNFTNGPVSLLPQIFGQALYNQSKFSGLQMS-QDM-----EGAQLGHQQQPG  566

Query  530   apppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMG  414
                 Q    ADT++AATAAI +DPNFTAALAAAI+SI+G
Sbjct  567   HQGQQQNSLADTVTAATAAIAADPNFTAALAAAITSIIG  605



>emb|CAN65218.1| hypothetical protein VITISV_024690 [Vitis vinifera]
Length=620

 Score =   399 bits (1024),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 292/512 (57%), Positives = 346/512 (68%), Gaps = 51/512 (10%)
 Frame = -1

Query  1874  PAAEKRGPPNEVDFFSDKKADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvdd  1695
             P  EK    +E DFF+DK  D   K   T +       ++NTGL L+ AN+ SD+S VDD
Sbjct  91    PDDEKPRIVDEKDFFADKNRD--SKPPTTDNKNSPYYFNVNTGLHLLTANTSSDQSMVDD  148

Query  1694  svss-DMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQ  1518
              +S  +++++R KN+L VLQ E+E+M+AEN+RLR ML QV+ NY ALQ H+  LMQ Q  
Sbjct  149   GMSPPNVDDKRVKNELVVLQAEIERMHAENERLRSMLXQVTNNYNALQVHMVALMQDQ--  206

Query  1517  QSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSE  1338
                     ++ E  D+K            VPRQF++L    G AA A+ +E S S  +SE
Sbjct  207   ------KAENNEEHDQK--HSGNNNGGVVVPRQFIDL----GLAAKAEVEEPSLS--SSE  252

Query  1337  ERTLS-AGSPRNN-----------NTELSRHKGIIAREDSPDSES-WApnklpklnpskP  1197
              R+   +GSP NN             E   +   I RE+SPD  S W  NK+P+LNPSK 
Sbjct  253   GRSGDRSGSPINNGEVGSKELELRKNEKKEYSSGIGREESPDQGSQWGANKVPRLNPSKN  312

Query  1196  VDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVR  1017
             VDQ  EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVR
Sbjct  313   VDQT-EATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVR  371

Query  1016  KQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFL  837
             KQVQRCAEDR+ILITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+MPSADG+MN+NFL
Sbjct  372   KQVQRCAEDRSILITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMPSADGLMNSNFL  431

Query  836   ARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQ  657
             AR +LPCSSS+ATISASAPFPTVTLDLTQ PN L  +QRPP+QF  P   +P   QN   
Sbjct  432   ARTVLPCSSSMATISASAPFPTVTLDLTQNPNPL-QFQRPPSQFXVP---SPNPXQNLAG  487

Query  656   ---------LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLF  504
                      LPQ+F Q LYNQSKFSGL +S QD+      A      Q       Q    
Sbjct  488   PAAATPSSLLPQIFNQALYNQSKFSGLQMS-QDM----EAAQLPTHHQPSSQQQSQQNSL  542

Query  503   ADTLSAATAAITSDPNFTAALAAAISSIMGGG  408
             A+T+SAATAAIT+DPNFTAALAAAI+SI+GG 
Sbjct  543   AETVSAATAAITADPNFTAALAAAITSIIGGA  574



>gb|KHN40870.1| WRKY transcription factor 6 [Glycine soja]
Length=535

 Score =   395 bits (1016),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 301/491 (61%), Positives = 352/491 (72%), Gaps = 42/491 (9%)
 Frame = -1

Query  1844  EVDFFSDKKADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvssDMEERR  1665
             EVDFFS      +VKKE+       T   +NTGLQL+ AN+ SD+STVDD +SSD E++R
Sbjct  47    EVDFFSHTPPPNIVKKELD-----QTPLHINTGLQLLTANTRSDQSTVDDGLSSDAEDKR  101

Query  1664  AKN-DLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQD  1488
             AK  +L+ LQVEL++MNAEN++L+ MLS V+ NYTALQ HL  LMQ QNQQ  R  ST++
Sbjct  102   AKTTELAQLQVELQRMNAENKKLKEMLSHVTGNYTALQMHLVTLMQ-QNQQ--RTESTEN  158

Query  1487  REVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPR  1308
               VA  K E+K        VPRQFL++ P G A       +   S ++S+ERT S+ +P+
Sbjct  159   -GVAQGKVEDKNHGVGGGKVPRQFLDIGPSGTAEV-----DDQVSDSSSDERTRSS-TPQ  211

Query  1307  NNNTELSRHKGI---------IAREDSPDSES--WApnklpklnpskPVDQA-AEATMRK  1164
             +NNTE     G          + RE+SPDSES  W PNKL K+NPS P+DQ+ AEATMRK
Sbjct  212   DNNTEAGTRDGARNNNGNKSELGREESPDSESQGWGPNKLQKVNPSNPMDQSTAEATMRK  271

Query  1163  ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT  984
             ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA+DRT
Sbjct  272   ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCADDRT  331

Query  983   ILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSV  804
             IL+TTYEGTHNHPLPPAAMAMASTT+AAA MLLSG+M SADG+MN N LARAILPCS+S+
Sbjct  332   ILVTTYEGTHNHPLPPAAMAMASTTAAAATMLLSGSMSSADGVMNPNLLARAILPCSTSM  391

Query  803   ATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYN  624
             AT+SASAPFPTVTLDLT  PN L  +QRP   FQ PF  A   PQN+        Q LYN
Sbjct  392   ATLSASAPFPTVTLDLTHNPNPL-QFQRPGAPFQVPFLQA--QPQNFGSGATPIAQALYN  448

Query  623   QSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAA  444
             QSKFSGL +S QD+      +    Q  + P  P QHP  ADT+S      TSDPNFTA 
Sbjct  449   QSKFSGLQLS-QDV----GSSQLAPQAPRPPLQPSQHPSLADTVS------TSDPNFTAV  497

Query  443   LAAAISSIMGG  411
             LAAAISSI+GG
Sbjct  498   LAAAISSIIGG  508



>ref|XP_006364165.1| PREDICTED: WRKY transcription factor 6-like [Solanum tuberosum]
Length=601

 Score =   397 bits (1021),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 277/501 (55%), Positives = 334/501 (67%), Gaps = 46/501 (9%)
 Frame = -1

Query  1847  NEVDFFSDKKADIVVKKEITLHGE-----------PVTKADLNTGLQLVIANsgsdkstv  1701
             +E+DFF+DKK D   ++  T +             P    ++NT L L+ AN+ SD+S V
Sbjct  83    DEMDFFADKKNDTNSEEPTTANDSDRKESNTPPPPPGLDFNINTALHLLTANTYSDQSLV  142

Query  1700  ddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQN  1521
             DD +S + +++R K++L VLQ ELE+MN EN+RLR ML+QV  NY  LQ H+  +MQ QN
Sbjct  143   DDGLSPNSDDKRIKSELVVLQAELERMNGENRRLRDMLNQVKNNYNTLQMHMMTVMQ-QN  201

Query  1520  QQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTS  1341
             Q+S +    +D +  + K +          VPRQF++L       AA++ +E SQS +  
Sbjct  202   QESGQ----RDGKSEEVKHQNGHGGGGGQVVPRQFMDL-----GLAASEAEETSQSSSEG  252

Query  1340  EERTLSAGSPRNNNTELSRHKGIIAREDSPDSES--WApnk---lpklnpskPVDQAAEA  1176
                   + SP NN  E     GII REDSP+ ES  W  NK   L   + +KP DQA EA
Sbjct  253   RSGREKSRSPANN-IEAGSTCGII-REDSPEKESPGWGSNKIPRLGNSSTNKPADQATEA  310

Query  1175  TMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA  996
             TMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCA
Sbjct  311   TMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQRCA  370

Query  995   EDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPC  816
             EDRTILITTYEGTHNHPLPPAAM MASTTS+AA MLLSG+MPSADG+MN NF AR +LPC
Sbjct  371   EDRTILITTYEGTHNHPLPPAAMGMASTTSSAARMLLSGSMPSADGLMNPNFFARTLLPC  430

Query  815   SSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQ---IPQNYPQLPQV  645
             SSS+ATISASAPFPTVTLDLTQ+PN L  + RPP  FQ PF+       +      LPQ+
Sbjct  431   SSSMATISASAPFPTVTLDLTQSPNPL-QFPRPPNPFQVPFSNPTHNNILANPAALLPQI  489

Query  644   FGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITS  465
             FGQ LYNQSKFSGL  S QD+           QQ         H   ADT++    A+TS
Sbjct  490   FGQALYNQSKFSGLQ-SSQDL---------EGQQHPSTMSSSNHNPLADTVN----ALTS  535

Query  464   DPNFTAALAAAISSIMGGGSQ  402
             DPNFTAALAAAI+S++G   Q
Sbjct  536   DPNFTAALAAAITSLIGNPGQ  556



>ref|XP_008779787.1| PREDICTED: probable WRKY transcription factor 31 isoform X1 [Phoenix 
dactylifera]
Length=584

 Score =   396 bits (1017),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 287/520 (55%), Positives = 346/520 (67%), Gaps = 58/520 (11%)
 Frame = -1

Query  1874  PAAEKRGPPNEVDFFSDKKADIVVKK-EITLHGEPVTKADLN-------TGLQLVIANsg  1719
             P  EKR   +E+DFFSD+K     +  +  +    + K DL        TGL L+ AN+G
Sbjct  67    PPGEKR--VDEMDFFSDEKKKKRGRDLDFKVPSLSIKKEDLTIDMRFPYTGLNLLTANTG  124

Query  1718  sdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSN  1539
             SD+S VDD +S   + +  K+ LS +Q EL +M  ENQRL+G+L+QV+TNY ALQ HL  
Sbjct  125   SDQSMVDDGLSPPEDNKEGKSKLSSMQAELVRMKEENQRLKGVLNQVTTNYNALQMHLVA  184

Query  1538  LMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEAS  1359
             LMQ + Q++   GS+QD E +D K++ K        VPRQFL+L P         TDE S
Sbjct  185   LMQERTQKN---GSSQDHEASDEKTDGK-------IVPRQFLDLGPAA------NTDEPS  228

Query  1358  QS--------HTTSEERTLSAGSPRNNNTELSRHKGIIA-------REDSPD--SESWAp  1230
             +S         ++S    + AGS      + + +K I++       REDSPD  SE W P
Sbjct  229   RSSIEGGGWDRSSSPTNNVEAGSMEYRLNKYNTNKEIVSFDHERTNREDSPDPSSEGWNP  288

Query  1229  nklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYY  1050
             NK  KL   K  +Q+ EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYY
Sbjct  289   NKASKLASPKSAEQSQEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYY  348

Query  1049  RCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMP  870
             RCTMA GCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMASTTSAAA+MLLSG+M 
Sbjct  349   RCTMATGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMASTTSAAASMLLSGSMS  408

Query  869   SADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPF-  693
             S +G++N+NFL+R +LPCSSS+ATISASAPFPTVTLDLT TPN L  +QR P QFQ PF 
Sbjct  409   STEGLINSNFLSRTVLPCSSSMATISASAPFPTVTLDLTHTPNPL-QFQRLPAQFQVPFP  467

Query  692   TGAPQI--PQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpappp  519
             +G P    P   P LPQVFGQ L NQS FSGL +S             +   Q     PP
Sbjct  468   SGTPAFGAPPQPPSLPQVFGQALNNQSTFSGLQMS-----------PNMDGAQFPRPKPP  516

Query  518   qhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQP  399
                   DT+SAATAAIT+DP+F AAL AAI+SI+GGG QP
Sbjct  517   SAASLPDTVSAATAAITADPSFKAALVAAITSIIGGGHQP  556



>ref|XP_004289178.1| PREDICTED: WRKY transcription factor 6-like [Fragaria vesca subsp. 
vesca]
Length=582

 Score =   395 bits (1016),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 281/501 (56%), Positives = 342/501 (68%), Gaps = 49/501 (10%)
 Frame = -1

Query  1847  NEVDFFSDKK----ADIVVKKEITLHGEPV-TKADLNTGLQLVIANsgsdkstvddsvss  1683
             +E DFF+D      A+     ++     P     +LNTGL L+I N+ SD+S VDD +SS
Sbjct  77    DERDFFADNNNKAAAEEASADKMDFDDGPSGMDFNLNTGLNLLITNTSSDQSVVDDGISS  136

Query  1682  DMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRI  1503
              +E++RAK++L+VLQ ELE+MN+ENQRLRGMLSQV+TNY ALQ HL +LMQ  NQ++   
Sbjct  137   SLEDKRAKSELAVLQAELERMNSENQRLRGMLSQVTTNYNALQVHLLSLMQ--NQKADNG  194

Query  1502  GSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLS  1323
                ++++V             +  VPRQF++L        AA  D    S ++S+ER+  
Sbjct  195   AEVEEKKV-------NTGNGSQVVVPRQFMDL------GLAANGDAEEPSQSSSDERSRE  241

Query  1322  AGSPRNNNTELSRH----------------KGIIAREDSPD--SESWApnklpklnpskP  1197
                  ++    + H                +GI  RE+SPD  ++SW PNK+P+LN  K 
Sbjct  242   RSGSGDDGKTGAGHVGDEGHAFDQVKKEFGRGISGREESPDQQTQSWGPNKVPRLNSPKE  301

Query  1196  VDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVR  1017
             VDQA EATMRKARVSVRARSEA MI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVR
Sbjct  302   VDQA-EATMRKARVSVRARSEATMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVR  360

Query  1016  KQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFL  837
             KQVQRCA+DRTIL+TTYEG HNHPLPPAAMAMASTTS+AA MLLSG+MPSADG+M+++FL
Sbjct  361   KQVQRCADDRTILVTTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMPSADGLMDSSFL  420

Query  836   ARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQ  657
              R ILPCSSS+ATISASAPFPTVTLDLTQ+PN L  + RPP QF  PF    Q       
Sbjct  421   TRTILPCSSSMATISASAPFPTVTLDLTQSPNPL-QFPRPPGQFNIPFPNPSQTNGPASL  479

Query  656   LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATA  477
             LPQ+FGQ LYNQSKFSGL +S QD+            Q Q      Q    ADT+SAATA
Sbjct  480   LPQIFGQALYNQSKFSGLQMS-QDM--------DRNAQPQQAQQGQQQNSLADTVSAATA  530

Query  476   AITSDPNFTAALAAAISSIMG  414
             AI +DP FTAALAAAI+SI+G
Sbjct  531   AIAADPTFTAALAAAITSILG  551



>ref|XP_007147706.1| hypothetical protein PHAVU_006G147800g [Phaseolus vulgaris]
 gb|ESW19700.1| hypothetical protein PHAVU_006G147800g [Phaseolus vulgaris]
Length=611

 Score =   394 bits (1013),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 313/578 (54%), Positives = 374/578 (65%), Gaps = 73/578 (13%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPI--------NP  1872
             MDKGWGLTL+    ++           +L P   P           M P+         P
Sbjct  43    MDKGWGLTLDTSSSQS----------LSLFPSKQPSTSFSKLTSDTMFPLLGFPVNLSRP  92

Query  1871  AAE----KRGPPNEVDFFSDKKADI-------------VVKKEITLHGEPVTKADLNTGL  1743
             + +     R    EVDFFSD+                 +VKKEI       T   +NTGL
Sbjct  93    SVKDDEHNRKVVGEVDFFSDRITKPTSPPSHDQHVKPNIVKKEIL-----ETPLHVNTGL  147

Query  1742  QLVIANsgsdkstvddsvssDMEERRAKN-DLSVLQVELEKMNAENQRLRGMLSQVSTNY  1566
             QL+ AN+GSD+STVDD VSSD E++ AK  +L+ +QVEL++MNAEN++L+ MLS V+ NY
Sbjct  148   QLLTANTGSDQSTVDDGVSSDAEDKLAKTTELAQMQVELQRMNAENKKLKEMLSHVTGNY  207

Query  1565  TALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaa  1386
             TALQ HL  LM HQNQ++       + EV   K  +K        +PRQFL++ P G A 
Sbjct  208   TALQMHLMTLM-HQNQRTENT----ENEVVQGKVGDKTYAVGGGKIPRQFLDIGPSGAAE  262

Query  1385  aaAQTDEASQSHTTSEERTLSAGSPRNNNTELSRHKGI--------IAREDSPDSES--W  1236
                   +   S ++S+ERT S+ +P+NNN E+    G         + RE SPDSES  W
Sbjct  263   V-----DDQVSDSSSDERTRSS-TPQNNNNEVGTRDGAKNVNGKRELGREGSPDSESQGW  316

Query  1235  ApnklpklnpskPVDQAA-EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPR  1059
              PNKL K++PS  +DQ+  EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPR
Sbjct  317   GPNKLQKVSPSNAIDQSTTEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPR  376

Query  1058  AYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSG  879
             AYYRCTMAVGCPVRKQVQRCAEDRTIL+TTYEGTHNHPLPPAAMAMASTT+AAA+MLLSG
Sbjct  377   AYYRCTMAVGCPVRKQVQRCAEDRTILVTTYEGTHNHPLPPAAMAMASTTAAAASMLLSG  436

Query  878   AMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQA  699
             +M SADG+MN N LARAILPC+SS+AT+SASAPFPTVTLDLT  PN L  +QRP T FQ 
Sbjct  437   SMSSADGIMNPNLLARAILPCNSSMATLSASAPFPTVTLDLTHNPNPL-QFQRPSTPFQV  495

Query  698   PFTGAPQIPQNYPQ--LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpap  525
             PF      PQN+     P    Q LYNQSKFSGL +S Q++ ++   A       Q    
Sbjct  496   PFLQGQ--PQNFGSGATPMAQAQALYNQSKFSGLQLS-QEVGSSQLTAQATRPPLQPSQQ  552

Query  524   ppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
             P      ADT+SAA AAITSDPNFTA LAAAISSI+GG
Sbjct  553   PSS----ADTVSAAAAAITSDPNFTAVLAAAISSIIGG  586



>ref|XP_004134775.1| PREDICTED: probable WRKY transcription factor 42-like [Cucumis 
sativus]
Length=623

 Score =   394 bits (1013),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 325/608 (53%), Positives = 386/608 (63%), Gaps = 89/608 (15%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRA-GFFTNKP--------------VF-GFNLSPRLNPINgggsggg  1896
             MDKGWGLTL + + ++ GFF+NKP              +F G   S +L   +       
Sbjct  1     MDKGWGLTLRDSEHQSIGFFSNKPPPPPPPPTLNSFQRMFQGLEFSGKLGHTDSTPDDNN  60

Query  1895  aGMVPINPAAEKRGPPNEVDFFSDKKADIVVKKEITLHGEP-----VTKAD---------  1758
                V             EVDFFS KK  +V   E     +P     + K D         
Sbjct  61    RLAV-------------EVDFFSAKKR-VVDDLEADQDSKPTSTTSIIKDDKALTPPPPP  106

Query  1757  ------LNTGLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLR  1596
                   +NTGL L+ AN+GSD+STVDD +SSD E++RAKN+L+ LQVEL++MNAEN +LR
Sbjct  107   TTSFNLVNTGLHLLTANTGSDQSTVDDGISSDGEDKRAKNELAQLQVELQRMNAENHKLR  166

Query  1595  GMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGS-TQDREV-ADRKSeekkpekeePTVPR  1422
              MLS VS NY++L  HL +LMQ + QQ +        RE+  ++KS E K E  +  VPR
Sbjct  167   DMLSHVSNNYSSLHMHLLSLMQQKQQQQNHPSEPAHQREIGGEKKSTEIKHEVGKVMVPR  226

Query  1421  QFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSP----------------RNN----  1302
             QF++L P G +       E    +++S+ERT S GSP                R++    
Sbjct  227   QFMDLGPSGNSNIGES--EELLCNSSSDERTRS-GSPLNINNNNNNTETASKKRDHAEIM  283

Query  1301  --NTELSRHKGIIAREDSPDSES--WApnklp----klnpskPVDQAAEATMRKARVSVR  1146
               N++    K  I REDSP+SES  W PN         + SKP+DQ+ EATMRKARVSVR
Sbjct  284   PPNSDHENSKRSIPREDSPESESQGWGPNHKTPRFNNSSNSKPLDQSTEATMRKARVSVR  343

Query  1145  ARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY  966
             ARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY
Sbjct  344   ARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY  403

Query  965   EGThnhplppaamamasttsaaanmllSGAMPSAD-GMMNTNFLARAILPCSSSVATISA  789
             EG HNHPLPPAAMAMASTT+AAA MLLSG+M SAD  +MN N LARAILPCS+S+ATISA
Sbjct  404   EGNHNHPLPPAAMAMASTTTAAATMLLSGSMSSADHNLMNPNLLARAILPCSTSMATISA  463

Query  788   SAPFPTVTLDLTQTPNSLPNYQRPPTQ-FQAPFTGAPQIPQNYPQLPQVFGQGLY-NQSK  615
             SAPFPT+TLDLT TPN L  +QRP    FQ PF G  Q P    QLPQV GQ LY NQSK
Sbjct  464   SAPFPTITLDLTHTPNPL-QFQRPTAAPFQVPFPGG-QPPSAAAQLPQVLGQALYNNQSK  521

Query  614   FSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAA  435
             FSGL +SH+ + A ++        Q      P    FADTLSAATAAIT+DPNFTAALAA
Sbjct  522   FSGLQLSHE-MGANSSHLGHHQITQPASPAQPGGASFADTLSAATAAITADPNFTAALAA  580

Query  434   AISSIMGG  411
             AISSI+GG
Sbjct  581   AISSIIGG  588



>gb|AGG23543.1| WRKY transcription factor 42 [Malus hupehensis]
Length=563

 Score =   391 bits (1004),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 297/523 (57%), Positives = 360/523 (69%), Gaps = 60/523 (11%)
 Frame = -1

Query  1847  NEVDFFSDKK------------ADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkst  1704
             +EVDFFSD+K             D      +++  E  T  D+NTGLQLV AN+GSD+S 
Sbjct  32    DEVDFFSDRKNKLNTNSTDDHHQDSKSNGAVSVKKENWTGLDVNTGLQLVTANTGSDQSM  91

Query  1703  vddsvssDME-ERRAKN-DLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQ  1530
             VDD +SSD    +RAKN +L+ LQVE+++MNAENQRL+ ML QV+ NY+ALQ HL+ ++Q
Sbjct  92    VDDGISSDHGVNKRAKNHELAQLQVEVQRMNAENQRLKEMLGQVTNNYSALQMHLAAVVQ  151

Query  1529  HQNQQSSRIGSTQDREVADRKSeekkpekeeP-TVPRQFLELVPgggaaaaAQTDEASQS  1353
              QN  ++     + +   D+ +E K  ++++   VPRQFL L P   A    +T +   S
Sbjct  152   RQNHTTAAPADKRSQLDHDQNAEAKSDQEKKQGLVPRQFLNLGPRATA----ETTDDQVS  207

Query  1352  HTTSEERTLSAGSPRNNNTELSRHKGI----------------IAREDSPDSES--WApn  1227
             +++SE RT SA  P+N N E++++  I                +  ++SP+S+S  W PN
Sbjct  208   NSSSEARTGSASPPQNIN-EVAKNDQIGPLDPPNSNNFRDGKRVGGDESPESQSQGWVPN  266

Query  1226  klpklnpskP---VDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRA  1056
             K+PKLN S     +DQ+ EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRA
Sbjct  267   KVPKLNNSAAPKPIDQSTEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRA  326

Query  1055  YYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGA  876
             YYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTT+AAA+MLLSG+
Sbjct  327   YYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTTAAASMLLSGS  386

Query  875   MPSADGM-MN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQ  702
             M SADGM MN  N LARAILPCSSSVATISASAPFPTVTLDLT +P     +QRP T FQ
Sbjct  387   MASADGMNMNPNNLLARAILPCSSSVATISASAPFPTVTLDLTTSP---LQFQRPNTPFQ  443

Query  701   AP-FTGAPQ-IPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpa  528
              P F G PQ       QLPQ FGQ LYNQSKFSGL +S QD+             QQ   
Sbjct  444   IPNFPGQPQSFGAASQQLPQGFGQALYNQSKFSGLQLS-QDL-------MGSTSSQQQQM  495

Query  527   pppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQP  399
                Q   FADT+S    AIT+DP+FTAALAAAI+SI+GGG+ P
Sbjct  496   QQTQSSSFADTVS----AITADPSFTAALAAAITSIIGGGAHP  534



>ref|XP_009358665.1| PREDICTED: probable WRKY transcription factor 31 [Pyrus x bretschneideri]
Length=606

 Score =   392 bits (1008),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 315/606 (52%), Positives = 378/606 (62%), Gaps = 91/606 (15%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKP-----------------VFGFNLSPRLN-PINgggsg  1902
             MDKGWGLTL++     G+  NKP                   G  + P +  P+  G   
Sbjct  1     MDKGWGLTLDS--DSFGYLLNKPPTAAVKLDHHNNKRSSFFRGERMFPGMEFPVKLGRRE  58

Query  1901  ggaGMVPINPAAEKRGPPNEVDFFSDKK------------ADIVVKKEITLHGEPVTKAD  1758
                   P N     R   +EVDFFSD+K             D      +++  E  T  D
Sbjct  59    EQDASQPSN--DNNRKVVDEVDFFSDRKNKLNTNSTDDHHQDSKSNGAVSVKKENWTGLD  116

Query  1757  LNTGLQLVIANsgsdkstvddsvssDME-ERRAKN-DLSVLQVELEKMNAENQRLRGMLS  1584
             +NTGLQLV AN+ SD+S VDD +SSD    + AKN +L+ LQVE+++MNAENQRL+ ML 
Sbjct  117   VNTGLQLVTANTRSDQSMVDDGISSDHGVNKTAKNHELAQLQVEVQRMNAENQRLKEMLG  176

Query  1583  QVSTNYTALQQHLSNLMQHQNQ-------QSSRIGSTQDREVADRKSeekkpekeePTVP  1425
             QV+ NY+ LQ HL+ ++Q QN        Q S++   Q+ E    + +++        VP
Sbjct  177   QVTNNYSVLQMHLAAVVQQQNHTTAAPADQRSQLDRDQNAEAKSDQEKKQG------LVP  230

Query  1424  RQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPRN---------------NNTEL  1290
             RQFL L P   A    +T++   S+ +SE RT SA  P+N                N+  
Sbjct  231   RQFLNLGPRATA----ETNDDQVSNCSSEARTRSASPPQNIDEVVKNDQIGPLDPPNSNN  286

Query  1289  SRHKGIIAREDSPDSES--WApnklpklnpskP---VDQAAEATMRKARVSVRARSEAPM  1125
              R    +  ++SP+SES  W PNK+PKLN S     +DQ+ EATMRKARVSVRARSEAPM
Sbjct  287   FRDGKRVGGDESPESESQGWVPNKVPKLNNSAAPKPIDQSTEATMRKARVSVRARSEAPM  346

Query  1124  ISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhp  945
             I+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHP
Sbjct  347   ITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHP  406

Query  944   lppaamamasttsaaanmllSGAMPSADGM-MN-TNFLARAILPCSSSVATISASAPFPT  771
             LPPAAMAMASTT+AAA+MLLSG+M SADGM MN  N LARAILPCSSSVATISASAPFPT
Sbjct  407   LPPAAMAMASTTTAAASMLLSGSMASADGMNMNPNNLLARAILPCSSSVATISASAPFPT  466

Query  770   VTLDLTQTPNSLPNYQRPPTQFQAP-FTGAPQ-IPQNYPQLPQVFGQGLYNQSKFSGLHV  597
             VTLDLT +P     +QRP T FQ P F G PQ       QLPQ FGQ LYNQSKFSGL +
Sbjct  467   VTLDLTTSP---LQFQRPNTPFQVPNFPGQPQSFGAASQQLPQGFGQALYNQSKFSGLQL  523

Query  596   SHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIM  417
             S QD+          + QQQ      Q   FADT+S    AI +DP+FTAALAAAI+SI+
Sbjct  524   S-QDL------MGSTSSQQQQQMQQTQSSSFADTVS----AIAADPSFTAALAAAITSII  572

Query  416   GGGSQP  399
             GGG+ P
Sbjct  573   GGGAHP  578



>ref|XP_010926194.1| PREDICTED: probable WRKY transcription factor 31 isoform X1 [Elaeis 
guineensis]
Length=584

 Score =   390 bits (1002),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 285/512 (56%), Positives = 342/512 (67%), Gaps = 57/512 (11%)
 Frame = -1

Query  1847  NEVDFFSDKKADIVVKKEITLH--GEPVTKADLN-------TGLQLVIANsgsdkstvdd  1695
             +E+DFFS++K     + ++ L      + K DLN       TGL L+ AN+ SD+STVDD
Sbjct  74    DEMDFFSNEKKRSREEPDLDLKVPSLSIKKEDLNIDMRYPYTGLNLLTANTASDQSTVDD  133

Query  1694  svssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQ  1515
              +S   +++  K++L+ +Q EL +MN ENQRLRGML+QV+TNY ALQ  L  LMQ + Q+
Sbjct  134   GLSPPQDDKEGKSELASMQAELSRMNEENQRLRGMLNQVTTNYNALQMQLVVLMQQRKQK  193

Query  1514  SSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQS------  1353
                 GS+Q+ E  D K++ K        VPRQF++L        AA TDE SQS      
Sbjct  194   D---GSSQEHEAMDEKTDGK-------IVPRQFMDL------GLAANTDEPSQSSIEGGG  237

Query  1352  --HTTSEERTLSAGSPRNNNTELSRHKGIIA-------REDSPD--SESWApnklpklnp  1206
                ++S    + AGS      + + +K I+        R+DSPD  SE W PNK  KL  
Sbjct  238   RERSSSPTNNVEAGSMEYRLKKNNANKEIVPLDHERSNRDDSPDPSSEGWNPNKASKLAS  297

Query  1205  skPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGC  1026
              K  +Q  EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GC
Sbjct  298   PKSEEQTQEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMATGC  357

Query  1025  PVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNT  846
             PVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMASTTSAAA+MLLSG+M SADG++N+
Sbjct  358   PVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMASTTSAAASMLLSGSMSSADGLINS  417

Query  845   NFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPF-TGAPQI--  675
             NFLAR +LPCSSS+ATISASAPFPTVTLDLT  PN L  +QR P QFQ P   G P    
Sbjct  418   NFLARTVLPCSSSLATISASAPFPTVTLDLTHNPNPL-QFQRLPAQFQLPLPNGTPAFGG  476

Query  674   PQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADT  495
             P   P LPQ+FGQ L +QS FSGL +S             +   Q     PP     ADT
Sbjct  477   PPQPPALPQIFGQALNSQSTFSGLQMS-----------PNMDGAQFPHPKPPSATSLADT  525

Query  494   LSAATAAITSDPNFTAALAAAISSIMGGGSQP  399
             +SAATAAIT+DP F AALAAAI+SI+GGG QP
Sbjct  526   VSAATAAITADPTFKAALAAAITSIIGGGHQP  557



>ref|XP_010035553.1| PREDICTED: probable WRKY transcription factor 31 [Eucalyptus 
grandis]
 gb|KCW46978.1| hypothetical protein EUGRSUZ_K00786 [Eucalyptus grandis]
Length=627

 Score =   390 bits (1001),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 284/515 (55%), Positives = 343/515 (67%), Gaps = 54/515 (10%)
 Frame = -1

Query  1871  AAEKRGPPNEVDFFSDKK-ADIVVKKEITLHGEPVTKADL-----------NTGLQLVIA  1728
             A E+R   +E+DFFS K  ++   K  I+   +   + D+           NTGL L+  
Sbjct  99    ADERRAVIDEMDFFSIKNNSEAAAKNVISSSDDGGARKDMTDGPTNLDFNVNTGLNLLTT  158

Query  1727  NsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQH  1548
             N+ SD+S VDD +S + E++RAKN+L+VLQ E+E+M+ ENQRL+ MLSQV+TNY+ALQ H
Sbjct  159   NTSSDQSMVDDGISPNSEDKRAKNELAVLQAEVERMSNENQRLKDMLSQVTTNYSALQMH  218

Query  1547  LSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTD  1368
             L  +MQ Q  ++S   S ++R+  ++K            VPRQF++L    G A A  +D
Sbjct  219   LLAVMQDQKPENS---SDENRKSDEKKENSMLM------VPRQFMDL----GLATANNSD  265

Query  1367  EASQSHTTSEERTLSAGSPRNNNTELS----------------RHKGIIAREDSPDSESW  1236
               S S   + +RT   GSP NNN E +                RHK    RE+SPD ES 
Sbjct  266   SPSSSEGGTRDRT---GSPVNNNREPAEVGMGLDPDKKESASGRHK----REESPDQESL  318

Query  1235  ApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRA  1056
                    ++PSK VDQ  EATMRKARVSVRA SEAPMI+DGCQWRKYGQKMAKGNPCPRA
Sbjct  319   PIKVPRSISPSKSVDQT-EATMRKARVSVRAHSEAPMITDGCQWRKYGQKMAKGNPCPRA  377

Query  1055  YYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGA  876
             YYRCTMA GCPVRKQVQRCAEDR++LITTYEG HNHPLPPAAMAMA+TTS+AA MLLSG+
Sbjct  378   YYRCTMAAGCPVRKQVQRCAEDRSVLITTYEGNHNHPLPPAAMAMAATTSSAARMLLSGS  437

Query  875   MPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAP  696
             MPS +G+MNTNFL R +LPCSSS+ATISASAPFPTVTLDLTQ PN+L   Q  P QFQ P
Sbjct  438   MPSGEGLMNTNFLTRTLLPCSSSMATISASAPFPTVTLDLTQNPNTL-QSQASPGQFQVP  496

Query  695   F--TGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapp  522
             F   G+     +   LPQ+FGQ LYNQSKFSGL +S QD  A   +      Q      P
Sbjct  497   FPNPGSSLPNHSAALLPQIFGQALYNQSKFSGLQMS-QDAKACRLEGQPQLPQPPGQGQP  555

Query  521   pqhpLFADTLSAATAAITSDPNFTAALAAAISSIM  417
                    DTLSAATAAI ++PNFTAALAAAISSIM
Sbjct  556   NSIFT-TDTLSAATAAIATNPNFTAALAAAISSIM  589



>gb|AGV75956.1| WRKY transcription factor 58 [Gossypium hirsutum]
Length=560

 Score =   387 bits (995),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 290/523 (55%), Positives = 338/523 (65%), Gaps = 66/523 (13%)
 Frame = -1

Query  1883  PINPAAEKRGPP----NEVDFFSDKKADIVVKKEITLHGEPVT-----------KADLNT  1749
             P+NP       P     E+DFFS+K   +V            T           + ++NT
Sbjct  19    PVNPNCTNDEIPRRVIGEMDFFSEKNHKLVDDHVDDSDHANATDINDSIDRTALELNVNT  78

Query  1748  GLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTN  1569
             GL L+  N+ SD+S+VDD +SS+ME++RAKN+L+VLQVELE+MN ENQ+LR MLSQV++N
Sbjct  79    GLNLLTTNTSSDQSSVDDGISSNMEDKRAKNELAVLQVELERMNTENQQLREMLSQVTSN  138

Query  1568  YTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPggga  1389
             Y  +Q+HL  LMQ Q            ++    K++E+K       VPRQF++L     A
Sbjct  139   YNTVQKHLVALMQQQ------------QDGKPEKNDEQKKSNGGLIVPRQFMDLGIAAAA  186

Query  1388  aaaAQTDEASQSHTTSEERTLSAGSPRNNNTEL------SRHKGI------IAREDSPDS  1245
             AA   TDE S S T      LS GSP   N E+      SR +G       I REDSPD 
Sbjct  187   AAEVDTDEPSLSSTEGRSHDLS-GSP---NVEVASKEFRSRKRGSSEEGRRIGREDSPDG  242

Query  1244  ESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPC  1065
                      K      VDQ  EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPC
Sbjct  243   NKVPRFNSSKT-----VDQT-EATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPC  296

Query  1064  PRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmll  885
             PRAYYRCTMA GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTTS+AA MLL
Sbjct  297   PRAYYRCTMAAGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTSSAARMLL  356

Query  884   SGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQF  705
             SG+M SADG+MN+NFL R +LPCSSS+ATISASAPFPTVTLDLTQTPN L  + RP  QF
Sbjct  357   SGSMSSADGLMNSNFLTRTLLPCSSSMATISASAPFPTVTLDLTQTPNPL-QFPRPEGQF  415

Query  704   QAPFTGAPQIPQN------YPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqq  543
             Q PF   P            P LPQ+FGQ LYNQSKFSGL +SH DI            Q
Sbjct  416   QVPFPNPPPHNLPNSQLSPLPLLPQIFGQALYNQSKFSGLQMSH-DI---------EQPQ  465

Query  542   qqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMG  414
               H     Q    ADT++AATAAI ++PNFTAALAAAI+SI+G
Sbjct  466   MSHQHQQGQQKSLADTVNAATAAIAANPNFTAALAAAITSIIG  508



>ref|XP_004231617.1| PREDICTED: WRKY transcription factor 6 [Solanum lycopersicum]
Length=504

 Score =   384 bits (985),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 306/544 (56%), Positives = 356/544 (65%), Gaps = 82/544 (15%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPINPAAEKRGPP  1848
             MDKGWGLTLEN          KP FGFN     + +N       A         +K+   
Sbjct  7     MDKGWGLTLEN----------KPFFGFN-----HMMNRREEQLVAD-------HDKK---  41

Query  1847  NEVDFFSDKKADIV----VKKEITLHGEPVT---KADLNTGLQLVIANsgsdkstvddsv  1689
              EVDFFS      +    +KKE  L+   +T   K  +NTGLQLV A+  S     +   
Sbjct  42    -EVDFFSHHNRKAIHHDFIKKE-DLNSTTITTPSKFIVNTGLQLVTASDQSTVDDGELI-  98

Query  1688  ssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSS  1509
                +EE RAKN+L+ LQVEL +MNAENQRLRGML+QV+ NYTALQ HL+ LMQ Q Q  S
Sbjct  99    ---LEEERAKNELAELQVELRRMNAENQRLRGMLTQVTNNYTALQMHLATLMQQQRQNIS  155

Query  1508  RIGSTQDR--EVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEE  1335
                +T D   ++ + K        +E  VPR+FLEL         +  D +  S+++SEE
Sbjct  156   ITQNTHDHNFQIVEAK------LNQEKIVPRRFLEL-------GRSGNDLSHNSNSSSEE  202

Query  1334  RTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRKARV  1155
             RT+S  SPRN+      H     RE+SP+S+SW PNK+PKLN S P+D   +ATMRKARV
Sbjct  203   RTVSK-SPRNDTQVTIMHNK--GREESPESDSWVPNKVPKLNSSMPIDPTTDATMRKARV  259

Query  1154  SVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILI  975
             SVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTIL 
Sbjct  260   SVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILN  319

Query  974   TTYEGThnhplppaamamasttsaaanmllSGAMPSADG-MMNTNFLARAILPCSSSVAT  798
             TTYEGTHNHPLPPAAMAMASTTSAAANMLLSG+M SADG +MN NFLAR +LPCSSS+AT
Sbjct  320   TTYEGTHNHPLPPAAMAMASTTSAAANMLLSGSMSSADGVLMNPNFLARTMLPCSSSMAT  379

Query  797   ISASAPFPTVTLDLTQTPNSLPNYQRPP--TQFQAPFTGAPQIPQNY------PQLPQVF  642
             ISASAPFPTVTLDLTQ  NSL   QR    +QFQ PF  +PQ P N+      P +PQV 
Sbjct  380   ISASAPFPTVTLDLTQNQNSLTYNQRSTQISQFQVPFQSSPQHP-NFITSMPPPPMPQV-  437

Query  641   GQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSD  462
                L+NQSKFSGL +S QDI              Q       H  F+DTL+AATAAIT+D
Sbjct  438   ---LHNQSKFSGLQIS-QDI-----------HHPQQLQHVQNHQSFSDTLTAATAAITAD  482

Query  461   PNFT  450
             PNFT
Sbjct  483   PNFT  486



>gb|KDO54715.1| hypothetical protein CISIN_1g007546mg [Citrus sinensis]
Length=599

 Score =   386 bits (991),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 275/505 (54%), Positives = 338/505 (67%), Gaps = 41/505 (8%)
 Frame = -1

Query  1862  KRGPPNEVDFFSDKKADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvss  1683
             KR   +E+DFF+DK       ++   + +   + ++NTGL L+  N+ SD STVDD +S+
Sbjct  88    KRKVIDEMDFFTDKNTH---SRDHHHYKDSKLELNVNTGLNLLTTNTSSDHSTVDDGIST  144

Query  1682  DMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRI  1503
             +ME+++AKN+ +V+Q ELE++NAENQRL+ M+++V+ NY ALQ  L   MQH N +++  
Sbjct  145   NMEDKKAKNEYAVVQAELERVNAENQRLKDMVNEVTNNYNALQLQLMAFMQHHNAKAADE  204

Query  1502  GSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLS  1323
              S   R+V ++K +           PR+F++L  G G   A   DE + S +    R L 
Sbjct  205   NS-DGRQVEEKKGQL--------AAPRRFIDL--GLGVNTADTADEPALSSSEGRSRDL-  252

Query  1322  AGSPRNNNTELSR---------HKGIIAREDSPDSESWApnklpklnpskPVDQAAEATM  1170
              GSP N N+  +           K  + R+DSPD            + SK VDQ  EATM
Sbjct  253   GGSPVNGNSNNNEESNVLFGQDKKEFVQRDDSPDRNYGPNKVPKFSSSSKNVDQT-EATM  311

Query  1169  RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAED  990
             RKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAED
Sbjct  312   RKARVSVRARSEAPMINDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQRCAED  371

Query  989   RTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSS  810
             RTILITTYEG HNHPLPPAAMAMASTTS+AA +LLSG+M SADG+MN NFLAR +LPCSS
Sbjct  372   RTILITTYEGNHNHPLPPAAMAMASTTSSAARLLLSGSMSSADGLMNANFLARTLLPCSS  431

Query  809   SVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQ---------  657
             S+ATISASAPFPTVTLDLTQTPN   N QR P QFQ PF   P    N+           
Sbjct  432   SMATISASAPFPTVTLDLTQTPNP-SNVQRSPNQFQVPF---PNPSHNFANGAAAAAAGS  487

Query  656   -LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAAT  480
              LPQ+FGQ LYNQSKFSGL +S QD+   +    Q            QH   AD++SAAT
Sbjct  488   LLPQIFGQALYNQSKFSGLQMS-QDM-DPSQLGNQSQLPSPAMQQGQQHNSLADSVSAAT  545

Query  479   AAITSDPNFTAALAAAISSIMGGGS  405
             AAI +DPNFTAALAAAI+SI+ GG+
Sbjct  546   AAIAADPNFTAALAAAITSIINGGT  570



>ref|XP_006447589.1| hypothetical protein CICLE_v10014665mg [Citrus clementina]
 ref|XP_006495237.1| PREDICTED: probable WRKY transcription factor 31-like [Citrus 
sinensis]
 gb|ESR60829.1| hypothetical protein CICLE_v10014665mg [Citrus clementina]
Length=599

 Score =   385 bits (990),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 275/505 (54%), Positives = 338/505 (67%), Gaps = 41/505 (8%)
 Frame = -1

Query  1862  KRGPPNEVDFFSDKKADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvss  1683
             KR   +E+DFF+DK       ++   + +   + ++NTGL L+  N+ SD STVDD +S+
Sbjct  88    KRKVIDEMDFFTDK---TTHSRDHHHYKDSKLELNVNTGLNLLTTNTSSDHSTVDDGIST  144

Query  1682  DMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRI  1503
             +ME+++AKN+ +V+Q ELE++NAENQRL+ M+++V+ NY ALQ  L   MQH N +++  
Sbjct  145   NMEDKKAKNEYAVVQAELERVNAENQRLKDMVNEVTNNYNALQLQLMAFMQHHNARAADE  204

Query  1502  GSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLS  1323
              S   R+V ++K +           PR+F++L  G G   A   DE + S +    R L 
Sbjct  205   NS-DGRQVEEKKGQL--------AAPRRFIDL--GLGVNTADTADEPALSSSEGRSRDL-  252

Query  1322  AGSPRNNNTELSR---------HKGIIAREDSPDSESWApnklpklnpskPVDQAAEATM  1170
              GSP N N+  +           K  + R+DSPD            + SK VDQ  EATM
Sbjct  253   GGSPVNGNSNNNEESNVLFGQDKKEFVKRDDSPDRNYGPNKVPKFSSSSKNVDQT-EATM  311

Query  1169  RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAED  990
             RKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAED
Sbjct  312   RKARVSVRARSEAPMINDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQRCAED  371

Query  989   RTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSS  810
             RTILITTYEG HNHPLPPAAMAMASTTS+AA +LLSG+M SADG+MN NFLAR +LPCSS
Sbjct  372   RTILITTYEGNHNHPLPPAAMAMASTTSSAARLLLSGSMSSADGLMNANFLARTLLPCSS  431

Query  809   SVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQ---------  657
             S+ATISASAPFPTVTLDLTQTPN   N QR P QFQ PF   P    N+           
Sbjct  432   SMATISASAPFPTVTLDLTQTPNP-SNVQRSPNQFQVPF---PNPSHNFADGAAAAAAGS  487

Query  656   -LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAAT  480
              LPQ+FGQ LYNQSKFSGL +S QD+   +    Q            QH   AD++SAAT
Sbjct  488   LLPQIFGQALYNQSKFSGLQMS-QDM-DPSQLGNQSQLPSPAMQQGQQHNSLADSVSAAT  545

Query  479   AAITSDPNFTAALAAAISSIMGGGS  405
             AAI +DPNFTAALAAAI+SI+ GG+
Sbjct  546   AAIAADPNFTAALAAAITSIINGGT  570



>gb|KHN33008.1| WRKY transcription factor 6 [Glycine soja]
Length=547

 Score =   384 bits (985),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 318/570 (56%), Positives = 377/570 (66%), Gaps = 80/570 (14%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAG--FFTNK----PVFGFNLSPRLNPINgggsgggaGMVPINPAA  1866
             MDKGWGLTL+    ++   F +N     P+ GF       P+N   +             
Sbjct  1     MDKGWGLTLDTSSSQSLPLFPSNDNKMFPLLGF-------PVNLSRASKEDD--------  45

Query  1865  EKRGPPNEVDFFSDKKADI------------VVKKEITLHGEPVTKADLNTGLQLVIANs  1722
             E R    EVDFFSD+                +VKKEI       T   +NTGLQL+ AN+
Sbjct  46    ENRKVVGEVDFFSDRNKPTPPPSHDHNVKPNIVKKEID-----ETPLHINTGLQLLTANT  100

Query  1721  gsdkstvddsvssDMEERRAKN-DLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHL  1545
             GSD+STVDD VSSD E +RAK  +L+ LQVEL++MN+EN++L+ MLS V+ NYTALQ HL
Sbjct  101   GSDQSTVDDGVSSDAENKRAKTTELAQLQVELQRMNSENKKLKEMLSHVTGNYTALQMHL  160

Query  1544  SNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDE  1365
               LMQ QNQQ  R GST++ EV   K E+K        VPRQFL++ P G A       +
Sbjct  161   VTLMQ-QNQQ--RTGSTEN-EVVQGKVEDKNVGVGGGKVPRQFLDIGPSGTAEV-----D  211

Query  1364  ASQSHTTSEERTLSAGSPRNNNTELSRHKGI--------IAREDSPDSES--WApnklpk  1215
                S ++S+ERT S+ +P+N+N E     G         + RE+SPDSES  W+PNKL K
Sbjct  212   DQVSDSSSDERTRSS-TPQNHNIEAGARDGARNNNGKSQLGREESPDSESQGWSPNKLQK  270

Query  1214  lnpskPVDQA-AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTM  1038
             +NPS P+DQ+ AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTM
Sbjct  271   MNPSNPMDQSTAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTM  330

Query  1037  AVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADG  858
             AVGCPVRKQVQRCA+DRTIL+TTYEGTHNHPLPPAAMAMASTT+AAA+MLLSG+M SADG
Sbjct  331   AVGCPVRKQVQRCADDRTILVTTYEGTHNHPLPPAAMAMASTTTAAASMLLSGSMSSADG  390

Query  857   MMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQ  678
             +MN N LARAILPCS+S+AT+SASAPFPTVTLDLT  PN L  +QRP   FQ PF  A  
Sbjct  391   IMNPNLLARAILPCSTSMATLSASAPFPTVTLDLTHNPNPL-QFQRPGAPFQVPFLQA--  447

Query  677   IPQNYPQ--LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLF  504
              PQN+     P    Q LYNQSKFSGL +S QD+      +    Q  + P  P QHP  
Sbjct  448   QPQNFGSGAAPIAQAQALYNQSKFSGLQLS-QDV----GSSQLAPQAPRPPLQPSQHPSL  502

Query  503   ADTLSAATAAITSDPNFTAALAAAISSIMG  414
             ADT+S          NFTA LAAAISSI+G
Sbjct  503   ADTVS----------NFTAVLAAAISSIIG  522



>ref|XP_009357474.1| PREDICTED: probable WRKY transcription factor 31 [Pyrus x bretschneideri]
Length=567

 Score =   383 bits (984),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 290/525 (55%), Positives = 352/525 (67%), Gaps = 62/525 (12%)
 Frame = -1

Query  1847  NEVDFFSDKK------------ADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkst  1704
             +EVDFFSD+K             D      +++  E  T  D+NTGL LV AN+GSD+S 
Sbjct  32    DEVDFFSDRKNKLKSNSTDDHHQDWSSNDAMSVKKENWTGLDVNTGLHLVTANTGSDQSM  91

Query  1703  vdds-vssDMEERRAKN-DLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQ  1530
             VDD   S   + +RAKN +L+ LQVEL++MN ENQRL+ ML QV+ NY+ALQ HL+ ++Q
Sbjct  92    VDDGISSGRADNKRAKNHELAQLQVELQRMNVENQRLKEMLGQVTNNYSALQMHLAAVVQ  151

Query  1529  HQNQQSSRIGSTQDREVADRKSeekkpe--keePTVPRQFLELVPgggaaaaAQTDEASQ  1356
              Q+ +++   + Q  ++   ++ E K +  K++  VPRQFL L P        +T +   
Sbjct  152   QQHNRTTAAPADQSSQLHHDQNAEAKADQGKKQVLVPRQFLNLGPRATT----ETTDDQV  207

Query  1355  SHTTSEERTLSAGSPRNNNTELSRHKGIIA-----------------REDSPDSES--WA  1233
             S+++SE +T SA  P+N N   S   G I                  R++SP+SES  W 
Sbjct  208   SNSSSEAKTRSASPPQNINEVASPKNGQIGPLDPVNSNTFRDGKRVGRDESPESESQGWV  267

Query  1232  pnklpklnpskP---VDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCP  1062
             P+K+PKLN S     +DQ+ EATMRKARVSVRARSEA MI+DGCQWRKYGQKMAKGNPCP
Sbjct  268   PDKVPKLNNSAAPKPIDQSTEATMRKARVSVRARSEASMITDGCQWRKYGQKMAKGNPCP  327

Query  1061  RAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllS  882
             RAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTT+AA +MLLS
Sbjct  328   RAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTTAAVSMLLS  387

Query  881   GAMPSADGM-MN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQ  708
             G+M SADGM MN  N LARAILPCSSSVATISASAPFPTVTLDLT TP+ +   QRP T 
Sbjct  388   GSMSSADGMNMNPNNLLARAILPCSSSVATISASAPFPTVTLDLTTTPSQV---QRPNTP  444

Query  707   FQAP-FTGA-PQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqh  534
             FQ P F G  P       QLPQ+FGQ LYNQSKFS L +S QD+          +   Q 
Sbjct  445   FQVPNFPGQPPSFGAASQQLPQIFGQALYNQSKFSELQLS-QDV--------MGSTSSQQ  495

Query  533   papppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQP  399
                  Q   FADT+S    AIT+DP+FTAALAAAI+SI+GGG+ P
Sbjct  496   QMQQTQSSSFADTVS----AITADPSFTAALAAAITSIIGGGAHP  536



>ref|XP_011047238.1| PREDICTED: probable WRKY transcription factor 31 isoform X2 [Populus 
euphratica]
Length=646

 Score =   385 bits (990),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 282/510 (55%), Positives = 345/510 (68%), Gaps = 50/510 (10%)
 Frame = -1

Query  1862  KRGPPNEVDFFSDKKADIVV------KKEITLHGEPV-TKADLNTGLQLVIANsgsdkst  1704
             +R   +E+DFF+ KK D           ++   G P   + ++NTGL L+  N+ SD+S 
Sbjct  101   RRTVIDEMDFFARKKHDDGYPITNNSTDDLKDSGSPARLELNVNTGLNLLTTNTSSDQSM  160

Query  1703  vddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQ  1524
             VDD +SS+ME +RAK++L+VLQ E+E+M  EN RL+GML+QV++NY ALQ HL  L    
Sbjct  161   VDDGISSNMEYKRAKSELAVLQAEVERMKVENLRLKGMLNQVTSNYNALQMHLVTL----  216

Query  1523  NQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTT  1344
                      TQD++   +  +     K    VPRQF++L  G  AAAA  TD+ S S + 
Sbjct  217   ---------TQDQKSHHKNEQHDGKNKNNGMVPRQFMDL--GLVAAAAGDTDDLSLSTSE  265

Query  1343  ---SEERTLSAGSPRNNNTELSR----------HKGIIAREDSPDSESWApnklpklnps  1203
                S +R+ S G+   NN E              +G   REDSP  + WA NK+ +LN +
Sbjct  266   GGRSRDRSRSPGNNVENNNEDGTLMFDQDKKGFARGADHREDSP-GQGWASNKVARLNSA  324

Query  1202  kPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCP  1023
             K +DQ  EAT+RKARVSVRARSE  MISDGCQWRKYGQK+AKGNPCPRAYYRCTMA GCP
Sbjct  325   KTIDQT-EATIRKARVSVRARSEDAMISDGCQWRKYGQKLAKGNPCPRAYYRCTMAAGCP  383

Query  1022  VRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTN  843
             VRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+M SADG++N+N
Sbjct  384   VRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMSSADGLLNSN  443

Query  842   FLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNY  663
             FL R++LPCSS++ATISASAPFPTVTLDLTQ PN L    + PTQFQ PF  APQ P N 
Sbjct  444   FLTRSLLPCSSNLATISASAPFPTVTLDLTQNPNPL-QLPKQPTQFQFPFPNAPQDPANA  502

Query  662   PQ---LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTL  492
                  LPQ+FGQ LYNQSKFSGL +S QD+        +  +  Q   P  Q    AD+L
Sbjct  503   SATALLPQIFGQALYNQSKFSGLQMS-QDM--------EPHRLGQQSQPASQQNPLADSL  553

Query  491   SAATAAITSDPNFTAALAAAISSIMGGGSQ  402
             +AATA I +DPNFTAALAAAI+SI+GG  Q
Sbjct  554   AAATAVIAADPNFTAALAAAITSIIGGAHQ  583



>gb|AGV75949.1| WRKY transcription factor 45 [Gossypium hirsutum]
Length=415

 Score =   377 bits (967),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 259/428 (61%), Positives = 293/428 (68%), Gaps = 59/428 (14%)
 Frame = -1

Query  1622  MNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpek  1443
             MNAENQ+L+ M++ VS NY+ALQ HL NLMQ    Q   I   +++E +           
Sbjct  1     MNAENQKLKDMVNDVSNNYSALQMHLVNLMQQH--QRHEINEVKEQEAS-----------  47

Query  1442  eePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNTELS--------  1287
                 VPRQF++L P G A    +TD    SH++SEERT S GSP NN    S        
Sbjct  48    --LIVPRQFMDLRPSGIA----ETDHEP-SHSSSEERTPS-GSPPNNVQVTSPKDYLKTK  99

Query  1286  -------------RHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRKARVSVR  1146
                          R    I RE+SP+SE+   NKL K+NPSKP+DQA EATMRKARVSVR
Sbjct  100   NPVSQLDQESSSFRDGKRIGREESPESENLGRNKLQKMNPSKPIDQATEATMRKARVSVR  159

Query  1145  ARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY  966
             ARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY
Sbjct  160   ARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY  219

Query  965   EGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISAS  786
             EG HNHPLPPAAMAMASTT++AA MLLSG+M S DGMMN N   R +LPC SS+ATISAS
Sbjct  220   EGNHNHPLPPAAMAMASTTASAATMLLSGSMHSGDGMMNPNLFPRTMLPC-SSMATISAS  278

Query  785   APFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQ--IPQNYPQLPQVFGQGLYNQSKF  612
             APFPTVTLDLT +PN+L  +QRP TQF  PF G PQ     +  Q PQVFGQ LYNQSKF
Sbjct  279   APFPTVTLDLTHSPNAL-QFQRPNTQFHVPFPGQPQNSTSTSATQFPQVFGQALYNQSKF  337

Query  611   SGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAA  432
             SGL +S QDI                    PQ    ADT+SAATAAI +DP+FTAALAAA
Sbjct  338   SGLQLS-QDI------------VSSSQLQQPQQSTLADTVSAATAAIANDPSFTAALAAA  384

Query  431   ISSIMGGG  408
             I+SI+GG 
Sbjct  385   ITSIIGGA  392



>ref|XP_004243486.1| PREDICTED: probable WRKY transcription factor 31 [Solanum lycopersicum]
Length=631

 Score =   384 bits (986),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 275/507 (54%), Positives = 336/507 (66%), Gaps = 39/507 (8%)
 Frame = -1

Query  1847  NEVDFFSDKKA-----------DIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstv  1701
             +E+DFF++KK            D   K+  T    P    ++NT L L+ AN+ +D+S +
Sbjct  95    DEMDFFAEKKNATNPDDPTTANDTDRKESNTTTTPPELDFNINTALHLLTANTYTDQSIM  154

Query  1700  ddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQ---QHLSNLMQ  1530
             DDS+S + +++R KN+L VLQ ELE+MN EN+RLR ML+QV  NY  LQ     + +  Q
Sbjct  155   DDSLSPNSDDKRIKNELVVLQAELERMNGENRRLRDMLNQVKNNYNTLQVHMMTMMHQQQ  214

Query  1529  HQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaa-AQTDEASQS  1353
                +   R G  ++ EV  ++   +        VPRQF++L    GA    ++ +EAS S
Sbjct  215   QNQESGQRDG--KNEEVKHQQHNNQNGHGGGQVVPRQFMDLGLAAGAGGTASEAEEASLS  272

Query  1352  HTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPD--SESWApnkl----pklnpskPVD  1191
              +        + SP NN  E S   GI+ REDSP+  S  W PNK+         +KP D
Sbjct  273   SSEGPSGREKSRSPVNN-IESSSTCGIV-REDSPEKVSPGWGPNKIPRLGNTSTNNKPAD  330

Query  1190  QAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQ  1011
             QA EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQ
Sbjct  331   QATEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQ  390

Query  1010  VQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLAR  831
             VQRCAEDRTILITTYEGTHNHPLPPAA+AMASTTS+AA MLLSG+MPSADG+MN+NF AR
Sbjct  391   VQRCAEDRTILITTYEGTHNHPLPPAAIAMASTTSSAAKMLLSGSMPSADGLMNSNFFAR  450

Query  830   AILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQ---IPQNYP  660
              +LPCSSS+ATISASAPFPTVTLDLTQ+PN L  + RPP QFQ PF+  P    +     
Sbjct  451   TLLPCSSSMATISASAPFPTVTLDLTQSPNPL-QFPRPPNQFQIPFSNPPHNNILANPAA  509

Query  659   QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAAT  480
              LPQ+FGQ LYNQSKFSGL  S QD+     +  Q          P  H   ADT++   
Sbjct  510   LLPQIFGQALYNQSKFSGLQ-SSQDL-----EGQQHPSTMPSSINPSNHNPVADTVN---  560

Query  479   AAITSDPNFTAALAAAISSIMGGGSQP  399
              A+TSDPNFTAALAAAI+S++G   QP
Sbjct  561   -ALTSDPNFTAALAAAITSLIGNPGQP  586



>gb|KHN36523.1| WRKY transcription factor 6 [Glycine soja]
Length=565

 Score =   382 bits (980),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 270/477 (57%), Positives = 316/477 (66%), Gaps = 54/477 (11%)
 Frame = -1

Query  1757  LNTGLQLVIANsgsdkstvddsvssDME-ERRAKNDLSVLQVELEKMNAENQRLRGMLSQ  1581
             +NTGL L+  N+ SD+S V D   S    ++RAK+++ VLQVELE+M  EN RL+ ML Q
Sbjct  85    VNTGLNLLTTNASSDQSMVVDDDISPNSGDKRAKSEMVVLQVELERMKVENHRLKNMLDQ  144

Query  1580  VSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRK-SeekkpekeePTVPRQFLELV  1404
             V+ NY ALQ HL +LM+  +Q        Q  +V D K  E++        VPRQF++L 
Sbjct  145   VNNNYNALQTHLVSLMK--DQMDKEDDKQQPHQVFDGKLEEKQAGNGGGALVPRQFMDL-  201

Query  1403  PgggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNTELSRHK-------GI---------  1272
                G A  A T+E S SH++S  R  S  SP  NNTE++  K       G+         
Sbjct  202   ---GLATNADTNETSHSHSSSVIR--SQDSPPTNNTEVASKKNGGASDEGLVFDQDKKEF  256

Query  1271  ---IAREDSPDSESWApnklpklnps-kPVDQAAEATMRKARVSVRARSEAPMISDGCQW  1104
                I REDSP  +  A N         + VDQA EATMRKARVSVRARSEAPMI+DGCQW
Sbjct  257   GRGIEREDSPSDQGVAANNNVPKFSPPRNVDQA-EATMRKARVSVRARSEAPMITDGCQW  315

Query  1103  RKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaama  924
             RKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMA
Sbjct  316   RKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMA  375

Query  923   masttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTP  744
             MA TTS+AA MLLSG+M SADG+MN +FL R +LPCSSS+ATISASAPFPTVTLDLTQ+P
Sbjct  376   MAQTTSSAARMLLSGSMSSADGLMNASFLTRTLLPCSSSMATISASAPFPTVTLDLTQSP  435

Query  743   NSLPNYQRPPTQFQAPFTGAPQIPQNYPQ-----LPQVFGQGLYNQSKFSGLHVSHQDIa  579
             N L  + + P+QFQ PF   P +PQN+       LPQ+FGQ LYNQSKFSGL +S QD  
Sbjct  436   NPL-QFPKQPSQFQIPF---PGVPQNFANSQASLLPQIFGQALYNQSKFSGLQMS-QD--  488

Query  578   aaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGG  408
                         Q         P  ADT+SAA AA   DPNFTAALAAAI+SI+GG 
Sbjct  489   --------SDPSQLSNQSQRPPPHLADTVSAAIAA---DPNFTAALAAAITSIIGGA  534



>ref|XP_010926185.1| PREDICTED: probable WRKY transcription factor 31 [Elaeis guineensis]
Length=588

 Score =   382 bits (980),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 282/518 (54%), Positives = 337/518 (65%), Gaps = 57/518 (11%)
 Frame = -1

Query  1865  EKRGPPNEVDFFSDKKADIVVKKEITLHGEP---VTKADL--NTGLQLVIANsgsdkstv  1701
             E R    E+DFFSD + +    +    H  P   + K DL  N GL L+  N+ SD+STV
Sbjct  60    ENRRVVGEMDFFSDDRKERA--RPALDHNAPNLCIKKEDLTINMGLHLLTTNTRSDQSTV  117

Query  1700  ddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQN  1521
             DD +S + E++ +K++L+ +Q EL ++N ENQRL+GML  V+ NY +LQ     LMQ   
Sbjct  118   DDGLSPNEEDKESKSELAAMQAELGRVNQENQRLKGMLGHVTNNYNSLQMQFITLMQ---  174

Query  1520  QQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTS  1341
             ++S R GS Q  EV+  +  +K+ E E+  VPRQFL+L P          ++AS S T  
Sbjct  175   ERSRRNGSPQSHEVSGDQMGDKRNEHEDAMVPRQFLDLGPASL------AEDASHSATEG  228

Query  1340  EERTLSAGSPRN-------NNTELSRHKGIIARED----------------SPD--SESW  1236
               R  S   P N       N+ + + +   IA  D                SPD  S+ W
Sbjct  229   GSRDRSTSPPNNMEVMPIDNSLKKNSNGKEIATLDCERTDVRDIRPTFGEVSPDQVSQGW  288

Query  1235  Apnklpkln---pskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPC  1065
              PNK PKL+    +    QA EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPC
Sbjct  289   VPNKAPKLSPPKSNTSDQQAQEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPC  348

Query  1064  PRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmll  885
             PRAYYRCTMA GCPVRKQVQRCAEDR++LITTYEG HNHPLPPAAMAMASTTSAAANMLL
Sbjct  349   PRAYYRCTMAAGCPVRKQVQRCAEDRSVLITTYEGNHNHPLPPAAMAMASTTSAAANMLL  408

Query  884   SGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQF  705
             SG+M S DG+MN+NFLAR ILPCSSS+ATISASAPFPTVTLDLT TPN+   +QR  TQF
Sbjct  409   SGSMSSTDGLMNSNFLARTILPCSSSMATISASAPFPTVTLDLTHTPNA--QFQRTSTQF  466

Query  704   QAPF-TGAPQIPQNYP-QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhp  531
             QAPF  GAP      P  LPQVFGQ L+NQSKFSG+ +S  D                 P
Sbjct  467   QAPFPNGAPGFGSTPPTSLPQVFGQTLFNQSKFSGVQMSAGD---------GAQFSHPKP  517

Query  530   apppqhpLFADTLSAATAAITSDPNFTAALAAAISSIM  417
                      ADT+SAATAAIT+DPNFTAALAAAI+SI+
Sbjct  518   QSMQPSTSLADTVSAATAAITADPNFTAALAAAITSII  555



>ref|XP_008779832.1| PREDICTED: probable WRKY transcription factor 31 isoform X2 [Phoenix 
dactylifera]
Length=546

 Score =   380 bits (977),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 259/439 (59%), Positives = 304/439 (69%), Gaps = 48/439 (11%)
 Frame = -1

Query  1655  DLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVA  1476
             DLS +Q EL +M  ENQRL+G+L+QV+TNY ALQ HL  LMQ + Q++   GS+QD E +
Sbjct  108   DLSSMQAELVRMKEENQRLKGVLNQVTTNYNALQMHLVALMQERTQKN---GSSQDHEAS  164

Query  1475  DRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQS--------HTTSEERTLSA  1320
             D K++ K        VPRQFL+L P         TDE S+S         ++S    + A
Sbjct  165   DEKTDGK-------IVPRQFLDLGPAA------NTDEPSRSSIEGGGWDRSSSPTNNVEA  211

Query  1319  GSPRNNNTELSRHKGIIA-------REDSPD--SESWApnklpklnpskPVDQAAEATMR  1167
             GS      + + +K I++       REDSPD  SE W PNK  KL   K  +Q+ EATMR
Sbjct  212   GSMEYRLNKYNTNKEIVSFDHERTNREDSPDPSSEGWNPNKASKLASPKSAEQSQEATMR  271

Query  1166  KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDR  987
             KARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR
Sbjct  272   KARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQRCAEDR  331

Query  986   TILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSS  807
             +ILITTYEG HNHPLPPAAMAMASTTSAAA+MLLSG+M S +G++N+NFL+R +LPCSSS
Sbjct  332   SILITTYEGNHNHPLPPAAMAMASTTSAAASMLLSGSMSSTEGLINSNFLSRTVLPCSSS  391

Query  806   VATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPF-TGAPQI--PQNYPQLPQVFGQ  636
             +ATISASAPFPTVTLDLT TPN L  +QR P QFQ PF +G P    P   P LPQVFGQ
Sbjct  392   MATISASAPFPTVTLDLTHTPNPL-QFQRLPAQFQVPFPSGTPAFGAPPQPPSLPQVFGQ  450

Query  635   GLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPN  456
              L NQS FSGL +S             +   Q     PP      DT+SAATAAIT+DP+
Sbjct  451   ALNNQSTFSGLQMS-----------PNMDGAQFPRPKPPSAASLPDTVSAATAAITADPS  499

Query  455   FTAALAAAISSIMGGGSQP  399
             F AAL AAI+SI+GGG QP
Sbjct  500   FKAALVAAITSIIGGGHQP  518



>gb|AIE43879.1| WRKY transcription factor 4 [Gossypium hirsutum]
 gb|KHG15815.1| WRKY transcription factor 6 -like protein [Gossypium arboreum]
Length=561

 Score =   380 bits (976),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 287/523 (55%), Positives = 334/523 (64%), Gaps = 66/523 (13%)
 Frame = -1

Query  1883  PINPAAEKRGPP----NEVDFFSDKKADIVVKKEITLHGEPVT-----------KADLNT  1749
             P+NP       P     E+DFF++K   +V            T           + ++NT
Sbjct  19    PVNPNCTNDEIPRRVIGEMDFFAEKNHKLVDDHVDDSDHANATDINGSIDRTALELNVNT  78

Query  1748  GLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTN  1569
             GL L+  N+ SD+S+VDD +SS+ME++RAKN+L+VLQVELE+MN ENQ+LR MLSQV++N
Sbjct  79    GLNLLTTNTSSDQSSVDDGISSNMEDKRAKNELAVLQVELERMNTENQQLREMLSQVTSN  138

Query  1568  YTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPggga  1389
             Y  +Q+HL  LMQ Q            ++    K++E+K       VPRQF++L     A
Sbjct  139   YNTVQKHLVTLMQQQ------------QDGKPEKNDEQKKSNGGLIVPRQFMDLGIAAAA  186

Query  1388  aaaAQTDEASQSHTTSEERTLSAGSPRNNNTEL------SRHKGI------IAREDSPDS  1245
             AA   TDE S S T      LS GSP   N E+      SR +G       I REDSPD 
Sbjct  187   AAEVDTDEPSLSSTEGRSHDLS-GSP---NVEVASKEFRSRKRGSSEEGRGIGREDSPDG  242

Query  1244  ESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPC  1065
                      K      VDQ  EATMRKARVSVRARSE PMI+DGCQWRKYGQKMAKGNPC
Sbjct  243   NKVPRFNSSKT-----VDQT-EATMRKARVSVRARSETPMITDGCQWRKYGQKMAKGNPC  296

Query  1064  PRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmll  885
             PRAYYRCTMA GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTTS+AA MLL
Sbjct  297   PRAYYRCTMAAGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTSSAARMLL  356

Query  884   SGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQF  705
             SG+M SADG+MN+NFL R +LPCSSS+ATISASAPFPTVTLDLTQ PN L    R   QF
Sbjct  357   SGSMSSADGLMNSNFLTRTLLPCSSSMATISASAPFPTVTLDLTQIPNPL-QIPRTEGQF  415

Query  704   QAPFTGAPQIPQN------YPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqq  543
             Q PF   P            P LPQ+FGQ LYNQSKFSGL +SH DI            Q
Sbjct  416   QVPFPNPPPHNLPNSQLSPLPLLPQIFGQALYNQSKFSGLQMSH-DI---------EQPQ  465

Query  542   qqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMG  414
               H     Q    ADT++AATAAI +DPNFTAALAAAI+SI+G
Sbjct  466   MSHQHQQGQQKSLADTVNAATAAIAADPNFTAALAAAITSIIG  508



>ref|XP_002321134.2| hypothetical protein POPTR_0014s15320g [Populus trichocarpa]
 gb|EEE99449.2| hypothetical protein POPTR_0014s15320g [Populus trichocarpa]
Length=624

 Score =   382 bits (980),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 279/510 (55%), Positives = 341/510 (67%), Gaps = 49/510 (10%)
 Frame = -1

Query  1862  KRGPPNEVDFFSDKKADIVV------KKEITLHGEPV-TKADLNTGLQLVIANsgsdkst  1704
             +R   +E+DFF+ KK D           ++   G P   + ++NTGL L+  N+ SD+S 
Sbjct  100   RRTVIDEMDFFARKKHDDGYPITNNSTDDLKDSGSPTGLELNVNTGLNLLTTNTSSDQSM  159

Query  1703  vddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQ  1524
             VDD +SS+ME++RAK++L+VLQ E+E+M  EN RL+ ML+QV++NY ALQ HL  L    
Sbjct  160   VDDGISSNMEDKRAKSELAVLQAEVERMKVENLRLKDMLNQVTSNYNALQMHLVTL----  215

Query  1523  NQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTT  1344
                      TQD++   +  +     K    VPRQF++L     AAAA  TD+ S S + 
Sbjct  216   ---------TQDQKSHHKNEKLDGKNKNNGMVPRQFMDL-GLVAAAAAGDTDDLSLSTSE  265

Query  1343  ---SEERTLSAGSPRNNNTELSR----------HKGIIAREDSPDSESWApnklpklnps  1203
                S +R+ S G+   NN E              +G   REDSP  + WA NK+ +LN +
Sbjct  266   GGRSRDRSRSPGNNVENNNEDGALVFDQDKKGFARGADHREDSP-GQGWASNKVARLNSA  324

Query  1202  kPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCP  1023
             K +DQ  EAT+RKARVSVRARSE  MISDGCQWRKYGQK+AKGNPCPRAYYRCTMA GCP
Sbjct  325   KTIDQT-EATIRKARVSVRARSEDAMISDGCQWRKYGQKLAKGNPCPRAYYRCTMAAGCP  383

Query  1022  VRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTN  843
             VRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+M SADG++N+N
Sbjct  384   VRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMSSADGLLNSN  443

Query  842   FLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNY  663
             FL R +LPCSS++ATISASAPFPTVTLDLTQ PN L    + PTQFQ PF  APQ P N 
Sbjct  444   FLTRTLLPCSSNLATISASAPFPTVTLDLTQNPNPL-QLPKQPTQFQFPFPNAPQDPANA  502

Query  662   PQ---LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTL  492
                  LPQ+FGQ LYNQSKFSGL +S            +  +  Q   P  Q    AD+L
Sbjct  503   SATALLPQIFGQALYNQSKFSGLQMSQH---------MEPNRLGQQSQPAIQQNPLADSL  553

Query  491   SAATAAITSDPNFTAALAAAISSIMGGGSQ  402
             +AATAAI +DPNFTAALAAAI+SI+GG  Q
Sbjct  554   AAATAAIAADPNFTAALAAAITSIIGGAHQ  583



>ref|XP_003541953.1| PREDICTED: probable WRKY transcription factor 31 [Glycine max]
Length=614

 Score =   381 bits (978),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 272/480 (57%), Positives = 320/480 (67%), Gaps = 55/480 (11%)
 Frame = -1

Query  1757  LNTGLQLVIANsgsdkstvddsvss-DMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQ  1581
             +NTGL L+  N+ SD+S V D   S +  ++RAK+++ VLQVELE+M  EN RL+ ML Q
Sbjct  134   VNTGLNLLTTNASSDQSMVVDDDISPNSGDKRAKSEMVVLQVELERMKVENHRLKNMLDQ  193

Query  1580  VSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRK-SeekkpekeePTVPRQFLELV  1404
             V+ NY ALQ HL +LM+  +Q        Q  +V D K  E++        VPRQF++L 
Sbjct  194   VNNNYNALQTHLVSLMK--DQMDKEDDKQQPHQVFDGKLEEKQAGNGGGALVPRQFMDL-  250

Query  1403  PgggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNTELSRHK-------GI---------  1272
                G A  A T+E S SH++S  R  S  SP  NNTE++  K       G+         
Sbjct  251   ---GLATNADTNETSHSHSSSVIR--SQDSPPTNNTEVASKKNGGASDEGLVFDQDKKEF  305

Query  1271  ---IAREDSPDSESWApnklpklnps-kPVDQAAEATMRKARVSVRARSEAPMISDGCQW  1104
                I REDSP  +  A N         + VDQA EATMRKARVSVRARSEAPMI+DGCQW
Sbjct  306   GRGIEREDSPSDQGVAANNNVPKFSPPRNVDQA-EATMRKARVSVRARSEAPMITDGCQW  364

Query  1103  RKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaama  924
             RKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMA
Sbjct  365   RKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMA  424

Query  923   masttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTP  744
             MA TTS+AA MLLSG+M SADG+MN +FL R +LPCSSS+ATISASAPFPTVTLDLTQ+P
Sbjct  425   MAQTTSSAARMLLSGSMSSADGLMNASFLTRTLLPCSSSMATISASAPFPTVTLDLTQSP  484

Query  743   NSLPNYQRPPTQFQAPFTGAPQIPQNYPQ-----LPQVFGQGLYNQSKFSGLHVSHQDIa  579
             N L  + + P+QFQ PF   P +PQN+       LPQ+FGQ LYNQSKFSGL +S QD  
Sbjct  485   NPL-QFPKQPSQFQIPF---PGVPQNFANSQASLLPQIFGQALYNQSKFSGLQMS-QD--  537

Query  578   aaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQP  399
                         Q         P  ADT+SAA AA   DPNFTAALAAAI+SI+ GG+QP
Sbjct  538   --------SDPSQLSNQSQRPPPHLADTVSAAIAA---DPNFTAALAAAITSII-GGAQP  585



>gb|KHN23479.1| WRKY transcription factor 6 [Glycine soja]
Length=619

 Score =   380 bits (977),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 274/477 (57%), Positives = 321/477 (67%), Gaps = 54/477 (11%)
 Frame = -1

Query  1757  LNTGLQLVIANsgsdkstvddsvssDME-ERRAKNDLSVLQVELEKMNAENQRLRGMLSQ  1581
             +NTGL L+  N+ SD+S V D   S    ++RAK+++ VLQVELE+M  EN RL+ ML Q
Sbjct  133   VNTGLNLLTTNASSDQSMVVDDDISPNSGDKRAKSEMVVLQVELERMKVENHRLKNMLDQ  192

Query  1580  VSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRK-SeekkpekeePTVPRQFLELV  1404
             V+ NY ALQ HL +LM+  +Q        Q  +V D K  E++        VPRQF++L 
Sbjct  193   VNNNYNALQTHLVSLMK--DQMDKEDDKQQPHQVFDGKLEEKQAGNGGGALVPRQFMDL-  249

Query  1403  PgggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNTELSRHK-------GI---------  1272
                G A  A T+E S SH++S  R  S  SP  NNTE++  K       G+         
Sbjct  250   ---GLATNADTNETSHSHSSSVIR--SQDSPPTNNTEVASKKNGGASDEGLVFDQDKKEF  304

Query  1271  ---IAREDSP-DSESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQW  1104
                I REDSP D    A N +PK +P + VDQA EATMRKARVSVRARSEAPMI+DGCQW
Sbjct  305   GRGIEREDSPSDQGVAANNNVPKFSPPRNVDQA-EATMRKARVSVRARSEAPMITDGCQW  363

Query  1103  RKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaama  924
             RKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMA
Sbjct  364   RKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMA  423

Query  923   masttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTP  744
             MA TTS+AA MLLSG+M SADG+MN +FL R +LPCSSS+ATISASAPFPTVTLDLTQ+P
Sbjct  424   MAQTTSSAARMLLSGSMSSADGLMNASFLTRTLLPCSSSMATISASAPFPTVTLDLTQSP  483

Query  743   NSLPNYQRPPTQFQAPFTGAPQIPQNYPQ-----LPQVFGQGLYNQSKFSGLHVSHQDIa  579
             N L  + + P+QFQ PF   P +PQN+       LPQ+FGQ LYNQSKFSGL +S QD  
Sbjct  484   NPL-QFPKQPSQFQIPF---PGVPQNFANSQASLLPQIFGQALYNQSKFSGLQMS-QD--  536

Query  578   aaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGG  408
                         Q         P  ADT+SAA AA   DPNFTAALAAAI+SI+GG 
Sbjct  537   --------SDPSQLSNQSQRPPPHLADTVSAAIAA---DPNFTAALAAAITSIIGGA  582



>ref|XP_007149982.1| hypothetical protein PHAVU_005G116000g [Phaseolus vulgaris]
 gb|ESW21976.1| hypothetical protein PHAVU_005G116000g [Phaseolus vulgaris]
Length=617

 Score =   380 bits (977),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 277/480 (58%), Positives = 325/480 (68%), Gaps = 52/480 (11%)
 Frame = -1

Query  1772  VTKADLNTGLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRG  1593
             + +  +NTGL L+  N+GSD S VDD  S++ EE+RAK+++ VLQ ELEKM  EN RLR 
Sbjct  136   ILELKVNTGLNLLTTNTGSDHSMVDDEASTNSEEKRAKSEMVVLQAELEKMKVENHRLRN  195

Query  1592  MLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFL  1413
             ML QV+T+Y ALQ HL +LMQ Q ++         ++V D K +E+K       VPRQF+
Sbjct  196   MLDQVNTSYNALQMHLVSLMQEQKEEEGE------QKVFDGKLDEEKQSGNGALVPRQFM  249

Query  1412  ELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNT---ELSRHK-------GI---  1272
             +L    G A+ A  +E S S +    + LS  SP NN     E    K       G+   
Sbjct  250   DL----GLASNADNNEPSHSSSVGRSQDLSK-SPINNEVASKEFDTKKNGSVSDEGLDQD  304

Query  1271  -------IAREDSPDSESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDG  1113
                    I REDSP     A + +PK +P + VDQA EATMRKARVSVRARSEAPMI+DG
Sbjct  305   KKEFVRGIEREDSPSEGIAANSNVPKFSPPRNVDQA-EATMRKARVSVRARSEAPMITDG  363

Query  1112  CQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppa  933
             CQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDRTILITTYEG HNHPLPPA
Sbjct  364   CQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPA  423

Query  932   amamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLT  753
             AMAMA TTS+AA MLLSG+M SADG+MN NFL R +LPCSSS+ATISASAPFPTVTLDLT
Sbjct  424   AMAMAQTTSSAARMLLSGSMSSADGLMNANFLTRTLLPCSSSMATISASAPFPTVTLDLT  483

Query  752   QTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQ-----LPQVFGQGLYNQSKFSGLHVSHQ  588
             Q+PN L  + +PP QFQ PF   P +PQN+       LPQ+FGQ LYNQSKFSGL +S Q
Sbjct  484   QSPNPL-QFPKPPNQFQIPF---PGVPQNFANSSASLLPQIFGQALYNQSKFSGLQMS-Q  538

Query  587   DIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGG  408
             D                        P  ADT+SAATAAI +DPNFTAALAAAI+SI+GG 
Sbjct  539   D----------ADPSPLSNQSQRPPPHLADTVSAATAAIAADPNFTAALAAAITSIIGGA  588



>ref|XP_009804478.1| PREDICTED: probable WRKY transcription factor 42 [Nicotiana sylvestris]
Length=597

 Score =   380 bits (975),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 273/503 (54%), Positives = 331/503 (66%), Gaps = 36/503 (7%)
 Frame = -1

Query  1847  NEVDFFSDKKAD-------------IVVKKEITLHGEPVTKAD--LNTGLQLVIANsgsd  1713
             +E+DFF+D K D               V  E      P  + D  +NTGL L+ AN+ SD
Sbjct  77    DEMDFFADHKKDGSNSEEPATTANNTAVDTERKESNTPPPELDFNINTGLHLLTANTYSD  136

Query  1712  kstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLM  1533
             +S V+D +S + E++R KN+L+VLQ ELE+MN EN+RL+ ML+Q + NY+ L   +  ++
Sbjct  137   QSIVEDGLSPNSEDKRTKNELAVLQAELERMNGENRRLKDMLNQATNNYSNLHMQMMTMI  196

Query  1532  QHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQS  1353
             Q Q  Q +     +  EV  +   +         VPRQF++L  G  AA  ++ +E S S
Sbjct  197   QQQQHQENDQHDGKSEEVRQQIQSKNGHGGGGQIVPRQFMDL--GLAAATGSEAEETSLS  254

Query  1352  HTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPD--SESWApnkl-pklnpskPVDQAA  1182
              +        + SP  NN E     GI+ REDSP+  S  W PNK+    N SK  DQA 
Sbjct  255   SSEGRSGRDKSRSP-TNNMESGSTCGIV-REDSPEKGSPGWGPNKIPRLGNGSKSTDQAT  312

Query  1181  EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQR  1002
             EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQR
Sbjct  313   EATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQR  372

Query  1001  CAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAIL  822
             CAEDRTILITTYEGTHNHPLPPAAMAMASTTS+AA MLLSG+MPSADG+MN+NF AR +L
Sbjct  373   CAEDRTILITTYEGTHNHPLPPAAMAMASTTSSAARMLLSGSMPSADGLMNSNFFARTLL  432

Query  821   PCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQ--LPQ  648
             PCSSS+ATISASAPFPTVTLDLTQ+PN L  + R P QFQ PF+  P    + P   LPQ
Sbjct  433   PCSSSMATISASAPFPTVTLDLTQSPNPL-QFPRSPNQFQVPFSNPPHNMLSNPAALLPQ  491

Query  647   VFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAIT  468
             +F Q LYNQSKFSGL +S QD         Q             H   ADT++    A+T
Sbjct  492   IFNQALYNQSKFSGLQLS-QD------SEGQNPSTLPSSIHQSNHNPLADTVN----ALT  540

Query  467   SDPNFTAALAAAISSIMGGGSQP  399
             +DPNFTAALAAAI+S++G   QP
Sbjct  541   ADPNFTAALAAAITSLIGNPQQP  563



>ref|XP_011047241.1| PREDICTED: probable WRKY transcription factor 31 isoform X4 [Populus 
euphratica]
Length=627

 Score =   380 bits (976),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 282/512 (55%), Positives = 345/512 (67%), Gaps = 52/512 (10%)
 Frame = -1

Query  1862  KRGPPNEVDFFSDKKADIVV------KKEITLHGEPV-TKADLNTGLQLVIANsgsdkst  1704
             +R   +E+DFF+ KK D           ++   G P   + ++NTGL L+  N+ SD+S 
Sbjct  101   RRTVIDEMDFFARKKHDDGYPITNNSTDDLKDSGSPARLELNVNTGLNLLTTNTSSDQSM  160

Query  1703  vddsvssDMEERRAKNDL--SVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQ  1530
             VDD +SS+ME +RAK++L  +VLQ E+E+M  EN RL+GML+QV++NY ALQ HL  L  
Sbjct  161   VDDGISSNMEYKRAKSELQLAVLQAEVERMKVENLRLKGMLNQVTSNYNALQMHLVTL--  218

Query  1529  HQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSH  1350
                        TQD++   +  +     K    VPRQF++L  G  AAAA  TD+ S S 
Sbjct  219   -----------TQDQKSHHKNEQHDGKNKNNGMVPRQFMDL--GLVAAAAGDTDDLSLST  265

Query  1349  TT---SEERTLSAGSPRNNNTELSR----------HKGIIAREDSPDSESWApnklpkln  1209
             +    S +R+ S G+   NN E              +G   REDSP  + WA NK+ +LN
Sbjct  266   SEGGRSRDRSRSPGNNVENNNEDGTLMFDQDKKGFARGADHREDSP-GQGWASNKVARLN  324

Query  1208  pskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVG  1029
              +K +DQ  EAT+RKARVSVRARSE  MISDGCQWRKYGQK+AKGNPCPRAYYRCTMA G
Sbjct  325   SAKTIDQT-EATIRKARVSVRARSEDAMISDGCQWRKYGQKLAKGNPCPRAYYRCTMAAG  383

Query  1028  CPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN  849
             CPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+M SADG++N
Sbjct  384   CPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMSSADGLLN  443

Query  848   TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQ  669
             +NFL R++LPCSS++ATISASAPFPTVTLDLTQ PN L    + PTQFQ PF  APQ P 
Sbjct  444   SNFLTRSLLPCSSNLATISASAPFPTVTLDLTQNPNPL-QLPKQPTQFQFPFPNAPQDPA  502

Query  668   NYPQ---LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFAD  498
             N      LPQ+FGQ LYNQSKFSGL +S QD+        +  +  Q   P  Q    AD
Sbjct  503   NASATALLPQIFGQALYNQSKFSGLQMS-QDM--------EPHRLGQQSQPASQQNPLAD  553

Query  497   TLSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
             +L+AATA I +DPNFTAALAAAI+SI+GG  Q
Sbjct  554   SLAAATAVIAADPNFTAALAAAITSIIGGAHQ  585



>ref|XP_011047237.1| PREDICTED: probable WRKY transcription factor 31 isoform X1 [Populus 
euphratica]
Length=648

 Score =   380 bits (977),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 282/512 (55%), Positives = 345/512 (67%), Gaps = 52/512 (10%)
 Frame = -1

Query  1862  KRGPPNEVDFFSDKKADIVV------KKEITLHGEPV-TKADLNTGLQLVIANsgsdkst  1704
             +R   +E+DFF+ KK D           ++   G P   + ++NTGL L+  N+ SD+S 
Sbjct  101   RRTVIDEMDFFARKKHDDGYPITNNSTDDLKDSGSPARLELNVNTGLNLLTTNTSSDQSM  160

Query  1703  vddsvssDMEERRAKNDL--SVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQ  1530
             VDD +SS+ME +RAK++L  +VLQ E+E+M  EN RL+GML+QV++NY ALQ HL  L  
Sbjct  161   VDDGISSNMEYKRAKSELQLAVLQAEVERMKVENLRLKGMLNQVTSNYNALQMHLVTL--  218

Query  1529  HQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSH  1350
                        TQD++   +  +     K    VPRQF++L  G  AAAA  TD+ S S 
Sbjct  219   -----------TQDQKSHHKNEQHDGKNKNNGMVPRQFMDL--GLVAAAAGDTDDLSLST  265

Query  1349  TT---SEERTLSAGSPRNNNTELSR----------HKGIIAREDSPDSESWApnklpkln  1209
             +    S +R+ S G+   NN E              +G   REDSP  + WA NK+ +LN
Sbjct  266   SEGGRSRDRSRSPGNNVENNNEDGTLMFDQDKKGFARGADHREDSP-GQGWASNKVARLN  324

Query  1208  pskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVG  1029
              +K +DQ  EAT+RKARVSVRARSE  MISDGCQWRKYGQK+AKGNPCPRAYYRCTMA G
Sbjct  325   SAKTIDQT-EATIRKARVSVRARSEDAMISDGCQWRKYGQKLAKGNPCPRAYYRCTMAAG  383

Query  1028  CPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN  849
             CPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+M SADG++N
Sbjct  384   CPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMSSADGLLN  443

Query  848   TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQ  669
             +NFL R++LPCSS++ATISASAPFPTVTLDLTQ PN L    + PTQFQ PF  APQ P 
Sbjct  444   SNFLTRSLLPCSSNLATISASAPFPTVTLDLTQNPNPL-QLPKQPTQFQFPFPNAPQDPA  502

Query  668   NYPQ---LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFAD  498
             N      LPQ+FGQ LYNQSKFSGL +S QD+        +  +  Q   P  Q    AD
Sbjct  503   NASATALLPQIFGQALYNQSKFSGLQMS-QDM--------EPHRLGQQSQPASQQNPLAD  553

Query  497   TLSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
             +L+AATA I +DPNFTAALAAAI+SI+GG  Q
Sbjct  554   SLAAATAVIAADPNFTAALAAAITSIIGGAHQ  585



>ref|XP_011047240.1| PREDICTED: probable WRKY transcription factor 31 isoform X3 [Populus 
euphratica]
Length=628

 Score =   379 bits (974),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 282/512 (55%), Positives = 345/512 (67%), Gaps = 52/512 (10%)
 Frame = -1

Query  1862  KRGPPNEVDFFSDKKADIVV------KKEITLHGEPV-TKADLNTGLQLVIANsgsdkst  1704
             +R   +E+DFF+ KK D           ++   G P   + ++NTGL L+  N+ SD+S 
Sbjct  101   RRTVIDEMDFFARKKHDDGYPITNNSTDDLKDSGSPARLELNVNTGLNLLTTNTSSDQSM  160

Query  1703  vddsvssDMEERRAKNDL--SVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQ  1530
             VDD +SS+ME +RAK++L  +VLQ E+E+M  EN RL+GML+QV++NY ALQ HL  L  
Sbjct  161   VDDGISSNMEYKRAKSELQLAVLQAEVERMKVENLRLKGMLNQVTSNYNALQMHLVTL--  218

Query  1529  HQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSH  1350
                        TQD++   +  +     K    VPRQF++L  G  AAAA  TD+ S S 
Sbjct  219   -----------TQDQKSHHKNEQHDGKNKNNGMVPRQFMDL--GLVAAAAGDTDDLSLST  265

Query  1349  TT---SEERTLSAGSPRNNNTELSR----------HKGIIAREDSPDSESWApnklpkln  1209
             +    S +R+ S G+   NN E              +G   REDSP  + WA NK+ +LN
Sbjct  266   SEGGRSRDRSRSPGNNVENNNEDGTLMFDQDKKGFARGADHREDSP-GQGWASNKVARLN  324

Query  1208  pskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVG  1029
              +K +DQ  EAT+RKARVSVRARSE  MISDGCQWRKYGQK+AKGNPCPRAYYRCTMA G
Sbjct  325   SAKTIDQT-EATIRKARVSVRARSEDAMISDGCQWRKYGQKLAKGNPCPRAYYRCTMAAG  383

Query  1028  CPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN  849
             CPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+M SADG++N
Sbjct  384   CPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMSSADGLLN  443

Query  848   TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQ  669
             +NFL R++LPCSS++ATISASAPFPTVTLDLTQ PN L    + PTQFQ PF  APQ P 
Sbjct  444   SNFLTRSLLPCSSNLATISASAPFPTVTLDLTQNPNPL-QLPKQPTQFQFPFPNAPQDPA  502

Query  668   NYPQ---LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFAD  498
             N      LPQ+FGQ LYNQSKFSGL +S QD+        +  +  Q   P  Q    AD
Sbjct  503   NASATALLPQIFGQALYNQSKFSGLQMS-QDM--------EPHRLGQQSQPASQQNPLAD  553

Query  497   TLSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
             +L+AATA I +DPNFTAALAAAI+SI+GG  Q
Sbjct  554   SLAAATAVIAADPNFTAALAAAITSIIGGAHQ  585



>ref|XP_011008022.1| PREDICTED: probable WRKY transcription factor 31 isoform X3 [Populus 
euphratica]
Length=594

 Score =   377 bits (969),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 316/589 (54%), Positives = 381/589 (65%), Gaps = 67/589 (11%)
 Frame = -1

Query  2027  MDKGWGLTL-ENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaG----MVPIN-PAA  1866
             MDKGWGLTL  +P        N    G  L  + + I+               P +  A 
Sbjct  1     MDKGWGLTLASDPVSVFSSNNNNSPVGSFLKIKRDFISDHNMDHSRNNNMFQFPGSLSAG  60

Query  1865  EKRGPP---NEVDFFSDK----------KADIVVKKEITLH----GEPVTKADLNTGLQL  1737
             + + PP   +EVDFF +K             ++VKKE ++     G   T  D+NTGL L
Sbjct  61    QDQQPPSAAHEVDFFKEKINKVGDDDSETTSVIVKKENSIAELAPGSTRTALDVNTGLHL  120

Query  1736  VIANsgsdkstvddsvssDMEERRAKND--LSVLQVELEKMNAENQRLRGMLSQVSTNYT  1563
             + ANS SD+STVDD VSSD++++R+KN+  L+ LQ+EL+KMN ENQRL+ ML  V+T+Y+
Sbjct  121   LTANSRSDQSTVDDGVSSDVDDKRSKNNEKLAQLQMELQKMNTENQRLKDMLGHVTTSYS  180

Query  1562  ALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaa  1383
             ALQ H + LMQ   QQ+    S ++ E   +    ++ + E+  VPRQF++L P      
Sbjct  181   ALQMHFAALMQQHQQQNHGKESNKEEENIVQGKPSEEKKHEDVVVPRQFMDLGPSA----  236

Query  1382  aAQTDEASQSHTTSEERTLSAGSPRN--------NNTELS--------RHKGIIAREDSP  1251
               +TDE S S  +S+ERT S G+P+N        NN +L         R    I RE+SP
Sbjct  237   --ETDELSNS--SSDERTRS-GTPQNHIEVASAKNNGKLPYDQENSSFRDGKRIGREESP  291

Query  1250  DSESWApnklpk---lnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMA  1080
             +SES A            +K ++Q+ EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMA
Sbjct  292   ESESQAWKVQKTDPASPANKAIEQSTEATMRKARVSVRARSEAPMITDGCQWRKYGQKMA  351

Query  1079  KGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaa  900
             KGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTT+AA
Sbjct  352   KGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTAAA  411

Query  899   anmllSGAMPSADGMMNTNFLARAILPC-SSSVATISASAPFPTVTLDLTQTPNSLPNYQ  723
             A+MLLSG+M SADG+MN N LARAILP  SS++ATISASAPFPTVTLDLT  PN L  +Q
Sbjct  412   ASMLLSGSMSSADGIMNPNLLARAILPAGSSNMATISASAPFPTVTLDLTHNPNPL-QFQ  470

Query  722   RPPTQFQAPFTGAPQIPQNY-----PQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaa  558
             RPP QFQ PF G    PQN+     PQLPQVFGQ LYNQSKFSGL +S Q+I        
Sbjct  471   RPPPQFQVPFPGQ---PQNFSSVTAPQLPQVFGQALYNQSKFSGLQLS-QEIGTPQLGQQ  526

Query  557   qlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                        P       DTLSAATAAIT+DPNFTAALAAAISSI+GG
Sbjct  527   AQPHLLHSGQQPSLSQ---DTLSAATAAITADPNFTAALAAAISSIIGG  572



>ref|XP_004486177.1| PREDICTED: probable WRKY transcription factor 31-like [Cicer 
arietinum]
Length=567

 Score =   377 bits (967),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 316/585 (54%), Positives = 378/585 (65%), Gaps = 88/585 (15%)
 Frame = -1

Query  2027  MDKGWGLTLEN------------PDRR---AGFFTNK---PVFGFNLSPRLNPINgggsg  1902
             MDKGWGL L+             P ++   + F TN    P+FGF       P+N   + 
Sbjct  1     MDKGWGLALDTSPSSPIPSLPFLPSKQPSASSFNTNDRMFPIFGF-------PVNLSRNT  53

Query  1901  ggaGMVPINPAAEKRGPPNEVDFFSDK-------KADIVVKKEITLHGE--PVTKADLNT  1749
                     N     R    EVDFFS++       K++  VKKEI    E  P++   +NT
Sbjct  54    S-------NAEDGDRKVIGEVDFFSERNNKPSHVKSNNTVKKEIITTDEKSPISNIHVNT  106

Query  1748  GLQLVIANsgsdkstvddsvssDMEERRAKN-DLSVLQVELEKMNAENQRLRGMLSQVST  1572
             GLQL  AN+GSD+S VDD+VSSD E +RAK  +L+ LQVEL++MN+EN++L+ MLS V+ 
Sbjct  107   GLQL--ANTGSDQSVVDDAVSSDAENKRAKTTELAQLQVELQRMNSENKKLKEMLSHVTG  164

Query  1571  NYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPggg  1392
             NYTALQ  L  LMQ  +  ++        EV + KSEEKK       VPRQFLE+ P G 
Sbjct  165   NYTALQMQLVALMQKNHHTAN--------EVVNAKSEEKKQGVGGGRVPRQFLEIGPSGT  216

Query  1391  aaaaAQTDEASQSHTTSEERTLS-------AGSPRNNNTELSRHKGIIAREDSPDSES--  1239
             AA     D+ S S  +S+ERT S       AG+ R++   +  + G   RE+S DSES  
Sbjct  217   AAEVD--DQVSNS--SSDERTRSNTPQIEAAGTTRDH--IVRNNNGKNGREESSDSESQG  270

Query  1238  WApnklpklnpskP-VDQAA-EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPC  1065
             W  NK+ K+      +DQ+  EATMRKARVSVRARSEA MISDGCQWRKYGQKMAKGNPC
Sbjct  271   WGSNKVQKILNPSNPIDQSTTEATMRKARVSVRARSEASMISDGCQWRKYGQKMAKGNPC  330

Query  1064  PRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmll  885
             PRAYYRCTMAVGCPVRKQVQRCAED TIL+TTYEGTHNHPLPPAAMAMASTTSAAA+MLL
Sbjct  331   PRAYYRCTMAVGCPVRKQVQRCAEDTTILVTTYEGTHNHPLPPAAMAMASTTSAAASMLL  390

Query  884   SGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLP-------NY  726
             SG+M SADG+M  N LARAILPCS+S+AT+SASAPFPTVTLDLTQ  NS P        +
Sbjct  391   SGSMSSADGIMTPNLLARAILPCSTSMATLSASAPFPTVTLDLTQNSNSNPNPNSNPLQF  450

Query  725   QRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaq  546
             QRP   FQ PF      PQN+ Q        +YNQSKFSGL +S Q+I      +    Q
Sbjct  451   QRPHAPFQVPFFQGQ--PQNFAQ-----AAAIYNQSKFSGLQLS-QEI----GSSHLTTQ  498

Query  545   qqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                   PPPQHP  AD++SAATAAIT+DPNFTA LAAAISSI+GG
Sbjct  499   ASSSTQPPPQHPSLADSVSAATAAITADPNFTAVLAAAISSIIGG  543



>ref|XP_009614876.1| PREDICTED: probable WRKY transcription factor 31 [Nicotiana tomentosiformis]
Length=598

 Score =   377 bits (968),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 273/504 (54%), Positives = 333/504 (66%), Gaps = 37/504 (7%)
 Frame = -1

Query  1847  NEVDFFSDKKADIVVKKE-------ITLHGE--------PVTKADLNTGLQLVIANsgsd  1713
             +E+DFF+D K D    +E        T+  E        P    ++NTGL L+ AN+ SD
Sbjct  78    DEMDFFADHKKDGSNSEEAATTANNTTMDTERKESNTPPPELDFNINTGLHLLTANTYSD  137

Query  1712  kstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLM  1533
             +S V+D +S + E++R KN+L+VLQ ELE+MN EN+RL+ ML+Q + +Y+ L   +  ++
Sbjct  138   QSIVEDGLSPNSEDKRTKNELAVLQAELERMNGENRRLKDMLNQATNDYSNLHMQMMTMI  197

Query  1532  QHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQS  1353
             Q Q  Q +     +  EV  +   +         VPRQF++L  G  AA  ++ +E S S
Sbjct  198   QQQQHQENDQRDGKSDEVRQQIQSKNGLGGGGQIVPRQFMDL--GLAAATGSEVEETSLS  255

Query  1352  HTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPD--SESWApnkl-pklnpskPVDQAA  1182
              +        + SP  NN E     GI  REDSP+  S  W PNK+    N SK  DQA 
Sbjct  256   SSEGRSGRDKSRSP-TNNMESGSTCGI-GREDSPEKGSPGWGPNKIPRLGNGSKTTDQAT  313

Query  1181  EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQR  1002
             EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQR
Sbjct  314   EATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQR  373

Query  1001  CAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAIL  822
             CAEDRTILITTYEGTHNHPLPPAAMAMASTTS+AA MLLSG+MPSADG+MN+NF AR +L
Sbjct  374   CAEDRTILITTYEGTHNHPLPPAAMAMASTTSSAARMLLSGSMPSADGLMNSNFFARTLL  433

Query  821   PCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQ---LP  651
             PCSSS+ATISASAPFPTVTLDLTQ+PN L  + R P QFQ PF+  P    + P    LP
Sbjct  434   PCSSSMATISASAPFPTVTLDLTQSPNPL-QFPRSPNQFQVPFSNPPHNMLSNPAAALLP  492

Query  650   QVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAI  471
             Q+F Q LYNQSKFSGL +S QD         Q A           H   ADT++    A+
Sbjct  493   QIFNQALYNQSKFSGLQLS-QD------SEGQNASTLPSSIHQSNHNPLADTVN----AL  541

Query  470   TSDPNFTAALAAAISSIMGGGSQP  399
             T+DPNFTAALAAAI+S++G   QP
Sbjct  542   TADPNFTAALAAAITSLIGNPQQP  565



>gb|ABS18425.1| WRKY23 [Glycine max]
Length=493

 Score =   373 bits (957),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 273/434 (63%), Positives = 320/434 (74%), Gaps = 32/434 (7%)
 Frame = -1

Query  1844  EVDFFSDKKADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvssDMEERR  1665
             EVDFFS      +VKKE+       T   +NTGLQL+ AN+ SD+STVDD +SSD E++R
Sbjct  46    EVDFFSHTPPPNIVKKELD-----QTPLHINTGLQLLTANTRSDQSTVDDGLSSDAEDKR  100

Query  1664  AKN-DLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQD  1488
             AK  +L+ LQVEL++MNAEN++L+ MLS V+ NYTALQ HL  LMQ QNQQ  R  ST++
Sbjct  101   AKTTELAQLQVELQRMNAENKKLKEMLSHVTGNYTALQMHLVTLMQ-QNQQ--RTESTEN  157

Query  1487  REVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPR  1308
               VA  K E+K        VPRQFL++ P G A       +   S ++S+ERT S+ +P+
Sbjct  158   -GVAQGKVEDKNHGVGGGKVPRQFLDIGPSGTAEV-----DDQVSDSSSDERTRSS-TPQ  210

Query  1307  NNNTELSRHKGI---------IAREDSPDSES--WApnklpklnpskPVDQA-AEATMRK  1164
             +NNTE     G          + RE+SPDSES  W PNKL K+NPS P+DQ+ AEATMRK
Sbjct  211   DNNTEAGTRDGARNNNGNKSELGREESPDSESQGWGPNKLQKVNPSNPMDQSTAEATMRK  270

Query  1163  ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT  984
             ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA+DRT
Sbjct  271   ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCADDRT  330

Query  983   ILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSV  804
             IL+TTYEGTHNHPLPPAAMAMASTT+AAA MLLSG+M SADG+MN N LARAILPCS+S+
Sbjct  331   ILVTTYEGTHNHPLPPAAMAMASTTAAAATMLLSGSMSSADGVMNPNLLARAILPCSTSM  390

Query  803   ATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYN  624
             AT+SASAPFPTVTLDLT  PN L  +QRP   FQ PF  A   PQN+        Q LYN
Sbjct  391   ATLSASAPFPTVTLDLTHNPNPL-QFQRPGAPFQVPFLQA--QPQNFGSGATPIAQALYN  447

Query  623   QSKFSGLHVSHQDI  582
             QSKFSGL +S QD+
Sbjct  448   QSKFSGLQLS-QDV  460



>ref|XP_007132527.1| hypothetical protein PHAVU_011G101900g [Phaseolus vulgaris]
 gb|ESW04521.1| hypothetical protein PHAVU_011G101900g [Phaseolus vulgaris]
Length=599

 Score =   376 bits (966),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 287/588 (49%), Positives = 355/588 (60%), Gaps = 73/588 (12%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVF-----------GFNLSPRLN---PINgggsgggaG  1890
             M +G GL++++ D    FF +KP+             + LSP  N    ++   +     
Sbjct  1     MVRGGGLSMDS-DPIGSFFLHKPIVLNSFPEDTNHPKWKLSPHNNMEATVSTKDTIPFQV  59

Query  1889  MVPINPAAEKRGPPN-----EVDFFSD--KKADIVVKKEITLHGE---PVTKADLNTGLQ  1740
              +  +P      P +     E+DFFSD  KK   V       H     P  +  +NTGL 
Sbjct  60    NLSCSPNNHDSSPSSLHNRTEMDFFSDNNKKEHNVSASASNHHHSTTPPTLEFKVNTGLN  119

Query  1739  LVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTA  1560
             L+ AN+ SD+S VDD +S + E+RRAKN+++ LQ ELE+M  ENQ+LR  L QV+ NY A
Sbjct  120   LLTANTSSDQSMVDDEISPNSEDRRAKNEVAALQAELERMKRENQKLRNTLDQVNVNYDA  179

Query  1559  LQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaa  1380
             LQ H  NLMQ Q  + +        ++ ++K    + E     VPRQF++L    G A  
Sbjct  180   LQMHFMNLMQQQKAEEAEEQEVIGGKLEEKK----QGESSGVLVPRQFMDL----GLATN  231

Query  1379  AQTDE-ASQSHTTSEERTLSAGSPR---------NNNTELSRHKGI----------IARE  1260
             A TDE +S S   S++R+   GSP             +E+   +G           +  E
Sbjct  232   ADTDEPSSSSGGRSQDRS---GSPHAEVASKELGTGKSEIVNDEGYDQEKKEYGRGVESE  288

Query  1259  DSPDSESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMA  1080
             DSP   +++ +K+P+ +P K   + AEATMRKARVSVRARSEAPMI+DGCQWRKYGQKMA
Sbjct  289   DSPSGHAFSGDKVPRFSPQKSNVEQAEATMRKARVSVRARSEAPMITDGCQWRKYGQKMA  348

Query  1079  KGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaa  900
             KGNPCPRAYYRCTMA GCPVRKQVQRCAEDRT+LITTYEG HNHPLPPAAMAMA TTS+A
Sbjct  349   KGNPCPRAYYRCTMAAGCPVRKQVQRCAEDRTVLITTYEGNHNHPLPPAAMAMAQTTSSA  408

Query  899   anmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQR  720
             A MLLSG+M SAD +MN N L R +LPCSSS+ATISASAPFPTVTLDLTQ+PN L    R
Sbjct  409   ARMLLSGSMSSADSLMNANLLTRTLLPCSSSMATISASAPFPTVTLDLTQSPNPL-QLPR  467

Query  719   PPTQFQAPFTGAPQIPQNYPQ--LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaq  546
              P Q Q P  G PQ   N P   +PQ+FGQ LYNQSKFSGL +SH               
Sbjct  468   HPNQLQIPLQGVPQNFANSPASLMPQIFGQALYNQSKFSGLQMSHD-----------ADP  516

Query  545   qqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
              Q    P    P   DT+SAA AA   DPNFTAALAAAI+SI+GG  Q
Sbjct  517   SQFGNHPQQVPPHLTDTVSAAIAA---DPNFTAALAAAITSIIGGAQQ  561



>ref|XP_011008021.1| PREDICTED: probable WRKY transcription factor 31 isoform X2 [Populus 
euphratica]
Length=597

 Score =   375 bits (964),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 301/530 (57%), Positives = 361/530 (68%), Gaps = 60/530 (11%)
 Frame = -1

Query  1871  AAEKRGPP---NEVDFFSDK----------KADIVVKKEITLH----GEPVTKADLNTGL  1743
             A + + PP   +EVDFF +K             ++VKKE ++     G   T  D+NTGL
Sbjct  63    AGQDQQPPSAAHEVDFFKEKINKVGDDDSETTSVIVKKENSIAELAPGSTRTALDVNTGL  122

Query  1742  QLVIANsgsdkstvddsvssDMEERRAKN-DLSVLQVELEKMNAENQRLRGMLSQVSTNY  1566
              L+ ANS SD+STVDD VSSD++++R+KN +L+ LQ+EL+KMN ENQRL+ ML  V+T+Y
Sbjct  123   HLLTANSRSDQSTVDDGVSSDVDDKRSKNNELAQLQMELQKMNTENQRLKDMLGHVTTSY  182

Query  1565  TALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaa  1386
             +ALQ H + LMQ   QQ+    S ++ E   +    ++ + E+  VPRQF++L P     
Sbjct  183   SALQMHFAALMQQHQQQNHGKESNKEEENIVQGKPSEEKKHEDVVVPRQFMDLGPSA---  239

Query  1385  aaAQTDEASQSHTTSEERTLSAGSPRN--------NNTELS--------RHKGIIAREDS  1254
                +TDE S S  +S+ERT S G+P+N        NN +L         R    I RE+S
Sbjct  240   ---ETDELSNS--SSDERTRS-GTPQNHIEVASAKNNGKLPYDQENSSFRDGKRIGREES  293

Query  1253  PDSESWApnklpk---lnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKM  1083
             P+SES A            +K ++Q+ EATMRKARVSVRARSEAPMI+DGCQWRKYGQKM
Sbjct  294   PESESQAWKVQKTDPASPANKAIEQSTEATMRKARVSVRARSEAPMITDGCQWRKYGQKM  353

Query  1082  AKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsa  903
             AKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTT+A
Sbjct  354   AKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTAA  413

Query  902   aanmllSGAMPSADGMMNTNFLARAILPC-SSSVATISASAPFPTVTLDLTQTPNSLPNY  726
             AA+MLLSG+M SADG+MN N LARAILP  SS++ATISASAPFPTVTLDLT  PN L  +
Sbjct  414   AASMLLSGSMSSADGIMNPNLLARAILPAGSSNMATISASAPFPTVTLDLTHNPNPL-QF  472

Query  725   QRPPTQFQAPFTGAPQIPQNY-----PQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqa  561
             QRPP QFQ PF G    PQN+     PQLPQVFGQ LYNQSKFSGL +S Q+I       
Sbjct  473   QRPPPQFQVPFPGQ---PQNFSSVTAPQLPQVFGQALYNQSKFSGLQLS-QEIGTPQLGQ  528

Query  560   aqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                         P       DTLSAATAAIT+DPNFTAALAAAISSI+GG
Sbjct  529   QAQPHLLHSGQQPSLSQ---DTLSAATAAITADPNFTAALAAAISSIIGG  575



>ref|XP_008224752.1| PREDICTED: probable WRKY transcription factor 31 [Prunus mume]
Length=596

 Score =   375 bits (964),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 310/613 (51%), Positives = 369/613 (60%), Gaps = 126/613 (21%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVP-------INPA  1869
             MDKGWGLTL++     GFF NKP     L    N        GG  M P       +   
Sbjct  1     MDKGWGLTLDS--DSFGFFLNKPPAAVKLDHHQNNSKISNFFGGERMFPGIEFPVKLGGR  58

Query  1868  AEKRGPP-------------NEVDFFSDKK------------ADIVVKKEITLHGEPVTK  1764
              ++   P             +EVDFFSD+K             D+  K  I++  E  T 
Sbjct  59    EDQLAAPQPSIHDNNNRVVVDEVDFFSDRKNKHNTTTTDDHHQDMKSKGTISVKKENWTG  118

Query  1763  ADLNTGLQLVIANsgsdkstvddsvssDMEERRAKN-DLSVLQVELEKMNAENQRLRGML  1587
              D+NTGL LV AN+GSD+S VDD +SSD++ +RAKN +L+ LQVEL++MN+EN RL+ ML
Sbjct  119   LDVNTGLHLVTANTGSDQSMVDDGISSDVDNKRAKNHELAQLQVELQRMNSENLRLKEML  178

Query  1586  SQVSTNYTALQQHLSNLMQHQN---------QQSSRIGSTQDREV-ADRKSeekkpekee  1437
              QV+ NY+ALQ H++ +MQ Q           QSS++   Q+ E  AD++ ++       
Sbjct  179   GQVTNNYSALQMHVAAVMQQQQQQQNHTAAADQSSQLKHDQNVEAKADQEKKQG------  232

Query  1436  PTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNTELS----------  1287
               VPRQFL+L P   A    Q      S+++SE RT SA SP+N N   S          
Sbjct  233   -LVPRQFLDLGPRATAETDDQV-----SNSSSEARTRSA-SPQNINEAASSKDHHLKKND  285

Query  1286  --------------RHKGIIAREDSPDSES--WApnkl---pklnpskPVDQAAEATMRK  1164
                           R    + RE+SP+SES  W PNK         +KP+DQ+ EATMRK
Sbjct  286   HPIGPLDPENSNNFRDGKRVGREESPESESQGWVPNKAPKLNNSAANKPIDQSTEATMRK  345

Query  1163  ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT  984
             ARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT
Sbjct  346   ARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT  405

Query  983   ILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN-TNFLARAILPCSSS  807
             ILITTYEG HNHPLPPAAMAMASTT+AAA+MLLSG+M SADG+MN  N LARAILPCSSS
Sbjct  406   ILITTYEGNHNHPLPPAAMAMASTTTAAASMLLSGSMSSADGIMNPNNLLARAILPCSSS  465

Query  806   VATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLY  627
             VAT                          P +QFQ PF      P   PQLPQVFGQ LY
Sbjct  466   VAT--------------------------PQSQFQVPF------PGQQPQLPQVFGQALY  493

Query  626   NQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTA  447
             NQSKFSGL +S QD+       +   QQQQH     Q   FADT+SAATAAIT+DP FTA
Sbjct  494   NQSKFSGLQLS-QDL-----MGSNSQQQQQHLPHQTQSASFADTVSAATAAITADPTFTA  547

Query  446   ALAAAISSIMGGG  408
             ALAAAI+SI+GGG
Sbjct  548   ALAAAITSIIGGG  560



>gb|AHD24521.1| WRKY6 [Capsicum annuum]
Length=636

 Score =   377 bits (967),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 280/511 (55%), Positives = 342/511 (67%), Gaps = 42/511 (8%)
 Frame = -1

Query  1847  NEVDFFSDKK-------ADIVVKKEITL-HGE--------PVTKADLNTGLQLVIANsgs  1716
             +E+DFF+DKK       AD+      T+ H +        P    ++NTGL L+ AN+ S
Sbjct  99    DEMDFFADKKNGNNSEEADVTTTTNNTINHSDRKDSNTPPPELDFNINTGLHLLTANTYS  158

Query  1715  dkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNL  1536
             D+S VDD +S + E++R K++L+VL+ ELE+MN EN+RLR ML+QV++NY+ LQ H+  +
Sbjct  159   DQSIVDDGLSPNSEDKRTKSELAVLRAELERMNGENRRLRDMLNQVTSNYSTLQMHMMTM  218

Query  1535  MQHQN----QQSSRIGSTQDREVADRKSeekkpekee-PTVPRQFLELVPgggaaaaAQT  1371
             MQ Q     +   R G +   EV  +              VPRQF++L      A  ++ 
Sbjct  219   MQQQQQQNQENGQRDGKSTREEVKQQHHSHNSHGGGGGQMVPRQFMDLGLAAAGATGSEA  278

Query  1370  DEASQSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPD--SESWApnk---lpklnp  1206
             +EASQS +        + SP NN    SR    I REDSP+  S  W PNK   L   + 
Sbjct  279   EEASQSSSEERSGREKSRSPMNNME--SRSTCGIGREDSPEKGSPGWGPNKIPRLGNAST  336

Query  1205  skPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGC  1026
             +KP DQA EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GC
Sbjct  337   NKPADQATEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGC  396

Query  1025  PVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNT  846
             PVRKQVQRCAEDRTILITTYEGTHNHPLPPAAMAMASTTS+AA MLLSG+MPSADG+MN+
Sbjct  397   PVRKQVQRCAEDRTILITTYEGTHNHPLPPAAMAMASTTSSAARMLLSGSMPSADGLMNS  456

Query  845   NFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQ---I  675
             NF AR +LPCSSS+ATISASAPFPTVTLDLTQ+PN L  + RPP QFQ PF+  P    +
Sbjct  457   NFFARTLLPCSSSMATISASAPFPTVTLDLTQSPNPL-QFPRPPNQFQVPFSNPPHTNIL  515

Query  674   PQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADT  495
                   LPQ+FGQ LYNQSKFSGL +S QD+     +  Q          P  H   ADT
Sbjct  516   ANPAALLPQIFGQALYNQSKFSGLQLS-QDL-----EGQQHPSTMSSSIHPSNHNPLADT  569

Query  494   LSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
             ++    A+T+DPNFTAALAAAI+S++G   Q
Sbjct  570   VN----ALTNDPNFTAALAAAITSLIGNPGQ  596



>ref|XP_010926195.1| PREDICTED: probable WRKY transcription factor 31 isoform X2 [Elaeis 
guineensis]
Length=546

 Score =   374 bits (959),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 263/440 (60%), Positives = 299/440 (68%), Gaps = 50/440 (11%)
 Frame = -1

Query  1655  DLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVA  1476
             DL+ +Q EL +MN ENQRLRGML+QV+TNY ALQ  L  LMQ + Q+    GS+Q+ E  
Sbjct  109   DLASMQAELSRMNEENQRLRGMLNQVTTNYNALQMQLVVLMQQRKQKD---GSSQEHEAM  165

Query  1475  DRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNT  1296
             D K++ K        VPRQF++L        AA TDE SQS      R  S+ SP NN  
Sbjct  166   DEKTDGK-------IVPRQFMDL------GLAANTDEPSQSSIEGGGRERSS-SPTNNVE  211

Query  1295  ELSR---------HKGIIA-------REDSPD--SESWApnklpklnpskPVDQAAEATM  1170
               S          +K I+        R+DSPD  SE W PNK  KL   K  +Q  EATM
Sbjct  212   AGSMEYRLKKNNANKEIVPLDHERSNRDDSPDPSSEGWNPNKASKLASPKSEEQTQEATM  271

Query  1169  RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAED  990
             RKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAED
Sbjct  272   RKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQRCAED  331

Query  989   RTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSS  810
             R+ILITTYEG HNHPLPPAAMAMASTTSAAA+MLLSG+M SADG++N+NFLAR +LPCSS
Sbjct  332   RSILITTYEGNHNHPLPPAAMAMASTTSAAASMLLSGSMSSADGLINSNFLARTVLPCSS  391

Query  809   SVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPF-TGAPQI--PQNYPQLPQVFG  639
             S+ATISASAPFPTVTLDLT  PN L  +QR P QFQ P   G P    P   P LPQ+FG
Sbjct  392   SLATISASAPFPTVTLDLTHNPNPL-QFQRLPAQFQLPLPNGTPAFGGPPQPPALPQIFG  450

Query  638   QGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDP  459
             Q L +QS FSGL +S             +   Q     PP     ADT+SAATAAIT+DP
Sbjct  451   QALNSQSTFSGLQMS-----------PNMDGAQFPHPKPPSATSLADTVSAATAAITADP  499

Query  458   NFTAALAAAISSIMGGGSQP  399
              F AALAAAI+SI+GGG QP
Sbjct  500   TFKAALAAAITSIIGGGHQP  519



>ref|XP_011008019.1| PREDICTED: probable WRKY transcription factor 31 isoform X1 [Populus 
euphratica]
Length=598

 Score =   375 bits (963),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 301/531 (57%), Positives = 361/531 (68%), Gaps = 61/531 (11%)
 Frame = -1

Query  1871  AAEKRGPP---NEVDFFSDK----------KADIVVKKEITLH----GEPVTKADLNTGL  1743
             A + + PP   +EVDFF +K             ++VKKE ++     G   T  D+NTGL
Sbjct  63    AGQDQQPPSAAHEVDFFKEKINKVGDDDSETTSVIVKKENSIAELAPGSTRTALDVNTGL  122

Query  1742  QLVIANsgsdkstvddsvssDMEERRAKND--LSVLQVELEKMNAENQRLRGMLSQVSTN  1569
              L+ ANS SD+STVDD VSSD++++R+KN+  L+ LQ+EL+KMN ENQRL+ ML  V+T+
Sbjct  123   HLLTANSRSDQSTVDDGVSSDVDDKRSKNNEKLAQLQMELQKMNTENQRLKDMLGHVTTS  182

Query  1568  YTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPggga  1389
             Y+ALQ H + LMQ   QQ+    S ++ E   +    ++ + E+  VPRQF++L P    
Sbjct  183   YSALQMHFAALMQQHQQQNHGKESNKEEENIVQGKPSEEKKHEDVVVPRQFMDLGPSA--  240

Query  1388  aaaAQTDEASQSHTTSEERTLSAGSPRN--------NNTELS--------RHKGIIARED  1257
                 +TDE S S  +S+ERT S G+P+N        NN +L         R    I RE+
Sbjct  241   ----ETDELSNS--SSDERTRS-GTPQNHIEVASAKNNGKLPYDQENSSFRDGKRIGREE  293

Query  1256  SPDSESWApnklpk---lnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQK  1086
             SP+SES A            +K ++Q+ EATMRKARVSVRARSEAPMI+DGCQWRKYGQK
Sbjct  294   SPESESQAWKVQKTDPASPANKAIEQSTEATMRKARVSVRARSEAPMITDGCQWRKYGQK  353

Query  1085  MAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamastts  906
             MAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTT+
Sbjct  354   MAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTA  413

Query  905   aaanmllSGAMPSADGMMNTNFLARAILPC-SSSVATISASAPFPTVTLDLTQTPNSLPN  729
             AAA+MLLSG+M SADG+MN N LARAILP  SS++ATISASAPFPTVTLDLT  PN L  
Sbjct  414   AAASMLLSGSMSSADGIMNPNLLARAILPAGSSNMATISASAPFPTVTLDLTHNPNPL-Q  472

Query  728   YQRPPTQFQAPFTGAPQIPQNY-----PQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaq  564
             +QRPP QFQ PF G    PQN+     PQLPQVFGQ LYNQSKFSGL +S Q+I      
Sbjct  473   FQRPPPQFQVPFPGQ---PQNFSSVTAPQLPQVFGQALYNQSKFSGLQLS-QEIGTPQLG  528

Query  563   aaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                          P       DTLSAATAAIT+DPNFTAALAAAISSI+GG
Sbjct  529   QQAQPHLLHSGQQPSLSQ---DTLSAATAAITADPNFTAALAAAISSIIGG  576



>gb|KDO78305.1| hypothetical protein CISIN_1g007099mg [Citrus sinensis]
Length=448

 Score =   369 bits (948),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 259/439 (59%), Positives = 297/439 (68%), Gaps = 44/439 (10%)
 Frame = -1

Query  1622  MNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpek  1443
             MN ENQRLR MLSQV+ NY ALQ H+  LMQ Q +      S Q  EV + K E KK + 
Sbjct  1     MNTENQRLRDMLSQVTNNYNALQMHIIALMQQQQENRRAPESNQAHEVVEGKDEGKKHDD  60

Query  1442  eePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPR------------NNN  1299
             +   VPRQF+ L P        +TD    + ++ EERTLS   P             N  
Sbjct  61    QV-MVPRQFIGLGPSA------ETDHEVSNCSSDEERTLSGTPPNIVEAASKEHVNSNGK  113

Query  1298  TEL--------------SRHKGIIAREDSPDSES--WA-pnklpklnpskPVDQAAEATM  1170
              E+              + +   I RE+SP+SE+  W   NK+ KL+ +K +DQ+ EATM
Sbjct  114   NEIVSFDDQAAAAAAAENSNGKRIGREESPESETQGWGPNNKVQKLSSAKGIDQSNEATM  173

Query  1169  RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAED  990
             RKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAED
Sbjct  174   RKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAED  233

Query  989   RTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSS  810
             RTILITTYEG HNHPLPPAAMAMASTT+AAA+MLLSG+M SADG+MN N LARAILPCSS
Sbjct  234   RTILITTYEGNHNHPLPPAAMAMASTTTAAASMLLSGSMSSADGIMNPNLLARAILPCSS  293

Query  809   SVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQ--IPQNYPQLPQVFGQ  636
             S+ATISASAPFPTVTLDLT +PN L   QR   QFQ  F G PQ        QLPQVFGQ
Sbjct  294   SMATISASAPFPTVTLDLTHSPNPL-QLQRQAAQFQVQFPGQPQNLASVTNTQLPQVFGQ  352

Query  635   GLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPN  456
              LYNQSKFSGL +S Q+I + +   +          P       ADT+SAATAAIT+DPN
Sbjct  353   ALYNQSKFSGLQLS-QNIGSNSQSGSHQTLPPPLQQPQQL----ADTVSAATAAITADPN  407

Query  455   FTAALAAAISSIMGGGSQP  399
             FTAALAAAI+SI+GG   P
Sbjct  408   FTAALAAAITSIIGGAQNP  426



>ref|XP_006389578.1| WRKY transcription factor 42 family protein [Populus trichocarpa]
 gb|ERP48492.1| WRKY transcription factor 42 family protein [Populus trichocarpa]
Length=590

 Score =   374 bits (960),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 323/589 (55%), Positives = 382/589 (65%), Gaps = 71/589 (12%)
 Frame = -1

Query  2027  MDKGWGLTL-ENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaG----MVPIN-PAA  1866
             MDKGWGLTL  +P        N    G  L  + + I+               P +  A 
Sbjct  1     MDKGWGLTLASDPVSVFSSNNNNSPVGSFLKIKRDFISDHNMDHSRNNNMFQFPGSLSAG  60

Query  1865  EKRGPP---NEVDFFS---DKKAD-------IVVKKEITLHG----EPVTKADLNTGLQL  1737
             +   PP   +EVDFF    DK  D       ++VKKE ++         T  D+NTGL L
Sbjct  61    QDEQPPSAAHEVDFFKERIDKVGDDDSKTTSVIVKKENSIAELAPRSTRTALDVNTGLHL  120

Query  1736  VIANsgsdkstvddsvssDMEERRAKND--LSVLQVELEKMNAENQRLRGMLSQVSTNYT  1563
             + ANS SD+STVDD VSSD++++R+KN+  L+ LQ+EL+KMN ENQRL+ ML QV+T+Y+
Sbjct  121   LTANSRSDQSTVDDGVSSDVDDKRSKNNEKLAQLQMELQKMNTENQRLKDMLGQVTTSYS  180

Query  1562  ALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaa  1383
             ALQ H + LMQ   QQ+   G   ++E   + SEEKK E     VPRQF++L P      
Sbjct  181   ALQMHFAALMQQHQQQNH--GKESNKEQQGKSSEEKKHEDV--VVPRQFMDLGPSA----  232

Query  1382  aAQTDEASQSHTTSEERTLSAGSPRN--------NNTELS--------RHKGIIAREDSP  1251
               +TDE S S  +S+ERT S G+P+N        NN +L         R    I RE+SP
Sbjct  233   --ETDELSNS--SSDERTRS-GTPQNHIEVASPKNNGKLPYDQENSSFRDGKRIGREESP  287

Query  1250  DSESWApnklpk---lnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMA  1080
             +SES A            +K ++Q+ EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMA
Sbjct  288   ESESQAWKVQKTDPASPANKAIEQSTEATMRKARVSVRARSEAPMITDGCQWRKYGQKMA  347

Query  1079  KGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaa  900
             KGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTT+AA
Sbjct  348   KGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTAAA  407

Query  899   anmllSGAMPSADGMMNTNFLARAILPC-SSSVATISASAPFPTVTLDLTQTPNSLPNYQ  723
             A+MLLSG+M SADG+MN N LARAILP  SS++ATISASAPFPTVTLDLT  PN L  +Q
Sbjct  408   ASMLLSGSMSSADGIMNPNLLARAILPAGSSNMATISASAPFPTVTLDLTHNPNPL-QFQ  466

Query  722   RPPTQFQAPFTGAPQIPQNY-----PQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaa  558
             RPP QFQ PF G    PQN+     PQLPQVFGQ LYNQSKFSGL +S Q+I        
Sbjct  467   RPPPQFQVPFPGQ---PQNFSSVTTPQLPQVFGQALYNQSKFSGLQLS-QEIGTPQLGHQ  522

Query  557   qlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                        P       DTLSAATAAIT+DPNFTAALAAAISSI+GG
Sbjct  523   AQPHLLHSGQQPSLSQ---DTLSAATAAITADPNFTAALAAAISSIIGG  568



>ref|XP_008797553.1| PREDICTED: probable WRKY transcription factor 31 [Phoenix dactylifera]
Length=585

 Score =   373 bits (958),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 281/521 (54%), Positives = 337/521 (65%), Gaps = 65/521 (12%)
 Frame = -1

Query  1871  AAEKRGPPNEVDFFSDKK-------ADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsd  1713
               E R    E+DFFSD +       +D+ V K + +  E +T   +N GL L+  N+ SD
Sbjct  58    GGENRRVVGEMDFFSDDRKERARPDSDLSVPK-LCVKEEDLT---INMGLHLLTTNTRSD  113

Query  1712  kstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLM  1533
             +STVDD +S + E++ +K +L+ ++ EL +MN ENQRL+GML   + NY +L  H   LM
Sbjct  114   QSTVDDGLSPNEEDKESKGELAAVRAELGRMNQENQRLKGMLVHATNNYNSLHMHFITLM  173

Query  1532  QHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQS  1353
             Q +N+   R GS Q  EV+  +  +K+ E E+   PRQFL+L P          DEAS S
Sbjct  174   QERNR---RNGSPQSHEVSGDQMGDKRNEHEDAIAPRQFLDLGPVLL------ADEASHS  224

Query  1352  HTTSEERTLSAGSPRNNNTEL----------SRHKGIIA---------------REDSP-  1251
              T    R  SA  P  NN E+          S  K I+                RE+ P 
Sbjct  225   TTEGGSRDRSASPP--NNMEVMPIDDSLKKASNGKEIVRIDRERSDVRDIRPTFREECPA  282

Query  1250  --DSESWApnklpklnpskPVD--QAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKM  1083
                SE W PNK PKL+P K     QA EA+MRKARVSVRARSEAPMI+DGCQWRKYGQKM
Sbjct  283   DRGSEGWVPNKAPKLSPPKSTSDQQAQEASMRKARVSVRARSEAPMITDGCQWRKYGQKM  342

Query  1082  AKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsa  903
             AKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR++LITTYEG HNHPLPPAAMAMASTTSA
Sbjct  343   AKGNPCPRAYYRCTMAAGCPVRKQVQRCAEDRSVLITTYEGNHNHPLPPAAMAMASTTSA  402

Query  902   aanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQ  723
             AANMLLSG+M S DG+MN+NFLAR +LPCSSS+ATISASAPFPTVTLDLT  P++   +Q
Sbjct  403   AANMLLSGSMSSTDGLMNSNFLARTMLPCSSSMATISASAPFPTVTLDLTHPPDA--KFQ  460

Query  722   RPPTQFQAPF-TGAPQIPQN-YPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqla  549
             RP TQFQ PF  GAP +    +  LPQVFGQ L+NQSKFSG  +S          A+   
Sbjct  461   RPSTQFQVPFPNGAPGLGSTPHTSLPQVFGQTLFNQSKFSGSQMS---------AASDGD  511

Query  548   qqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAIS  426
             Q         Q    ADT+SAATAAIT+DPNFTAALAAAI+
Sbjct  512   QFSHPKPQSLQPSSLADTVSAATAAITADPNFTAALAAAIT  552



>emb|CDP10754.1| unnamed protein product [Coffea canephora]
Length=622

 Score =   374 bits (961),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 259/439 (59%), Positives = 309/439 (70%), Gaps = 27/439 (6%)
 Frame = -1

Query  1844  EVDFFSDKKADIVVKKEITL-HGEPVTKA---------DLNTGLQLVIANsgsdkstvdd  1695
             E+DFF+DKK      K  T+ H +  TK          ++NTGL L+ AN+ SD+S VDD
Sbjct  90    EMDFFADKKLKTDESKAATIPHPDANTKDLSGPTELGFNVNTGLHLLTANTSSDQSIVDD  149

Query  1694  svssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQ-  1518
              +S   +++R K++L+VLQ ELE++N EN RLR +L+QVS NY  LQ HL  +MQ Q Q 
Sbjct  150   GISPHSDDKRTKSELAVLQAELERLNGENLRLREVLTQVSNNYNNLQMHLMTVMQQQPQQ  209

Query  1517  -----QSSRIGSTQDREV-ADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQ  1356
                  ++  IG  Q+ ++  +  + + +       VPRQF++L  G  A A  +TDEAS 
Sbjct  210   KQDHIKADNIGEGQEGKLPLEDNNNKHQQNSHGLMVPRQFMDL--GLAAGATVETDEASL  267

Query  1355  SHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPD--SESWApnkl-pklnpskPVDQA  1185
             S +        + SP  NN E S   G   R+DSP+  S+ W PNK+    N SK VDQA
Sbjct  268   SSSEGRSGRERSRSP-TNNVEAST-GGSDGRDDSPEKGSQGWGPNKVPRLNNGSKNVDQA  325

Query  1184  AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQ  1005
              EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQ
Sbjct  326   TEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQ  385

Query  1004  RCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAI  825
             RCAEDRTILITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+MPSADG+MN+NFLAR +
Sbjct  386   RCAEDRTILITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMPSADGLMNSNFLARTL  445

Query  824   LPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQ--IPQNYPQLP  651
             LPCSSS+ATISASAPFPTVTLDLTQ PN L  +QR P QF  PF  APQ  +      LP
Sbjct  446   LPCSSSMATISASAPFPTVTLDLTQNPNPL-QFQRSPNQFHLPFPNAPQNFVGNPVALLP  504

Query  650   QVFGQGLYNQSKFSGLHVS  594
             Q+FGQ LYNQSKFSGL +S
Sbjct  505   QIFGQALYNQSKFSGLQMS  523



>gb|ACD40316.1| WRKY transcription factor WRKY100630 [Medicago truncatula]
 gb|KEH36906.1| WRKY1b transcription factor [Medicago truncatula]
Length=553

 Score =   372 bits (954),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 301/580 (52%), Positives = 360/580 (62%), Gaps = 88/580 (15%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAG-------FFTNKPVFGFNLSPRLNPINgggsgggaGMVPINPA  1869
             MDK WGL L+              F  +K     + + R+ PI            P+N  
Sbjct  1     MDKAWGLALDTSSSSPIPISHSHPFLPSKQPSSTHTNDRMFPI---------LGFPVNLT  51

Query  1868  AEKRGP-------PNEVDFFSDK-------------KADIVVKKEITLHGEPVT-KADLN  1752
                 G          EVDFFS++             K++I+ K+ ++   +P T    +N
Sbjct  52    RNTNGEDGGDRKITGEVDFFSERNKPSPSHEHNQHVKSNIIKKEIVSTDEKPSTSNIHVN  111

Query  1751  TGLQLVIANsgsdkstvddsvssDMEERRAKN-DLSVLQVELEKMNAENQRLRGMLSQVS  1575
             TGLQL  AN+GSD+S VDD  SSD E +RAK  +L+ LQVEL++MN+EN++L+ MLS V+
Sbjct  112   TGLQL--ANTGSDQSVVDDGASSDAENKRAKTTELAQLQVELQRMNSENKKLKEMLSHVT  169

Query  1574  TNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgg  1395
              NYTALQ  L  LMQ  +          + EV + K+EEK        VPRQFLE+  G 
Sbjct  170   GNYTALQLQLVALMQKNHHT--------ENEVVNAKAEEKNQGVGGAMVPRQFLEITNGT  221

Query  1394  gaaaaAQTDEASQSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSES--WApnkl  1221
                      E   S+++S+ERT      R+N  ++    G   REDSP+SE+  W PNK 
Sbjct  222   TEV------EDQVSNSSSDERT------RSNTPQMRNSNGKTGREDSPESETQGWGPNKS  269

Query  1220  pklnpskPV-DQA-AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYR  1047
              K+  S  V DQA  EATMRKARVSVRARSEA MISDGCQWRKYGQKMAKGNPCPRAYYR
Sbjct  270   QKILNSSNVADQANTEATMRKARVSVRARSEASMISDGCQWRKYGQKMAKGNPCPRAYYR  329

Query  1046  CTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPS  867
             CTMAVGCPVRKQVQRCAED+TIL+TTYEGTHNHPLPPAAMAMASTTSAAA+MLLSG+M S
Sbjct  330   CTMAVGCPVRKQVQRCAEDKTILVTTYEGTHNHPLPPAAMAMASTTSAAASMLLSGSMSS  389

Query  866   ADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQ----A  699
             ADG+M  N LARAILPCS+S+AT+SASAPFPTVTLDLTQ  NS PN    P QFQ    A
Sbjct  390   ADGIMTPNLLARAILPCSTSMATLSASAPFPTVTLDLTQ--NSNPN----PLQFQRPQHA  443

Query  698   PFTGAPQIPQNYPQLPQVFGQG---LYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpa  528
             PF    Q+P  +    Q F Q    LYNQSKFSGL +S +                Q   
Sbjct  444   PFH---QVPSFFQGQNQNFAQAAASLYNQSKFSGLQLSQE--------VGSSHLTTQAST  492

Query  527   pppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGG  408
                Q P  AD++SAATAAIT+DPNFTA LAAAISSI+GGG
Sbjct  493   QQQQQPSLADSVSAATAAITADPNFTAVLAAAISSIIGGG  532



>gb|AGQ04221.1| WRKY transcription factor 32 [Jatropha curcas]
 gb|KDP24852.1| hypothetical protein JCGZ_24446 [Jatropha curcas]
Length=645

 Score =   375 bits (962),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 287/522 (55%), Positives = 345/522 (66%), Gaps = 47/522 (9%)
 Frame = -1

Query  1874  PAAEKRGPPNEVDFFSDKKADIVVKKEITLHGEPVTKA----DLNTGLQLVIANsgsdks  1707
             P+ EKR   +E+DFF++K  D V    IT H  P +      D+NTGL L I N+ SD+S
Sbjct  89    PSDEKRTVIDEMDFFAEK--DDVKPTNITSH-HPKSPTRLDFDVNTGLNLHITNTSSDQS  145

Query  1706  tvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQH  1527
              VDD +SS+M+E+R+KN+L+VLQ ELE+   EN RLR ML+QV+ NY ALQ  L  +MQ+
Sbjct  146   MVDDGISSNMDEKRSKNELAVLQAELERTKMENLRLRDMLNQVTNNYNALQMRLITIMQN  205

Query  1526  QN-QQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQ--  1356
             +  + ++  G   + +V ++K            VPRQF++L     A             
Sbjct  206   RKVEDNNEDGDALETKVGNKK----HAGNGAKVVPRQFMDLGLAAAATGGGGGGGGGDTD  261

Query  1355  --SHTTSEERTLS-AGSPRNNNTELSRH---------KGIIAREDSPD--SESWApnklp  1218
               S ++SE R+   + SP NN    S           KG I RE+SPD  S+ W  NK+ 
Sbjct  262   ELSLSSSEGRSRDRSRSPANNVENRSNEDGMVFDQEKKGTIGREESPDQGSQDWGSNKVG  321

Query  1217  k-lnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCT  1041
             +  +    VDQ  EAT+RKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCT
Sbjct  322   RFNSSKNNVDQT-EATIRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCT  380

Query  1040  MAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSAD  861
             MA GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+M SAD
Sbjct  381   MAAGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMSSAD  440

Query  860   GMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLP-NYQRPPTQFQAPFTGA  684
             G+MN NFL R +LPCSSS+ATISASAPFPTVTLDLTQ PN  P  +QR  TQFQ PF   
Sbjct  441   GLMNPNFLTRTLLPCSSSMATISASAPFPTVTLDLTQNPNPNPLQFQRQQTQFQVPF---  497

Query  683   PQIPQNYPQ-------LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpap  525
             P   QNYP        LPQ+FGQ LYNQSKFSGL +S QD+    + +      Q  PA 
Sbjct  498   PNPQQNYPNAANPAALLPQIFGQALYNQSKFSGLQMS-QDMEGNNSNSNNKLGHQSSPAA  556

Query  524   ppqh-----pLFADTLSAATAAITSDPNFTAALAAAISSIMG  414
               +         ADT+SAATAAI +DPNFTAALAAAI+SI+G
Sbjct  557   MQEQGQGQGNSLADTVSAATAAIAADPNFTAALAAAITSIIG  598



>ref|XP_011033773.1| PREDICTED: probable WRKY transcription factor 31 [Populus euphratica]
Length=443

 Score =   367 bits (942),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 258/444 (58%), Positives = 308/444 (69%), Gaps = 45/444 (10%)
 Frame = -1

Query  1679  MEERRAKNDL--SVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSR  1506
             ME++RAK++L  +VLQ E+E+M  EN RL+GML+QV++NY ALQ HL  L          
Sbjct  10    MEDKRAKSELQLAVLQAEVERMKVENLRLKGMLNQVTSNYNALQMHLVTL----------  59

Query  1505  IGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTT---SEE  1335
                TQD++   +  +     K    VPRQF++L  G  AAAA  TD+ S S +    S +
Sbjct  60    ---TQDQKSHHKNEQHDGKNKNNGMVPRQFMDL--GLVAAAAGDTDDLSLSTSEGGRSRD  114

Query  1334  RTLSAGSPRNNNTELSR----------HKGIIAREDSPDSESWApnklpklnpskPVDQA  1185
             R+ S G+   NN E              +G   REDSP  + WA NK+ +LN +K +DQ 
Sbjct  115   RSRSPGNNVENNNEDGTLMFDQDKKGFARGADHREDSP-GQGWASNKVARLNSAKTIDQT  173

Query  1184  AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQ  1005
              EAT+RKARVSVRARSE  MISDGCQWRKYGQK+AKGNPCPRAYYRCTMA GCPVRKQVQ
Sbjct  174   -EATIRKARVSVRARSEDAMISDGCQWRKYGQKLAKGNPCPRAYYRCTMAAGCPVRKQVQ  232

Query  1004  RCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAI  825
             RCAEDRTILITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+M SADG++N+NFL R++
Sbjct  233   RCAEDRTILITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMSSADGLLNSNFLTRSL  292

Query  824   LPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQ---L  654
             LPCSS++ATISASAPFPTVTLDLTQ PN L    + PTQFQ PF  APQ P N      L
Sbjct  293   LPCSSNLATISASAPFPTVTLDLTQNPNPL-QLPKQPTQFQFPFPNAPQDPANASATALL  351

Query  653   PQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAA  474
             PQ+FGQ LYNQSKFSGL +S QD+        +  +  Q   P  Q    AD+L+AATA 
Sbjct  352   PQIFGQALYNQSKFSGLQMS-QDM--------EPHRLGQQSQPASQQNPLADSLAAATAV  402

Query  473   ITSDPNFTAALAAAISSIMGGGSQ  402
             I +DPNFTAALAAAI+SI+GG  Q
Sbjct  403   IAADPNFTAALAAAITSIIGGAHQ  426



>ref|XP_011024798.1| PREDICTED: probable WRKY transcription factor 31 isoform X1 [Populus 
euphratica]
Length=598

 Score =   371 bits (953),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 318/595 (53%), Positives = 385/595 (65%), Gaps = 75/595 (13%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNK-------PVFGFNLSPRLNPINgggsgggaG----MVP  1881
             MDKGWGLTL + D  + F ++        PV  F L  + + I+               P
Sbjct  1     MDKGWGLTLAS-DPVSVFSSSNSSNNNNSPVGSF-LKIKRDFISDHNMDHSRNNNMFQFP  58

Query  1880  IN-PAAEKRGPP---NEVDFFSDK----------KADIVVKKEITLHG----EPVTKADL  1755
              +  A +   PP   +EVDFF +K             ++VKKE ++         T  D+
Sbjct  59    GSLSAGQDEQPPSAAHEVDFFKEKINKVGDDDSETTSVIVKKENSIAELAPRSTRTAPDV  118

Query  1754  NTGLQLVIANsgsdkstvddsvssDMEERRAKND--LSVLQVELEKMNAENQRLRGMLSQ  1581
             NTGL L+ ANS SD+STVDD VSSD++++R+KN+  L+ LQ+EL+KMN ENQRL+ ML  
Sbjct  119   NTGLHLLTANSRSDQSTVDDGVSSDVDDKRSKNNENLAQLQMELQKMNTENQRLKDMLGH  178

Query  1580  VSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVP  1401
             V+T+Y+ALQ H + LMQ   QQ+    S ++ E   +    ++ + E+  VPRQF++L P
Sbjct  179   VTTSYSALQMHFAALMQQHQQQNHGKESNKEEENIVQGKPSEEKKHEDVVVPRQFMDLGP  238

Query  1400  gggaaaaAQTDEASQSHTTSEERTLSAGSPRN--------NNTELS--------RHKGII  1269
                     +TDE S S  +S+ERT S G+P+N        NN +L         R    I
Sbjct  239   SA------ETDELSNS--SSDERTRS-GTPQNHIEVASAKNNGKLPYDQENSSFRDGKRI  289

Query  1268  AREDSPDSESWA---pnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRK  1098
              RE+SP+SES A       P    +K ++Q+ EATMRKARVSVRARSEAPMI+DGCQWRK
Sbjct  290   GREESPESESQAWKVQKTDPASPANKAIEQSTEATMRKARVSVRARSEAPMITDGCQWRK  349

Query  1097  YGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamama  918
             YGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMA
Sbjct  350   YGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMA  409

Query  917   sttsaaanmllSGAMPSADGMMNTNFLARAILPC-SSSVATISASAPFPTVTLDLTQTPN  741
             STT+AAA+MLLSG+M SADG+MN N LARAILP  SS++ATISASAPFPTVTLDLT  PN
Sbjct  410   STTAAAASMLLSGSMSSADGIMNPNLLARAILPAGSSNMATISASAPFPTVTLDLTHNPN  469

Query  740   SLPNYQRPPTQFQAPFTGAPQIPQNY-----PQLPQVFGQGLYNQSKFSGLHVSHQDIaa  576
              L  +QRPP QFQ PF G    PQN+     PQLPQVFGQ LYNQSKFSGL +S Q+I  
Sbjct  470   PL-QFQRPPPQFQVPFPGQ---PQNFSSVTAPQLPQVFGQALYNQSKFSGLQLS-QEIGT  524

Query  575   aaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                              P       DTLSAATAAIT+DPNFTAALAAAISSI+GG
Sbjct  525   PQLGQQAQPHLLHSGQQPSLSQ---DTLSAATAAITADPNFTAALAAAISSIIGG  576



>ref|XP_002524838.1| WRKY transcription factor, putative [Ricinus communis]
 gb|EEF37558.1| WRKY transcription factor, putative [Ricinus communis]
Length=652

 Score =   372 bits (956),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 282/506 (56%), Positives = 329/506 (65%), Gaps = 38/506 (8%)
 Frame = -1

Query  1862  KRGPPNEVDFFSDK-----------KADIVVKKEITLHGEPVTKA-DLNTGLQLVIANsg  1719
             KR   +E+DFF++K           K        I    +P +   D+NTGL L+  N+ 
Sbjct  100   KRTAIDEMDFFAEKHHRDDDDDDDVKPTNNTSPTIDDFKDPKSLGFDVNTGLNLLTTNTS  159

Query  1718  sdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSN  1539
             SD+S VDD +SS+ME++RAKN+L+VLQ ELE+M  EN RLR MLSQV++NY ALQ HL  
Sbjct  160   SDQSMVDDGISSNMEDKRAKNELAVLQAELERMKVENLRLRDMLSQVTSNYNALQMHLVT  219

Query  1538  LMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEAS  1359
             LMQ Q Q    I + ++++  +               PRQF++L      A  A  D   
Sbjct  220   LMQDQKQSRDEITNGEEKKKHNGNGTAVG--------PRQFMDLGLAAATAGGAGGDTDE  271

Query  1358  QSHTTSE----ERTLSAGSPRNNNTELSR-----HKGI---IAREDSPDSESWApnklpk  1215
              S ++SE    +R+ S G+  NNN E         KGI   I REDSPD    +      
Sbjct  272   LSLSSSEGRSRDRSRSPGNNNNNNIEDGTAFDQDKKGINGGIEREDSPDQGWGSNKVARF  331

Query  1214  lnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMA  1035
              +    VDQ  EAT+RKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA
Sbjct  332   NSSKNSVDQT-EATIRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMA  390

Query  1034  VGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGM  855
              GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+M SADG+
Sbjct  391   AGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMSSADGI  450

Query  854   MNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQI  675
             MN NFL R ILPCSSS+ATISASAPFPTVTLDLTQ PN L  +QR  TQFQ PF   PQ 
Sbjct  451   MNPNFLTRTILPCSSSMATISASAPFPTVTLDLTQNPNPL-QFQRQQTQFQVPFPNPPQN  509

Query  674   PQNYPQ---LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLF  504
               N P    LPQ+FGQ LYNQSKFSGL +S QD+        Q            Q    
Sbjct  510   FANSPAAALLPQIFGQALYNQSKFSGLQMS-QDVEGNNKLGNQSQPGPIQQQQQGQQNSL  568

Query  503   ADTLSAATAAITSDPNFTAALAAAIS  426
             ADT+SAATAAI +DPNFTAALAAAI+
Sbjct  569   ADTVSAATAAIAADPNFTAALAAAIT  594



>ref|XP_010686807.1| PREDICTED: probable WRKY transcription factor 31 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=652

 Score =   372 bits (954),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 299/542 (55%), Positives = 346/542 (64%), Gaps = 87/542 (16%)
 Frame = -1

Query  1844  EVDFFSDKKADIV----------------------VKKEITLHGE------PVTKADLNT  1749
             EVDFFSD K + +                      VK+E +          PV   +L+T
Sbjct  94    EVDFFSDHKNNNISVNRSSSSSASHHQQQQQQQHRVKEETSSRDHHHAAAVPVPDPNLDT  153

Query  1748  GLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTN  1569
             GL L+  N+GSD+STVDD  SSD E++R KN+L VLQ EL++MN ENQ+L+ MLSQVS N
Sbjct  154   GLHLLTTNTGSDQSTVDDGASSDAEDKRNKNELIVLQAELQRMNTENQKLKSMLSQVSNN  213

Query  1568  YTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPggga  1389
             Y ALQ HL  LMQ Q        +TQ  E        +   +E+  VPRQFL+LVPG   
Sbjct  214   YNALQMHLVTLMQQQQNHRKGESNTQLHE-----ETMQGKVEEKEIVPRQFLDLVPGANT  268

Query  1388  aaaAQTDEASQSHTTSEERTLS-AGSPRN--------NNTEL---SRHKGIIAREDSPD-  1248
                 + DE +    + +ERT+  + SPRN        NN EL   +   G   R++SP+ 
Sbjct  269   ----EGDELTSQTLSDDERTVDRSSSPRNAMEVASRNNNKELMLANYDNGKRIRDESPED  324

Query  1247  --SESWApnklpk------lnpskPVDQAA-EATMRKARVSVRARSEAPMISDGCQWRKY  1095
               ++ W  NK+PK         S PVD AA EATMRKARVSVRARSEAPMISDGCQWRKY
Sbjct  325   SATQGWVHNKVPKLMNNIPKATSPPVDHAAAEATMRKARVSVRARSEAPMISDGCQWRKY  384

Query  1094  GQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamas  915
             GQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMAS
Sbjct  385   GQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMAS  444

Query  914   ttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSL  735
             TTSAAA+MLLSG+MPS DG+MN NFLAR ILPCSSS+ATISASAPFPTVTLDLT +PN L
Sbjct  445   TTSAAASMLLSGSMPSGDGLMNPNFLARTILPCSSSMATISASAPFPTVTLDLTHSPNPL  504

Query  734   PNYQRPP-----TQFQAPFTG-APQIPQNY-PQLPQVFGQGLYN-------QSKFSGLHV  597
                QRP      T FQ PF     Q+  N+   +PQ+FGQ L N       QSKFSGL  
Sbjct  505   ---QRPSGPQANTPFQVPFPPPTAQVGPNFLSSIPQIFGQALLNNNNNNSNQSKFSGLQT  561

Query  596   SHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIM  417
             S                   H   P Q+  F+DTLSAATAAI SDPNFTAALAAAISSI+
Sbjct  562   S-----------TPQGLNAAHLQLPNQNAAFSDTLSAATAAIASDPNFTAALAAAISSII  610

Query  416   GG  411
             GG
Sbjct  611   GG  612



>ref|XP_010057908.1| PREDICTED: probable WRKY transcription factor 31 isoform X2 [Eucalyptus 
grandis]
Length=655

 Score =   371 bits (952),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 329/627 (52%), Positives = 386/627 (62%), Gaps = 104/627 (17%)
 Frame = -1

Query  2027  MDK-GWGLTLENPDRRAG--FFTNKPVFGFNL--SPRLNPINgggsgggaGMVP------  1881
             MDK GWGLTL++        FF  KP     L   P  +P +   +   A M P      
Sbjct  1     MDKAGWGLTLDSSSSSHSDSFFPKKPSGFLKLKRDPPGDPPSAAAAAAAARMFPGIDFSA  60

Query  1880  ----------------INPAA-EKRGPPNEVDFFSDKK-----------------ADIVV  1803
                              +PAA E R    EVDFFSD K                 A + V
Sbjct  61    SLGRRDDHRHASILNSSSPAADEGRVVVGEVDFFSDCKSRSSLPAAAAGGEEGRAATVSV  120

Query  1802  KKEITLHGEPV-TKADLNTGLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELE  1626
             K+E  +   P  ++ ++NTGL+L+ AN+GSD+STVDD  SSD+EE+RAKN+L+ L  EL+
Sbjct  121   KRESPVASGPARSELNVNTGLRLLTANTGSDQSTVDDGFSSDIEEKRAKNELAHLNAELQ  180

Query  1625  KMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGS-------TQDREVADRK  1467
             +MN+ENQRL+ MLSQV++NY ALQ HLS+L+Q Q Q   +           QD E A +K
Sbjct  181   RMNSENQRLKEMLSQVTSNYNALQLHLSSLLQQQQQHHIQHQHQSNGAEPAQDHENAMKK  240

Query  1466  SeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLS-----------A  1320
             ++          VPRQFL+L P   AAA  +TDE S S  +SEERT             A
Sbjct  241   NQT--------VVPRQFLDLGPMSAAAA--ETDEISNS--SSEERTRDGSRSPLAKMEVA  288

Query  1319  GSPRNNNTELSR-------HKGIIAREDSPD---SESWA-pnklpklnpskPVDQAAEAT  1173
              S  NN  E           +G+  R +SPD   ++ W              ++Q+AEAT
Sbjct  289   SSAHNNKAEQDSSGARDGDKRGV--RNESPDDSETQGWGPNKAAKLEAARTSIEQSAEAT  346

Query  1172  MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAE  993
             MRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAE
Sbjct  347   MRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAE  406

Query  992   DRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCS  813
             DR ILITTYEG HNHPLPPAAMAMASTT+AA +MLLSG+M SADG+MN N LARAILPCS
Sbjct  407   DRGILITTYEGNHNHPLPPAAMAMASTTAAAVSMLLSGSMSSADGIMNPNLLARAILPCS  466

Query  812   SSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYP--QLPQVFG  639
             SSVATISASAPFPTVTLDLT +PN L   QRP  QFQ PF G PQ   + P   LP  FG
Sbjct  467   SSVATISASAPFPTVTLDLTHSPNPL-QIQRPQPQFQVPFPGQPQNFGSLPSQSLPPAFG  525

Query  638   QGLYNQSKFSGLHVSHQDIaaaaaqaaqlaq-----------qqqhpapppqhpLFADTL  492
             Q LYNQSKFSGL +S QD+A  +    Q+A            QQQ      Q    ADTL
Sbjct  526   QALYNQSKFSGLQLS-QDLANPSQLGQQVASLPQHLQQAQQQQQQQQQQQQQSASLADTL  584

Query  491   SAATAAITSDPNFTAALAAAISSIMGG  411
             SAATAAIT+DPNFTAALAAAISSI+GG
Sbjct  585   SAATAAITADPNFTAALAAAISSIIGG  611



>ref|XP_010686806.1| PREDICTED: probable WRKY transcription factor 31 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=654

 Score =   371 bits (952),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 299/544 (55%), Positives = 345/544 (63%), Gaps = 89/544 (16%)
 Frame = -1

Query  1844  EVDFFSDKKADIV----------------------VKKEITLHGE--------PVTKADL  1755
             EVDFFSD K + +                      VK+E +            P    D+
Sbjct  94    EVDFFSDHKNNNISVNRSSSSSASHHQQQQQQQHRVKEETSSRDHHHAAAVPVPDPNLDV  153

Query  1754  NTGLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVS  1575
             NTGL L+  N+GSD+STVDD  SSD E++R KN+L VLQ EL++MN ENQ+L+ MLSQVS
Sbjct  154   NTGLHLLTTNTGSDQSTVDDGASSDAEDKRNKNELIVLQAELQRMNTENQKLKSMLSQVS  213

Query  1574  TNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgg  1395
              NY ALQ HL  LMQ Q        +TQ  E        +   +E+  VPRQFL+LVPG 
Sbjct  214   NNYNALQMHLVTLMQQQQNHRKGESNTQLHE-----ETMQGKVEEKEIVPRQFLDLVPGA  268

Query  1394  gaaaaAQTDEASQSHTTSEERTLS-AGSPRN--------NNTEL---SRHKGIIAREDSP  1251
                   + DE +    + +ERT+  + SPRN        NN EL   +   G   R++SP
Sbjct  269   NT----EGDELTSQTLSDDERTVDRSSSPRNAMEVASRNNNKELMLANYDNGKRIRDESP  324

Query  1250  D---SESWApnklpk------lnpskPVDQAA-EATMRKARVSVRARSEAPMISDGCQWR  1101
             +   ++ W  NK+PK         S PVD AA EATMRKARVSVRARSEAPMISDGCQWR
Sbjct  325   EDSATQGWVHNKVPKLMNNIPKATSPPVDHAAAEATMRKARVSVRARSEAPMISDGCQWR  384

Query  1100  KYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamam  921
             KYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAM
Sbjct  385   KYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAM  444

Query  920   asttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPN  741
             ASTTSAAA+MLLSG+MPS DG+MN NFLAR ILPCSSS+ATISASAPFPTVTLDLT +PN
Sbjct  445   ASTTSAAASMLLSGSMPSGDGLMNPNFLARTILPCSSSMATISASAPFPTVTLDLTHSPN  504

Query  740   SLPNYQRPP-----TQFQAPFTG-APQIPQNY-PQLPQVFGQGLYN-------QSKFSGL  603
              L   QRP      T FQ PF     Q+  N+   +PQ+FGQ L N       QSKFSGL
Sbjct  505   PL---QRPSGPQANTPFQVPFPPPTAQVGPNFLSSIPQIFGQALLNNNNNNSNQSKFSGL  561

Query  602   HVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISS  423
               S                   H   P Q+  F+DTLSAATAAI SDPNFTAALAAAISS
Sbjct  562   QTS-----------TPQGLNAAHLQLPNQNAAFSDTLSAATAAIASDPNFTAALAAAISS  610

Query  422   IMGG  411
             I+GG
Sbjct  611   IIGG  614



>ref|XP_011024799.1| PREDICTED: probable WRKY transcription factor 31 isoform X2 [Populus 
euphratica]
Length=594

 Score =   369 bits (946),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 323/595 (54%), Positives = 386/595 (65%), Gaps = 79/595 (13%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNK-------PVFGFNLSPRLNPINgggsgggaG----MVP  1881
             MDKGWGLTL + D  + F ++        PV  F L  + + I+               P
Sbjct  1     MDKGWGLTLAS-DPVSVFSSSNSSNNNNSPVGSF-LKIKRDFISDHNMDHSRNNNMFQFP  58

Query  1880  IN-PAAEKRGPP---NEVDFFSDK----------KADIVVKKEITLHG----EPVTKADL  1755
              +  A +   PP   +EVDFF +K             ++VKKE ++         T  D+
Sbjct  59    GSLSAGQDEQPPSAAHEVDFFKEKINKVGDDDSETTSVIVKKENSIAELAPRSTRTAPDV  118

Query  1754  NTGLQLVIANsgsdkstvddsvssDMEERRAKND--LSVLQVELEKMNAENQRLRGMLSQ  1581
             NTGL L+ ANS SD+STVDD VSSD++++R+KN+  L+ LQ+EL+KMN ENQRL+ ML  
Sbjct  119   NTGLHLLTANSRSDQSTVDDGVSSDVDDKRSKNNENLAQLQMELQKMNTENQRLKDMLGH  178

Query  1580  VSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVP  1401
             V+T+Y+ALQ H + LMQ   QQ+   G   ++E   + SEEKK E     VPRQF++L P
Sbjct  179   VTTSYSALQMHFAALMQQHQQQNH--GKESNKEEQGKPSEEKKHEDV--VVPRQFMDLGP  234

Query  1400  gggaaaaAQTDEASQSHTTSEERTLSAGSPRN--------NNTELS--------RHKGII  1269
                     +TDE S S  +S+ERT S G+P+N        NN +L         R    I
Sbjct  235   SA------ETDELSNS--SSDERTRS-GTPQNHIEVASAKNNGKLPYDQENSSFRDGKRI  285

Query  1268  AREDSPDSESWA---pnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRK  1098
              RE+SP+SES A       P    +K ++Q+ EATMRKARVSVRARSEAPMI+DGCQWRK
Sbjct  286   GREESPESESQAWKVQKTDPASPANKAIEQSTEATMRKARVSVRARSEAPMITDGCQWRK  345

Query  1097  YGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamama  918
             YGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMA
Sbjct  346   YGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMA  405

Query  917   sttsaaanmllSGAMPSADGMMNTNFLARAILPC-SSSVATISASAPFPTVTLDLTQTPN  741
             STT+AAA+MLLSG+M SADG+MN N LARAILP  SS++ATISASAPFPTVTLDLT  PN
Sbjct  406   STTAAAASMLLSGSMSSADGIMNPNLLARAILPAGSSNMATISASAPFPTVTLDLTHNPN  465

Query  740   SLPNYQRPPTQFQAPFTGAPQIPQNY-----PQLPQVFGQGLYNQSKFSGLHVSHQDIaa  576
              L  +QRPP QFQ PF G    PQN+     PQLPQVFGQ LYNQSKFSGL +S Q+I  
Sbjct  466   PL-QFQRPPPQFQVPFPGQ---PQNFSSVTAPQLPQVFGQALYNQSKFSGLQLS-QEIGT  520

Query  575   aaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                              P       DTLSAATAAIT+DPNFTAALAAAISSI+GG
Sbjct  521   PQLGQQAQPHLLHSGQQPSLSQ---DTLSAATAAITADPNFTAALAAAISSIIGG  572



>ref|XP_006350473.1| PREDICTED: WRKY transcription factor 6-like [Solanum tuberosum]
Length=496

 Score =   364 bits (935),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 304/539 (56%), Positives = 355/539 (66%), Gaps = 74/539 (14%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVPINPAAEKRGPP  1848
             MDKGWGLTLEN          KP FGFN            +     +V  +   +K+   
Sbjct  1     MDKGWGLTLEN----------KPFFGFN---------HMMNRREEQLVADH---DKK---  35

Query  1847  NEVDFFSDKKADIV----VKKEITLHGEPVTKAD--LNTGLQLVIANsgsdkstvddsvs  1686
              EVDFFS      +    +KKE +      T ++  +NTGLQLV A+  S       S  
Sbjct  36    -EVDFFSHHNRKPIHHDFIKKEDSNTTTITTPSEFIVNTGLQLVTASDQSTVDDGISSEI  94

Query  1685  sDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSR  1506
               +EE RAKN+L+ LQVEL +MNAENQRLRGML+QV+ NYTALQ HL+ LMQ   QQ  +
Sbjct  95    I-LEEERAKNELAQLQVELRRMNAENQRLRGMLTQVTNNYTALQMHLATLMQ--QQQQQQ  151

Query  1505  IGSTQDR--EVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEER  1332
             I +TQ+   ++ + K        +E  VP +FLEL         +  D +  SH++SEER
Sbjct  152   ISTTQNTHDQIVEAK------FDQEKIVPGRFLEL-------GRSDNDLSHNSHSSSEER  198

Query  1331  TLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRKARVS  1152
             T+S  SPRN+ T+++RH     RE+SP+SESW PNK+PKLN S P D    ATMRKARVS
Sbjct  199   TVSK-SPRND-TQVTRHNKA-GREESPESESWVPNKVPKLNSSMPTD----ATMRKARVS  251

Query  1151  VRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILIT  972
             VRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTIL T
Sbjct  252   VRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILNT  311

Query  971   TYEGThnhplppaamamasttsaaanmllSGAMPSADG-MMNTNFLARAILPCSSSVATI  795
             TYEGTHNHPLPPAAMAMASTTSAAANMLLSG+M SADG +MN NFLAR +LPCSSS+ATI
Sbjct  312   TYEGTHNHPLPPAAMAMASTTSAAANMLLSGSMSSADGTLMNPNFLARTMLPCSSSMATI  371

Query  794   SASAPFPTVTLDLTQTPNSLPNYQ--RPPTQFQAPFTGAPQIPQ--NYPQLPQVFGQGLY  627
             SASAPFPT+TLDLTQ  NSL   Q   P +QFQ PF  +PQ P        P    Q L+
Sbjct  372   SASAPFPTITLDLTQNQNSLTYNQTSTPISQFQIPFQSSPQHPNFITSMPPPPPMPQVLH  431

Query  626   NQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFT  450
             NQSKFSGL +S QDI            Q Q       H  F+DTL+AATAAIT+DPNFT
Sbjct  432   NQSKFSGLQIS-QDI-----------HQPQQLQHVQNHRSFSDTLTAATAAITADPNFT  478



>ref|XP_004144595.1| PREDICTED: probable WRKY transcription factor 42-like [Cucumis 
sativus]
Length=469

 Score =   363 bits (932),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 266/489 (54%), Positives = 320/489 (65%), Gaps = 56/489 (11%)
 Frame = -1

Query  1841  VDFF-SDKKADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvssDMEERR  1665
             ++FF SD K+ ++      L    +   ++NTGL L+  NS SD+S VDD VS + EE+R
Sbjct  1     MNFFPSDDKSRVLSASHSNLTPTKL-PFNVNTGLNLLTTNSCSDQSMVDDGVSPNPEEKR  59

Query  1664  AKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDR  1485
              KN+ +VLQ ELE++N+EN RL+ ML+QV++NY  LQ   + L+Q Q  +          
Sbjct  60    VKNERAVLQAELERINSENLRLKDMLNQVTSNYQTLQMQFNTLIQTQKTE----------  109

Query  1484  EVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTT--SEERTLSAGSP  1311
             +V D   E          VPRQF++L    G A   + DEAS S +   S ER+ S G  
Sbjct  110   DVGDPIEENPDGSGGGGMVPRQFMDL----GLATNTENDEASMSSSEGRSGERSRSPG--  163

Query  1310  RNNNTELSRHKGIIAREDSPD-SESWApnklp--------klnpskPVDQAAEATMRKAR  1158
               N  E++  K       SPD S +W  N             +  K VDQ  EATMRKAR
Sbjct  164   --NTGEVASSK-----RQSPDQSSNWGSNNNNNNNKVPKFSSSSGKEVDQT-EATMRKAR  215

Query  1157  VSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTIL  978
             VSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA+GCPVRKQVQRCAED+TIL
Sbjct  216   VSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMALGCPVRKQVQRCAEDKTIL  275

Query  977   ITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVAT  798
             ITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+M SADG+MN+NFLAR +LPCSSS+AT
Sbjct  276   ITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMSSADGLMNSNFLARTLLPCSSSMAT  335

Query  797   ISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQS  618
             ISASAPFPTVTLDLTQTPN  P +QRP T        A   PQ +   PQ+FG  LYNQS
Sbjct  336   ISASAPFPTVTLDLTQTPN--PLFQRPATGHFPIPFAAAAPPQTF---PQIFGHALYNQS  390

Query  617   KFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALA  438
             KFSGL +S +D+             +    PPP    F DTLSAA AAI SDPNF AALA
Sbjct  391   KFSGLQMS-KDM-------------EAPQPPPPPQNPFTDTLSAAGAAIASDPNFIAALA  436

Query  437   AAISSIMGG  411
              A++S++GG
Sbjct  437   TAMTSLIGG  445



>ref|XP_011100410.1| PREDICTED: WRKY transcription factor 6-like [Sesamum indicum]
Length=590

 Score =   364 bits (935),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 268/498 (54%), Positives = 319/498 (64%), Gaps = 59/498 (12%)
 Frame = -1

Query  1847  NEVDFFSDKK------ADIVVKKEITLHG---EPVTKADLNTGLQLVI-ANsgsdkstvd  1698
             +E+DFFSDKK       D       T H      V    +NTGL L+  AN+GSD+S +D
Sbjct  100   DEMDFFSDKKQGGGGGGDDAGDANATAHLTGLNSVLDFKVNTGLHLLTTANTGSDESILD  159

Query  1697  dsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQ  1518
             D +SS+ E++R+K +++ LQ E+E+MN ENQRLR ML+QV+ NY  LQ HL  LMQ+   
Sbjct  160   DRISSNSEDKRSKTEMAFLQAEMERMNTENQRLREMLNQVTNNYNGLQMHLLTLMQNG--  217

Query  1517  QSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSE  1338
                  GS ++ +      +          VPRQF++L    G  AAA  DE S S T+SE
Sbjct  218   -----GSAEEGKSGQGNGQ---------VVPRQFMDL----GLGAAADDDEVSLS-TSSE  258

Query  1337  ERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRKAR  1158
              RT     P       +  K +   +    SE+               DQA EATMRKAR
Sbjct  259   GRTGRQQPP-------TPDKDVGGGDQDQCSENKVARLGHSSRN---ADQATEATMRKAR  308

Query  1157  VSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTIL  978
             VSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCA DR+IL
Sbjct  309   VSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQRCAGDRSIL  368

Query  977   ITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVAT  798
             ITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+MPSADG+MN+NFLAR +LPCSSS+AT
Sbjct  369   ITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMPSADGLMNSNFLARTLLPCSSSMAT  428

Query  797   ISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAP---QIPQNYP--QLPQVFGQG  633
             ISASAPFPTVTLDLTQ+PN L  + RP  QF  PF   P     P N     LPQ+FGQG
Sbjct  429   ISASAPFPTVTLDLTQSPNPL-QFPRPSGQFPLPFLNNPPNIGTPANPAPGLLPQLFGQG  487

Query  632   LYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNF  453
             LYNQSKFSGL +S +          Q + Q     P       +DT++    A+ +DPNF
Sbjct  488   LYNQSKFSGLQMSQE--------MDQGSNQLSTTLPSVHQGQLSDTVN----ALATDPNF  535

Query  452   TAALAAAISSIMGGGSQP  399
             TAALAAAISS +GGG  P
Sbjct  536   TAALAAAISSFIGGGQYP  553



>ref|XP_010057907.1| PREDICTED: probable WRKY transcription factor 31 isoform X1 [Eucalyptus 
grandis]
Length=656

 Score =   366 bits (940),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 329/628 (52%), Positives = 386/628 (61%), Gaps = 105/628 (17%)
 Frame = -1

Query  2027  MDK-GWGLTLENPDRRAG--FFTNKPVFGFNL--SPRLNPINgggsgggaGMVP------  1881
             MDK GWGLTL++        FF  KP     L   P  +P +   +   A M P      
Sbjct  1     MDKAGWGLTLDSSSSSHSDSFFPKKPSGFLKLKRDPPGDPPSAAAAAAAARMFPGIDFSA  60

Query  1880  ----------------INPAA-EKRGPPNEVDFFSDKK-----------------ADIVV  1803
                              +PAA E R    EVDFFSD K                 A + V
Sbjct  61    SLGRRDDHRHASILNSSSPAADEGRVVVGEVDFFSDCKSRSSLPAAAAGGEEGRAATVSV  120

Query  1802  KKEITLHGEPV-TKADLNTGLQLVIANsgsdkstvddsvssDMEERRAKND-LSVLQVEL  1629
             K+E  +   P  ++ ++NTGL+L+ AN+GSD+STVDD  SSD+EE+RAKN+ L+ L  EL
Sbjct  121   KRESPVASGPARSELNVNTGLRLLTANTGSDQSTVDDGFSSDIEEKRAKNEQLAHLNAEL  180

Query  1628  EKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGS-------TQDREVADR  1470
             ++MN+ENQRL+ MLSQV++NY ALQ HLS+L+Q Q Q   +           QD E A +
Sbjct  181   QRMNSENQRLKEMLSQVTSNYNALQLHLSSLLQQQQQHHIQHQHQSNGAEPAQDHENAMK  240

Query  1469  KSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLS-----------  1323
             K++          VPRQFL+L P   AAA  +TDE S S  +SEERT             
Sbjct  241   KNQT--------VVPRQFLDLGPMSAAAA--ETDEISNS--SSEERTRDGSRSPLAKMEV  288

Query  1322  AGSPRNNNTELSR-------HKGIIAREDSPD---SESWA-pnklpklnpskPVDQAAEA  1176
             A S  NN  E           +G+  R +SPD   ++ W              ++Q+AEA
Sbjct  289   ASSAHNNKAEQDSSGARDGDKRGV--RNESPDDSETQGWGPNKAAKLEAARTSIEQSAEA  346

Query  1175  TMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA  996
             TMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA
Sbjct  347   TMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA  406

Query  995   EDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPC  816
             EDR ILITTYEG HNHPLPPAAMAMASTT+AA +MLLSG+M SADG+MN N LARAILPC
Sbjct  407   EDRGILITTYEGNHNHPLPPAAMAMASTTAAAVSMLLSGSMSSADGIMNPNLLARAILPC  466

Query  815   SSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYP--QLPQVF  642
             SSSVATISASAPFPTVTLDLT +PN L   QRP  QFQ PF G PQ   + P   LP  F
Sbjct  467   SSSVATISASAPFPTVTLDLTHSPNPL-QIQRPQPQFQVPFPGQPQNFGSLPSQSLPPAF  525

Query  641   GQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaq-----------qqqhpapppqhpLFADT  495
             GQ LYNQSKFSGL +S QD+A  +    Q+A            QQQ      Q    ADT
Sbjct  526   GQALYNQSKFSGLQLS-QDLANPSQLGQQVASLPQHLQQAQQQQQQQQQQQQQSASLADT  584

Query  494   LSAATAAITSDPNFTAALAAAISSIMGG  411
             LSAATAAIT+DPNFTAALAAAISSI+GG
Sbjct  585   LSAATAAITADPNFTAALAAAISSIIGG  612



>gb|KCW75259.1| hypothetical protein EUGRSUZ_E04011 [Eucalyptus grandis]
Length=605

 Score =   364 bits (935),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 310/551 (56%), Positives = 362/551 (66%), Gaps = 78/551 (14%)
 Frame = -1

Query  1877  NPAA-EKRGPPNEVDFFSDKK-----------------ADIVVKKEITLHGEPV-TKADL  1755
             +PAA E R    EVDFFSD K                 A + VK+E  +   P  ++ ++
Sbjct  27    SPAADEGRVVVGEVDFFSDCKSRSSLPAAAAGGEEGRAATVSVKRESPVASGPARSELNV  86

Query  1754  NTGLQLVIANsgsdkstvddsvssDMEERRAKND-LSVLQVELEKMNAENQRLRGMLSQV  1578
             NTGL+L+ AN+GSD+STVDD  SSD+EE+RAKN+ L+ L  EL++MN+ENQRL+ MLSQV
Sbjct  87    NTGLRLLTANTGSDQSTVDDGFSSDIEEKRAKNEQLAHLNAELQRMNSENQRLKEMLSQV  146

Query  1577  STNYTALQQHLSNLMQHQNQQSSRIGS-------TQDREVADRKSeekkpekeePTVPRQ  1419
             ++NY ALQ HLS+L+Q Q Q   +           QD E A +K++          VPRQ
Sbjct  147   TSNYNALQLHLSSLLQQQQQHHIQHQHQSNGAEPAQDHENAMKKNQT--------VVPRQ  198

Query  1418  FLELVPgggaaaaAQTDEASQSHTTSEERTLS-----------AGSPRNNNTELSR----  1284
             FL+L P   AAA  +TDE S S  +SEERT             A S  NN  E       
Sbjct  199   FLDLGPMSAAAA--ETDEISNS--SSEERTRDGSRSPLAKMEVASSAHNNKAEQDSSGAR  254

Query  1283  ---HKGIIAREDSPD---SESWA-pnklpklnpskPVDQAAEATMRKARVSVRARSEAPM  1125
                 +G+  R +SPD   ++ W              ++Q+AEATMRKARVSVRARSEAPM
Sbjct  255   DGDKRGV--RNESPDDSETQGWGPNKAAKLEAARTSIEQSAEATMRKARVSVRARSEAPM  312

Query  1124  ISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhp  945
             I+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDR ILITTYEG HNHP
Sbjct  313   ITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRGILITTYEGNHNHP  372

Query  944   lppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVT  765
             LPPAAMAMASTT+AA +MLLSG+M SADG+MN N LARAILPCSSSVATISASAPFPTVT
Sbjct  373   LPPAAMAMASTTAAAVSMLLSGSMSSADGIMNPNLLARAILPCSSSVATISASAPFPTVT  432

Query  764   LDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYP--QLPQVFGQGLYNQSKFSGLHVSH  591
             LDLT +PN L   QRP  QFQ PF G PQ   + P   LP  FGQ LYNQSKFSGL +S 
Sbjct  433   LDLTHSPNPL-QIQRPQPQFQVPFPGQPQNFGSLPSQSLPPAFGQALYNQSKFSGLQLS-  490

Query  590   QDIaaaaaqaaqlaq-----------qqqhpapppqhpLFADTLSAATAAITSDPNFTAA  444
             QD+A  +    Q+A            QQQ      Q    ADTLSAATAAIT+DPNFTAA
Sbjct  491   QDLANPSQLGQQVASLPQHLQQAQQQQQQQQQQQQQSASLADTLSAATAAITADPNFTAA  550

Query  443   LAAAISSIMGG  411
             LAAAISSI+GG
Sbjct  551   LAAAISSIIGG  561



>gb|AGV75965.1| WRKY transcription factor 80 [Gossypium hirsutum]
Length=466

 Score =   358 bits (920),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 254/464 (55%), Positives = 302/464 (65%), Gaps = 56/464 (12%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKP----------------------VFGFNLSPRLNPINg  1914
             M KGWGLTL++    + FFTNK                       +F F +S   +  N 
Sbjct  1     MGKGWGLTLDSDPVTSNFFTNKSNSTTVAGGSFLGLKQHHHHHRDMFQFPVSLAGSRDND  60

Query  1913  ggsgggaGMVPINPAAEKRGPPNEVDFFSDKKADIV--VKKEITLHGEPVTKADLNTGLQ  1740
                   +     +P+ + + P +EVDFFSDKK  +V  VKKE      P +  D+NTGL 
Sbjct  61    RRGTSASS----SPSDDTKIPVDEVDFFSDKKVRVVDDVKKESI--ETPASDLDVNTGLL  114

Query  1739  LVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTA  1560
             L+ A S         S    ME++RAKN+L+ LQ EL++MNAENQ+L+ MLS VS NY+A
Sbjct  115   LLTAGSDQSTVDDGVSSD--MEDKRAKNELAQLQDELKRMNAENQKLKDMLSHVSNNYSA  172

Query  1559  LQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELV-Pgggaaa  1383
             L  HL  LMQ Q Q   R          +R+++  +  K E   P Q L+L  P    A 
Sbjct  173   LHMHLVTLMQQQQQPPQR----------NRETQAIQKSKPEEVTPLQILDLSRPSAAGAE  222

Query  1382  aAQTDEASQSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnps  1203
             AA+T     SH++SEERT S   P N           + RE+SP+SESW PN   +   S
Sbjct  223   AAET----ISHSSSEERTRSGTPPSNVEKR-------VNREESPESESWGPNCKVQNLSS  271

Query  1202  kP-VDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGC  1026
                VDQ+ EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGC
Sbjct  272   GKPVDQSTEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGC  331

Query  1025  PVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNT  846
             PVRKQVQRCA+DRTILITTYEG HNHPLPPAAMAMASTT+AAA+MLLSG+MPSADG+MN 
Sbjct  332   PVRKQVQRCADDRTILITTYEGNHNHPLPPAAMAMASTTAAAASMLLSGSMPSADGIMNP  391

Query  845   NFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPP  714
             N LARAILPCSSS+ATISASAPFPTVTLDLT +PN L  +QRPP
Sbjct  392   NLLARAILPCSSSMATISASAPFPTVTLDLTHSPNPL-QFQRPP  434



>gb|KGN43509.1| hypothetical protein Csa_7G043020 [Cucumis sativus]
Length=525

 Score =   360 bits (924),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 265/496 (53%), Positives = 323/496 (65%), Gaps = 53/496 (11%)
 Frame = -1

Query  1847  NEVDFF-SDKKADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvssDMEE  1671
             +E++FF SD K+ ++      L    +   ++NTGL L+  NS SD+S VDD VS + EE
Sbjct  42    DEMNFFPSDDKSRVLSASHSNLTPTKL-PFNVNTGLNLLTTNSCSDQSMVDDGVSPNPEE  100

Query  1670  RRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQ  1491
             +R KN+ +VLQ ELE++N+EN RL+ ML+QV++NY  LQ   + L+Q   Q++  +G   
Sbjct  101   KRVKNERAVLQAELERINSENLRLKDMLNQVTSNYQTLQMQFNTLIQ--TQKTEDVGDPI  158

Query  1490  DRE-----VADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTT--SEER  1332
             +            +           VPRQF++L    G A   + DEAS S +   S ER
Sbjct  159   EENPDGSGGGGNNNNNNNTNISNKLVPRQFMDL----GLATNTENDEASMSSSEGRSGER  214

Query  1331  TLSAGSPRNNNTELSRHKGIIAREDSPD-SESWApnklp--------klnpskPVDQAAE  1179
             + S G    N  E++  K       SPD S +W  N             +  K VDQ  E
Sbjct  215   SRSPG----NTGEVASSK-----RQSPDQSSNWGSNNNNNNNKVPKFSSSSGKEVDQT-E  264

Query  1178  ATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRC  999
             ATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA+GCPVRKQVQRC
Sbjct  265   ATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMALGCPVRKQVQRC  324

Query  998   AEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILP  819
             AED+TILITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+M SADG+MN+NFLAR +LP
Sbjct  325   AEDKTILITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMSSADGLMNSNFLARTLLP  384

Query  818   CSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFG  639
             CSSS+ATISASAPFPTVTLDLTQTPN  P +QRP T        A   PQ +   PQ+FG
Sbjct  385   CSSSMATISASAPFPTVTLDLTQTPN--PLFQRPATGHFPIPFAAAAPPQTF---PQIFG  439

Query  638   QGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDP  459
               LYNQSKFSGL +S +D+             +    PPP    F DTLSAA AAI SDP
Sbjct  440   HALYNQSKFSGLQMS-KDM-------------EAPQPPPPPQNPFTDTLSAAGAAIASDP  485

Query  458   NFTAALAAAISSIMGG  411
             NF AALA A++S++GG
Sbjct  486   NFIAALATAMTSLIGG  501



>ref|NP_001288955.1| WRKY transcription factor 6 [Brassica rapa]
 gb|AHB33818.1| WRKY transcription factor 6 [Brassica rapa]
Length=550

 Score =   361 bits (926),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 269/505 (53%), Positives = 319/505 (63%), Gaps = 73/505 (14%)
 Frame = -1

Query  1859  RGPPNEVDFFSDKK----------ADIVVKKEITLHGEPVTKADLNTGLQL-VIANsgsd  1713
             R  P EVDFFSDKK          A + VKKE     E   + D+NTGL L    N+ SD
Sbjct  84    REVPGEVDFFSDKKSRVCQDEVDDAGLRVKKE-----EQDDRTDVNTGLNLRTTVNARSD  138

Query  1712  kstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLM  1533
             +S +D+  SS+ME++RA N+L  LQ EL+KM  EN++LR +L+QVS NYT+L  HL +LM
Sbjct  139   QSVIDNGESSEMEDKRANNELVKLQDELKKMTMENEKLRELLTQVSNNYTSLHMHLVSLM  198

Query  1532  QHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQ-  1356
             Q Q QQ +             K+ E   + EE  VPRQF++L P         +DEA   
Sbjct  199   QQQQQQQN-------------KALEAAGKHEETIVPRQFIDLGPSRA------SDEAEDL  239

Query  1355  SHTTSEERTLSAGSP----RNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQ  1188
             S+++SE+RT S G      RNN     R    + RE+SP++ES    +    +     +Q
Sbjct  240   SNSSSEDRTRSGGCSAVERRNNEV---RDGKRLGREESPETES-NKVQKVNNSSPPTFEQ  295

Query  1187  AAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQV  1008
             + EATMRKARVSVRARSEA MISDGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQV
Sbjct  296   STEATMRKARVSVRARSEATMISDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQV  355

Query  1007  QRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN-TNFLAR  831
             QRCAEDR+ILITTYEG HNHPLPPAA+AMASTT AAANMLLSG+M S DGMMN TN LAR
Sbjct  356   QRCAEDRSILITTYEGNHNHPLPPAAVAMASTTMAAANMLLSGSMSSHDGMMNPTNLLAR  415

Query  830   AILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQ---NYP  660
             A+LPCS+S+ATISASAPFPTVTLDLT  P  LPN   P T        +  + Q   N P
Sbjct  416   AVLPCSTSMATISASAPFPTVTLDLTHAP-PLPNGSSPSTAAATNNHNSLMLQQQMTNLP  474

Query  659   --QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSA  486
                LP V GQ LYNQSKFSGL  S                         Q    ADT+S 
Sbjct  475   PNMLPHVIGQALYNQSKFSGLQFS------------------SGSPSAAQSHAVADTIS-  515

Query  485   ATAAITSDPNFTAALAAAISSIMGG  411
                A+T+DPNFTAALA+ ISS++ G
Sbjct  516   ---ALTADPNFTAALASVISSMING  537



>ref|XP_009421491.1| PREDICTED: probable WRKY transcription factor 31 [Musa acuminata 
subsp. malaccensis]
Length=562

 Score =   360 bits (925),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 268/492 (54%), Positives = 325/492 (66%), Gaps = 42/492 (9%)
 Frame = -1

Query  1844  EVDFFSDKKADI--VVKKEITLHG---EPVTKADLN--TGLQLVIANsgsdkstvddsvs  1686
             EVDFFS +K +   +V+ E+ L       + K DL   T L L   N+ SD+STVDD  S
Sbjct  81    EVDFFSGEKKNSRSLVETELDLKVPSLSSIKKEDLTIQTRLHLQTPNTASDRSTVDDGSS  140

Query  1685  sDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSR  1506
              + +++   N+L+ +Q E+ +M  ENQ+LR +L QV+T+Y +L  HL+ LMQ +NQ+ + 
Sbjct  141   KNEDDKEGMNELAAMQAEVARMKEENQKLRAVLGQVTTSYNSLHMHLTTLMQQRNQRETA  200

Query  1505  IGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTL  1326
                  +  V + K++ K  +     VPRQF++L P          ++ S S T S +R  
Sbjct  201   TPQAHEAMV-EEKTDAKDRDHGGVLVPRQFMDLGPAA------DDEQTSDSSTASPDR--  251

Query  1325  SAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRKARVSVR  1146
             SA  P N              E     +SW P K  KLNP+KP D A EATMRKARVSVR
Sbjct  252   SASPPGN-------------AEVGSAEQSWNPYKAQKLNPTKPADHAQEATMRKARVSVR  298

Query  1145  ARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY  966
             ARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCA+DR+ILITTY
Sbjct  299   ARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQRCADDRSILITTY  358

Query  965   EGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISAS  786
             EGTHNHPLPPAAMAMASTTSAAA+MLLSG+M S DG+MN+NFLAR ILPCSS++ATISAS
Sbjct  359   EGTHNHPLPPAAMAMASTTSAAASMLLSGSMSSTDGLMNSNFLARTILPCSSNMATISAS  418

Query  785   APFPTVTLDLTQTPNSLPNYQRPPTQ-FQAPFTGAP---QIPQNYPQLPQVFGQGLYNQS  618
             APFPTVTLDLTQ P +   YQRPP   F  P+ GA      P   P LPQVFGQ  +NQS
Sbjct  419   APFPTVTLDLTQNPTNPLQYQRPPAGPFHVPYPGAAPAFSAPSQPPSLPQVFGQTPHNQS  478

Query  617   KFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALA  438
              FSGL +S +            AQ     A P   P  A+T++AATAAIT+DPNFTAAL 
Sbjct  479   TFSGLQMSLE---------MAAAQFPHPKAQPVMPPSMAETVNAATAAITADPNFTAALT  529

Query  437   AAISSIMGGGSQ  402
             AAI SI+GG  Q
Sbjct  530   AAIKSIIGGNHQ  541



>emb|CDY12937.1| BnaA09g13370D [Brassica napus]
Length=552

 Score =   359 bits (922),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 269/509 (53%), Positives = 318/509 (62%), Gaps = 79/509 (16%)
 Frame = -1

Query  1859  RGPPNEVDFFSDKK----------ADIVVKKEITLHGEPVTKADLNTGLQL-VIANsgsd  1713
             R  P EVDFFSDKK          A + VKKE     E   + D+NTGL L    N+ SD
Sbjct  84    REVPGEVDFFSDKKSRVCQDEVDDAGLRVKKE-----EQDDRTDVNTGLNLRTTVNARSD  138

Query  1712  kstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLM  1533
             +S +D+  SS+ME++RA N+L  LQ EL+KM  EN++LR +L+QVS NYT+L  HL +LM
Sbjct  139   QSVIDNGESSEMEDKRANNELVKLQDELKKMTMENEKLRELLTQVSNNYTSLHMHLVSLM  198

Query  1532  QHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQ-  1356
             Q Q QQ +             K+ E   + EE  VPRQF++L P         +DEA   
Sbjct  199   QQQQQQQN-------------KALEAAGKHEETIVPRQFIDLGPSRA------SDEAEDL  239

Query  1355  SHTTSEERTLSAGSP----RNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQ  1188
             S+++SE+RT S G      RNN     R    + RE+SP++ES    +    +     +Q
Sbjct  240   SNSSSEDRTRSGGCSAVERRNNEV---RDGKRLGREESPETES-NKVQKVNNSSPPTFEQ  295

Query  1187  AAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQV  1008
             + EATMRKARVSVRARSEA MISDGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQV
Sbjct  296   STEATMRKARVSVRARSEATMISDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQV  355

Query  1007  QRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN-TNFLAR  831
             QRCAEDR+ILITTYEG HNHPLPPAA+AMASTT AAANMLLSG+M S DGMMN TN LAR
Sbjct  356   QRCAEDRSILITTYEGNHNHPLPPAAVAMASTTMAAANMLLSGSMSSHDGMMNPTNLLAR  415

Query  830   AILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQ---------FQAPFTGAPQ  678
             A+LPCS+S+ATISASAPFPTVTLDLT  P  LPN   P T             P      
Sbjct  416   AVLPCSTSMATISASAPFPTVTLDLTHAP-PLPNGSSPSTAAATNNHNSLMLRPQQQMTN  474

Query  677   IPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFAD  498
             +P N   LP V GQ LYNQSKFSGL  S                         Q    AD
Sbjct  475   LPPNM--LPHVIGQALYNQSKFSGLQFS------------------SGSPSAAQSHAVAD  514

Query  497   TLSAATAAITSDPNFTAALAAAISSIMGG  411
             T+S    A+T+DPNFTAALA+ ISS++ G
Sbjct  515   TIS----ALTADPNFTAALASVISSMING  539



>ref|XP_011006460.1| PREDICTED: probable WRKY transcription factor 31 [Populus euphratica]
Length=617

 Score =   361 bits (927),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 269/502 (54%), Positives = 325/502 (65%), Gaps = 45/502 (9%)
 Frame = -1

Query  1847  NEVDFFSDKKADI----VVKK---EITLHGEPV-TKADLNTGLQLVIANsgsdkstvdds  1692
             +E+DFF+DKK DI    ++     ++   G P   + ++NTGL L+  N+  ++STVDD 
Sbjct  98    DEMDFFADKKHDIDRMTIINNGTGDLKDSGSPAGLELNVNTGLNLLTTNTSGEQSTVDDG  157

Query  1691  vssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQS  1512
             +SS+ME++RAK++L+VL+ E+E+M  EN RL+ ML+ V++NY ALQ  L  LMQ QN   
Sbjct  158   LSSNMEDKRAKSELAVLRAEVERMKVENLRLKDMLTHVTSNYNALQMDLVALMQDQN---  214

Query  1511  SRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEER  1332
                 S    E  D K+++         VPRQF++L     A     TD+ S S  TSE R
Sbjct  215   ----SHHKNEQHDGKNKDNG------IVPRQFMDL-GLVAATGDGDTDDLSLS--TSEGR  261

Query  1331  TLSAGSPRNNNTELSRHKGII---------AREDSPDSESWApnklpklnpskPVDQAAE  1179
                      NN E +   G +          RE+SPD + W  NK  + N  K VDQ  E
Sbjct  262   RRDRSRSSGNNAENNNEDGTVFEQDKKGTDQREESPD-QVWGSNKDARFNSKKTVDQT-E  319

Query  1178  ATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRC  999
             AT+RKARVSVRARSE   ISDGCQWRKYGQK+AKGNPCPRAYYRCTMA GCPVRKQVQRC
Sbjct  320   ATIRKARVSVRARSEDATISDGCQWRKYGQKIAKGNPCPRAYYRCTMAAGCPVRKQVQRC  379

Query  998   AEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILP  819
             AEDRTIL TTYEG H+HPLPPAA AMASTTS+AA MLLSG+M S DG MN+NFL R ILP
Sbjct  380   AEDRTILTTTYEGNHSHPLPPAATAMASTTSSAARMLLSGSMSSTDGQMNSNFLTRTILP  439

Query  818   CSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQ---IPQNYPQLPQ  648
             CSSS+ATISASAPFPTVTLDLTQ P+ L    + P QFQ PF   PQ          LPQ
Sbjct  440   CSSSLATISASAPFPTVTLDLTQNPSPL-QLLKQPIQFQVPFPNPPQNLANASAAALLPQ  498

Query  647   VFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAIT  468
             + GQ LYNQSK SGL +S QD+     Q  +L  Q Q      Q    AD  + ATAAI 
Sbjct  499   ILGQALYNQSKSSGLQMS-QDM-----QPNRLGHQSQPALQQGQQNSLADNFTTATAAIA  552

Query  467   SDPNFTAALAAAISSIMGGGSQ  402
             +DPNFTAALAAAI+SI+GG  Q
Sbjct  553   ADPNFTAALAAAITSIIGGAHQ  574



>ref|XP_002886480.1| WRKY DNA-binding protein 6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62739.1| WRKY DNA-binding protein 6 [Arabidopsis lyrata subsp. lyrata]
Length=553

 Score =   357 bits (917),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 265/505 (52%), Positives = 321/505 (64%), Gaps = 70/505 (14%)
 Frame = -1

Query  1859  RGPPNEVDFFSDKKADIV--------VKKEITLHGEPVTKADLNTGLQL-VIANsgsdks  1707
             R  P EVDFFSDKK+ +         VKKE     E   + D+NTGL L    N+ SD+S
Sbjct  84    REVPGEVDFFSDKKSRVCREDEDGFRVKKE-----EQDDRTDVNTGLNLRTTGNTKSDES  138

Query  1706  tvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQH  1527
              +DD  SS+ME++RAKN+L  LQ EL+KM  +NQ+LR +L+QVS +YT+LQ HL +LMQ 
Sbjct  139   MIDDGESSEMEDKRAKNELVKLQDELKKMTMDNQKLRELLTQVSNSYTSLQMHLVSLMQQ  198

Query  1526  QNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHT  1347
             Q QQ++++      E A++  E          VPRQF++L P      A        S++
Sbjct  199   QQQQNNKV-----IEAAEKPEET--------IVPRQFIDLGPTRAVGEAEDV-----SNS  240

Query  1346  TSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMR  1167
             +SE+RT S GS   +  E   +   + RE+SP++ES    +          DQ+AEATMR
Sbjct  241   SSEDRTRSGGS---SAAERRSNGKRLGREESPETES-NKIQKVNSTTPTTFDQSAEATMR  296

Query  1166  KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDR  987
             KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR
Sbjct  297   KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQRCAEDR  356

Query  986   TILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN-TNFLARAILPCSS  810
             +ILITTYEG HNHPLPPAA+AMASTT+AAANMLLSG+M S DGMMN TN LARA+LPCS+
Sbjct  357   SILITTYEGNHNHPLPPAAVAMASTTTAAANMLLSGSMSSHDGMMNPTNLLARAVLPCST  416

Query  809   SVATISASAPFPTVTLDLTQTPN------------SLPNYQRPPTQFQAPFTGAPQIPQN  666
             S+ATISASAPFPTVTLDLT +P             +  N     +  Q P      +P  
Sbjct  417   SMATISASAPFPTVTLDLTHSPPPPNGSNPSSSAAATSNNNNQNSLMQRPQQQMTNLPPG  476

Query  665   YPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSA  486
                LP V GQ LYNQSKFSGL  S                     A   Q    ADT++ 
Sbjct  477   M--LPHVIGQALYNQSKFSGLQFS---------------GGSPSTAAFSQSHAVADTIT-  518

Query  485   ATAAITSDPNFTAALAAAISSIMGG  411
                A+T+DPNFTAALAA ISS++ G
Sbjct  519   ---ALTADPNFTAALAAVISSMING  540



>gb|ACI14403.1| WRKY6-1 transcription factor [Brassica napus]
Length=553

 Score =   357 bits (916),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 269/506 (53%), Positives = 318/506 (63%), Gaps = 73/506 (14%)
 Frame = -1

Query  1859  RGPPNEVDFFSDKK----------ADIVVKKEITLHGEPVTKADLNTGLQL-VIANsgsd  1713
             R  P EVDFFSDKK          A + VKKE     E   + D+NTGL L    N+ SD
Sbjct  85    REVPGEVDFFSDKKSRVSRDEVDDAGLRVKKE-----EQDDRTDINTGLNLRTTVNARSD  139

Query  1712  kstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLM  1533
             +S +D+  SS+ME++RA N+L  LQ EL+KM  EN++LR +L+QVS NYT+L  HL +LM
Sbjct  140   QSVIDNGESSEMEDKRANNELVKLQDELKKMTMENEKLRELLTQVSNNYTSLHMHLVSLM  199

Query  1532  QHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQS  1353
             Q Q QQ +             K+ E   + EE  VPRQF++L P   A  A        S
Sbjct  200   QQQQQQQN-------------KALEAAGKHEETIVPRQFIDLGPSRAAGEAEDL-----S  241

Query  1352  HTTSEERTLSAGSP----RNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQA  1185
             +++SE+RT S G      RNN     R    + RE+SP++ES    +    +     +Q+
Sbjct  242   NSSSEDRTRSGGCSAVERRNNEV---RDGKRLGREESPETES-NKVQKVNNSSLPTFEQS  297

Query  1184  AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQ  1005
              EATMRKARVSVRARSEA MISDGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQ
Sbjct  298   TEATMRKARVSVRARSEASMISDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQ  357

Query  1004  RCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN-TNFLARA  828
             RCAEDR+ILITTYEG HNHPLPPAA+AMASTT AAANMLLSG+M S DGMMN TN LARA
Sbjct  358   RCAEDRSILITTYEGNHNHPLPPAAVAMASTTMAAANMLLSGSMSSQDGMMNPTNLLARA  417

Query  827   ILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQI-PQ----NY  663
             +LPCS+S+ATISASAPFPTVTLDLT  P  LPN   P T        +  + PQ    N 
Sbjct  418   VLPCSTSMATISASAPFPTVTLDLTHAP-PLPNGSSPSTAAATNNHNSLMLRPQQQMTNL  476

Query  662   P--QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLS  489
             P   LP V GQ LYNQSKFSGL  S                         Q    ADT+S
Sbjct  477   PPNMLPHVIGQALYNQSKFSGLQFS------------------SGSPSAAQSHAVADTIS  518

Query  488   AATAAITSDPNFTAALAAAISSIMGG  411
                 A+T+DPNFTAALA+ ISS++ G
Sbjct  519   ----ALTADPNFTAALASVISSMING  540



>ref|NP_564792.1| WRKY transcription factor 6 [Arabidopsis thaliana]
 sp|Q9C519.1|WRKY6_ARATH RecName: Full=WRKY transcription factor 6; AltName: Full=WRKY 
DNA-binding protein 6; Short=AtWRKY6 [Arabidopsis thaliana]
 gb|AAK01127.1|AF331712_1 transcription factor WRKY6 [Arabidopsis thaliana]
 gb|AAK01128.1|AF331713_1 transcription factor WRKY6 [Arabidopsis thaliana]
 dbj|BAH30352.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33948.1| WRKY transcription factor 6 [Arabidopsis thaliana]
Length=553

 Score =   357 bits (916),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 267/508 (53%), Positives = 321/508 (63%), Gaps = 76/508 (15%)
 Frame = -1

Query  1859  RGPPNEVDFFSDKKADIV--------VKKEITLHGEPVTKADLNTGLQL-VIANsgsdks  1707
             R  P EVDFFSDKK+ +         VKKE     E   + D+NTGL L    N+ SD+S
Sbjct  84    REVPGEVDFFSDKKSRVCREDDEGFRVKKE-----EQDDRTDVNTGLNLRTTGNTKSDES  138

Query  1706  tvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQH  1527
              +DD  SS+ME++RAKN+L  LQ EL+KM  +NQ+LR +L+QVS +YT+LQ HL +LMQ 
Sbjct  139   MIDDGESSEMEDKRAKNELVKLQDELKKMTMDNQKLRELLTQVSNSYTSLQMHLVSLMQQ  198

Query  1526  QNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHT  1347
             Q QQ++++      E A++  E          VPRQF++L P      A        S++
Sbjct  199   QQQQNNKV-----IEAAEKPEET--------IVPRQFIDLGPTRAVGEAEDV-----SNS  240

Query  1346  TSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMR  1167
             +SE+RT S GS   +  E   +   + RE+SP++ES    +          DQ AEATMR
Sbjct  241   SSEDRTRSGGS---SAAERRSNGKRLGREESPETES-NKIQKVNSTTPTTFDQTAEATMR  296

Query  1166  KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDR  987
             KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR
Sbjct  297   KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQRCAEDR  356

Query  986   TILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN-TNFLARAILPCSS  810
             +ILITTYEG HNHPLPPAA+AMASTT+AAANMLLSG+M S DGMMN TN LARA+LPCS+
Sbjct  357   SILITTYEGNHNHPLPPAAVAMASTTTAAANMLLSGSMSSHDGMMNPTNLLARAVLPCST  416

Query  809   SVATISASAPFPTVTLDLTQ---------------TPNSLPNYQRPPTQFQAPFTGAPQI  675
             S+ATISASAPFPTVTLDLT                T N+  +  + P Q Q   T  P  
Sbjct  417   SMATISASAPFPTVTLDLTHSPPPPNGSNPSSSAATNNNHNSLMQRPQQQQQQMTNLPP-  475

Query  674   PQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADT  495
                   LP V GQ LYNQSKFSGL  S                     A   Q    ADT
Sbjct  476   ----GMLPHVIGQALYNQSKFSGLQFS---------------GGSPSTAAFSQSHAVADT  516

Query  494   LSAATAAITSDPNFTAALAAAISSIMGG  411
             ++    A+T+DPNFTAALAA ISS++ G
Sbjct  517   IT----ALTADPNFTAALAAVISSMING  540



>ref|XP_006302067.1| hypothetical protein CARUB_v10020051mg [Capsella rubella]
 gb|EOA34965.1| hypothetical protein CARUB_v10020051mg [Capsella rubella]
Length=574

 Score =   357 bits (917),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 271/517 (52%), Positives = 322/517 (62%), Gaps = 83/517 (16%)
 Frame = -1

Query  1859  RGPPNEVDFFSDKKADIV--------VKKEITLHGEPVTKADLNTGLQL-VIANsgsdks  1707
             R  P EVDFFSDKK+ +         VKKE     E   + D+NTGL L    N+ SD+S
Sbjct  96    REVPGEVDFFSDKKSRVCREDDGGFRVKKE-----EQDDRTDVNTGLNLRTTGNTKSDES  150

Query  1706  tvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQH  1527
              +DD  SS+ME++RAK +L  LQ EL++M  +NQ+LR +L+QVS +YT+LQ HL +LMQ 
Sbjct  151   MIDDGESSEMEDKRAKIELVKLQDELKRMTMDNQKLRELLTQVSNSYTSLQMHLVSLMQQ  210

Query  1526  QNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHT  1347
             Q +Q            ++ K  E   + EE  VPRQF++L P   A      D    S++
Sbjct  211   QQEQQQ----------SNNKVIEAAEKPEETIVPRQFIDLGPMRAAG-----DAGEVSNS  255

Query  1346  TSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMR  1167
             +S+E+T S GS   N     R +  +ARE++P++ES    K+   N S     AAEATMR
Sbjct  256   SSDEKTRSGGSSPANEV---RDRKRLAREETPETESNKVQKVNITNQSTFDQSAAEATMR  312

Query  1166  KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDR  987
             KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR
Sbjct  313   KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQRCAEDR  372

Query  986   TILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN-TNFLARAILPCSS  810
             +ILITTYEG HNHPLPPAA+AMASTT+AAANMLLSG+M S DGMMN TN LARA+LPCS+
Sbjct  373   SILITTYEGNHNHPLPPAAVAMASTTTAAANMLLSGSMSSHDGMMNPTNLLARAVLPCST  432

Query  809   SVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQ---------  657
             S+ATISASAPFPTVTLDLT    S P    PPT    P T A     N  Q         
Sbjct  433   SMATISASAPFPTVTLDLTH---SSP----PPTNGSNPSTSAAATIDNNTQNNSLMQRPQ  485

Query  656   ---------------LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapp  522
                            LP V GQ LYNQSKFSGL  S                     A  
Sbjct  486   QQQQQQQMGNLPPGMLPHVIGQALYNQSKFSGLQFS---------------GGSPSTAAY  530

Query  521   pqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
              Q    ADT++    A+T+DPNFTAALAA ISS++ G
Sbjct  531   SQSHAVADTIT----ALTADPNFTAALAAVISSMING  563



>emb|CDY19535.1| BnaC09g13680D [Brassica napus]
Length=552

 Score =   356 bits (914),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 269/506 (53%), Positives = 318/506 (63%), Gaps = 73/506 (14%)
 Frame = -1

Query  1859  RGPPNEVDFFSDKK----------ADIVVKKEITLHGEPVTKADLNTGLQL-VIANsgsd  1713
             R  P EVDFFSDKK          A + VKKE     E   + D+NTGL L    N+ SD
Sbjct  84    REVPGEVDFFSDKKSRVSRDDVDDAGLRVKKE-----EQDDRTDINTGLNLRTTVNARSD  138

Query  1712  kstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLM  1533
             +S +D+  SS+ME++RA N+L  LQ EL+KM  EN++LR +L+QVS NYT+L  HL +LM
Sbjct  139   QSVIDNGESSEMEDKRANNELVKLQDELKKMTMENEKLRELLTQVSNNYTSLHMHLVSLM  198

Query  1532  QHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQS  1353
             Q Q QQ +             K+ E   + EE  VPRQF++L P   A  A        S
Sbjct  199   QQQQQQQN-------------KALEAAGKHEETIVPRQFIDLGPLRAAGEAEDL-----S  240

Query  1352  HTTSEERTLSAGSP----RNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQA  1185
             +++SE+RT S G      RNN     R    + RE+SP++ES    +    +     +Q+
Sbjct  241   NSSSEDRTRSGGCSAVERRNNEV---RDGKRLGREESPETES-NKVQKVNNSSPPTFEQS  296

Query  1184  AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQ  1005
              EATMRKARVSVRARSEA MISDGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQ
Sbjct  297   TEATMRKARVSVRARSEATMISDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQ  356

Query  1004  RCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN-TNFLARA  828
             RCAEDR+ILITTYEG HNHPLPPAA+AMASTT AAANMLLSG+M S DGMMN TN LARA
Sbjct  357   RCAEDRSILITTYEGNHNHPLPPAAVAMASTTMAAANMLLSGSMSSQDGMMNPTNLLARA  416

Query  827   ILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQI-PQ----NY  663
             +LPCS+S+ATISASAPFPTVTLDLT  P  LPN   P T        +  + PQ    N 
Sbjct  417   VLPCSTSMATISASAPFPTVTLDLTHAP-PLPNGSSPSTAAATNNHNSLMLRPQQQMTNL  475

Query  662   P--QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLS  489
             P   LP V GQ LYNQSKFSGL  S                         Q    ADT+S
Sbjct  476   PPNMLPHVIGQALYNQSKFSGLQFS------------------SGSPSAAQSHAVADTIS  517

Query  488   AATAAITSDPNFTAALAAAISSIMGG  411
                 A+T+DPNFTAALA+ ISS++ G
Sbjct  518   ----ALTADPNFTAALASVISSMING  539



>gb|KFK40614.1| hypothetical protein AALP_AA2G019000 [Arabis alpina]
Length=568

 Score =   356 bits (913),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 288/600 (48%), Positives = 348/600 (58%), Gaps = 100/600 (17%)
 Frame = -1

Query  2027  MDKGW-GLTLE-------NPDR-----RAGFFTN--------------KPVFGFNLSPRL  1929
             MD+GW GLTL+       NP+R        FF+N              K   GF     L
Sbjct  1     MDRGWSGLTLDSSSLDLINPNRLNHSNHGRFFSNPLTMSRNVDDDEKTKVSTGFRFPVSL  60

Query  1928  NPINgggsgggaGMVPINPAAEKRGPPNEVDFFSDKKADIV--------VKKEITLHGEP  1773
             + I        +  V        R  P EVDFFSDKK+ +         VKKE     E 
Sbjct  61    SGIRDREDDDLSSEVA---GDNDREVPGEVDFFSDKKSRVCHVDVDETRVKKE-----EH  112

Query  1772  VTKADLNTGLQL-VIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLR  1596
               + D+NTGL L    N+ SD+S +DD VSS++E++RAKN+L+ LQ EL+KM  ENQ+L+
Sbjct  113   DDRTDVNTGLNLRTTGNTRSDESMIDDGVSSEIEDKRAKNELAQLQDELKKMTMENQQLK  172

Query  1595  GMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQF  1416
              +L+QVS NYT+LQ HL +LMQ Q QQ               K+ E   + EE  VPRQF
Sbjct  173   ELLTQVSNNYTSLQMHLVSLMQQQQQQHQNNIHHN-------KAIEAVEKPEETIVPRQF  225

Query  1415  LELVPgggaaaaAQTDEASQSHTTSEERTLSAGSP----RNNNTELSRHKGIIAREDSPD  1248
             ++L P        +      S+++SE+RT S GS     R+N     R    + RE+SP+
Sbjct  226   IDLGPLRAVGEGEEV-----SNSSSEDRTRSGGSSAAERRSNEV---RDGKRVGREESPE  277

Query  1247  SESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNP  1068
             +ES    K+   +     +Q+AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNP
Sbjct  278   TESNKVQKVNNTSSPATFEQSAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNP  337

Query  1067  CPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanml  888
             CPRAYYRCTMA  CPVRKQVQRCAEDR+ILITTYEG HNHPLPPAA+AMASTT+AAANML
Sbjct  338   CPRAYYRCTMATACPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAVAMASTTTAAANML  397

Query  887   lSGAMPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPT  711
             LSG+M S DGMMN TN LARA+LPCS+S+ATISASAPFPTVTLDLT +P          +
Sbjct  398   LSGSMSSHDGMMNPTNLLARAVLPCSTSMATISASAPFPTVTLDLTHSPPPPNGPNPSSS  457

Query  710   QFQAPFTGAPQIPQ---------------NYP--QLPQVFGQGLYNQSKFSGLHVSHQDI  582
                A                         N P   LPQV GQ LYNQSKFSGL  S    
Sbjct  458   AAAASNNNNQNHNSLMQRSQLPQQQQQMTNLPPGMLPQVIGQALYNQSKFSGLQFS----  513

Query  581   aaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
                              A   Q    ADT++    A+T+DPNFTAALAA ISS++ G +Q
Sbjct  514   -----------GGSPSVAAFSQPHTVADTIT----ALTADPNFTAALAAVISSMINGSNQ  558



>gb|KHN03496.1| WRKY transcription factor 6 [Glycine soja]
Length=489

 Score =   353 bits (905),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 265/487 (54%), Positives = 313/487 (64%), Gaps = 50/487 (10%)
 Frame = -1

Query  1844  EVDFFSDKKADIVVKKEITLHGEP-VTKADLNTGLQLVIANsgsdkstvddsvssDMEER  1668
             EVDF S +            HG P  +   +NTGLQL+ AN+GSD+STVDD  SS+ E++
Sbjct  24    EVDFLSARNNS---SPHTNDHGTPPKSYPHVNTGLQLLTANAGSDQSTVDDGASSEAEDK  80

Query  1667  RAK-NDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQ  1491
             RAK  +L+ L+ +L  MNAENQ+L+ MLS VS+NY  LQ HL+ ++Q Q  Q+ R  ST+
Sbjct  81    RAKMTELARLKEDLRNMNAENQKLKEMLSHVSSNYANLQMHLAAVLQQQ--QNQRTESTE  138

Query  1490  DREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSP  1311
                V  + +EE+K      TVPRQFL LVP          D+ S S  +S ERT S   P
Sbjct  139   QEVVQGKLAEERKHGVGGGTVPRQFLSLVPSEID------DQVSNS--SSGERTRSTTPP  190

Query  1310  RNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRKARVSVRARSEA  1131
              N N + ++         +P ++                  + EA MRKARVSVRARSEA
Sbjct  191   SNKNDKDNKETDDKLNPSNPTTDPST---------------SPEAAMRKARVSVRARSEA  235

Query  1130  PMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThn  951
             PMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTIL TTYEGTHN
Sbjct  236   PMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILTTTYEGTHN  295

Query  950   hplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPT  771
             HPLPPAAMAMASTT AA +MLLSG+M SADG MN N L  AILPC S++AT+SASAPFPT
Sbjct  296   HPLPPAAMAMASTTVAATSMLLSGSMSSADGKMNPNLLTGAILPC-SNMATLSASAPFPT  354

Query  770   VTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNY------PQLPQVFGQGLYNQSKFS  609
             VTLDLT  PN+L  YQ  P Q Q PF  +P  PQN+      PQLP++  Q LYNQSKFS
Sbjct  355   VTLDLTHNPNALQQYQLRP-QTQTPFLPSP--PQNFMSGPTTPQLPKLIAQVLYNQSKFS  411

Query  608   GLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAI  429
             GL +S QD+                   P Q     DT+S    AIT+DPNF AAL AAI
Sbjct  412   GLQLS-QDV-----GPNNSQAPTPSLLQPSQQVSLTDTVS----AITADPNFPAALTAAI  461

Query  428   SSIMGGG  408
             SSI+GG 
Sbjct  462   SSIIGGA  468



>gb|KHN35721.1| WRKY transcription factor 6 [Glycine soja]
Length=515

 Score =   353 bits (907),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 269/489 (55%), Positives = 320/489 (65%), Gaps = 53/489 (11%)
 Frame = -1

Query  1844  EVDFFSDKKADIVVKKEITLHGEPVTKAD--LNTGLQLVIANsgsdkstvddsvssDMEE  1671
             EVDFFS  + +I        HG P+ K D  +NTGLQL+ AN+GSD+STVDD  SSD E+
Sbjct  44    EVDFFSGAR-NISSSHTNNDHGTPL-KCDPHVNTGLQLLTANAGSDQSTVDDGASSDAED  101

Query  1670  RRAK-NDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGST  1494
             +  K  +L+ LQ +L +MNAENQ+L+ MLS VS+NY  LQ HL+ ++Q Q+ Q +     
Sbjct  102   KLVKITELARLQEDLRRMNAENQKLKEMLSHVSSNYANLQMHLAAVLQQQHNQRTE---N  158

Query  1493  QDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGS  1314
              ++EV   K+EE+K     P  PRQFL+LVP G      Q      S+++  ERT S   
Sbjct  159   TEQEVVQGKAEERKHGGMVP--PRQFLDLVPSGTTEIDDQV-----SNSSLGERTRSTTP  211

Query  1313  PRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAA--EATMRKARVSVRAR  1140
             P  N            + D  D +            +   D +   EA MRKARVSVRAR
Sbjct  212   PSCN------------KNDDKDKKETTDIPHSGKLLNHTTDPSTSPEAAMRKARVSVRAR  259

Query  1139  SEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG  960
             SEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTIL TTYEG
Sbjct  260   SEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILTTTYEG  319

Query  959   ThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAP  780
             THNHPLPPAAMAMASTT+AAA+MLLSG+M SADG+MN N L RAILPC SS+AT+SASAP
Sbjct  320   THNHPLPPAAMAMASTTAAAASMLLSGSMTSADGIMNPNLLTRAILPC-SSMATLSASAP  378

Query  779   FPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNY------PQLPQVFGQGLYNQS  618
             FPTVTLDLT   N+  NYQRP    Q P    P  PQ++      PQLPQ+  Q LYNQS
Sbjct  379   FPTVTLDLTHNQNAFQNYQRP----QTPL--FPSQPQDFIAGSTPPQLPQLIAQALYNQS  432

Query  617   KFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALA  438
             KFSGL +S QD+          +Q  +    P Q     DT+S    AIT+DPNFTAAL 
Sbjct  433   KFSGLQLS-QDV------GPNNSQAPRPFLQPSQQVSLTDTIS----AITADPNFTAALV  481

Query  437   AAISSIMGG  411
             +AISSI+GG
Sbjct  482   SAISSIIGG  490



>ref|XP_003549709.1| PREDICTED: WRKY transcription factor 6-like isoform X1 [Glycine 
max]
Length=489

 Score =   353 bits (905),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 266/487 (55%), Positives = 313/487 (64%), Gaps = 50/487 (10%)
 Frame = -1

Query  1844  EVDFFSDKKADIVVKKEITLHGEP-VTKADLNTGLQLVIANsgsdkstvddsvssDMEER  1668
             EVDF S +            HG P  +   +NTGLQL+ AN+GSD+STVDD  SSD E++
Sbjct  24    EVDFLSARNNS---SPHTNDHGTPPKSYPHVNTGLQLLTANAGSDQSTVDDGASSDAEDK  80

Query  1667  RAK-NDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQ  1491
             RAK  +L+ L+ +L  MNAENQ+L+ MLS VS+NY  LQ HL+ ++Q Q  Q+ R  ST+
Sbjct  81    RAKMTELARLKEDLRNMNAENQKLKEMLSHVSSNYANLQMHLAAVLQQQ--QNQRTESTE  138

Query  1490  DREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSP  1311
                V  + +EE+K      TVPRQFL LVP          D+ S S  +S ERT S   P
Sbjct  139   QEVVQGKLAEERKHGVGGGTVPRQFLSLVPSEID------DQVSNS--SSGERTRSTTPP  190

Query  1310  RNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRKARVSVRARSEA  1131
              N N + ++         +P ++                  + EA MRKARVSVRARSEA
Sbjct  191   SNKNDKDNKETDDKLNPSNPTTDPST---------------SPEAAMRKARVSVRARSEA  235

Query  1130  PMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThn  951
             PMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTIL TTYEGTHN
Sbjct  236   PMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILTTTYEGTHN  295

Query  950   hplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPT  771
             HPLPPAAMAMASTT AA +MLLSG+M SADG MN N L  AILPC S++AT+SASAPFPT
Sbjct  296   HPLPPAAMAMASTTVAATSMLLSGSMSSADGKMNPNLLTGAILPC-SNMATLSASAPFPT  354

Query  770   VTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNY------PQLPQVFGQGLYNQSKFS  609
             VTLDLT  PN+L  YQ  P Q Q PF  +P  PQN+      PQLP++  Q LYNQSKFS
Sbjct  355   VTLDLTHNPNALQQYQLRP-QTQTPFLPSP--PQNFMSGPTTPQLPKLIAQVLYNQSKFS  411

Query  608   GLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAI  429
             GL +S QD+                   P Q     DT+S    AIT+DPNF AAL AAI
Sbjct  412   GLQLS-QDV-----GPNNSQAPTPSLLQPSQQVSLTDTVS----AITADPNFPAALTAAI  461

Query  428   SSIMGGG  408
             SSI+GG 
Sbjct  462   SSIIGGA  468



>ref|XP_003528693.2| PREDICTED: WRKY transcription factor 6 [Glycine max]
Length=517

 Score =   353 bits (906),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 269/489 (55%), Positives = 320/489 (65%), Gaps = 53/489 (11%)
 Frame = -1

Query  1844  EVDFFSDKKADIVVKKEITLHGEPVTKAD--LNTGLQLVIANsgsdkstvddsvssDMEE  1671
             EVDFFS  + +I        HG P+ K D  +NTGLQL+ AN+GSD+STVDD  SSD E+
Sbjct  46    EVDFFSGAR-NISSSHTNNDHGTPL-KCDPHVNTGLQLLTANAGSDQSTVDDGASSDAED  103

Query  1670  RRAK-NDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGST  1494
             +  K  +L+ LQ +L +MNAENQ+L+ MLS VS+NY  LQ HL+ ++Q Q+ Q +     
Sbjct  104   KLVKITELARLQEDLRRMNAENQKLKEMLSHVSSNYANLQMHLAAVLQQQHNQRTE---N  160

Query  1493  QDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGS  1314
              ++EV   K+EE+K     P  PRQFL+LVP G      Q      S+++  ERT S   
Sbjct  161   TEQEVVQGKAEERKHGGMVP--PRQFLDLVPSGTTEIDDQV-----SNSSLGERTRSTTP  213

Query  1313  PRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAA--EATMRKARVSVRAR  1140
             P  N            + D  D +            +   D +   EA MRKARVSVRAR
Sbjct  214   PSCN------------KNDDKDKKETTDIPHSGKLLNHTTDPSTSPEAAMRKARVSVRAR  261

Query  1139  SEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG  960
             SEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTIL TTYEG
Sbjct  262   SEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILTTTYEG  321

Query  959   ThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAP  780
             THNHPLPPAAMAMASTT+AAA+MLLSG+M SADG+MN N L RAILPC SS+AT+SASAP
Sbjct  322   THNHPLPPAAMAMASTTAAAASMLLSGSMTSADGIMNPNLLTRAILPC-SSMATLSASAP  380

Query  779   FPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNY------PQLPQVFGQGLYNQS  618
             FPTVTLDLT   N+  NYQRP    Q P    P  PQ++      PQLPQ+  Q LYNQS
Sbjct  381   FPTVTLDLTHNQNAFQNYQRP----QTPL--FPSQPQDFIAGSTPPQLPQLIAQALYNQS  434

Query  617   KFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALA  438
             KFSGL +S QD+          +Q  +    P Q     DT+S    AIT+DPNFTAAL 
Sbjct  435   KFSGLQLS-QDV------GPNNSQAPRPFLQPSQQVSLTDTIS----AITADPNFTAALV  483

Query  437   AAISSIMGG  411
             +AISSI+GG
Sbjct  484   SAISSIIGG  492



>gb|AGA37233.1| WRKY transcription factor 6.1 [Brassica napus]
Length=552

 Score =   354 bits (909),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 268/506 (53%), Positives = 317/506 (63%), Gaps = 73/506 (14%)
 Frame = -1

Query  1859  RGPPNEVDFFSDKK----------ADIVVKKEITLHGEPVTKADLNTGLQL-VIANsgsd  1713
             R  P EVDFFSDKK          A + VKKE     E   + D+NTGL L    N+ SD
Sbjct  83    REVPGEVDFFSDKKSRVSRDEVDDAGLRVKKE-----EQDDRTDINTGLNLRTTVNARSD  137

Query  1712  kstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLM  1533
             +S +D+  SS+ME++RA N+L  LQ EL+KM  EN++LR +L+QVS NYT+L  HL +LM
Sbjct  138   QSVIDNGESSEMEDKRANNELVKLQDELKKMTMENEKLRELLTQVSNNYTSLHMHLVSLM  197

Query  1532  QHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQS  1353
             Q Q QQ +             K+ E   + EE  VPRQF++L P   A  A        S
Sbjct  198   QQQQQQQN-------------KALEAAGKHEETIVPRQFIDLGPSRAAGEAEDL-----S  239

Query  1352  HTTSEERTLSAGSP----RNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQA  1185
             +++SE+RT S G      RNN     R    + RE+SP++ES    +    +     +Q+
Sbjct  240   NSSSEDRTRSGGCSAVERRNNEV---RDGKRLGREESPETES-NKVQKVNNSSLPTFEQS  295

Query  1184  AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQ  1005
              EATMRKARVSVRARSEA MISDGCQWRKYGQKMAKGNPCPRAYYRCTMA  CPVRKQVQ
Sbjct  296   TEATMRKARVSVRARSEASMISDGCQWRKYGQKMAKGNPCPRAYYRCTMATSCPVRKQVQ  355

Query  1004  RCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN-TNFLARA  828
             RCAEDR+ILITTYEG HNHPLPPAA+AMASTT AAANMLLSG+M S DGMMN TN LARA
Sbjct  356   RCAEDRSILITTYEGNHNHPLPPAAVAMASTTMAAANMLLSGSMSSQDGMMNPTNLLARA  415

Query  827   ILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQI-PQ----NY  663
             +LPCS+S+ATISASAPFPTVTLDLT  P  LPN   P T        +  + PQ    N 
Sbjct  416   VLPCSTSMATISASAPFPTVTLDLTHAP-PLPNGSSPSTAAATNNHNSLMLRPQQQMTNL  474

Query  662   P--QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLS  489
             P   LP V GQ LYNQSKFSGL  S                         Q    ADT+S
Sbjct  475   PPNMLPHVIGQALYNQSKFSGLQFS------------------SGSPSAAQSHAVADTIS  516

Query  488   AATAAITSDPNFTAALAAAISSIMGG  411
                 A+T+DPNFTAALA+ ISS++ G
Sbjct  517   ----ALTADPNFTAALASVISSMING  538



>ref|XP_009381020.1| PREDICTED: probable WRKY transcription factor 31 [Musa acuminata 
subsp. malaccensis]
Length=565

 Score =   353 bits (906),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 267/499 (54%), Positives = 326/499 (65%), Gaps = 56/499 (11%)
 Frame = -1

Query  1847  NEVDFFSDKKADIVVKKE----ITLHGEPVTKADL--NTGLQLVIANsgsdkstvddsvs  1686
             NE+DFFS+++     K E    + L    V K DL  +TGL L+ AN+G+D+S VD+ +S
Sbjct  63    NEMDFFSEERKKAFSKVENDLDLMLPSSCVKKEDLTIHTGLNLLTANAGNDESMVDNKLS  122

Query  1685  sDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSR  1506
                + + +K +L+ ++ EL ++  ENQ+L+ M+ Q +TNY ALQ+HL  LM+ Q+Q  S 
Sbjct  123   PTKDHKESKTELAAMESELARVKEENQKLQEMVEQATTNYNALQKHLVALMRQQHQ--SN  180

Query  1505  IGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTL  1326
                 +D EVAD   +    E     VPRQF++L       AA + DE S S T S++R  
Sbjct  181   RHPPRDHEVADENVKATNQEHGGVLVPRQFMDL------GAAVEADEPSHSSTASQDRPP  234

Query  1325  SAGSPR----NNNTELSR-HKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRKA  1161
              +   R    +N  E++    G   RE+ PD  + AP   P        +QA EA MRKA
Sbjct  235   GSTDHRLHGGSNKKEIAPPDHGSSFREEKPDHPNKAPKLTPAGV----TEQAQEAIMRKA  290

Query  1160  RVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTI  981
             RVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR+I
Sbjct  291   RVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMASGCPVRKQVQRCAEDRSI  350

Query  980   LITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVA  801
             LITTYEGTHNHPLPPAAMAMASTTSAAA+MLLSG+M S +G+MN NFLAR +LP SSS+A
Sbjct  351   LITTYEGTHNHPLPPAAMAMASTTSAAASMLLSGSMSSPEGLMNPNFLARTMLPYSSSMA  410

Query  800   TISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTG------APQIPQNYPQLPQVFG  639
             TISASAPFPTVTLDLT +PN+    QRPPTQFQ PF G      AP  P + P  PQ+FG
Sbjct  411   TISASAPFPTVTLDLTHSPNAA-QLQRPPTQFQVPFPGAAAGFLAPPQPASLP--PQIFG  467

Query  638   QGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDP  459
             Q LY+ SKFS L  +                               DT+SAATAAIT+DP
Sbjct  468   QALYDPSKFSSLQSA------------------------LPPSSLTDTVSAATAAITADP  503

Query  458   NFTAALAAAISSIMGGGSQ  402
             NFTAALAAAISSI+GG  Q
Sbjct  504   NFTAALAAAISSIIGGNHQ  522



>ref|XP_009389998.1| PREDICTED: probable WRKY transcription factor 31 [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   352 bits (902),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 249/488 (51%), Positives = 304/488 (62%), Gaps = 41/488 (8%)
 Frame = -1

Query  1862  KRGPPNEVDFFSDKKADIVVKKEITLHGEPVTKADLNTGL-QLVIANsgsdkstvddsvs  1686
             KR   +EVDFFSD+K     K   T+   PV + DL+  +  L I        T     +
Sbjct  77    KRVVADEVDFFSDEKKKQKKKD--TIAASPV-ETDLDLKVPSLGIKKEDLTIQTGLHLRN  133

Query  1685  sDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSR  1506
              D  +    + ++ +Q EL +MN ENQ+LRGMLSQV+++Y+ALQ  L+ LMQ +N+    
Sbjct  134   GDTAKESVDDGMAAMQAELARMNEENQKLRGMLSQVNSSYSALQMQLATLMQQRNRTPQA  193

Query  1505  IGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTL  1326
                  D E  D+             V RQFL+L P          DE S S T S ER  
Sbjct  194   HEEKIDAENGDQGGAR---------VLRQFLDLGPDA------DVDEHSNSSTASLER--  236

Query  1325  SAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRKARVSVR  1146
             S+ +P N     S   G+   E +P        +  +L P+   +Q  E+TMR+ RVSVR
Sbjct  237   SSSTPENVEVG-SMGYGLHKNEGNP-------REALELTPTATAEQ--ESTMRRTRVSVR  286

Query  1145  ARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY  966
             ARSEAP I+DGCQWRKYGQK+AKGNPCPRAYYRCTMA GCPVRKQVQRCA+DR+ILITTY
Sbjct  287   ARSEAPTITDGCQWRKYGQKIAKGNPCPRAYYRCTMATGCPVRKQVQRCADDRSILITTY  346

Query  965   EGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISAS  786
             EGTHNHPLPPAAMAMAS TSAAA+ L SG+  SADG+MN+NFL+RA+LPCSSSVATISAS
Sbjct  347   EGTHNHPLPPAAMAMASATSAAASTLFSGSTSSADGLMNSNFLSRAVLPCSSSVATISAS  406

Query  785   APFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSG  606
             APFPTVTLDLT++P+ L + + P  QFQ PF     +PQ  P LP VFGQ L NQS+FSG
Sbjct  407   APFPTVTLDLTRSPDPLQSLRTPAGQFQFPFPALGALPQP-PSLPPVFGQTLLNQSRFSG  465

Query  605   LHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAIS  426
             L VS              AQ               +T++AATAAIT+DPNFTA LAAAI 
Sbjct  466   LQVS---------SGMAAAQFPHPKPQTTMPSSLEETVNAATAAITADPNFTAVLAAAIK  516

Query  425   SIMGGGSQ  402
             SI+GG  Q
Sbjct  517   SIIGGNDQ  524



>ref|XP_010533798.1| PREDICTED: LOW QUALITY PROTEIN: WRKY transcription factor 6-like 
[Tarenaya hassleriana]
Length=543

 Score =   351 bits (901),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 280/584 (48%), Positives = 344/584 (59%), Gaps = 95/584 (16%)
 Frame = -1

Query  2027  MDKGWG-LTLE-------NPDRRAGFFTNKPV---------FGFNLSPRLNPINgggsgg  1899
             MD+GWG LTL+       NP+ R  F  N PV         F F +S             
Sbjct  1     MDRGWGGLTLDSQSPDLINPNCRLKF-PNSPVSDAPQKTELFRFPVS-----FARFRDRE  54

Query  1898  gaGMVPINPAAEKRGPPNEVDFFSDKKADIVVKKEITLHGEPVT------KADLNTGLQL  1737
                          R  P+EVDFF+DKK  +V++      G  V       + D+NTGL L
Sbjct  55    DDHFSSTGDDDNDRKVPSEVDFFADKKY-MVLRGSDGGDGLRVKEEDGDGRTDVNTGLNL  113

Query  1736  VIA--NsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYT  1563
             +    N+GSD+S +DD +S+DMEE+R KN+L+ LQ++L++MN+EN++L+ ML +V  NY 
Sbjct  114   LTTGNNTGSDQSVIDDGISADMEEKRTKNELAELQLQLQRMNSENRKLKEMLDEVYKNYN  173

Query  1562  ALQQHLSNLMQHQNQQSSRI-GSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaa  1386
             +L + L+ + Q QN  +  I G   + ++ D              VPRQF+ L       
Sbjct  174   SLYRQLALMQQQQNIPNKAIEGKPIETQLQD-----------GVNVPRQFIGLA------  216

Query  1385  aaAQTDEASQSHTTSEERTLSAGSPRNNNTELS-----RHKGIIAREDSPDSES---WAp  1230
                 ++    S+++SEERT S   P N   EL      R +  +AREDS ++ES   W  
Sbjct  217   --GPSEAEDVSNSSSEERTRSGALPVNK-VELEGDDDLRGEKRLAREDSAETESNNIWKA  273

Query  1229  --nklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRA  1056
                     N S   DQ+ EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRA
Sbjct  274   PNKLQKVNNSSSQTDQSTEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRA  333

Query  1055  YYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGA  876
             YYRCTMA GCPVRKQVQRCAED++ILITTYEG HNHPLPPAA+AMASTT+AAANMLLSG+
Sbjct  334   YYRCTMATGCPVRKQVQRCAEDKSILITTYEGNHNHPLPPAAVAMASTTTAAANMLLSGS  393

Query  875   MPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQA  699
             M S DG+MN TN LARA+LPCSSS+ATISASAPFPTVTLDLT TP       +PP  F +
Sbjct  394   MASHDGLMNHTNLLARAVLPCSSSMATISASAPFPTVTLDLTHTPT------QPPNPFGS  447

Query  698   PFTGAPQIPQ----NYPQ--LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqq  537
             P       PQ    N P   LP V GQ LYNQSKFSG+  S                   
Sbjct  448   PLARQLTPPQQQMTNLPHGLLPHVIGQALYNQSKFSGVQFSGN---------------VN  492

Query  536   hpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGS  405
                  P   + ADT++    AIT+DPNFTAALA  ISS+  G S
Sbjct  493   GSPAAPPPQVLADTVN----AITADPNFTAALATVISSMFNGSS  532



>ref|XP_008455449.1| PREDICTED: probable WRKY transcription factor 31 [Cucumis melo]
Length=456

 Score =   347 bits (890),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 254/462 (55%), Positives = 304/462 (66%), Gaps = 44/462 (10%)
 Frame = -1

Query  1757  LNTGLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQV  1578
             L TGL L+  NS SD+S VDD VS + EE+R KN+ +VLQ ELE++N+EN RL+ ML+QV
Sbjct  2     LYTGLNLLTTNSCSDQSMVDDGVSPNPEEKRVKNERAVLQAELERINSENLRLKDMLNQV  61

Query  1577  STNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePT---------VP  1425
             ++NY  LQ   + L+Q   Q++  +G   + E AD                       VP
Sbjct  62    TSNYQTLQMQFNTLIQ--TQKTEDVGDPIE-ENADGSGGGGNNNNNNNNNNTNISNKLVP  118

Query  1424  RQFLELVPgggaaaaAQTDEASQSHTT--SEERTLSAGSPRNNNTELS--RHKGIIARED  1257
             RQF++L    G A   + DE S S +   S ER+ S G    N  E++  RH    +   
Sbjct  119   RQFMDL----GLATNMENDEESMSSSEGRSGERSRSPG----NTGEVASKRHSPDQSSNW  170

Query  1256  SPDSESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAK  1077
               ++ +         +  K VDQ  EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAK
Sbjct  171   GSNNNNNNKVPKFSSSSGKEVDQT-EATMRKARVSVRARSEAPMITDGCQWRKYGQKMAK  229

Query  1076  GNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaa  897
             GNPCPRAYYRCTMA+GCPVRKQVQRCAED+TILITTYEG HNHPLPPAAMAMASTTS+AA
Sbjct  230   GNPCPRAYYRCTMALGCPVRKQVQRCAEDKTILITTYEGNHNHPLPPAAMAMASTTSSAA  289

Query  896   nmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRP  717
              MLLSG+M SADG+MN+NFLAR +LPCSSS+ATISASAPFPTVTLDLTQTPN  P +QRP
Sbjct  290   RMLLSGSMSSADGLMNSNFLARTLLPCSSSMATISASAPFPTVTLDLTQTPN--PLFQRP  347

Query  716   PTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqq  537
                       A   PQ +   PQ+FG  LYNQSKFSGL +S +DI             + 
Sbjct  348   APGHFPIPFAAAAPPQTF---PQIFGHALYNQSKFSGLQMS-KDI-------------EA  390

Query  536   hpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                PPP    F DTLS A AAI SDPNF AALA A++S++GG
Sbjct  391   PSPPPPTQNPFTDTLSVAGAAIASDPNFIAALATAMTSLIGG  432



>ref|XP_010430271.1| PREDICTED: WRKY transcription factor 6-like [Camelina sativa]
Length=571

 Score =   350 bits (899),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 273/518 (53%), Positives = 325/518 (63%), Gaps = 78/518 (15%)
 Frame = -1

Query  1859  RGPPNEVDFFSDKKADIV--------VKKEITLHGEPVTKADLNTGLQL-VIANsgsdks  1707
             R  P EVDFFSDKK+ +         VKKE     E   + D+NTGL L    N+ SD+S
Sbjct  90    REVPGEVDFFSDKKSRVCREDDAGFRVKKE-----EQDDRTDVNTGLNLRTTGNTKSDES  144

Query  1706  tvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQH  1527
              +DD  SS+ME++RAK +L  LQ EL++M  +NQ+LR +L+QVS +YT+LQ HL +LMQ 
Sbjct  145   MIDDGESSEMEDKRAKIELVKLQDELKRMTMDNQKLRELLAQVSNSYTSLQMHLVSLMQQ  204

Query  1526  QNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHT  1347
             Q QQ             + K  E   + EE  VPRQF++L P               S++
Sbjct  205   QQQQQQ---------QNNNKVIEAAEKPEETIVPRQFIDLGPTRAVGE-----AEEASNS  250

Query  1346  TSEERTLSAGS-PRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQ-AAEAT  1173
             +SEE+T S GS P    +   R +  + RE+SP++ES    K+         DQ AAEAT
Sbjct  251   SSEEKTRSGGSSPAERRSNEVRDRKRLGREESPETESNKIQKVNNSTNPTTFDQSAAEAT  310

Query  1172  MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAE  993
             MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAE
Sbjct  311   MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQRCAE  370

Query  992   DRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN-TNFLARAILPC  816
             DR+ILITTYEG HNHPLPPAA+AMASTT+AAANMLLSG+M S DGMMN TN LARA+LPC
Sbjct  371   DRSILITTYEGNHNHPLPPAAVAMASTTTAAANMLLSGSMSSHDGMMNPTNLLARAVLPC  430

Query  815   SSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAP-----------QIPQ  669
             S+S+ATISASAPFPTVTLDLT +P        PPT    P + A            Q PQ
Sbjct  431   STSMATISASAPFPTVTLDLTHSP--------PPTNGSNPSSSAAATTNNDHNLLMQRPQ  482

Query  668   -------NYP--QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppq  516
                    N P   LP V GQ LYNQSKFSGL  S+                    A   Q
Sbjct  483   QQQQQMANLPPGMLPHVIGQALYNQSKFSGLQFSN---------------GSPSAAAYSQ  527

Query  515   hpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
                 ADT++    A+T+DPNFTAALAA ISS++ G +Q
Sbjct  528   SNAVADTIT----ALTADPNFTAALAAVISSMINGSNQ  561



>gb|AHC54606.1| WRKY1 [Chrysanthemum x morifolium]
Length=504

 Score =   347 bits (890),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 275/544 (51%), Positives = 337/544 (62%), Gaps = 80/544 (15%)
 Frame = -1

Query  2018  GWGLTLENPDRRAGFFTNKPVFGFNLSPRLNP-INgggsgggaGMVPIN-PAAEKRGPPN  1845
             GW LT E            PV    LSPRLN  +            P + P  E +    
Sbjct  5     GWRLTFE------------PVKL--LSPRLNSSVKATMYSSDTAASPSSSPKPEDKNSHR  50

Query  1844  EVDFFSDKKAD---IVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvssDME  1674
             EVDFFS  K D   +VVKKE +   E     D+NTGL L+  NS         S +S  +
Sbjct  51    EVDFFSTCKLDDDHVVVKKENSHDNE----LDVNTGLHLLTTNSDQSSVDDGGSSTS--Q  104

Query  1673  ERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGST  1494
             E++AK+ L++L+ ELEKMN ENQRLRGML+ VS NYTALQ H+SN +  Q  Q       
Sbjct  105   EKQAKDKLTILKAELEKMNTENQRLRGMLTHVSNNYTALQIHISNEIHKQQNQ-------  157

Query  1493  QDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGS  1314
                 + ++ S             RQ  ELV              + + ++SEERT S GS
Sbjct  158   ----IVEQNS-------------RQLNELV-------------RNSNDSSSEERTQS-GS  186

Query  1313  PRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRKARVSVRARSE  1134
              +  + ++ +  G   RE++PDS+ W  NK+ +L+ SK ++Q  E+ MRKARVSVRARSE
Sbjct  187   IKLGD-KIGKRNG---RENTPDSDGWVSNKVSRLDTSKNINQPNESAMRKARVSVRARSE  242

Query  1133  APMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGTh  954
             APMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGC VRKQVQRC +D+TILITTYEGTH
Sbjct  243   APMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCSVRKQVQRCVDDQTILITTYEGTH  302

Query  953   nhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFP  774
             +HPLPPAAMAMASTTSAAA+MLLSG+M SAD MMN N LAR+IL  +SS+ATIS+SAPFP
Sbjct  303   SHPLPPAAMAMASTTSAAASMLLSGSMSSADAMMNPNILARSILHNTSSIATISSSAPFP  362

Query  773   TVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGL-YNQSKFSGLHV  597
             T+TLDLT  PN +    +  TQFQAP  G     QN+  +  +  Q +  NQSKFS L +
Sbjct  363   TITLDLTHNPNQIQRNNK-STQFQAPHQGQLS-SQNFAPIATMPLQSISTNQSKFSDLQL  420

Query  596   SHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIM  417
             SH DI          + Q        Q   FAD+LSAATA IT+DPNFTAALAAAI+SIM
Sbjct  421   SH-DI---------ESSQLLAHNKGQQQTSFADSLSAATAVITADPNFTAALAAAITSIM  470

Query  416   GGGS  405
              GG+
Sbjct  471   SGGN  474



>ref|XP_010473445.1| PREDICTED: WRKY transcription factor 6 [Camelina sativa]
Length=570

 Score =   348 bits (894),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 272/517 (53%), Positives = 325/517 (63%), Gaps = 77/517 (15%)
 Frame = -1

Query  1859  RGPPNEVDFFSDKKADIV--------VKKEITLHGEPVTKADLNTGLQL-VIANsgsdks  1707
             R  P EVDFFSDKK+ +         VKKE     E   + D+NTGL L    N+ SD+S
Sbjct  90    REVPGEVDFFSDKKSRVCREDDAGFRVKKE-----EQDDRTDVNTGLNLRTTGNTKSDES  144

Query  1706  tvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQH  1527
              +DD  SS+ME++R KN+L  LQ EL++M  +NQ+LR +L+QVS +YT+LQ HL +LMQ 
Sbjct  145   MIDDGESSEMEDKRVKNELVKLQDELKRMTMDNQKLRELLAQVSNSYTSLQMHLVSLMQQ  204

Query  1526  QNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHT  1347
             Q QQ             + K  E   + EE  VPRQF++L P               S++
Sbjct  205   QQQQQQ---------QNNNKVIEAAEKPEETIVPRQFIDLGPTRAVGE-----GEEASNS  250

Query  1346  TSEERTLSAGS-PRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATM  1170
             +SEE+T S GS P    +   R +  + RE+SP++ES    K+   NP+     AAEATM
Sbjct  251   SSEEKTRSGGSSPAERRSNEVRDRKRLGREESPETESNKIQKVNSTNPATFDQSAAEATM  310

Query  1169  RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAED  990
             RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAED
Sbjct  311   RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQRCAED  370

Query  989   RTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN-TNFLARAILPCS  813
             R+ILITTYEG HNHPLPPAA+AMASTT+AAANMLLSG+M S DGMMN TN LARA+LPCS
Sbjct  371   RSILITTYEGNHNHPLPPAAVAMASTTTAAANMLLSGSMSSHDGMMNPTNLLARAVLPCS  430

Query  812   SSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAP-----------QIPQ-  669
             +S+ATISASAPFPTVTLDLT +P        PP     P + A            Q PQ 
Sbjct  431   TSMATISASAPFPTVTLDLTHSP--------PPANGSNPSSSAAATTNNDHNLLMQRPQQ  482

Query  668   ------NYP--QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqh  513
                   N P   LP V GQ LYNQSKFSGL  S+                    A   Q 
Sbjct  483   QQQQMANLPPGMLPHVIGQALYNQSKFSGLQFSN---------------GSPSAAAYSQS  527

Query  512   pLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
                ADT++    A+T+DPNFTAALAA ISS++ G +Q
Sbjct  528   HAVADTIT----ALTADPNFTAALAAVISSMINGSNQ  560



>ref|XP_010418216.1| PREDICTED: WRKY transcription factor 6-like [Camelina sativa]
Length=569

 Score =   348 bits (894),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 272/514 (53%), Positives = 324/514 (63%), Gaps = 77/514 (15%)
 Frame = -1

Query  1859  RGPPNEVDFFSDKKADIV--------VKKEITLHGEPVTKADLNTGLQL-VIANsgsdks  1707
             R  P EVDFFSDKK+ +         VKKE     E   + D+NTGL L    N+ SD+S
Sbjct  91    REVPGEVDFFSDKKSRVCREDDAGFRVKKE-----EQDDRTDVNTGLNLRTTGNTKSDES  145

Query  1706  tvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQH  1527
              +DD  SS+ME++RAKN+L  LQ EL++M  +NQ+LR +L+QVS +YT+LQ HL +LMQ 
Sbjct  146   MIDDGESSEMEDKRAKNELVKLQDELKRMTMDNQKLRELLAQVSNSYTSLQMHLVSLMQQ  205

Query  1526  QNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHT  1347
             Q QQ             + K  E   + EE  VPRQF++L P               S++
Sbjct  206   QQQQQQ---------QNNNKVIEAAEKPEETIVPRQFIDLGPTRAVGE-----AEEASNS  251

Query  1346  TSEERTLSAGS-PRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATM  1170
             +SEE+T S GS P    +   R +  + RE+SP++ES    K+   NP+     AAEATM
Sbjct  252   SSEEKTRSGGSSPAERRSNEVRDRKRLGREESPETESNKIQKVNSTNPATFDQSAAEATM  311

Query  1169  RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAED  990
             RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAED
Sbjct  312   RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQRCAED  371

Query  989   RTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN-TNFLARAILPCS  813
             R+ILITTYEG HNHPLPPAA+AMASTT+AAANMLLSG+M S DGMMN TN LARA+LPCS
Sbjct  372   RSILITTYEGNHNHPLPPAAVAMASTTTAAANMLLSGSMSSHDGMMNPTNLLARAVLPCS  431

Query  812   SSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAP-----------QIPQ-  669
             +S+ATISASAPFPTVTLDLT +P        PP     P + A            Q PQ 
Sbjct  432   TSMATISASAPFPTVTLDLTHSP--------PPANGSNPSSSAAATTNNDHNLLMQRPQQ  483

Query  668   ------NYP--QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqh  513
                   N P   LP V GQ LYNQSKFSGL  S+                    A   Q 
Sbjct  484   QQQQMANLPPGMLPHVIGQALYNQSKFSGLQFSN---------------GSPSAAAYSQS  528

Query  512   pLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                ADT++    A+T+DPNFTAALAA ISS++ G
Sbjct  529   NAVADTIT----ALTADPNFTAALAAVISSMING  558



>ref|XP_006391908.1| hypothetical protein EUTSA_v10023390mg [Eutrema salsugineum]
 gb|ESQ29194.1| hypothetical protein EUTSA_v10023390mg [Eutrema salsugineum]
Length=556

 Score =   348 bits (892),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 267/514 (52%), Positives = 314/514 (61%), Gaps = 79/514 (15%)
 Frame = -1

Query  1859  RGPPNEVDFFSDKKADIV----------VKKEITLHGEPVTKADLNTGLQL-VIANsgsd  1713
             R  P EVDFFSD+K+ +           VKKE     E   +  +NTGL L    N+ SD
Sbjct  78    REVPGEVDFFSDRKSIVCGDDVDDPRARVKKE-----EQDDQTHVNTGLNLRTTGNTRSD  132

Query  1712  kstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLM  1533
             +S VDD  SS+ME++RAKN+L  LQ EL++M  EN +LR +L+QVS NYT+LQ HL +LM
Sbjct  133   QSVVDDGESSEMEDKRAKNELVKLQDELKEMTMENHKLRELLTQVSNNYTSLQMHLVSLM  192

Query  1532  QHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQS  1353
             Q Q QQ+  I + +  E              E  VPRQF+ L P   A  A        S
Sbjct  193   QQQ-QQNKVIEAAEKPE--------------ETIVPRQFINLGPSRAAGEAEDV-----S  232

Query  1352  HTTSEERTLSAGS----PRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQA  1185
             +++SEERT S GS     R+N     R    + RE+SP++ES    +    +     DQ+
Sbjct  233   NSSSEERTRSGGSSAAEKRSNEI---RDGKRLGREESPETES-NKVQKVNNSSPSTFDQS  288

Query  1184  AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQ  1005
              EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQ
Sbjct  289   TEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQ  348

Query  1004  RCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN-TNFLARA  828
             RCAEDR+ILITTYEG H HPLPPAA+AMASTT+AAANMLLSG+M S DGMMN TN LARA
Sbjct  349   RCAEDRSILITTYEGNHIHPLPPAAVAMASTTTAAANMLLSGSMSSHDGMMNPTNLLARA  408

Query  827   ILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQ-------------FQAPFTG  687
             +LPCS+S+ATISASAPFPTVTLDLT  P+         +               Q P   
Sbjct  409   VLPCSTSMATISASAPFPTVTLDLTHAPSPPNGSNSSSSTAAATTNNNNHNSLMQRPQQH  468

Query  686   APQIPQNYP--QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqh  513
               Q   N P   LP V GQ LYNQSKFSGL  S                     A   Q 
Sbjct  469   QQQQMTNLPPGMLPHVIGQALYNQSKFSGLQFS---------------GGSPSAAAFSQP  513

Query  512   pLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                ADT+    AA+T+DPNFTA LAA ISS++ G
Sbjct  514   TAVADTI----AALTADPNFTAVLAAVISSMING  543



>ref|XP_002302873.1| hypothetical protein POPTR_0002s21330g [Populus trichocarpa]
 gb|EEE82146.1| hypothetical protein POPTR_0002s21330g [Populus trichocarpa]
Length=613

 Score =   349 bits (896),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 264/511 (52%), Positives = 325/511 (64%), Gaps = 56/511 (11%)
 Frame = -1

Query  1862  KRGPPNEVDFFSDKKADI----VVKK---EITLHGEPV-TKADLNTGLQLVIANsgsdks  1707
             +R   +E+DFF+DKK D+    ++     ++   G P   + ++NTGL L+  N+ S++S
Sbjct  92    RRTVIDEMDFFADKKHDVDRMTIINNGTGDLKDSGSPAGLELNVNTGLNLLTTNTSSEQS  151

Query  1706  tvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQH  1527
             TVDD VSS+ME++RAK++L+VL+ E+E+M  EN RL+GML+ V++NY ALQ  L  LMQ 
Sbjct  152   TVDDGVSSNMEDKRAKSELAVLRAEVERMKVENLRLKGMLNHVTSNYNALQMDLVTLMQD  211

Query  1526  QN---QQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEA--  1362
             QN   +   R G  +D  V                VPRQ ++L     A      D +  
Sbjct  212   QNSHHKNEQRDGKNKDDGV----------------VPRQCMDLGLVAAAGGDDTDDHSLS  255

Query  1361  -SQSHTTSEERTLSAGSPRNNNTELS----RHKGIIAREDSPDSESWApnklpklnpskP  1197
              S+     +    S  +  NNN + +      KG   RE+SPD + W  NK  + N +K 
Sbjct  256   TSEGGRRRDRSRSSGNNAENNNEDGTVFEQDKKGTDQREESPD-QGWGSNKAARFNSTKT  314

Query  1196  VDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVR  1017
             VDQ  EAT+RKARVSVRARSE   ISDGCQWRKYGQKMAKGNPCPRAYYRCTMA GCP  
Sbjct  315   VDQT-EATIRKARVSVRARSEDATISDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCP--  371

Query  1016  KQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFL  837
               VQRCAEDRTIL TTYEG H+HPLPPAA AMASTTS+AA MLLSG+M S DG+MN+NFL
Sbjct  372   --VQRCAEDRTILTTTYEGNHSHPLPPAATAMASTTSSAARMLLSGSMSSTDGLMNSNFL  429

Query  836   ARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQN---  666
              R ILPCSSS+ATISASAPFPTVTLDLTQ P+ L    + P QFQ PF   P  PQN   
Sbjct  430   TRTILPCSSSLATISASAPFPTVTLDLTQNPSPL-QLPKQPIQFQFPF---PNPPQNLAT  485

Query  665   ---YPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADT  495
                   LPQ+ GQ LYNQSK  GL +S +       Q  +L  Q Q      Q    AD+
Sbjct  486   ASAAALLPQILGQALYNQSKSFGLQMSQE------MQPNRLDHQSQPALQQGQKNSLADS  539

Query  494   LSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
             L+ ATAAI +DPNFTAALAAAI+SI+GG  Q
Sbjct  540   LTTATAAIAADPNFTAALAAAITSIIGGAHQ  570



>ref|XP_004171898.1| PREDICTED: probable WRKY transcription factor 42-like, partial 
[Cucumis sativus]
Length=453

 Score =   343 bits (880),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 252/494 (51%), Positives = 308/494 (62%), Gaps = 66/494 (13%)
 Frame = -1

Query  1841  VDFF-SDKKADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvssDMEERR  1665
             ++FF SD K+ ++      L    +   ++NTGL L+  NS S             ++  
Sbjct  1     MNFFPSDDKSRVLSASHSNLTPTKL-PFNVNTGLNLLTTNSCS-------------DQSM  46

Query  1664  AKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDR  1485
               +  +VLQ ELE++N+EN RL+ ML+QV++NY  LQ   + L+Q   Q++  +G   + 
Sbjct  47    VDDGRAVLQAELERINSENLRLKDMLNQVTSNYQTLQMQFNTLIQ--TQKTEDVGDPIEE  104

Query  1484  E-----VADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTT--SEERTL  1326
                        +           VPRQF++L    G A   + DEAS S +   S ER+ 
Sbjct  105   NPDGSGGGGNNNNNNNTNISNKLVPRQFMDL----GLATNTENDEASMSSSEGRSGERSR  160

Query  1325  SAGSPRNNNTELSRHKGIIAREDSPD-SESWApnklp--------klnpskPVDQAAEAT  1173
             S G    N  E++  K       SPD S +W  N             +  K VDQ  EAT
Sbjct  161   SPG----NTGEVASSK-----RQSPDQSSNWGSNNNNNNNKVPKFSSSSGKEVDQT-EAT  210

Query  1172  MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAE  993
             MRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA+GCPVRKQVQRCAE
Sbjct  211   MRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMALGCPVRKQVQRCAE  270

Query  992   DRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCS  813
             D+TILITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+M SADG+MN+NFLAR +LPCS
Sbjct  271   DKTILITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMSSADGLMNSNFLARTLLPCS  330

Query  812   SSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQG  633
             SS+ATISASAPFPTVTLDLTQTPN  P +QRP T        A   PQ +   PQ+FG  
Sbjct  331   SSMATISASAPFPTVTLDLTQTPN--PLFQRPATGHFPIPFAAAAPPQTF---PQIFGHA  385

Query  632   LYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNF  453
             LYNQSKFSGL +S +D+             +    PPP    F DTLSAA AAI SDPNF
Sbjct  386   LYNQSKFSGLQMS-KDM-------------EAPQPPPPPQNPFTDTLSAAGAAIASDPNF  431

Query  452   TAALAAAISSIMGG  411
              AALA A++S++GG
Sbjct  432   IAALATAMTSLIGG  445



>ref|XP_009388735.1| PREDICTED: probable WRKY transcription factor 31 [Musa acuminata 
subsp. malaccensis]
Length=562

 Score =   346 bits (888),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 271/495 (55%), Positives = 327/495 (66%), Gaps = 20/495 (4%)
 Frame = -1

Query  1871  AAEKRGPPNEVDFFSDKKADIVVKKEITLHGEPVTKADL--NTGLQLVIANsgsdkstvd  1698
             + E R   NE+DFFSD++   V K E  L  + VT+ DL  NTGL L+ AN+GSD+STVD
Sbjct  47    SGENRPVVNEMDFFSDERWKAVSKVEPDLDLK-VTREDLTINTGLNLLTANAGSDQSTVD  105

Query  1697  dsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQ  1518
             D +S   + +  K++L+ +Q EL +   ENQ+L   L+Q++ +Y ALQ HL  LMQ Q+Q
Sbjct  106   DGMSPADDSKENKSELAAMQAELARTKEENQKLNETLNQLTASYNALQMHLIALMQQQHQ  165

Query  1517  QSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSE  1338
                     Q  E AD K +    E     VPRQF++L P   A   + +  AS+   +S 
Sbjct  166   PKR---DPQAHEAADEKGQATNHEHGGVLVPRQFMDLGPAAEADEPSHSSTASRDQPSSP  222

Query  1337  ERTLSAGSP-RNNNTELSR-HKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRK  1164
                +  GS  R  + +++R  +   +REDSPD + W P+K PKL+PSK  +Q  EA MRK
Sbjct  223   PDNVEVGSKDRQLHKQIARPDRAKSSREDSPD-QGWNPSKDPKLSPSKSTEQVQEAIMRK  281

Query  1163  ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT  984
             ARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA  CPVRKQVQRCAEDR+
Sbjct  282   ARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMATACPVRKQVQRCAEDRS  341

Query  983   ILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSV  804
             ILITTYEGTHNHPLPPAAMAMASTTSAA +MLLSG+M S +G+MN NFLAR ILP SSS+
Sbjct  342   ILITTYEGTHNHPLPPAAMAMASTTSAAVSMLLSGSMSSPEGLMNPNFLARTILPYSSSM  401

Query  803   ATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLP-QVFGQGLY  627
             ATISASAPFPTVTLDLT   N+L   QRPP QF   F G           P Q+ GQ L+
Sbjct  402   ATISASAPFPTVTLDLTHNTNAL-QLQRPPAQFPLSFPGVAATAAAGFIAPSQIMGQALH  460

Query  626   NQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTA  447
             NQS FSGL +             + A      A        ADT+SAATAAIT+DPNFTA
Sbjct  461   NQSNFSGLQM---------PVGMEAAHLLHPKAQSALPSTLADTVSAATAAITADPNFTA  511

Query  446   ALAAAISSIMGGGSQ  402
             ALAAAISSI+ G  Q
Sbjct  512   ALAAAISSIISGNHQ  526



>gb|EEE54229.1| hypothetical protein OsJ_01092 [Oryza sativa Japonica Group]
Length=593

 Score =   345 bits (886),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 268/518 (52%), Positives = 314/518 (61%), Gaps = 63/518 (12%)
 Frame = -1

Query  1844  EVDFFSDKKADI-------VVKKEI------TLHGEPVTKADLNTGLQLVIANsgsdkst  1704
             EVDFFSD+K ++        V  E          G  + K DL   L     N+ SD+S 
Sbjct  59    EVDFFSDEKKNMKKSRVSGCVAAEADDAKGPAAAGLAIKKEDLTINLLPAGNNARSDRSM  118

Query  1703  vddsvssDM----EERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNL  1536
             V D  ++      E+ R+ N+L+ +Q EL +MN ENQRLRGML+QV+T+Y ALQ HL  L
Sbjct  119   VVDDDAASRPDHEEKSRSSNELAAMQAELGRMNEENQRLRGMLTQVTTSYQALQMHLVAL  178

Query  1535  MQHQNQQ-SSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEAS  1359
             MQ + Q               D K+E          VPRQFL+L P  GA   A  +E S
Sbjct  179   MQQRPQMMQPPTQPEPPPPHQDGKAEGA-------VVPRQFLDLGPSSGAGGEA-AEEPS  230

Query  1358  QSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApn-----------klpkl  1212
              S T        AGSPR +++  ++ +    R DSPD+ S A                  
Sbjct  231   NSST-------EAGSPRRSSSTGNKDQ---ERGDSPDAPSTAAAWLPGRAMAPQMGAAGA  280

Query  1211  npskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAV  1032
                    QA +A MRKARVSVRARSEAP+I+DGCQWRKYGQKMAKGNPCPRAYYRCTMA 
Sbjct  281   AGKSHDQQAQDANMRKARVSVRARSEAPIIADGCQWRKYGQKMAKGNPCPRAYYRCTMAT  340

Query  1031  GCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSAD---  861
             GCPVRKQVQRCAEDR+ILITTYEGTHNHPLPPAAMAMASTTSAAA+MLLSG+MPSAD   
Sbjct  341   GCPVRKQVQRCAEDRSILITTYEGTHNHPLPPAAMAMASTTSAAASMLLSGSMPSADGAA  400

Query  860   GMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNY--------QRPPTQF  705
             G+M++NFLAR +LPCSSS+ATISASAPFPTVTLDLT  P   PN           P  QF
Sbjct  401   GLMSSNFLARTVLPCSSSMATISASAPFPTVTLDLTHAPPGAPNAVPLNAARPGAPAPQF  460

Query  704   QAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpap  525
             Q P  G    P  +   PQV    LYNQSKFSGL +S     AAAA AA     Q  P  
Sbjct  461   QVPLPGGGMAPA-FAVPPQV----LYNQSKFSGLQMSSDSAEAAAAAAAAAQFAQPRPPI  515

Query  524   ppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                    +DT+SAA  AIT+DPNFT ALAAAI+SI+GG
Sbjct  516   GQLPGPLSDTVSAAEEAITADPNFTVALAAAITSIIGG  553



>ref|XP_003540834.1| PREDICTED: probable WRKY transcription factor 31-like [Glycine 
max]
Length=614

 Score =   344 bits (882),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 249/513 (49%), Positives = 308/513 (60%), Gaps = 51/513 (10%)
 Frame = -1

Query  1844  EVDFFSDKKADIVVKKEITLHGE--------------PVTKADLNTGLQLVIANsgsdks  1707
             E+DFFS+K +       I                   P     +NT L L+  N+ SD+S
Sbjct  89    EMDFFSNKNSTKDDDNNIVAAAGSASLPDNDHHSISPPTLDLKVNTCLNLLTTNASSDQS  148

Query  1706  tvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQH  1527
              V+D +S + E++  K +++ LQ +LE++  ENQ+LR  L +V+TNY ALQ H  N+MQ 
Sbjct  149   MVEDEISPNSEDKETKKEMADLQGDLERIKRENQKLRDTLDEVNTNYNALQMHFMNMMQE  208

Query  1526  QNQQSSRIGSTQDREVADRK--SeekkpekeePTVPRQFLEL-------VPgggaaaaAQ  1374
             +  +    G  Q +EV+D K   +++        V RQF++L        P   +     
Sbjct  209   RKGEE---GEDQ-QEVSDGKVKEKKQGQSGGGVLVSRQFMDLGLASADIEPSSSSGGIRS  264

Query  1373  TDEASQSHTTSEERTLSAGSPRNNNT----ELSRHKGIIAREDSPDSESWApnklpklnp  1206
              D +   +     + L   +   NN+    E   +   I  EDSP   +    +    + 
Sbjct  265   QDRSGSPNIDVASKGLGTSNNDGNNSVNDEEEKEYDRGIESEDSPSGHADKVPRFSSPSK  324

Query  1205  skPVDQA-AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVG  1029
             +  VDQA AEATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA G
Sbjct  325   NNNVDQAEAEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAAG  384

Query  1028  CPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN  849
             CPVRKQVQRCAEDRT+LITTYEG HNHPLPP AMAMA TTS+AA MLLSG+M SAD +MN
Sbjct  385   CPVRKQVQRCAEDRTVLITTYEGNHNHPLPPTAMAMAQTTSSAARMLLSGSMSSADSIMN  444

Query  848   TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSL--PNYQRPPTQFQAPFTGAPQI  675
              +FL R +LPCSSS+ATISASAPFPTVTLDLT +PN L  P  Q  P Q Q    G PQ 
Sbjct  445   ADFLTRTLLPCSSSMATISASAPFPTVTLDLTHSPNPLQFPRQQH-PNQLQ---IGVPQN  500

Query  674   PQNYPQ--LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFA  501
               N P   +PQ+FGQ LYNQSKFSGL +S  D              Q    P    P  A
Sbjct  501   FANSPSSLMPQIFGQALYNQSKFSGLQMSSHDT--------ADPSSQFGYQPHQVPPHLA  552

Query  500   DTLSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
             DT+    AAI +DPNFT+ALAAAI+SI+GG  Q
Sbjct  553   DTVG---AAIATDPNFTSALAAAITSIIGGAQQ  582



>tpg|DAA05066.1| TPA_inf: WRKY transcription factor 1 [Oryza sativa (japonica 
cultivar-group)]
Length=593

 Score =   342 bits (876),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 269/518 (52%), Positives = 314/518 (61%), Gaps = 63/518 (12%)
 Frame = -1

Query  1844  EVDFFSDKK-------------ADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkst  1704
             EVDFFSD+K             A+    K     G  + K DL   L     N+ SD+S 
Sbjct  59    EVDFFSDEKKNMKKSRVSGGVAAEADDAKGPAAAGLAIKKEDLTINLLPAGNNARSDRSM  118

Query  1703  vddsvssDM----EERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNL  1536
             V D  ++      E+ R+ N+L+ +Q EL +MN ENQRLRGML+QV+T+Y ALQ HL  L
Sbjct  119   VVDDDAASRPDHEEKSRSSNELAAMQAELGRMNEENQRLRGMLTQVTTSYQALQMHLVAL  178

Query  1535  MQHQNQQ-SSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEAS  1359
             MQ + Q               D K+E          VPRQFL+L P  GA   A  +E S
Sbjct  179   MQQRPQMMQPPTQPEPPPPHQDGKAEGA-------VVPRQFLDLGPSSGAGGEA-AEEPS  230

Query  1358  QSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApn-----------klpkl  1212
              S T        AGSPR +++  ++ +    R DSPD+ S A                  
Sbjct  231   NSST-------EAGSPRRSSSTGNKDQ---ERGDSPDAPSTAAAWLPGRAMAPQMGAAGA  280

Query  1211  npskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAV  1032
                    QA +A MRKARVSVRARSEAP+I+DGCQWRKYGQKMAKGNPCPRAYYRCTMA 
Sbjct  281   AGKSHDQQAQDANMRKARVSVRARSEAPIIADGCQWRKYGQKMAKGNPCPRAYYRCTMAT  340

Query  1031  GCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSAD---  861
             GCPVRKQVQRCAEDR+ILITTYEGTHNHPLPPAAMAMASTTSAAA+MLLSG+MPSAD   
Sbjct  341   GCPVRKQVQRCAEDRSILITTYEGTHNHPLPPAAMAMASTTSAAASMLLSGSMPSADGAA  400

Query  860   GMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNY--------QRPPTQF  705
             G+M++NFLAR +LPCSSS+ATISASAPFPTVTLDLT  P   PN           P  QF
Sbjct  401   GLMSSNFLARTVLPCSSSMATISASAPFPTVTLDLTHAPPGAPNAVPLNAARPGAPAPQF  460

Query  704   QAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpap  525
             Q P  G    P  +   PQV    LYNQSKFSGL +S     AAAA AA     Q  P  
Sbjct  461   QVPLPGGGMAPA-FAVPPQV----LYNQSKFSGLQMSSDSAEAAAAAAAAAQFAQPRPPI  515

Query  524   ppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                    +DT+SAA AAIT+DPNFT ALAAAI+SI+GG
Sbjct  516   GQLPGPLSDTVSAAAAAITADPNFTVALAAAITSIIGG  553



>ref|XP_009390745.1| PREDICTED: WRKY transcription factor 6-like [Musa acuminata subsp. 
malaccensis]
Length=511

 Score =   336 bits (861),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 231/438 (53%), Positives = 284/438 (65%), Gaps = 51/438 (12%)
 Frame = -1

Query  1676  EERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSR---  1506
             +++  +N+L+ +QVEL +MN ENQ+LR +LSQV  +Y+AL+ HL+ L + ++Q+++    
Sbjct  104   DDKEGRNELAAMQVELARMNEENQKLRLLLSQVRASYSALEMHLATLTRQRHQRNNESWK  163

Query  1505  -------IGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHT  1347
                    +G+T D    DR              PR F+EL P        + D+ S S T
Sbjct  164   AREVIEVMGATVDAMNRDRG---------RVIFPRHFMELGPVA------EEDKPSNSST  208

Query  1346  TSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMR  1167
              S  R+    SP  +N        ++ + D     SW  NK  KL P+K  +Q   ATMR
Sbjct  209   ASPGRS----SPPPDN--------LLYKNDENLDPSWNTNKALKLFPTKTAEQTPVATMR  256

Query  1166  KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDR  987
             KARVSVRARSEA MI+DGC WRKYGQK+AKGNPCPRAYYRCTMA GCPVRKQVQRCA+DR
Sbjct  257   KARVSVRARSEATMIADGCHWRKYGQKIAKGNPCPRAYYRCTMATGCPVRKQVQRCADDR  316

Query  986   TILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSS  807
             +ILITTYEG HNHPLPPAAMAM STTSAAA+MLLSG+M S DG+MN+NFLA  +LPCSSS
Sbjct  317   SILITTYEGNHNHPLPPAAMAMKSTTSAAASMLLSGSMTSTDGLMNSNFLASTVLPCSSS  376

Query  806   VATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPF--TGAPQIPQNYPQLPQVFGQG  633
             +AT+SASAPFPTVTLDLTQ PN L + + P  QF  PF   GAP  PQ+   LP V GQ 
Sbjct  377   MATVSASAPFPTVTLDLTQDPNPLLSKRPPAAQFHFPFPSGGAPPQPQS---LPHVHGQK  433

Query  632   LYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNF  453
             L NQS FS    S Q            +Q  Q  A P   P   + +SAATAAIT+DPNF
Sbjct  434   LLNQSAFSEFQTSPQ---------MAASQLPQQRAQPVVPPSLTEAVSAATAAITADPNF  484

Query  452   TAALAAAISSIMGGGSQP  399
              AALA AI S++GGG +P
Sbjct  485   AAALADAIKSVIGGGHRP  502



>gb|EEC70308.1| hypothetical protein OsI_01154 [Oryza sativa Indica Group]
Length=590

 Score =   338 bits (866),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 267/518 (52%), Positives = 313/518 (60%), Gaps = 66/518 (13%)
 Frame = -1

Query  1844  EVDFFSDKK-------------ADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkst  1704
             EVDFFSD+K             A+    K     G  + K DL   L     N+ SD+S 
Sbjct  59    EVDFFSDEKKNMKKSRVSGGAAAEADDGKGPAAAGLAIKKEDLTINLLPAGNNARSDRSM  118

Query  1703  vddsvssDM----EERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNL  1536
             V D  ++      E+ R+ N+L+ +Q EL +MN ENQRLRGML+QV+T+Y ALQ HL  L
Sbjct  119   VVDDDAASRPDHEEKSRSSNELAAMQAELGRMNEENQRLRGMLTQVTTSYQALQMHLVAL  178

Query  1535  MQHQNQQ-SSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEAS  1359
             MQ + Q               D K+E          VPRQFL+L P  GA   A  +E S
Sbjct  179   MQQRPQMMQPPTQPEPPPPHQDGKAEGA-------VVPRQFLDLGPSSGAGGEA-AEEPS  230

Query  1358  QSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApn-----------klpkl  1212
              S T        AGSPR +++  ++ +    R DSPD+ S A                  
Sbjct  231   NSST-------EAGSPRRSSSTGNKDQ---ERGDSPDAPSTAAAWLPGRAMAPQMGAAGA  280

Query  1211  npskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAV  1032
                    QA +A MRKARVSVRARSEAP+I+DGCQWRKYGQKMAKGNPCPRAYYRCTMA 
Sbjct  281   AGKSHDQQAQDANMRKARVSVRARSEAPIIADGCQWRKYGQKMAKGNPCPRAYYRCTMAT  340

Query  1031  GCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSAD---  861
             GCPVRKQVQRCAEDR+ILITTYEGTHNHPLPPAAMAMASTTSAAA+MLLSG+MPSAD   
Sbjct  341   GCPVRKQVQRCAEDRSILITTYEGTHNHPLPPAAMAMASTTSAAASMLLSGSMPSADGAA  400

Query  860   GMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNY--------QRPPTQF  705
             G+M++NFLAR +LPCSSS+ATISASAPFPTVTLDLT  P   PN           P  QF
Sbjct  401   GLMSSNFLARTVLPCSSSMATISASAPFPTVTLDLTHAPPGAPNAVPLNAARPGAPAPQF  460

Query  704   QAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpap  525
             Q P  G    P  +   PQV    LYNQSKFSGL +S     +A A AA     Q  P  
Sbjct  461   QVPLPGGGMAPA-FAVPPQV----LYNQSKFSGLQMSSD---SAEAAAAAAQFAQPRPPI  512

Query  524   ppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                    +DT+SAA AAIT+DPNFT ALAAAI+SI+GG
Sbjct  513   GQLPGPLSDTVSAAAAAITADPNFTVALAAAITSIIGG  550



>ref|XP_008800737.1| PREDICTED: probable WRKY transcription factor 31 [Phoenix dactylifera]
Length=592

 Score =   335 bits (860),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 269/516 (52%), Positives = 330/516 (64%), Gaps = 43/516 (8%)
 Frame = -1

Query  1865  EKRGPPNEVDFFSD--KKADIVVKKEITLHGEPVTKADL--NTGLQLVIANsgsdkstvd  1698
             EKR    E+DFFSD  +K       +  +    + K DL  N GL L+  N+GSD+STV 
Sbjct  62    EKRRVVCEMDFFSDELRKERAPPDPDPDVPDISIKKEDLTINMGLHLLTTNTGSDQSTVV  121

Query  1697  dsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQ  1518
             + +S + E++ +KNDL+ +Q EL +MN ENQRL+ MLS  + N+ +LQ H   LMQ +NQ
Sbjct  122   NGLSLN-EDKESKNDLAAVQAELGRMNQENQRLKSMLSHATNNFNSLQMHFIALMQERNQ  180

Query  1517  QSSRIGSTQDREVADRKSeekkpekeePTVPRQFLEL--VPgggaaaaAQTDEASQSHTT  1344
                R GS Q  E    K  +K+ E E+  VPR+FL L   P    A+ + T+  SQ  + 
Sbjct  181   ---RNGSLQWHEAMHEKMGDKRNEHEDAIVPRRFLNLGLAPLADEASHSPTEGGSQDRSI  237

Query  1343  S---------------EERTLSAGSPRNNNTELSRHKGIIAREDSPD--SESWApnklpk  1215
             S               E        P +      R   +  RE+SP   S+SW PNK   
Sbjct  238   SPPNNVEVMSMDYNVEENYNSKEAVPMDGERSDGRDVRVTFREESPGKVSQSWIPNKAAN  297

Query  1214  lnpskPVDQAA-EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTM  1038
              +PSK  DQ + EAT+RKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTM
Sbjct  298   SSPSKSSDQQSQEATIRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTM  357

Query  1037  AVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADG  858
             A GCPVRKQVQRCAEDR++LITTYEG HNHPLPPAAMA ASTTSAAANMLLSG+M S DG
Sbjct  358   AAGCPVRKQVQRCAEDRSVLITTYEGKHNHPLPPAAMATASTTSAAANMLLSGSMSSTDG  417

Query  857   MMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPF--TGA  684
             +MN++FLA+  LPCSSSVA ISA+APFPTVTLDL  TPN +P ++RP TQFQ PF    A
Sbjct  418   LMNSSFLAKTELPCSSSVAAISAAAPFPTVTLDLAHTPN-VP-FRRPSTQFQVPFPNGAA  475

Query  683   PQIPQNYP-QLPQVFGQGLYNQSKF-SGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhp  510
             P +    P  L   FGQ  +NQSK  SG+ +S           +  +Q         Q  
Sbjct  476   PVLGATPPTSLLLDFGQTFFNQSKLISGVQMS---------PGSDGSQLSHPKVQSVQPS  526

Query  509   LFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
               ADT+SAATAAIT+DP+FTA LAAAI+SI+GGG +
Sbjct  527   SLADTVSAATAAITADPSFTAVLAAAITSIIGGGGK  562



>gb|AAD38283.1|AC007789_9 putative WRKY DNA binding protein [Oryza sativa Japonica Group]
Length=470

 Score =   332 bits (850),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 247/437 (57%), Positives = 284/437 (65%), Gaps = 46/437 (11%)
 Frame = -1

Query  1652  LSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQ-SSRIGSTQDREVA  1476
             L+ +Q EL +MN ENQRLRGML+QV+T+Y ALQ HL  LMQ + Q               
Sbjct  17    LAAMQAELGRMNEENQRLRGMLTQVTTSYQALQMHLVALMQQRPQMMQPPTQPEPPPPHQ  76

Query  1475  DRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNT  1296
             D K+E          VPRQFL+L P  GA   A  +E S S T        AGSPR +++
Sbjct  77    DGKAEGA-------VVPRQFLDLGPSSGAGGEA-AEEPSNSST-------EAGSPRRSSS  121

Query  1295  ELSRHKGIIAREDSPDSESWApnklpklnpskPVD-----------QAAEATMRKARVSV  1149
               ++ +    R DSPD+ S A   LP    +  +            QA +A MRKARVSV
Sbjct  122   TGNKDQ---ERGDSPDAPSTAAAWLPGRAMAPQMGAAGAAGKSHDQQAQDANMRKARVSV  178

Query  1148  RARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITT  969
             RARSEAP+I+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR+ILITT
Sbjct  179   RARSEAPIIADGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQRCAEDRSILITT  238

Query  968   YEGThnhplppaamamasttsaaanmllSGAMPSAD---GMMNTNFLARAILPCSSSVAT  798
             YEGTHNHPLPPAAMAMASTTSAAA+MLLSG+MPSAD   G+M++NFLAR +LPCSSS+AT
Sbjct  239   YEGTHNHPLPPAAMAMASTTSAAASMLLSGSMPSADGAAGLMSSNFLARTVLPCSSSMAT  298

Query  797   ISASAPFPTVTLDLTQTPNSLPNY--------QRPPTQFQAPFTGAPQIPQNYPQLPQVF  642
             ISASAPFPTVTLDLT  P   PN           P  QFQ P  G    P  +   PQV 
Sbjct  299   ISASAPFPTVTLDLTHAPPGAPNAVPLNAARPGAPAPQFQVPLPGGGMAPA-FAVPPQV-  356

Query  641   GQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSD  462
                LYNQSKFSGL +S     AAAA AA     Q  P         +DT+SAA AAIT+D
Sbjct  357   ---LYNQSKFSGLQMSSDSAEAAAAAAAAAQFAQPRPPIGQLPGPLSDTVSAAAAAITAD  413

Query  461   PNFTAALAAAISSIMGG  411
             PNFT ALAAAI+SI+GG
Sbjct  414   PNFTVALAAAITSIIGG  430



>gb|AAT84159.1| transcription factor OsWRKY99 [Oryza sativa Indica Group]
Length=580

 Score =   335 bits (859),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 246/445 (55%), Positives = 284/445 (64%), Gaps = 49/445 (11%)
 Frame = -1

Query  1676  EERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQ-SSRIG  1500
             E+ R+ N+L+ +Q EL +MN ENQRLRGML+QV+T+Y ALQ HL  LMQ + Q       
Sbjct  122   EKSRSSNELAAMQAELGRMNEENQRLRGMLTQVTTSYQALQMHLVALMQQRPQMMQPPTQ  181

Query  1499  STQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSA  1320
                     D K+E          VPRQFL+L P  GA   A  +E S S T        A
Sbjct  182   PEPPPPHQDGKAEGA-------VVPRQFLDLGPSSGAGGEA-AEEPSNSST-------EA  226

Query  1319  GSPRNNNTELSRHKGIIAREDSPDSESWApn-----------klpklnpskPVDQAAEAT  1173
             GSPR +++  ++ +    R DSPD+ S A                         QA +A 
Sbjct  227   GSPRRSSSTGNKDQ---ERGDSPDAPSTAAAWLPGRAMAPQMGAAGAAGKSHDQQAQDAN  283

Query  1172  MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAE  993
             MRKARVSVRARSEAP+I+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAE
Sbjct  284   MRKARVSVRARSEAPIIADGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQRCAE  343

Query  992   DRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSAD---GMMNTNFLARAIL  822
             DR+ILITTYEGTHNHPLPPAAMAMASTTSAAA+MLLSG+MPSAD   G+M++NFLAR +L
Sbjct  344   DRSILITTYEGTHNHPLPPAAMAMASTTSAAASMLLSGSMPSADGAAGLMSSNFLARTVL  403

Query  821   PCSSSVATISASAPFPTVTLDLTQTPNSLPNY--------QRPPTQFQAPFTGAPQIPQN  666
             PCSSS+ATISASAPFPTVTLDLT  P   PN           P  QFQ P  G    P  
Sbjct  404   PCSSSMATISASAPFPTVTLDLTHAPPGAPNAVPLNAARPGAPAPQFQVPLPGGGMAPA-  462

Query  665   YPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSA  486
             +   PQV    LYNQSKFSGL +S      A A AA     Q  P         +DT+SA
Sbjct  463   FAVPPQV----LYNQSKFSGLQMSSDS---AEAAAAAAQFAQPRPPIGQLPGPLSDTVSA  515

Query  485   ATAAITSDPNFTAALAAAISSIMGG  411
             A AAIT+DPNFT ALAAAI+SI+GG
Sbjct  516   AAAAITADPNFTVALAAAITSIIGG  540



>ref|XP_003566323.1| PREDICTED: probable WRKY transcription factor 31 [Brachypodium 
distachyon]
Length=580

 Score =   335 bits (859),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 257/510 (50%), Positives = 304/510 (60%), Gaps = 61/510 (12%)
 Frame = -1

Query  1844  EVDFFSDKKADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvssDM----  1677
             EVDFFSD+K ++  KK     G    +   + G  L I       + +       M    
Sbjct  63    EVDFFSDEKKNM--KKSRVSAGGTDAEGHKDAGAGLAIKKEDLTINLLPGRSDRSMVVDD  120

Query  1676  ----------EERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQH  1527
                         R+  N+L+ +Q EL +MN ENQRLRGML+QV+ +Y ALQ HL  LMQ 
Sbjct  121   DAASRPDNDKNGRQDTNELAAMQAELGRMNEENQRLRGMLTQVTNSYQALQMHLVALMQQ  180

Query  1526  QNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHT  1347
             + Q        Q         + +        VPRQFL+L P G  A +   +E S S T
Sbjct  181   RTQLLPTQPQQQQPPPTHEDGKIEGA-----IVPRQFLDLGPSGAGAGSEVAEEPSNSST  235

Query  1346  TSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESW----ApnklpklnpskPVDQAA-  1182
                      GSPR +++  +         + P +  W    A N+      +K  DQ A 
Sbjct  236   -------EVGSPRRSSSNGNEDPERSDNPEGPSTAGWLPGRAMNQQQLGAAAKGHDQQAQ  288

Query  1181  EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQR  1002
             EATMRKARVSVRARSEAP+I+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQR
Sbjct  289   EATMRKARVSVRARSEAPIIADGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQR  348

Query  1001  CAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSAD---GMMNTNFLAR  831
             CAEDRTILITTYEGTHNHPLPPAAMAMASTTSAAA+MLLSG+MPSAD   G+M++NFLAR
Sbjct  349   CAEDRTILITTYEGTHNHPLPPAAMAMASTTSAAASMLLSGSMPSADGSAGLMSSNFLAR  408

Query  830   AILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQ-----RPPT----QFQAPFTGAPQ  678
              +LPCSSS+ATISASAPFPTVTLDLT  P   PN       RPP     QFQ P  GA  
Sbjct  409   TVLPCSSSMATISASAPFPTVTLDLTHAPPGAPNAMPLSALRPPAPAPGQFQVPLPGAGG  468

Query  677   IPQNYP-QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFA  501
                     +PQ   Q LYNQSKFSGLH+S              +   +   P PQ    +
Sbjct  469   GMAGPTFAMPQ---QMLYNQSKFSGLHMS------------SSSDTAEFAQPRPQMGQLS  513

Query  500   DTLSAATAAITSDPNFTAALAAAISSIMGG  411
             DT+SAA AAIT+DPNFT ALAAAI+SI+GG
Sbjct  514   DTVSAAAAAITADPNFTVALAAAITSIIGG  543



>ref|NP_001042577.1| Os01g0246700 [Oryza sativa Japonica Group]
 dbj|BAF04491.1| Os01g0246700 [Oryza sativa Japonica Group]
Length=580

 Score =   335 bits (858),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 246/445 (55%), Positives = 284/445 (64%), Gaps = 49/445 (11%)
 Frame = -1

Query  1676  EERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQ-SSRIG  1500
             E+ R+ N+L+ +Q EL +MN ENQRLRGML+QV+T+Y ALQ HL  LMQ + Q       
Sbjct  122   EKSRSSNELAAMQAELGRMNEENQRLRGMLTQVTTSYQALQMHLVALMQQRPQMMQPPTQ  181

Query  1499  STQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSA  1320
                     D K+E          VPRQFL+L P  GA   A  +E S S T        A
Sbjct  182   PEPPPPHQDGKAEGA-------VVPRQFLDLGPSSGAGGEA-AEEPSNSST-------EA  226

Query  1319  GSPRNNNTELSRHKGIIAREDSPDSESWApn-----------klpklnpskPVDQAAEAT  1173
             GSPR +++  ++ +    R DSPD+ S A                         QA +A 
Sbjct  227   GSPRRSSSTGNKDQ---ERGDSPDAPSTAAAWLPGRAMAPQMGAAGAAGKSHDQQAQDAN  283

Query  1172  MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAE  993
             MRKARVSVRARSEAP+I+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAE
Sbjct  284   MRKARVSVRARSEAPIIADGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQRCAE  343

Query  992   DRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSAD---GMMNTNFLARAIL  822
             DR+ILITTYEGTHNHPLPPAAMAMASTTSAAA+MLLSG+MPSAD   G+M++NFLAR +L
Sbjct  344   DRSILITTYEGTHNHPLPPAAMAMASTTSAAASMLLSGSMPSADGAAGLMSSNFLARTVL  403

Query  821   PCSSSVATISASAPFPTVTLDLTQTPNSLPNY--------QRPPTQFQAPFTGAPQIPQN  666
             PCSSS+ATISASAPFPTVTLDLT  P   PN           P  QFQ P  G    P  
Sbjct  404   PCSSSMATISASAPFPTVTLDLTHAPPGAPNAVPLNAARPGAPAPQFQVPLPGGGMAPA-  462

Query  665   YPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSA  486
             +   PQV    LYNQSKFSGL +S      A A AA     Q  P         +DT+SA
Sbjct  463   FAVPPQV----LYNQSKFSGLQMSSDS---AEAAAAAAQFAQPRPPIGQLPGPLSDTVSA  515

Query  485   ATAAITSDPNFTAALAAAISSIMGG  411
             A AAIT+DPNFT ALAAAI+SI+GG
Sbjct  516   AAAAITADPNFTVALAAAITSIIGG  540



>gb|KDO78306.1| hypothetical protein CISIN_1g007099mg [Citrus sinensis]
Length=386

 Score =   328 bits (840),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 228/375 (61%), Positives = 260/375 (69%), Gaps = 43/375 (11%)
 Frame = -1

Query  1430  VPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPR------------NNNTEL-  1290
             VPRQF+ L P        +TD    + ++ EERTLS   P             N   E+ 
Sbjct  2     VPRQFIGLGPSA------ETDHEVSNCSSDEERTLSGTPPNIVEAASKEHVNSNGKNEIV  55

Query  1289  -------------SRHKGIIAREDSPDSES--WA-pnklpklnpskPVDQAAEATMRKAR  1158
                          + +   I RE+SP+SE+  W   NK+ KL+ +K +DQ+ EATMRKAR
Sbjct  56    SFDDQAAAAAAAENSNGKRIGREESPESETQGWGPNNKVQKLSSAKGIDQSNEATMRKAR  115

Query  1157  VSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTIL  978
             VSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTIL
Sbjct  116   VSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTIL  175

Query  977   ITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVAT  798
             ITTYEG HNHPLPPAAMAMASTT+AAA+MLLSG+M SADG+MN N LARAILPCSSS+AT
Sbjct  176   ITTYEGNHNHPLPPAAMAMASTTTAAASMLLSGSMSSADGIMNPNLLARAILPCSSSMAT  235

Query  797   ISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQ--IPQNYPQLPQVFGQGLYN  624
             ISASAPFPTVTLDLT +PN L   QR   QFQ  F G PQ        QLPQVFGQ LYN
Sbjct  236   ISASAPFPTVTLDLTHSPNPL-QLQRQAAQFQVQFPGQPQNLASVTNTQLPQVFGQALYN  294

Query  623   QSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAA  444
             QSKFSGL +S Q+I + +   +          P       ADT+SAATAAIT+DPNFTAA
Sbjct  295   QSKFSGLQLS-QNIGSNSQSGSHQTLPPPLQQPQQL----ADTVSAATAAITADPNFTAA  349

Query  443   LAAAISSIMGGGSQP  399
             LAAAI+SI+GG   P
Sbjct  350   LAAAITSIIGGAQNP  364



>emb|CDM82460.1| unnamed protein product [Triticum aestivum]
Length=576

 Score =   334 bits (856),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 257/512 (50%), Positives = 309/512 (60%), Gaps = 66/512 (13%)
 Frame = -1

Query  1844  EVDFFSDKKADIVV------------KKEITLHGEPVTKADLNTGLQLVIANsgsdkstv  1701
             EVDFFSD+K ++              K + +  G  + K DL   + L+  N+     ++
Sbjct  59    EVDFFSDEKKNMKKSRASAGADAEDHKDQASAAGLAIKKEDLT--INLLPGNNTRSDRSM  116

Query  1700  ddsvssDM---EERRAKN--DLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNL  1536
                        ++R  +N  +L+V+Q EL +MN ENQRLRGML+QV+ +Y ALQ HL  L
Sbjct  117   VVDDDGASRADQDRNGRNTGELAVIQAELSRMNEENQRLRGMLTQVNNSYHALQMHLVAL  176

Query  1535  MQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQ  1356
             MQ Q  Q   +   Q     D K+       E   VPRQFL L P G +      D A +
Sbjct  177   MQ-QRTQMPPVQPQQPPTHEDGKN-------ESAIVPRQFLGLGPSGAS-----ADVAEE  223

Query  1355  SHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPV------  1194
                +S E     GSPR +++  +         D P +  W P +       + +      
Sbjct  224   PSNSSTE----VGSPRRSSSNGNEDPERGENPDGPSTAGWLPGRGMSQQQQQQLGAAAKG  279

Query  1193  --DQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPV  1020
                QA EATMRKARVSVRARSEAP+I+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPV
Sbjct  280   HDQQAQEATMRKARVSVRARSEAPIIADGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPV  339

Query  1019  RKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSAD--GMMNT  846
             RKQVQRCAEDRTILITTYEGTHNHPLPPAAMAMASTTSAAA+MLLSG+MPSAD  G+M++
Sbjct  340   RKQVQRCAEDRTILITTYEGTHNHPLPPAAMAMASTTSAAASMLLSGSMPSADGAGLMSS  399

Query  845   NFLARAILPCSSSVATISASAPFPTVTLDLTQ----TPNSLP-NYQRP--PTQFQAPFTG  687
             NFLAR +LPCSSS+ATISASAPFPTVTLDLT      PN++P N  RP  P QF  P  G
Sbjct  400   NFLARTVLPCSSSMATISASAPFPTVTLDLTHAPPGAPNAMPLNVARPHAPGQFHVPMPG  459

Query  686   APQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpL  507
                 P  +   P +    LYNQSKFSGL +S   +           Q  Q   P      
Sbjct  460   GGMAPA-FAMPPHM----LYNQSKFSGLQMSSDSV--------DAGQFAQPRPPMGLPGQ  506

Query  506   FADTLSAATAAITSDPNFTAALAAAISSIMGG  411
              +DT+SAA AAIT+DPNFT ALAAAISSIM G
Sbjct  507   LSDTVSAAAAAITADPNFTVALAAAISSIMAG  538



>ref|XP_003526336.1| PREDICTED: probable WRKY transcription factor 31-like [Glycine 
max]
Length=628

 Score =   334 bits (857),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 245/475 (52%), Positives = 303/475 (64%), Gaps = 37/475 (8%)
 Frame = -1

Query  1775  PVTKADLNTG-LQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRL  1599
             P  +  LNTG L L+  N+ SD+S VDD +S + E++RAKN+++VLQ +LE+M  ENQ+L
Sbjct  124   PTLEFKLNTGGLNLLTTNTNSDQSMVDDEISPNSEDKRAKNEMAVLQADLERMKRENQKL  183

Query  1598  RGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQ  1419
             R  L +V+TNY+ALQ H  NLMQ +  +       ++    ++K +  +   +   VPRQ
Sbjct  184   RDSLDEVTTNYSALQMHFMNLMQERKGEEGEE-EQEEVYGGEKKQQLGESGGDGILVPRQ  242

Query  1418  FLELVPgggaaaaAQTDEASQSHTTSEERTLS-----AGSPRNNNTELSRH---KGIIAR  1263
             F++L        +   + +S S   S++R+ S     A      N E  +    +GI   
Sbjct  243   FMDLGLAANNGTSTGIEPSSSSGGRSQDRSRSPNVEVASKELGTNDEEEKKEYGRGIERE  302

Query  1262  EDSPDSESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKM  1083
             +DSP   +    +      +  V+  AEATMRKARVSVRARSE PMI+DGCQWRKYGQKM
Sbjct  303   DDSPSGHAHKVPRFSPPKDNNSVE--AEATMRKARVSVRARSETPMIADGCQWRKYGQKM  360

Query  1082  AKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsa  903
             AKGNPCPRAYYRC+MA  CPVRKQVQRCAEDRT+LITTYEG HNHPLPP AMAMA TTS+
Sbjct  361   AKGNPCPRAYYRCSMASACPVRKQVQRCAEDRTVLITTYEGNHNHPLPPTAMAMAQTTSS  420

Query  902   aanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSL--PN  729
             AA MLLSG+M SAD +MN NFL   +LPCSSS+ATISASAPFPTVTLDLT +PN L  P 
Sbjct  421   AARMLLSGSMSSADSIMNANFLTGTLLPCSSSMATISASAPFPTVTLDLTHSPNPLQFPR  480

Query  728   YQRPPTQFQAPFTGAPQIPQNYPQ------LPQVFGQGLY-NQSKFSGLHV--SHQDIaa  576
              Q  P Q Q    G PQ   N+        LPQ+FGQ LY NQSKFSGL +  SH D   
Sbjct  481   QQH-PNQLQ---IGVPQ--NNFANSPAASLLPQIFGQALYNNQSKFSGLQMSSSHYD---  531

Query  575   aaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
               A  +      Q P      P  ADT+    AAI +DPNFTAALAAAI+SI+GG
Sbjct  532   --ADPSSQFGNNQLPPHQVVPPHLADTVG---AAIATDPNFTAALAAAITSIIGG  581



>ref|XP_009404403.1| PREDICTED: probable WRKY transcription factor 31 [Musa acuminata 
subsp. malaccensis]
Length=557

 Score =   332 bits (851),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 262/495 (53%), Positives = 321/495 (65%), Gaps = 47/495 (9%)
 Frame = -1

Query  1844  EVDFFSDKKADI--VVKKEITLHGEPVT---KADLN--TGLQLVIANsgsdkstvddsvs  1686
             E+DFFS ++ D   +V+ ++ L    +T   K DL   TGL L   N+GSD+STVDD +S
Sbjct  72    EMDFFSGERKDTTSLVEPDLDLKVPSLTRIKKEDLTIQTGLHLHTGNTGSDQSTVDDGLS  131

Query  1685  sDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSR  1506
              + ++   KN+L+ +Q EL +MN ENQ+LRG+LSQV+TN+ ALQ HL+ LMQ ++ QS  
Sbjct  132   RNEDDEEGKNELAAMQAELARMNEENQKLRGILSQVTTNFNALQMHLATLMQQRSHQSHE  191

Query  1505  IGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTL  1326
               + Q+ E  D K++ K        VP+QF++L P           E S S T S +R+ 
Sbjct  192   --TPQEHEAMDVKTDAKNDGHGGVLVPKQFMDLGPAVNDV------EPSNSSTVSPDRSA  243

Query  1325  SAGSPRNNNTELSRHKGIIARED--SPDSESWApnklpklnpskPVDQAAEATMRKARVS  1152
             S  +    N E+      + + D  S   ++W      K     P +QA EATMRKARVS
Sbjct  244   SPPA----NVEVGSMGYDLHKNDGRSTSDQTW---NPNKALKLNPTNQAQEATMRKARVS  296

Query  1151  VRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILIT  972
             VRARSEAPMI+DGCQWRKYGQKMAKGNPCP+AYYRCTMA  CPVRKQVQRCA+DR+ILIT
Sbjct  297   VRARSEAPMITDGCQWRKYGQKMAKGNPCPKAYYRCTMASACPVRKQVQRCADDRSILIT  356

Query  971   TYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATIS  792
             TYEGTHNHPLPPAAMAMASTTSAAA+MLLSG+M S DG+MN+NF AR  LPCSSSVAT+S
Sbjct  357   TYEGTHNHPLPPAAMAMASTTSAAASMLLSGSMWSTDGLMNSNFPARTTLPCSSSVATVS  416

Query  791   ASAPFPTVTLDLTQTPNSLPNYQRPPTQ-FQAPFTG---APQIPQNYPQLPQVFGQGLYN  624
             ASAPFPTVTLDLT+ PN L  YQRPPT  F  PF G   A   P   P LPQ+FGQ L  
Sbjct  417   ASAPFPTVTLDLTKNPNPL-QYQRPPTGPFSVPFPGVSPAFGAPPQPPSLPQLFGQTLLQ  475

Query  623   QS-KFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTA  447
              S + +     HQ         +                  A+T+ AATAAIT+DPNFTA
Sbjct  476   TSPEMAATQFPHQKTHLVMPSPST-----------------AETVKAATAAITTDPNFTA  518

Query  446   ALAAAISSIMGGGSQ  402
             ALAAAI SI+GG  Q
Sbjct  519   ALAAAIKSIIGGNHQ  533



>gb|AFS64077.1| WRKY transcription factor 12 [Tamarix hispida]
Length=517

 Score =   331 bits (848),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 226/452 (50%), Positives = 278/452 (62%), Gaps = 63/452 (14%)
 Frame = -1

Query  1757  LNTGLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQV  1578
             +NTGL L+I N+ SD+S VDD +S + E++R +N+L + + E+E+   ENQRL+ MLSQ+
Sbjct  12    VNTGLNLLITNTSSDQSMVDDGISPNNEDKRVRNELVLAKAEVERFKTENQRLKDMLSQL  71

Query  1577  STNYTALQQHLSNLMQHQNQQSSRIGSTQDREVAD----------------RKSeekkpe  1446
             +TNY+ LQ HL+ +MQ  ++  S     + ++V                  +        
Sbjct  72    TTNYSTLQVHLATVMQQHDEPDSYRKDARKKKVDGGGGGDDEEEEVNDDMMQDKMIMNSN  131

Query  1445  keePTVPRQFLEL--VPgggaaaaAQTDE---------------ASQSHTTSEERTLSAG  1317
                  VPRQF++L    GG  AAA QT E                S S    +  ++   
Sbjct  132   SHNQMVPRQFIDLGFAAGGSRAAADQTTEDRLSLSSSDRKSSHDPSHSPAPPDHHSVEVA  191

Query  1316  SPRNNNTELSRHKGIIAREDSPDSE-----SWApnklpklnpskPVD-------------  1191
             S RN+   +    G++ RE +P        +W             +              
Sbjct  192   S-RNDLINIGSRPGVLERETTPPDHNIIPRAWGSGASCSNLHHNNIKVPRLATPPPSPNT  250

Query  1190  ------QAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVG  1029
                    AAEATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA G
Sbjct  251   SVDHHQSAAEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAAG  310

Query  1028  CPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN  849
             CPVRKQVQRCAEDRTILITTYEG HNHPLPP A+AMA+TTS+AA MLLSG+MPSADG++N
Sbjct  311   CPVRKQVQRCAEDRTILITTYEGNHNHPLPPTAVAMANTTSSAARMLLSGSMPSADGLIN  370

Query  848   TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQ  669
              NFLAR +LPCSSS+ATISASAPFPTVTLDLTQ+PN L  YQ   +QFQ P      IP 
Sbjct  371   PNFLARTLLPCSSSMATISASAPFPTVTLDLTQSPNPL-QYQSTTSQFQLPLPNLQNIP-  428

Query  668   NYPQ---LPQVFGQGLYNQSKFSGLHVSHQDI  582
             N P    LPQ+ GQ L+NQSKFSGLH+S Q I
Sbjct  429   NSPVAAFLPQILGQALHNQSKFSGLHLSQQGI  460



>ref|XP_011079008.1| PREDICTED: WRKY transcription factor 6-like isoform X2 [Sesamum 
indicum]
Length=504

 Score =   330 bits (846),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 250/491 (51%), Positives = 312/491 (64%), Gaps = 67/491 (14%)
 Frame = -1

Query  1865  EKRGPPNEVDFFSDKKADIVVKKEITLHGE-PVTKAD--LNTGLQLVIA-Nsgsdkstvd  1698
             ++R   +E+DFF+DKK     +       + P +  D  +NTGL L+ A N+GSD+S  D
Sbjct  35    DRRKIIDEMDFFADKKEARRCEPTSDDGADGPSSFMDFNVNTGLHLLTAANTGSDQSVAD  94

Query  1697  dsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQ  1518
             D +SS+   +R K ++  L+ EL++MN+ENQRL+ ML+Q + +Y  LQ+HL  LMQ Q  
Sbjct  95    DRISSNANNKRGKTEVGFLKTELQRMNSENQRLKEMLNQATNDYKGLQRHLMTLMQEQQS  154

Query  1517  QSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSE  1338
              ++  GS Q+R   +   +          V RQF++L    G A A  TD+ S S     
Sbjct  155   DNNGGGSAQERRGCNGNGK---------VVSRQFMDL----GLAVAPDTDDVS-SEGPMA  200

Query  1337  ERTLSAG---SPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMR  1167
             ++ +  G    P N   +L+          SPD+                VDQA EAT+R
Sbjct  201   DKEIRGGEDLGPDNKIPKLNNR--------SPDTS---------------VDQATEATIR  237

Query  1166  KARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDR  987
             KARVSVRARSEAPM++DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCA+DR
Sbjct  238   KARVSVRARSEAPMMTDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQRCADDR  297

Query  986   TILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSS  807
             ++LITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+MPSADG+MN+NFLAR +LPCSSS
Sbjct  298   SVLITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMPSADGLMNSNFLARTLLPCSSS  357

Query  806   VATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLY  627
             +ATISASAPFPTVTLDLTQ+PN        P QF  P + A         LPQ+FGQ LY
Sbjct  358   MATISASAPFPTVTLDLTQSPN--------PLQFPKPNSPA-------ALLPQIFGQALY  402

Query  626   NQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTA  447
             N SKFSGL VS Q+I     Q   L    +       +   A+TL+       +DPNF A
Sbjct  403   NHSKFSGLQVS-QEIDQTTQQLPPLISSMKQGVQNQLNVDTANTLA-------TDPNFAA  454

Query  446   ALAAAISSIMG  414
             ALAAAI+SIMG
Sbjct  455   ALAAAITSIMG  465



>gb|KHN41239.1| WRKY transcription factor 6 [Glycine soja]
Length=630

 Score =   334 bits (856),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 244/475 (51%), Positives = 301/475 (63%), Gaps = 35/475 (7%)
 Frame = -1

Query  1775  PVTKADLNTG-LQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRL  1599
             P  +  LNTG L L+  N+ SD+S VDD +S + E++RAKN+++VLQ +LE+M  ENQ+L
Sbjct  124   PTLEFKLNTGGLNLLTTNTNSDQSMVDDEISPNSEDKRAKNEMAVLQADLERMKRENQKL  183

Query  1598  RGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQ  1419
             R  L +V+TNY+ALQ H  NLMQ + +        ++    ++K +  +   +   VPRQ
Sbjct  184   RDSLDEVTTNYSALQMHFMNLMQ-ERKGEEGEEEQEEVYGGEKKQQLGESGGDGILVPRQ  242

Query  1418  FLELVPgggaaaaAQTDEASQSHTTSEERTLS-----AGSPRNNNTELSRH---KGIIAR  1263
             F++L        +   + +S S   S++R+ S     A      N E  +    +GI   
Sbjct  243   FMDLGLAANNGTSTGIEPSSSSGGRSQDRSRSPNVEVASKELGTNDEEEKKEYGRGIERE  302

Query  1262  EDSPDSESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKM  1083
             +DSP   +    +      +      AEATMRKARVSVRARSE PMI+DGCQWRKYGQKM
Sbjct  303   DDSPSGHAHKVPRFSPPKDNNNNSVEAEATMRKARVSVRARSETPMIADGCQWRKYGQKM  362

Query  1082  AKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsa  903
             AKGNPCPRAYYRC+MA  CPVRKQVQRCAEDRT+LITTYEG HNHPLPP AMAMA TTS+
Sbjct  363   AKGNPCPRAYYRCSMASACPVRKQVQRCAEDRTVLITTYEGNHNHPLPPTAMAMAQTTSS  422

Query  902   aanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSL--PN  729
             AA MLLSG+M SAD +MN NFL   +LPCSSS+ATISASAPFPTVTLDLT +PN L  P 
Sbjct  423   AARMLLSGSMSSADSIMNANFLTGTLLPCSSSMATISASAPFPTVTLDLTHSPNPLQFPR  482

Query  728   YQRPPTQFQAPFTGAPQIPQNYPQ------LPQVFGQGLY-NQSKFSGLHV--SHQDIaa  576
              Q  P Q Q    G PQ   N+        LPQ+FGQ LY NQSKFSGL +  SH D   
Sbjct  483   QQH-PNQLQ---IGVPQ--NNFANSPAASLLPQIFGQALYNNQSKFSGLQMSSSHYD---  533

Query  575   aaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
               A  +      Q P      P  ADT+    AAI +DPNFTAALAAAI+SI+GG
Sbjct  534   --ADPSSQFGNNQLPPHQVVPPHLADTVG---AAIATDPNFTAALAAAITSIIGG  583



>dbj|BAJ96003.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88666.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=569

 Score =   332 bits (852),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 254/513 (50%), Positives = 302/513 (59%), Gaps = 70/513 (14%)
 Frame = -1

Query  1844  EVDFFSDKKADIVV------------KKEITLHGEPVTKADLNTGLQLVIANsgsdkstv  1701
             EVDFFSD+K ++              K + +  G  + K DL   + L+  N+     ++
Sbjct  56    EVDFFSDEKKNMKKSRASAGADADDQKDQASAAGLAIKKEDLT--INLLSGNNTKRDRSM  113

Query  1700  ddsvssDM---EERRAKN--DLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNL  1536
                        E+   +N  +L+ +Q EL +MN ENQRLRGML+QV+ +Y ALQ HL  L
Sbjct  114   VVDDDGASRADEDSNGRNTGELAAMQAELSRMNDENQRLRGMLTQVNNSYHALQMHLVTL  173

Query  1535  MQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQ  1356
             MQ + Q               +             VPRQFL L P G +A  A+    S 
Sbjct  174   MQQRTQMPPAQPQQPPTHEEGKNE--------SAIVPRQFLGLGPSGASAEVAEEPSNSS  225

Query  1355  SHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWA---------pnklpklnps  1203
             +   S  R+ S G   N + E         R D+PD  S A           +       
Sbjct  226   TEVGSPRRSSSNG---NEDPE---------RGDNPDGPSTAGWLPGRGMTQQQQLGAAAK  273

Query  1202  kPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCP  1023
                 QA EATMRKARVSVRARSEAP+I+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCP
Sbjct  274   GHDQQAQEATMRKARVSVRARSEAPIIADGCQWRKYGQKMAKGNPCPRAYYRCTMATGCP  333

Query  1022  VRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSAD--GMMN  849
             VRKQVQRCAEDRTILITTYEGTHNHPLPPAAMAMASTTSAAA+MLLSG+MPSAD  G+M+
Sbjct  334   VRKQVQRCAEDRTILITTYEGTHNHPLPPAAMAMASTTSAAASMLLSGSMPSADGAGLMS  393

Query  848   TNFLARAILPCSSSVATISASAPFPTVTLDLTQ----TPNSLP-NYQRP--PTQFQAPFT  690
             +NFLAR +LPCSSS+ATISASAPFPTVTLDLT      PN++P N  RP  P QF  P  
Sbjct  394   SNFLARTVLPCSSSMATISASAPFPTVTLDLTHAPPGAPNAMPLNVARPHAPGQFHVPMP  453

Query  689   GAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhp  510
             G    P  +   PQ+    LYNQSKFSGL +S   +           Q  Q   P     
Sbjct  454   GGGMAPA-FAMPPQM----LYNQSKFSGLQMSSDSV--------DAGQFAQPRQPMGLPG  500

Query  509   LFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
               +D++SAA AAIT+DPNFT ALAAAISSIM G
Sbjct  501   QLSDSVSAAAAAITADPNFTVALAAAISSIMAG  533



>ref|XP_008226855.1| PREDICTED: probable WRKY transcription factor 31 [Prunus mume]
Length=547

 Score =   331 bits (849),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 250/520 (48%), Positives = 313/520 (60%), Gaps = 75/520 (14%)
 Frame = -1

Query  1847  NEVDFFSDKKADIVVKKEITL----------HGEPVTKA--DLNTGLQLVIA--Nsgsdk  1710
             +E+DFF+D K  ++  ++ T+          HG    K   D+NTGL L+    +S    
Sbjct  39    DELDFFADNKGRLMEMRDQTVEVKEEGAHDHHGVGQEKQLPDVNTGLNLLTTYTSSDKSS  98

Query  1709  stvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQ  1530
                  S S +ME++   N+L+VLQ EL +MN ENQRLR M+SQV+ NY ALQ  +  LMQ
Sbjct  99    MDDGTSSSHNMEDKHRTNELAVLQAELGRMNVENQRLRVMISQVNNNYQALQVQIVTLMQ  158

Query  1529  HQNQQSSRIGSTQDREVADRKSeekkpekee----PTVPRQFLELVPgggaaaaAQTDEA  1362
              Q  Q +   + +  ++ +  S   + ++        VPRQF+++         A+ DE 
Sbjct  159   RQQNQKADHQTPEQHKMINNGSVVVEEKQMMNGFNHIVPRQFMDM-------GRAEKDER  211

Query  1361  SQSHTTSEERTLSAGSPRNNN----------TELSRHKGIIAR-------EDSPDSE--S  1239
             SQ           +GSP  N+          T    H+ +  R       EDSPD E   
Sbjct  212   SQCPLEGCRSQDCSGSPPRNDIVESMECCKSTSHVLHRDLSGRISTTNGGEDSPDQEFQG  271

Query  1238  WApnklpklnpskPVDQAAEATM---RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNP  1068
             W P K+ K+   + VDQA+  TM   +KARVSVRARSEA MISDGCQWRKYGQKMAKGNP
Sbjct  272   WVPKKVSKMMSPRDVDQASSETMSMIKKARVSVRARSEASMISDGCQWRKYGQKMAKGNP  331

Query  1067  CPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanml  888
             CPRAYYRCTM  GC VRKQVQRCAEDRTIL+TTYEG HNHPLPPAAMAMASTTSAAA+ML
Sbjct  332   CPRAYYRCTMGTGCAVRKQVQRCAEDRTILVTTYEGHHNHPLPPAAMAMASTTSAAASML  391

Query  887   lSGAMPSADGMMNTN-FLARAILP-CSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPP  714
             LSG+MPSADG++++N FLAR+ LP C  S+AT+SASAPFPTVTLDLT+TP S       P
Sbjct  392   LSGSMPSADGLISSNSFLARSALPNCPPSLATLSASAPFPTVTLDLTRTPTSSEMPLGQP  451

Query  713   TQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqh  534
              Q        P  PQN   +PQ+ GQ L +QSKFS L  S Q + +A             
Sbjct  452   NQL------PPSFPQNMMSVPQILGQALSSQSKFSVLD-SFQGLDSATHS----------  494

Query  533   papppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMG  414
                       AD ++AATAAIT+DPNFTAAL AAI+SI+G
Sbjct  495   ---------LADKVNAATAAITADPNFTAALVAAITSIVG  525



>ref|XP_009616884.1| PREDICTED: probable WRKY transcription factor 31 [Nicotiana tomentosiformis]
Length=565

 Score =   330 bits (847),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 255/503 (51%), Positives = 312/503 (62%), Gaps = 62/503 (12%)
 Frame = -1

Query  1880  INPAAEKRGPPNEVDFFSDKK----ADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsd  1713
             IN   +KR   +E+DFF+ K+     D   +KE     E     ++NTGLQL+ AN+ SD
Sbjct  67    INDHDQKRPILDEMDFFAAKEDVNCKDTDERKEFNKPLE--LDFNINTGLQLLTANTSSD  124

Query  1712  kstvddsvs-sDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNL  1536
             +S V+D +S +  E+RR K +L+VLQ ELE++N EN+ LR ML+QV+TN + LQ  L+  
Sbjct  125   QSIVEDGLSPASSEDRRTKTELAVLQAELERINGENRHLRDMLNQVTTNCSTLQMQLT--  182

Query  1535  MQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQ  1356
             M  Q QQ   +      E  D+  E K+  +     PRQF++L            +EAS 
Sbjct  183   MIKQKQQHDHV------EQDDKGDEIKQQYQSSQMRPRQFMDL--------GRLANEASL  228

Query  1355  SHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDS--ESWA-----pnklpklnpskP  1197
             S +        + SP  N  E     G   REDSP+     W           +   S  
Sbjct  229   SSSEGRRSWEQSRSPPMNIVE----SGSSDREDSPEKGLSCWGPNKVPRVAGNESKSSTT  284

Query  1196  VDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVR  1017
             VDQA EAT+RKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVR
Sbjct  285   VDQATEATIRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVR  344

Query  1016  KQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFL  837
             KQVQRCAED+TILITTYEG HNHPLPPAA AMASTTS+AA MLLSG+MPSADG+M++N L
Sbjct  345   KQVQRCAEDKTILITTYEGNHNHPLPPAAAAMASTTSSAARMLLSGSMPSADGLMSSNIL  404

Query  836   ARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYP-  660
             AR +LPCSSS+ATISASAPFPTVTLDLTQT N L  ++ P  Q Q PF    Q     P 
Sbjct  405   ARTLLPCSSSIATISASAPFPTVTLDLTQTSNPL-QFKGPSNQSQFPFQNPHQNSPGNPI  463

Query  659   -QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAA  483
               LPQ+FGQ LYNQSKFSGL +S                           P   DT++  
Sbjct  464   ALLPQIFGQALYNQSKFSGLQMSQN---------------------LSTLPSIGDTVN--  500

Query  482   TAAITSDPNFTAALAAAISSIMG  414
                +T+DPNF AALA A++S++G
Sbjct  501   --VLTADPNFAAALATAVTSLIG  521



>ref|XP_006287494.1| hypothetical protein CARUB_v10000703mg [Capsella rubella]
 gb|EOA20392.1| hypothetical protein CARUB_v10000703mg [Capsella rubella]
Length=525

 Score =   328 bits (841),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 256/518 (49%), Positives = 325/518 (63%), Gaps = 85/518 (16%)
 Frame = -1

Query  1871  AAEKRG--PPNEVDFFSDKKADIV-VKKEITL----HGEPVTKADLNTGLQLVIANsgsd  1713
             +AEKR     +E +  +D +  +V VK+EI      H +  +   +N GL L+ AN+GSD
Sbjct  37    SAEKRDRVARDEQNIITDDETHMVHVKREINSRVDDHHDDRSTDHINIGLNLLTANTGSD  96

Query  1712  kstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLM  1533
             +S VDD +S DMEE+R K +   L+ EL+K + +NQRL+ MLSQ + N+ +LQ  L  +M
Sbjct  97    ESMVDDGLSVDMEEKRTKCENVQLREELKKASEDNQRLKEMLSQTTKNFNSLQMQLVAVM  156

Query  1532  QHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQS  1353
             + Q +    + +T++++ A  +       +    VPRQF++L P         +DEAS  
Sbjct  157   RQQEEDHHHLATTENKDNAKSR------HEVPEMVPRQFIDLGPP--------SDEAS--  200

Query  1352  HTTSEERT----------LSAGSPRNNNTELSRHKGIIAREDSPDSES--W---------  1236
                SEERT          L   SPR N       K  +ARE+SP++ES  W         
Sbjct  201   ---SEERTTVRSGSPPSLLEKSSPRQNG------KRALAREESPETESNGWRTPNKVPKH  251

Query  1235  -ApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPR  1059
              A +     N +      AEATMRKARVSVRARSEAPM+SDGCQWRKYGQKMAKGNPCPR
Sbjct  252   HASSSNGNGNNNVIEQSTAEATMRKARVSVRARSEAPMLSDGCQWRKYGQKMAKGNPCPR  311

Query  1058  AYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSG  879
             AYYRCTM  GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAM+MASTT+AAA+MLLSG
Sbjct  312   AYYRCTMVNGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMSMASTTTAAASMLLSG  371

Query  878   A-MPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQF  705
             + M S DG+MN TN LAR +LPCSSS+ATISASAPFPT+TLDLT++PN       P  QF
Sbjct  372   STMSSQDGLMNPTNLLARTMLPCSSSMATISASAPFPTITLDLTESPNGNNLTNNPLMQF  431

Query  704   QAPFTGAPQIPQNYPQLPQVFGQGLY--NQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhp  531
              +  +G  ++ Q+   LPQ+ GQ LY   QSKFSGLH+  Q + A               
Sbjct  432   -SQRSGFAELNQSV--LPQMMGQALYYNQQSKFSGLHMPSQSLNA---------------  473

Query  530   apppqhpLFADTLSAATAAITSDPNFTAALAAAISSIM  417
                       +++SAATAAI S+PNF AALAAAI+SI+
Sbjct  474   ---------GESVSAATAAIASNPNFAAALAAAITSII  502



>ref|XP_010089474.1| WRKY transcription factor 6 [Morus notabilis]
 gb|EXB37867.1| WRKY transcription factor 6 [Morus notabilis]
Length=600

 Score =   329 bits (844),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 248/498 (50%), Positives = 315/498 (63%), Gaps = 63/498 (13%)
 Frame = -1

Query  1865  EKRGPPNEVDFFSDKKADIVV----KKEITLHG-EPVTKADLNTGLQLVIANsgsdkst-  1704
             +KR   +E+DFF D ++  +      K++ ++  + + +  +NTGL L+ AN+ SD+S  
Sbjct  85    QKRKVIDEMDFFRDNRSSSMATSDDHKDLNINRMDQIDELKVNTGLNLLTANTSSDQSMV  144

Query  1703  -vddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQH  1527
               D   +   EE++AK++L+VLQ E ++M +ENQRL+  L+QV+ NY ALQ H+ +LM+ 
Sbjct  145   LDDSVSTDHGEEKKAKSELAVLQAEFKRMKSENQRLKQALNQVTGNYNALQMHIFSLMKT  204

Query  1526  QNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHT  1347
             Q +Q  +I S  + E+A R+            VP QF++L            DE S    
Sbjct  205   Q-KQDKKINSISEVELAARE-----------VVPWQFMDLGLASNNNGRGNGDEPS----  248

Query  1346  TSEERTLSAGSPRNNNTELSRHKGIIAREDSP------DSESWApnklpklnpskPVDQA  1185
             ++      +GS  NNN +         REDSP       S+ W   K      S   DQ+
Sbjct  249   STSSEERRSGSAGNNNGK--------TREDSPADHDHQSSQGWGYQKKVPRTASS--DQS  298

Query  1184  A-------EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGC  1026
             A       EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GC
Sbjct  299   AAKDNDQTEATMRKARVSVRARSEAPMIADGCQWRKYGQKMAKGNPCPRAYYRCTMAAGC  358

Query  1025  PVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNT  846
             PVRKQVQRCAE++TIL+TTYEG HNHPLPP AMAMASTTS+AA MLLSG++ SADG+MN 
Sbjct  359   PVRKQVQRCAEEQTILVTTYEGNHNHPLPPPAMAMASTTSSAARMLLSGSISSADGVMNP  418

Query  845   NFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQN  666
             NF+AR +LPCSSS+ATISASAPFPTVTLDLTQ+PN L + Q+PP    +PF  +  +P N
Sbjct  419   NFMARTMLPCSSSMATISASAPFPTVTLDLTQSPNPL-HLQKPPQ--MSPFHVS--LPSN  473

Query  665   YPQ---LPQVFG--QGLY-NQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLF  504
              P    LPQ+FG  Q LY NQS+FSGL VS    A     A        H    PQH  F
Sbjct  474   RPSQGLLPQIFGQAQALYNNQSEFSGLQVSR---AGQDNMAVVTGGHNGHQVQMPQHGSF  530

Query  503   ADTLSAATAAITSDPNFT  450
              D++   TAAI +DPNFT
Sbjct  531   TDSV---TAAIAADPNFT  545



>gb|KHN21215.1| WRKY transcription factor 6 [Glycine soja]
Length=609

 Score =   329 bits (843),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 227/435 (52%), Positives = 273/435 (63%), Gaps = 37/435 (9%)
 Frame = -1

Query  1652  LSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVAD  1473
             ++ LQ +LE++  ENQ+LR  L +V+TNY ALQ H  N+MQ +  +    G  Q +EV+D
Sbjct  166   MADLQGDLERIKRENQKLRDTLDEVNTNYNALQMHFMNMMQERKGEE---GEDQ-QEVSD  221

Query  1472  RK--SeekkpekeePTVPRQFLEL-------VPgggaaaaAQTDEASQSHTTSEERTLSA  1320
              K   +++        V RQF++L        P   +      D +   +     + L  
Sbjct  222   GKVKEKKQGQSGGGVLVSRQFMDLGLASADIEPSSSSGGIRSQDRSGSPNIDVASKGLGT  281

Query  1319  GSPRNNNT----ELSRHKGIIAREDSPDSESWApnklpklnpskPVDQA-AEATMRKARV  1155
              +   NN+    E   +   I  EDSP   +    +    + +  VDQA AEATMRKARV
Sbjct  282   SNNDGNNSVNDEEEKEYDRGIESEDSPSGHADKVPRFSSPSKNNNVDQAQAEATMRKARV  341

Query  1154  SVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILI  975
             SVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDRT+LI
Sbjct  342   SVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQRCAEDRTVLI  401

Query  974   TTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATI  795
             TTYEG HNHPLPP AMAMA TTS+AA MLLSG+M SAD +MN +FL R +LPCSSS+ATI
Sbjct  402   TTYEGNHNHPLPPTAMAMAQTTSSAARMLLSGSMSSADSIMNADFLTRTLLPCSSSMATI  461

Query  794   SASAPFPTVTLDLTQTPNSL--PNYQRPPTQFQAPFTGAPQIPQNYPQ--LPQVFGQGLY  627
             SASAPFPTVTLDLT +PN L  P  Q  P Q Q    G PQ   N P   +PQ+FGQ LY
Sbjct  462   SASAPFPTVTLDLTHSPNPLQFPRQQH-PNQLQ---IGVPQNFANSPSSLMPQIFGQALY  517

Query  626   NQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTA  447
             NQSKFSGL +S  D              Q    P    P  ADT+    AAI +DPNFT+
Sbjct  518   NQSKFSGLQMSSHDT--------ADPSSQFGYQPHQVPPHLADTVG---AAIATDPNFTS  566

Query  446   ALAAAISSIMGGGSQ  402
             ALAAAI+SI+ G  Q
Sbjct  567   ALAAAITSIIRGAQQ  581



>ref|XP_011079007.1| PREDICTED: WRKY transcription factor 6-like isoform X1 [Sesamum 
indicum]
Length=505

 Score =   325 bits (834),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 250/492 (51%), Positives = 312/492 (63%), Gaps = 68/492 (14%)
 Frame = -1

Query  1865  EKRGPPNEVDFFSDKKADIVVKKEITLHGE-PVTKAD--LNTGLQLVIA-Nsgsdkstvd  1698
             ++R   +E+DFF+DKK     +       + P +  D  +NTGL L+ A N+GSD+S  D
Sbjct  35    DRRKIIDEMDFFADKKEARRCEPTSDDGADGPSSFMDFNVNTGLHLLTAANTGSDQSVAD  94

Query  1697  dsvssDMEERRAKND-LSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQN  1521
             D +SS+   +R K + +  L+ EL++MN+ENQRL+ ML+Q + +Y  LQ+HL  LMQ Q 
Sbjct  95    DRISSNANNKRGKTEQVGFLKTELQRMNSENQRLKEMLNQATNDYKGLQRHLMTLMQEQQ  154

Query  1520  QQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTS  1341
               ++  GS Q+R   +   +          V RQF++L    G A A  TD+ S S    
Sbjct  155   SDNNGGGSAQERRGCNGNGK---------VVSRQFMDL----GLAVAPDTDDVS-SEGPM  200

Query  1340  EERTLSAG---SPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATM  1170
              ++ +  G    P N   +L+          SPD+                VDQA EAT+
Sbjct  201   ADKEIRGGEDLGPDNKIPKLNNR--------SPDTS---------------VDQATEATI  237

Query  1169  RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAED  990
             RKARVSVRARSEAPM++DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCA+D
Sbjct  238   RKARVSVRARSEAPMMTDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQRCADD  297

Query  989   RTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSS  810
             R++LITTYEG HNHPLPPAAMAMASTTS+AA MLLSG+MPSADG+MN+NFLAR +LPCSS
Sbjct  298   RSVLITTYEGNHNHPLPPAAMAMASTTSSAARMLLSGSMPSADGLMNSNFLARTLLPCSS  357

Query  809   SVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGL  630
             S+ATISASAPFPTVTLDLTQ+PN        P QF  P + A         LPQ+FGQ L
Sbjct  358   SMATISASAPFPTVTLDLTQSPN--------PLQFPKPNSPA-------ALLPQIFGQAL  402

Query  629   YNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFT  450
             YN SKFSGL VS Q+I     Q   L    +       +   A+TL+       +DPNF 
Sbjct  403   YNHSKFSGLQVS-QEIDQTTQQLPPLISSMKQGVQNQLNVDTANTLA-------TDPNFA  454

Query  449   AALAAAISSIMG  414
             AALAAAI+SIMG
Sbjct  455   AALAAAITSIMG  466



>ref|XP_008226947.1| PREDICTED: probable WRKY transcription factor 31 [Prunus mume]
Length=544

 Score =   327 bits (837),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 247/518 (48%), Positives = 309/518 (60%), Gaps = 73/518 (14%)
 Frame = -1

Query  1847  NEVDFFSDKKADIVVKKEITL----------HGEPVTKADLNTGLQLVIA--Nsgsdkst  1704
             +E+DFF+D K  ++  ++ T+          HG    K   +TGL L+    +S      
Sbjct  38    DELDFFADNKGRLMEMRDQTVEVQEEGAHDHHGVGQEKQLPDTGLNLLTTYTSSDKSSMD  97

Query  1703  vddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQ  1524
                S S +ME++   N+L+VLQ EL +MN ENQRLR M+SQV+ NY ALQ  +  LMQ Q
Sbjct  98    DGTSSSHNMEDKHRTNELAVLQAELGRMNVENQRLRVMISQVNNNYQALQVQIVTLMQRQ  157

Query  1523  NQQSSRIGSTQDREVADRKSeekkpekee----PTVPRQFLELVPgggaaaaAQTDEASQ  1356
               Q     + +  ++ +  S   + ++        VPRQF+++         A+ DE SQ
Sbjct  158   QNQKVDHQTPEQHKMNNNGSVVVEEKQMMNGFNHIVPRQFMDM-------GRAEKDELSQ  210

Query  1355  -SHTTSEERTLSAGSPRNN---------NTELSRHKGIIAR-------EDSPDSE--SWA  1233
              S      +  S  SPRN+         +T    H+ +  R       EDSPD E   W 
Sbjct  211   CSLEGCRSQDCSGSSPRNDIVESMECCKSTSHVLHRDLSGRISTTNGGEDSPDQEFQGWV  270

Query  1232  pnklpklnpskPVDQAAEATM---RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCP  1062
             P K+ K+   + VDQA+  TM   +KARVSVRARSEA MISDGCQWRKYGQKMAKGNPCP
Sbjct  271   PKKVSKMMSPRHVDQASSETMSMIKKARVSVRARSEASMISDGCQWRKYGQKMAKGNPCP  330

Query  1061  RAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllS  882
             RAYYRCTM  GCPVRKQVQRCAEDRTIL+TTYEG HNHPLPPAAMAMASTTSAAA+MLLS
Sbjct  331   RAYYRCTMGTGCPVRKQVQRCAEDRTILVTTYEGHHNHPLPPAAMAMASTTSAAASMLLS  390

Query  881   GAMPSADGMMNTN-FLARAILP-CSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQ  708
             G+MPSADG++++N FLAR+ L  C  S+AT+SASAPFPTVTLDLT+TP S       P Q
Sbjct  391   GSMPSADGLISSNSFLARSALQNCPPSLATLSASAPFPTVTLDLTRTPTSSEMPLGQPNQ  450

Query  707   FQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpa  528
                     P  PQN   +PQ+ GQ L +QS FS L                    +  P 
Sbjct  451   L------PPSFPQNMMPVPQILGQALSSQSTFSVL--------------------ESFPG  484

Query  527   pppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMG  414
                     AD ++AATAAIT+DPNFTAAL AAI+SI+G
Sbjct  485   LDSATHSLADKVNAATAAITADPNFTAALVAAITSIVG  522



>emb|CDX82900.1| BnaC01g13500D [Brassica napus]
Length=521

 Score =   325 bits (834),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 250/468 (53%), Positives = 298/468 (64%), Gaps = 54/468 (12%)
 Frame = -1

Query  1880  INPAAEKRGPPNEVDFFSDKK----------------ADIVVKKEITLHGEPVTKADLNT  1749
             I P  E+R    EVDFFSDK+                + + VK E +   +     D+N 
Sbjct  20    ITPLDERRVVVGEVDFFSDKRDRVSRENINDDEDDEASKVHVKMESSRVEDNDRSRDVNI  79

Query  1748  GLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTN  1569
             GL L+ AN+GSD+STVDD +S DME++RAK + + LQ EL+KM  ENQRLR MLSQ + N
Sbjct  80    GLNLLTANTGSDESTVDDGLSMDMEDKRAKFENAQLQEELKKMKIENQRLREMLSQATNN  139

Query  1568  YTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePT-VPRQFLELVPggg  1392
             + +LQ  L  +M+ Q Q++S    +QD  +A   + E    +E  T VPRQF++L P  G
Sbjct  140   FNSLQMQLVAVMRQQEQRNS----SQDHLLATEGNAEGSKRQEVQTMVPRQFMDLGPSSG  195

Query  1391  aaaaAQTDEASQSHTTSEERT-LSAGSP---RNNNTELSRHKGIIAREDSPDSES--WAp  1230
             AA          +  +SEERT L +GSP     N+      K ++ RE+SP+SES  W  
Sbjct  196   AAEQ-------DAEVSSEERTMLRSGSPPLLLENSNPRETGKRLLGREESPESESNAWGN  248

Query  1229  nklpkl------------npskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKYGQ  1089
                                    +DQ AAEATMRKARVSVRARSEA MI+DGCQWRKYGQ
Sbjct  249   PNKVSKHNPPSGSNNNNNGNRNLIDQSAAEATMRKARVSVRARSEATMITDGCQWRKYGQ  308

Query  1088  KMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamastt  909
             KMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMASTT
Sbjct  309   KMAKGNPCPRAYYRCTMAGGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMASTT  368

Query  908   saaanmllSGAMPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLP  732
             +AAA+MLLSG++ S D +MN TN LARAILPCSSS+ATISASAPFPT+TLDLT +PN   
Sbjct  369   TAAASMLLSGSVSSQDNLMNPTNLLARAILPCSSSMATISASAPFPTITLDLTNSPNGNN  428

Query  731   NYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLY---NQSKFSGLHV  597
                         F   P    N   LPQV GQGLY    QSKFSGLHV
Sbjct  429   PNMTTNNPLMQ-FAQRPGF--NPAVLPQVVGQGLYYNQQQSKFSGLHV  473



>gb|ABS18435.1| WRKY36 [Glycine max]
Length=332

 Score =   316 bits (809),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 217/344 (63%), Positives = 244/344 (71%), Gaps = 46/344 (13%)
 Frame = -1

Query  1373  TDEASQSHTTSEERTLSAGSPRNNNTELSRHK-------GI------------IAREDSP  1251
             T+E S SH++S  R  S  SP  NNTE++  K       G+            I REDSP
Sbjct  10    TNETSHSHSSSVIR--SQDSPPTNNTEVASKKNGGASDEGLVFDQDKKEFGRGIEREDSP  67

Query  1250  -DSESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKG  1074
              D    A N +PK +P + VDQA EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKG
Sbjct  68    SDQGVAANNNVPKFSPPRNVDQA-EATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKG  126

Query  1073  NPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaan  894
             NPCPRAYYRCTMA GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMA TTS+AA 
Sbjct  127   NPCPRAYYRCTMAAGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMAMAQTTSSAAR  186

Query  893   mllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPP  714
             MLLSG+M SADG+MN +FL R +LPCSSS+ATISASAPFPTVTLDLTQ+PN L  + + P
Sbjct  187   MLLSGSMSSADGLMNASFLTRTLLPCSSSMATISASAPFPTVTLDLTQSPNPL-QFPKQP  245

Query  713   TQFQAPFTGAPQIPQNYPQ-----LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqla  549
             +QFQ PF G   +PQN+       LPQ+FGQ LYNQSKFSGL +S QD            
Sbjct  246   SQFQIPFPG---VPQNFANSQASLLPQIFGQALYNQSKFSGLQMS-QD----------SD  291

Query  548   qqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIM  417
               Q         P  ADT+SAA AA   DPNFTAALAAAI+SI+
Sbjct  292   PSQLSNQSQRPPPHLADTVSAAIAA---DPNFTAALAAAITSII  332



>ref|XP_010644477.1| PREDICTED: probable WRKY transcription factor 31 isoform X2 [Vitis 
vinifera]
Length=550

 Score =   323 bits (828),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 253/494 (51%), Positives = 320/494 (65%), Gaps = 44/494 (9%)
 Frame = -1

Query  1847  NEVDFFSDKK-ADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvssDMEE  1671
             NE+DFF+ K+ A + VK+E T H   V    +NTGL L +A+ GS+KS+VD   S   +E
Sbjct  54    NEMDFFAQKETARVDVKRETTAHDGLVQGFHINTGLNLHLASGGSEKSSVDGGTSPSNKE  113

Query  1670  RRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQ  1491
             +   +D+  L+ ELE MN EN++LR MLSQV+ NY+ALQ H+  LMQ Q+ + + I    
Sbjct  114   KLNMSDMVGLRAELENMNKENKQLRAMLSQVNNNYSALQMHVVTLMQRQHNRRAEISLAN  173

Query  1490  DREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEA-----------SQSHTT  1344
             +    + + +  +  + E  VPRQF++L    G A+ A+ DE+           +    +
Sbjct  174   E---VNTEGKVGERNRNETIVPRQFMDL----GRASMAEKDESSPSWSGSRSPQTNEDAS  226

Query  1343  SEERTLSAGSPRNNNTELSRHKGIIAREDSPDS--ESWApnklpklnpskPVDQAAEAT-  1173
              E R    GS  N N +         RE+S D   +   PNK+PK N S+ V+QA+EA  
Sbjct  227   RESRRRKTGSTSNENKD-------GGREESSDQSLQGGLPNKVPKFNCSQNVEQASEAMS  279

Query  1172  -MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA  996
              MRKARVSVRARSEA MISDGCQWRKYGQKMAKGNPCPRAYYRCTMA  CPVRKQVQR A
Sbjct  280   MMRKARVSVRARSEASMISDGCQWRKYGQKMAKGNPCPRAYYRCTMATACPVRKQVQRSA  339

Query  995   EDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPC  816
             EDRT+LITTYEG HNHPLPPAAMAMASTTSAAA MLLSG+MPS+DG+M+++F +R + PC
Sbjct  340   EDRTVLITTYEGHHNHPLPPAAMAMASTTSAAATMLLSGSMPSSDGIMSSSFHSRTMFPC  399

Query  815   SSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQ  636
             S S+ATISASAPFPT+TLDLT +PN L  +QRP  QF  PF     +PQN+      F  
Sbjct  400   SPSLATISASAPFPTITLDLTHSPNLL-QHQRPNAQFHVPFQ---NLPQNFAPGSHAFNP  455

Query  635   GLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPN  456
              L++QSKFS L  S +              Q             +DT++AATAAIT+DPN
Sbjct  456   VLHSQSKFSALQSSPE----------MQPPQVGTEQVLKPSSSSSDTVTAATAAITADPN  505

Query  455   FTAALAAAISSIMG  414
             FTAAL AAI+SI+G
Sbjct  506   FTAALVAAITSIIG  519



>ref|XP_007212993.1| hypothetical protein PRUPE_ppa022758mg, partial [Prunus persica]
 gb|EMJ14192.1| hypothetical protein PRUPE_ppa022758mg, partial [Prunus persica]
Length=513

 Score =   322 bits (825),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 246/516 (48%), Positives = 300/516 (58%), Gaps = 95/516 (18%)
 Frame = -1

Query  1847  NEVDFFSDKKADIVVKKEITL----------HGEPVTKA--DLNTGLQLVIA--Nsgsdk  1710
             +E+DFF+D K  ++  ++ T+          HG    K   D+NTGL L+    +S    
Sbjct  33    DELDFFADNKGRLMEMRDQTVEVKEEGAHDHHGVGQEKQLPDVNTGLNLLTTYTSSDKSS  92

Query  1709  stvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQ  1530
                  S   +ME++   N+L+VLQ EL +M+ ENQRLR M+SQV+ NY ALQ  +  LMQ
Sbjct  93    MDDGTSSFHNMEDKHRTNELAVLQAELGRMSVENQRLRVMISQVNNNYQALQVQIVTLMQ  152

Query  1529  HQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSH  1350
              Q  Q            AD ++                    P       A+ DE SQ  
Sbjct  153   RQQNQK-----------ADHQT--------------------PEQHKVYMAEKDELSQCS  181

Query  1349  TTSEERTLSAGSPRNNN----------TELSRHKGIIAR-------EDSPDSE--SWApn  1227
                      +GSP  N+          T    H+ +  R       EDSPD E   W P 
Sbjct  182   LEGCRSQDCSGSPPRNDIVESMECGKSTSHVLHRDLSGRISTTNGGEDSPDQEFQGWVPK  241

Query  1226  klpklnpskPVDQAAEATM---RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRA  1056
             K+ K+   + VDQA+  TM   +KARVSVRARSEA MISDGCQWRKYGQKMAKGNPCPRA
Sbjct  242   KVSKMMSPRDVDQASSETMSMIKKARVSVRARSEASMISDGCQWRKYGQKMAKGNPCPRA  301

Query  1055  YYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGA  876
             YYRCTM  GCPVRKQVQRCAEDRTIL+TTYEG HNHPLPPAAMAMASTTSAAA+MLLSG+
Sbjct  302   YYRCTMGTGCPVRKQVQRCAEDRTILVTTYEGHHNHPLPPAAMAMASTTSAAASMLLSGS  361

Query  875   MPSADGMMNTN-FLARAILP-CSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQ  702
             MPSADG++++N FLAR+ LP C  S+AT+SASAPFPTVTLDLT+TP S       P Q  
Sbjct  362   MPSADGLISSNSFLARSALPNCPPSLATLSASAPFPTVTLDLTRTPTSSEMPLGQPNQL-  420

Query  701   APFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapp  522
                   P  PQN   +PQ+ GQ L +QSKFS L  S Q + +A                 
Sbjct  421   -----PPSFPQNMMSVPQILGQALSSQSKFSVLD-SFQGLDSATHS--------------  460

Query  521   pqhpLFADTLSAATAAITSDPNFTAALAAAISSIMG  414
                   AD ++AATAAIT+DPNFTAAL AAI+SI+G
Sbjct  461   -----LADKVNAATAAITADPNFTAALVAAITSIVG  491



>gb|AGA37242.1| WRKY transcription factor 31.1 [Brassica napus]
Length=539

 Score =   322 bits (825),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 252/472 (53%), Positives = 301/472 (64%), Gaps = 56/472 (12%)
 Frame = -1

Query  1880  INPAAEKRGPPNEVDFFSDKK----------------ADIVVKKEITLHGEPVTKADLNT  1749
             I P  E+R    EVDFFSDK+                + + VK E +   +     D+N 
Sbjct  21    ITPLDERRVVVGEVDFFSDKRDRVSRENINDDEDDEASKVHVKMESSRVEDNDRSRDVNI  80

Query  1748  GLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTN  1569
             GL L+ AN+GSD+STVDD +S DME++RAK + + LQ EL+KM  ENQRLR MLSQ + N
Sbjct  81    GLNLLTANTGSDESTVDDGLSMDMEDKRAKFENAQLQEELKKMKIENQRLREMLSQATNN  140

Query  1568  YTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePT-VPRQFLELVPggg  1392
             + +LQ  L  +M+ Q Q++S    +QD  +A   + E    +E  T VPRQF++L P  G
Sbjct  141   FNSLQMQLVAVMRQQEQRNS----SQDHLLATEGNAEGGKRQEVQTMVPRQFMDLGPSSG  196

Query  1391  aaaaAQTDEASQSHTTSEERT-LSAGSP----RNNNTELSRHKGIIAREDSPDSES--WA  1233
             AA          +  +SEERT L +GSP     N+N   S  K ++ARE+SP+SES  W 
Sbjct  197   AAEQ-------DAEVSSEERTMLRSGSPPLLLENSNPRES-GKRLLAREESPESESNAWG  248

Query  1232  pnklpkl------------npskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKYG  1092
                                     +DQ AAEATMRKARVSVRARSEA MI+DGCQWRKYG
Sbjct  249   NPNKVSKHNPPSGSNNNNNGNRNLIDQSAAEATMRKARVSVRARSEATMITDGCQWRKYG  308

Query  1091  QKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamast  912
             QKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMAST
Sbjct  309   QKMAKGNPCPRAYYRCTMAGGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMAST  368

Query  911   tsaaanmllSGAMPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSL  735
             T+AAA+MLLSG++ S D +MN TN LARAILPCSSS+ATISASAPFPT+TLDLT +PN  
Sbjct  369   TTAAASMLLSGSVSSQDNLMNPTNLLARAILPCSSSMATISASAPFPTITLDLTNSPNGN  428

Query  734   PNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLY---NQSKFSGLHVSHQ  588
                          F   P    N   LPQV GQGLY    QSKFSGL +  Q
Sbjct  429   NPNMTTNNPLMQ-FAQRPGF--NPGVLPQVVGQGLYYNQQQSKFSGLQLPAQ  477



>gb|EYU34028.1| hypothetical protein MIMGU_mgv1a004322mg [Erythranthe guttata]
Length=533

 Score =   320 bits (821),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 242/474 (51%), Positives = 296/474 (62%), Gaps = 51/474 (11%)
 Frame = -1

Query  1790  TLHG-EPVTKADLNTGLQLVI-ANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMN  1617
             TLHG   V   ++NTGL L+  AN+GSD+S VD   SS+ E +R+ +++  LQ E+E+MN
Sbjct  75    TLHGSNSVLNFNVNTGLHLLTPANTGSDESIVDKQTSSNSENKRSNSEMIFLQAEMERMN  134

Query  1616  AENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekee  1437
             +EN+ L+ ML+QV  +YT LQ  L  +MQ+Q+Q         +  V    +         
Sbjct  135   SENRHLKEMLNQVENDYTGLQMQLMTIMQNQHQTDRHQNQDDEEHVIKNGNGIHNNNNNG  194

Query  1436  PTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNTELSRHKGIIARED  1257
               VPRQF++L                    T+++  L++   R+        K +   E 
Sbjct  195   VLVPRQFMDL-----------------GFGTNDDVLLTSPERRDPPPPTPTDKDV-GDEQ  236

Query  1256  SPDSESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAK  1077
             SP  E+    KL     +  VDQA EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAK
Sbjct  237   SP--ENNKVPKLSHPPRNSTVDQATEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAK  294

Query  1076  GNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaa  897
             GNPCPRAYYRCTMA GCPVRKQVQRCA+DRTIL TTYEG HNHPLPPAAMAMASTTS+AA
Sbjct  295   GNPCPRAYYRCTMAAGCPVRKQVQRCADDRTILTTTYEGNHNHPLPPAAMAMASTTSSAA  354

Query  896   nmllSGAMPSADGMMNT-NFLARAI---LPCSSSVATISASAPFPTVTLDLTQTP-NSLP  732
              MLLSG+MPSADG+MN+ NFLAR +   LPCSS++ATISASAPFPT+TLDLTQ+P N L 
Sbjct  355   KMLLSGSMPSADGLMNSNNFLARTLLPQLPCSSNMATISASAPFPTITLDLTQSPANPLQ  414

Query  731   NYQRPPTQFQAPFTGAPQIPQNYPQ-------LPQVFGQGLYNQSKFSGLHVSHQDIaaa  573
               + P  QF  PF   P +             LPQ+FGQ  YNQSKFSGL +S QD    
Sbjct  415   FPKIPSNQFTLPFLN-PLLNNIANINPNAAALLPQIFGQAAYNQSKFSGLQMSSQD----  469

Query  572   aaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                      Q       P      DT++    A+ +DPNFTAALAAAISS+M G
Sbjct  470   --------HQGTSNNQLPPPFQLNDTVN----ALATDPNFTAALAAAISSLMTG  511



>ref|XP_009135540.1| PREDICTED: probable WRKY transcription factor 31 [Brassica rapa]
 ref|XP_009135548.1| PREDICTED: probable WRKY transcription factor 31 [Brassica rapa]
Length=538

 Score =   320 bits (821),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 254/473 (54%), Positives = 303/473 (64%), Gaps = 58/473 (12%)
 Frame = -1

Query  1880  INPAAEKRGPPNEVDFFSDKKADIVVKKEIT---------LHGEPVTKA--------DLN  1752
             I P  E+R    EVDFFSDK+ D V ++ I          +H E  +          D+N
Sbjct  20    ITPLDERRVVVGEVDFFSDKR-DRVSRENINDDEDDEASKVHVEMESSRVEDKDRSRDVN  78

Query  1751  TGLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVST  1572
              GL L+ AN+GSD+STVDD +S DME++RAK + + LQ EL+KM  ENQRLR MLSQ + 
Sbjct  79    IGLNLLTANTGSDESTVDDGLSMDMEDKRAKFENAQLQEELKKMKIENQRLREMLSQATN  138

Query  1571  NYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePT-VPRQFLELVPgg  1395
             N+ +LQ  L  +M+ Q Q++S    +QD  +A   + E    +E  T VPRQF++L P  
Sbjct  139   NFNSLQMQLVAVMRQQEQRNS----SQDHLLATEGNAEGGKRQEVQTMVPRQFMDLGPSS  194

Query  1394  gaaaaAQTDEASQSHTTSEERT-LSAGSP----RNNNTELSRHKGIIAREDSPDSES--W  1236
             GAA          +  +SEERT L +GSP     N+N   S  K ++ARE+SP+SES  W
Sbjct  195   GAAEQ-------DAEVSSEERTMLRSGSPPLLLENSNPRES-GKRLLAREESPESESNAW  246

Query  1235  Apnklpkl------------npskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKY  1095
                                      +DQ AAEATMRKARVSVRARSEA MI+DGCQWRKY
Sbjct  247   GNPNKVTKHNPPSGSNNNNNGNRNLIDQSAAEATMRKARVSVRARSEATMITDGCQWRKY  306

Query  1094  GQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamas  915
             GQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMAS
Sbjct  307   GQKMAKGNPCPRAYYRCTMAGGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMAS  366

Query  914   ttsaaanmllSGAMPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNS  738
             TT+AAA+MLLSG++ S D +MN TN LARAILPCSSS+ATISASAPFPT+TLDLT +PN 
Sbjct  367   TTTAAASMLLSGSVSSQDNLMNPTNLLARAILPCSSSMATISASAPFPTITLDLTNSPNG  426

Query  737   LPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLY---NQSKFSGLHVSHQ  588
                           F   P    N   LPQV GQGLY    QSKFSGL +  Q
Sbjct  427   NNPNMTTNNPLMQ-FAQRPGF--NPGVLPQVVGQGLYYNQQQSKFSGLQLPAQ  476



>ref|XP_010529453.1| PREDICTED: probable WRKY transcription factor 31 isoform X3 [Tarenaya 
hassleriana]
Length=599

 Score =   322 bits (825),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 275/536 (51%), Positives = 336/536 (63%), Gaps = 85/536 (16%)
 Frame = -1

Query  1874  PAAEKRGPPNEVDFFSDKK--------AD----IVVKKEITLHGEPVTKADLNTGLQLVI  1731
             PA E R   +EVDFFS+K+        AD    + VK EI+   +     D+N GL L+ 
Sbjct  81    PADEHRVAVDEVDFFSEKRDRVSRDNTADETNRVHVKMEISRVEDDDRSRDVNIGLNLLT  140

Query  1730  ANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQ  1551
             AN+GSD+STVDD +S DMEE+RAK+++  LQ EL+KM  ENQRLR ML+Q S+NY++LQ 
Sbjct  141   ANAGSDESTVDDGLSMDMEEKRAKSEMVQLQGELQKMKEENQRLREMLNQASSNYSSLQM  200

Query  1550  HLSNLMQHQNQQSSRIGSTQDREV-ADRKSeekkpekeePTVPRQFLELVPgggaaaaAQ  1374
              L  +M+ Q  ++S    +QD  + A+ KS+ +  +++   VPRQF++L P   AA    
Sbjct  201   QLVAVMRQQEHRNS----SQDHLLGAEGKSDGRTRQEQPAMVPRQFIDLGPLSSAAEH--  254

Query  1373  TDEASQSHTTSEERT-LSAGSP---RNNNTELSRHKGIIAREDSPDSES--WApnkl---  1221
                   +  +SEERT + +GSP     N+ +    K ++ RE SP++ES  W   K    
Sbjct  255   -----DTEVSSEERTTVRSGSPPPILENSNQRDDGKRLLGREASPETESNGWGNPKKVPK  309

Query  1220  ---pklnpskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAY  1053
                        +DQ AAEATMRKARVSVRARSE PMISDGCQWRKYGQKMAKGNPCPRAY
Sbjct  310   HNPSGNGNGNVIDQSAAEATMRKARVSVRARSEVPMISDGCQWRKYGQKMAKGNPCPRAY  369

Query  1052  YRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAM  873
             YRCTMAVGCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMASTT+AAA+MLLSG+M
Sbjct  370   YRCTMAVGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMASTTTAAASMLLSGSM  429

Query  872   PSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPT-----  711
              S +G+MN TN LARAI PCSSS+ATISASAPFPT+TLDLT    +  N   P       
Sbjct  430   ASQEGLMNPTNLLARAIFPCSSSMATISASAPFPTITLDLTTNSANAGNNPNPNATATAT  489

Query  710   ------QF-QAPFTGAPQIPQNYPQLPQVFGQGLY----NQSKFSGLHVSHQDIaaaaaq  564
                   QF Q P   A  +  N   LPQV  Q LY     QSKFSGL +  Q +      
Sbjct  490   ANNPLLQFAQRPGFAASAL--NPSVLPQVVSQALYYNNNQQSKFSGLQLPAQPLPT----  543

Query  563   aaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIM-GGGSQP  399
                                     +AATAAI +DPNF AALAAAI+SI+ G G QP
Sbjct  544   ------------------------AAATAAIAADPNFAAALAAAITSIINGSGHQP  575



>gb|EYU33884.1| hypothetical protein MIMGU_mgv1a008427mg [Erythranthe guttata]
Length=374

 Score =   314 bits (805),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 239/404 (59%), Positives = 277/404 (69%), Gaps = 54/404 (13%)
 Frame = -1

Query  1622  MNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpek  1443
             MN ENQRLRGML+QVSTNYT+LQ HL  +MQ Q   ++++   Q +++  R+ E KK E 
Sbjct  1     MNGENQRLRGMLTQVSTNYTSLQMHLVTMMQKQQNPTTQLNHDQ-QQIVVREHEIKKHED  59

Query  1442  eePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNTELSRHKGIIAR  1263
                 VPRQF +L        + +     +S ++SEERT+S     N           I R
Sbjct  60    GGLLVPRQFFDL--------SNRILSDERSDSSSEERTISIAESPNR----------IDR  101

Query  1262  EDSPDSESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKM  1083
             ED   +  ++PNK PKL+ +KPV+Q+ EATMRKARVSVRARSEAPMISDGCQWRKYGQKM
Sbjct  102   EDQ--NREYSPNKAPKLDHAKPVEQSTEATMRKARVSVRARSEAPMISDGCQWRKYGQKM  159

Query  1082  AKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsa  903
             AKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTIL TTYEG HNHPLPPAAMAMA+TTS+
Sbjct  160   AKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILTTTYEGNHNHPLPPAAMAMAATTSS  219

Query  902   aanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQ  723
             AANMLLSG+M SADG MN NFL R ILPCSS+VATISASAPFPT+TLDLTQ+PN L  +Q
Sbjct  220   AANMLLSGSMSSADGFMNPNFLTRTILPCSSNVATISASAPFPTITLDLTQSPNPL-QFQ  278

Query  722   RPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqq  543
             RP  QFQ PF        N   L     Q +YNQSKFSGLH+                  
Sbjct  279   RPGPQFQIPFAIPNNPNPNPNML---IPQDMYNQSKFSGLHMPQ----------------  319

Query  542   qqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                         +ADT+S    AIT+DPNFTAALAAAISSI+GG
Sbjct  320   ---------TTSYADTVS----AITADPNFTAALAAAISSIIGG  350



>ref|XP_010644476.1| PREDICTED: probable WRKY transcription factor 31 isoform X1 [Vitis 
vinifera]
Length=551

 Score =   320 bits (819),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 254/495 (51%), Positives = 320/495 (65%), Gaps = 45/495 (9%)
 Frame = -1

Query  1847  NEVDFFSDKK-ADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvssDMEE  1671
             NE+DFF+ K+ A + VK+E T H   V    +NTGL L +A+ GS+KS+VD   S   +E
Sbjct  54    NEMDFFAQKETARVDVKRETTAHDGLVQGFHINTGLNLHLASGGSEKSSVDGGTSPSNKE  113

Query  1670  RRAKNDLSV-LQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGST  1494
             +   +D  V L+ ELE MN EN++LR MLSQV+ NY+ALQ H+  LMQ Q+ + + I   
Sbjct  114   KLNMSDKMVGLRAELENMNKENKQLRAMLSQVNNNYSALQMHVVTLMQRQHNRRAEISLA  173

Query  1493  QDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEA-----------SQSHT  1347
              +    + + +  +  + E  VPRQF++L    G A+ A+ DE+           +    
Sbjct  174   NE---VNTEGKVGERNRNETIVPRQFMDL----GRASMAEKDESSPSWSGSRSPQTNEDA  226

Query  1346  TSEERTLSAGSPRNNNTELSRHKGIIAREDSPDS--ESWApnklpklnpskPVDQAAEAT  1173
             + E R    GS  N N +         RE+S D   +   PNK+PK N S+ V+QA+EA 
Sbjct  227   SRESRRRKTGSTSNENKD-------GGREESSDQSLQGGLPNKVPKFNCSQNVEQASEAM  279

Query  1172  --MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRC  999
               MRKARVSVRARSEA MISDGCQWRKYGQKMAKGNPCPRAYYRCTMA  CPVRKQVQR 
Sbjct  280   SMMRKARVSVRARSEASMISDGCQWRKYGQKMAKGNPCPRAYYRCTMATACPVRKQVQRS  339

Query  998   AEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILP  819
             AEDRT+LITTYEG HNHPLPPAAMAMASTTSAAA MLLSG+MPS+DG+M+++F +R + P
Sbjct  340   AEDRTVLITTYEGHHNHPLPPAAMAMASTTSAAATMLLSGSMPSSDGIMSSSFHSRTMFP  399

Query  818   CSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFG  639
             CS S+ATISASAPFPT+TLDLT +PN L  +QRP  QF  PF     +PQN+      F 
Sbjct  400   CSPSLATISASAPFPTITLDLTHSPNLL-QHQRPNAQFHVPFQ---NLPQNFAPGSHAFN  455

Query  638   QGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDP  459
               L++QSKFS L  S +              Q             +DT++AATAAIT+DP
Sbjct  456   PVLHSQSKFSALQSSPE----------MQPPQVGTEQVLKPSSSSSDTVTAATAAITADP  505

Query  458   NFTAALAAAISSIMG  414
             NFTAAL AAI+SI+G
Sbjct  506   NFTAALVAAITSIIG  520



>ref|XP_009403740.1| PREDICTED: WRKY transcription factor 6-like [Musa acuminata subsp. 
malaccensis]
Length=510

 Score =   317 bits (812),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 253/486 (52%), Positives = 317/486 (65%), Gaps = 46/486 (9%)
 Frame = -1

Query  1847  NEVDFFSDKKADIVVKK------EITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvs  1686
             +E+DFFS++K  + +        ++ +    + + DL+    L ++N+ SD STVDD +S
Sbjct  34    SEMDFFSNEKKKMTMTSCAAPELDLKVPSLCIKREDLSVNTGLHLSNTRSDLSTVDDGMS  93

Query  1685  sDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSR  1506
                +++  K++L+ +Q EL +MN EN +LR ML+Q++TNY ALQ  L  L     QQ   
Sbjct  94    PPEDDKEGKSELTAVQAELARMNQENNKLRLMLNQLTTNYNALQMQLVAL----TQQRRT  149

Query  1505  IGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTL  1326
              G+ Q+ E    + +            RQF++L PGG        DE S S +TS +  L
Sbjct  150   SGNPQEPENKKMEEKSHDEHDGAVVPRRQFMDLGPGG------DIDEPSHSSSTSRDPCL  203

Query  1325  SAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRKARVSVR  1146
             S  S    +TE+S       RED      W  NK P+L PSK  ++A +ATMRKARVSVR
Sbjct  204   SLRS----HTEVSLDHEKHVREDDRAEHGWNSNKTPRLAPSKSAERAEDATMRKARVSVR  259

Query  1145  ARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY  966
             ARSEAP I+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCA+DR+ILITTY
Sbjct  260   ARSEAPTITDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQRCADDRSILITTY  319

Query  965   EGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISAS  786
             EGTH+HPLPPAA+ MASTTSAAA+ML+SG+MPSADG M++NFLAR +LPCSSS+A+ISAS
Sbjct  320   EGTHSHPLPPAAIPMASTTSAAASMLVSGSMPSADGPMSSNFLARTVLPCSSSMASISAS  379

Query  785   APFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSG  606
             APFPTVTLDLTQ+P+        P QFQ PF      P   P LPQVFGQ L NQS+FSG
Sbjct  380   APFPTVTLDLTQSPS--------PLQFQLPF------PSAAPPLPQVFGQPLQNQSRFSG  425

Query  605   LHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAIS  426
             L +S +            AQ     A     P  ADT+S   A IT+DPNFTAA+AAAIS
Sbjct  426   LQMSPE---------MDPAQLAHPKAQSVAPPSLADTVS---AVITADPNFTAAVAAAIS  473

Query  425   SIMGGG  408
             SI+GG 
Sbjct  474   SIIGGA  479



>emb|CAN78720.1| hypothetical protein VITISV_035804 [Vitis vinifera]
Length=551

 Score =   318 bits (814),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 254/495 (51%), Positives = 319/495 (64%), Gaps = 45/495 (9%)
 Frame = -1

Query  1847  NEVDFFSDKK-ADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvssDMEE  1671
             NE+DFF+ K+ A + VK+E T H   V    +NTGL L +A+ GS+KS+VD   S   +E
Sbjct  54    NEMDFFAQKETARVDVKRETTAHDGLVQGFHINTGLNLHLASGGSEKSSVDGGTSPSNKE  113

Query  1670  RRAKNDLSV-LQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGST  1494
             +   +D  V L+ ELE MN EN++LR MLSQV+ NY+ALQ H+  LMQ Q+ + + I   
Sbjct  114   KLNMSDKMVGLRAELENMNKENKQLRAMLSQVNNNYSALQMHVVTLMQRQHNRRAEISLA  173

Query  1493  QDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEA-----------SQSHT  1347
              +    + + +  +  + E  VPRQF++L    G A+ A+ DE+           +    
Sbjct  174   NE---VNTEGKVGERNRNETIVPRQFMDL----GRASMAEKDESSPSWSGSRSPQTNEDA  226

Query  1346  TSEERTLSAGSPRNNNTELSRHKGIIAREDSPDS--ESWApnklpklnpskPVDQAAEAT  1173
             + E R    GS  N N +         RE+S D   +   PNK+PK N S+ V+QA+EA 
Sbjct  227   SRESRRRKTGSTSNENKD-------GGREESSDQSLQGGLPNKVPKFNCSQNVEQASEAM  279

Query  1172  --MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRC  999
               MRKARVSVRARSEA MISDGCQWRKYGQKMAKGNPCPRAYYRCTMA  CPVRKQVQR 
Sbjct  280   SMMRKARVSVRARSEASMISDGCQWRKYGQKMAKGNPCPRAYYRCTMATACPVRKQVQRS  339

Query  998   AEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILP  819
             AEDRT+LITTYEG HNHPLPPAAMAMASTTSAAA MLLSG+MPS+DG+M+++F +R + P
Sbjct  340   AEDRTVLITTYEGHHNHPLPPAAMAMASTTSAAATMLLSGSMPSSDGIMSSSFHSRTMFP  399

Query  818   CSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFG  639
             CS S+ATISASAPFPT+TLDLT +PN L  +QRP  QF  PF      PQN+      F 
Sbjct  400   CSPSLATISASAPFPTITLDLTHSPNLL-QHQRPNAQFHVPFQNH---PQNFAPGSHAFN  455

Query  638   QGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDP  459
               L++QSKFS L  S +              Q             +DT++AATAAIT+DP
Sbjct  456   PVLHSQSKFSALQSSPE----------MQPPQVGTEQVLKPSSSSSDTVTAATAAITADP  505

Query  458   NFTAALAAAISSIMG  414
             NFTAAL AAI+SI+G
Sbjct  506   NFTAALVAAITSIIG  520



>ref|XP_007020766.1| WRKY transcription factor-like protein [Theobroma cacao]
 gb|EOY12291.1| WRKY transcription factor-like protein [Theobroma cacao]
Length=580

 Score =   318 bits (814),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 257/522 (49%), Positives = 320/522 (61%), Gaps = 80/522 (15%)
 Frame = -1

Query  1847  NEVDFFS---------DKKADIVVKKE----ITLHGEPVTKADLNTGLQLVIANsgsdks  1707
             NE+DFF          + KAD+ ++ E    +  + EP   AD+NTGL L+  N  S+KS
Sbjct  72    NEMDFFGSGGRSSSKEEAKADVKIESERQGLVQENDEPAA-ADVNTGLNLLTTNIVSEKS  130

Query  1706  tvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQH  1527
                D  S +++++   N L+ ++ ELE++N ENQRL+  L+QV++NY ALQ HL +LMQ 
Sbjct  131   VPGDRTSQNLKDKERVNQLADVRAELERINEENQRLKVTLNQVNSNYYALQMHLVSLMQR  190

Query  1526  QNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHT  1347
             Q  Q+ R  S+   E ++     ++    E  V RQF++L    G +A A+ DE S+S +
Sbjct  191   Q--QNRRDESS---EASEMNRTTEEKRHGEVIVARQFIDL----GQSAKAEKDELSESSS  241

Query  1346  TSEERTLSAGSPRNNNTE-LSRHK-----------------------GIIAREDSPDSE-  1242
                 +  S GSP N   E + R K                       G   RE++P+   
Sbjct  242   DGRVQEFS-GSPGNTIVESMERRKTNSSRNCETVPIDPISRKDLMDPGRNQREETPEGRP  300

Query  1241  --SWApnklpklnpskPVDQAAE--ATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKG  1074
                W  NK+PK N S+ V+ A E  A +RKARVSVRARSEA MISDGCQWRKYGQKMAKG
Sbjct  301   HPGWLQNKVPKFNTSRDVELAQETMAMIRKARVSVRARSEASMISDGCQWRKYGQKMAKG  360

Query  1073  NPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaan  894
             NPCPRAYYRCTMA GCPVRKQVQRCA+DRTIL TTYEG HNHPLPPAAMAMASTTSAAA+
Sbjct  361   NPCPRAYYRCTMATGCPVRKQVQRCADDRTILNTTYEGNHNHPLPPAAMAMASTTSAAAS  420

Query  893   mllSGAMPSADGMMNTN-FLARAI-LPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQR  720
             MLLSG+MPSADGMMN++  L + I LPCS +  T+SASAPFPTVTLDLT  PN     QR
Sbjct  421   MLLSGSMPSADGMMNSSTILPKGIMLPCSPNSVTLSASAPFPTVTLDLTYNPN-----QR  475

Query  719   PPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqq  540
             P +Q  AP           P +P + G  +YNQSK  GL  S Q I      A    Q  
Sbjct  476   PTSQLLAP----------SPNIPHLLGHPIYNQSKLLGL-FSSQGIEHHPHLAQNQMQPP  524

Query  539   qhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMG  414
                         ADT++AATAAIT+DPNFTAAL AAI+SI+G
Sbjct  525   HP---------MADTVNAATAAITADPNFTAALVAAITSIIG  557



>ref|XP_010529450.1| PREDICTED: probable WRKY transcription factor 31 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010529451.1| PREDICTED: probable WRKY transcription factor 31 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010529452.1| PREDICTED: probable WRKY transcription factor 31 isoform X1 [Tarenaya 
hassleriana]
Length=600

 Score =   318 bits (815),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 276/537 (51%), Positives = 336/537 (63%), Gaps = 86/537 (16%)
 Frame = -1

Query  1874  PAAEKRGPPNEVDFFSDKK--------AD----IVVKKEITLHGEPVTKADLNTGLQLVI  1731
             PA E R   +EVDFFS+K+        AD    + VK EI+   +     D+N GL L+ 
Sbjct  81    PADEHRVAVDEVDFFSEKRDRVSRDNTADETNRVHVKMEISRVEDDDRSRDVNIGLNLLT  140

Query  1730  ANsgsdkstvddsvssDMEERRAKNDLSV-LQVELEKMNAENQRLRGMLSQVSTNYTALQ  1554
             AN+GSD+STVDD +S DMEE+RAK++  V LQ EL+KM  ENQRLR ML+Q S+NY++LQ
Sbjct  141   ANAGSDESTVDDGLSMDMEEKRAKSEQMVQLQGELQKMKEENQRLREMLNQASSNYSSLQ  200

Query  1553  QHLSNLMQHQNQQSSRIGSTQDREV-ADRKSeekkpekeePTVPRQFLELVPgggaaaaA  1377
               L  +M+ Q  ++S    +QD  + A+ KS+ +  +++   VPRQF++L P   AA   
Sbjct  201   MQLVAVMRQQEHRNS----SQDHLLGAEGKSDGRTRQEQPAMVPRQFIDLGPLSSAAEH-  255

Query  1376  QTDEASQSHTTSEERT-LSAGSP---RNNNTELSRHKGIIAREDSPDSES--WApnkl--  1221
                    +  +SEERT + +GSP     N+ +    K ++ RE SP++ES  W   K   
Sbjct  256   ------DTEVSSEERTTVRSGSPPPILENSNQRDDGKRLLGREASPETESNGWGNPKKVP  309

Query  1220  ----pklnpskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRA  1056
                         +DQ AAEATMRKARVSVRARSE PMISDGCQWRKYGQKMAKGNPCPRA
Sbjct  310   KHNPSGNGNGNVIDQSAAEATMRKARVSVRARSEVPMISDGCQWRKYGQKMAKGNPCPRA  369

Query  1055  YYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGA  876
             YYRCTMAVGCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMASTT+AAA+MLLSG+
Sbjct  370   YYRCTMAVGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMASTTTAAASMLLSGS  429

Query  875   MPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPT----  711
             M S +G+MN TN LARAI PCSSS+ATISASAPFPT+TLDLT    +  N   P      
Sbjct  430   MASQEGLMNPTNLLARAIFPCSSSMATISASAPFPTITLDLTTNSANAGNNPNPNATATA  489

Query  710   -------QF-QAPFTGAPQIPQNYPQLPQVFGQGLY----NQSKFSGLHVSHQDIaaaaa  567
                    QF Q P   A  +  N   LPQV  Q LY     QSKFSGL +  Q +     
Sbjct  490   TANNPLLQFAQRPGFAASAL--NPSVLPQVVSQALYYNNNQQSKFSGLQLPAQPLPT---  544

Query  566   qaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIM-GGGSQP  399
                                      +AATAAI +DPNF AALAAAI+SI+ G G QP
Sbjct  545   -------------------------AAATAAIAADPNFAAALAAAITSIINGSGHQP  576



>emb|CBI26664.3| unnamed protein product [Vitis vinifera]
Length=496

 Score =   315 bits (807),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 252/493 (51%), Positives = 318/493 (65%), Gaps = 45/493 (9%)
 Frame = -1

Query  1841  VDFFSDKK-ADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvssDMEERR  1665
             +DFF+ K+ A + VK+E T H   V    +NTGL L +A+ GS+KS+VD   S   +E+ 
Sbjct  1     MDFFAQKETARVDVKRETTAHDGLVQGFHINTGLNLHLASGGSEKSSVDGGTSPSNKEKL  60

Query  1664  AKNDLSV-LQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQD  1488
               +D  V L+ ELE MN EN++LR MLSQV+ NY+ALQ H+  LMQ Q+ + + I    +
Sbjct  61    NMSDKMVGLRAELENMNKENKQLRAMLSQVNNNYSALQMHVVTLMQRQHNRRAEISLANE  120

Query  1487  REVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEA-----------SQSHTTS  1341
                 + + +  +  + E  VPRQF++L    G A+ A+ DE+           +    + 
Sbjct  121   ---VNTEGKVGERNRNETIVPRQFMDL----GRASMAEKDESSPSWSGSRSPQTNEDASR  173

Query  1340  EERTLSAGSPRNNNTELSRHKGIIAREDSPDS--ESWApnklpklnpskPVDQAAEAT--  1173
             E R    GS  N N +         RE+S D   +   PNK+PK N S+ V+QA+EA   
Sbjct  174   ESRRRKTGSTSNENKD-------GGREESSDQSLQGGLPNKVPKFNCSQNVEQASEAMSM  226

Query  1172  MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAE  993
             MRKARVSVRARSEA MISDGCQWRKYGQKMAKGNPCPRAYYRCTMA  CPVRKQVQR AE
Sbjct  227   MRKARVSVRARSEASMISDGCQWRKYGQKMAKGNPCPRAYYRCTMATACPVRKQVQRSAE  286

Query  992   DRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCS  813
             DRT+LITTYEG HNHPLPPAAMAMASTTSAAA MLLSG+MPS+DG+M+++F +R + PCS
Sbjct  287   DRTVLITTYEGHHNHPLPPAAMAMASTTSAAATMLLSGSMPSSDGIMSSSFHSRTMFPCS  346

Query  812   SSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQG  633
              S+ATISASAPFPT+TLDLT +PN L  +QRP  QF  PF     +PQN+      F   
Sbjct  347   PSLATISASAPFPTITLDLTHSPNLL-QHQRPNAQFHVPFQ---NLPQNFAPGSHAFNPV  402

Query  632   LYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNF  453
             L++QSKFS L  S +              Q             +DT++AATAAIT+DPNF
Sbjct  403   LHSQSKFSALQSSPE----------MQPPQVGTEQVLKPSSSSSDTVTAATAAITADPNF  452

Query  452   TAALAAAISSIMG  414
             TAAL AAI+SI+G
Sbjct  453   TAALVAAITSIIG  465



>ref|NP_192354.1| putative WRKY transcription factor 42 [Arabidopsis thaliana]
 sp|Q9XEC3.1|WRK42_ARATH RecName: Full=Probable WRKY transcription factor 42; AltName: 
Full=WRKY DNA-binding protein 42 [Arabidopsis thaliana]
 gb|AAD29757.1|AF076243_4 putative DNA-binding protein [Arabidopsis thaliana]
 emb|CAB77913.1| putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAL11011.1| WRKY transcription factor 42 [Arabidopsis thaliana]
 gb|ABE66044.1| WRKY family transcription factor [Arabidopsis thaliana]
 dbj|BAH30514.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82389.1| putative WRKY transcription factor 42 [Arabidopsis thaliana]
Length=528

 Score =   315 bits (807),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 255/527 (48%), Positives = 323/527 (61%), Gaps = 92/527 (17%)
 Frame = -1

Query  1862  KRGPPNEVDFF-SDKKADIVVKKEITLHGEPVTKAD------------------LNTGLQ  1740
             +R   NEVDFF S +K D V ++E  +  +   +                    +N GL 
Sbjct  24    QRAVVNEVDFFRSAEKRDRVSREEQNIIADETHRVHVKRENSRVDDHDDRSTDHINIGLN  83

Query  1739  LVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTA  1560
             L+ AN+GSD+S VDD +S DMEE+R K + + L+ EL+K + +NQRL+ MLSQ + N+ +
Sbjct  84    LLTANTGSDESMVDDGLSVDMEEKRTKCENAQLREELKKASEDNQRLKQMLSQTTNNFNS  143

Query  1559  LQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaa  1380
             LQ  L  +M+ Q        +  +  V +R    +        VPRQF++L P       
Sbjct  144   LQMQLVAVMRQQEDHHHLATTENNDNVKNRHEVPE-------MVPRQFIDLGP-------  189

Query  1379  AQTDEASQSHTTSEERT-LSAGSP---RNNNTELSRHKGIIAREDSPDSES--W------  1236
               +DE S     SEERT + +GSP      ++     K ++ RE+SP++ES  W      
Sbjct  190   -HSDEVS-----SEERTTVRSGSPPSLLEKSSSRQNGKRVLVREESPETESNGWRNPNKV  243

Query  1235  ---------ApnklpklnpskPVDQAA-EATMRKARVSVRARSEAPMISDGCQWRKYGQK  1086
                            +   SK ++QAA EATMRKARVSVRARSEAPM+SDGCQWRKYGQK
Sbjct  244   PKHHASSSICGGNGSENASSKVIEQAAAEATMRKARVSVRARSEAPMLSDGCQWRKYGQK  303

Query  1085  MAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamastts  906
             MAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAM MASTT+
Sbjct  304   MAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMNMASTTT  363

Query  905   aaanmllSGA-MPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLP  732
             AAA+MLLSG+ M + DG+MN TN LAR ILPCSSS+ATISASAPFPT+TLDLT++PN   
Sbjct  364   AAASMLLSGSTMSNQDGLMNPTNLLARTILPCSSSMATISASAPFPTITLDLTESPNGNN  423

Query  731   NYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLY--NQSKFSGLHVSHQDIaaaaaqaa  558
                 P  QF +  +G  ++ Q+   LP + GQ LY   QSKFSGLH+  Q + A      
Sbjct  424   PTNNPLMQF-SQRSGLVELNQSV--LPHMMGQALYYNQQSKFSGLHMPSQPLNA------  474

Query  557   qlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIM  417
                                +++SAATAAI S+PNF AALAAAI+SI+
Sbjct  475   ------------------GESVSAATAAIASNPNFAAALAAAITSII  503



>gb|AFH01342.1| WRKY4 transcription factor, partial [Gossypium hirsutum]
Length=252

 Score =   305 bits (782),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 195/252 (77%), Positives = 212/252 (84%), Gaps = 11/252 (4%)
 Frame = -1

Query  1196  VDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVR  1017
             VDQ+ EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVR
Sbjct  7     VDQSTEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVR  66

Query  1016  KQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFL  837
             KQVQRCA+DRTILITTYEG HNHPLPPAAMAMASTT+AAA+MLLSG+MPSADG+MN N L
Sbjct  67    KQVQRCADDRTILITTYEGNHNHPLPPAAMAMASTTAAAASMLLSGSMPSADGIMNPNLL  126

Query  836   ARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQR---PPTQFQAPFTGAPQIPQN  666
             ARAILPCSSS+ATISASAPFPTVTLDLT +PN L  +QR   PPTQFQ PF G P  P +
Sbjct  127   ARAILPCSSSMATISASAPFPTVTLDLTHSPNPL-QFQRPPPPPTQFQVPFPGQP-APVS  184

Query  665   YPQLPQVFGQGLY--NQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTL  492
              PQLPQVFGQ LY  NQSKFSGL +S +      +      QQQQH +PP Q P  ADT+
Sbjct  185   APQLPQVFGQPLYNNNQSKFSGLQLSQE----MGSSQLGHQQQQQHQSPPQQPPTLADTV  240

Query  491   SAATAAITSDPN  456
             SAATAAIT+DPN
Sbjct  241   SAATAAITNDPN  252



>ref|XP_010455724.1| PREDICTED: probable WRKY transcription factor 42 [Camelina sativa]
Length=531

 Score =   314 bits (805),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 242/473 (51%), Positives = 305/473 (64%), Gaps = 73/473 (15%)
 Frame = -1

Query  1757  LNTGLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQV  1578
             +N GL L+ AN+GSD+S VDD +S DMEE+R K +   L+ EL+K + +NQRL+ MLSQ 
Sbjct  81    INIGLNLLTANTGSDESMVDDGLSVDMEEKRTKCENVQLREELKKASEDNQRLKEMLSQT  140

Query  1577  STNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPg  1398
             + N+ +LQ  L  +M+ Q +    + +T++++ A  + E  +       VPRQF++L P 
Sbjct  141   TNNFNSLQMQLVAVMRQQ-EDHHHLATTENKDNAKNRHEVPEM------VPRQFIDLGPP  193

Query  1397  ggaaaaAQTDEASQSHTTSEERTL-SAGSPRN---NNTELSRHKGIIAREDSPDSES--W  1236
                     +DE S     SEERT+  AGSP++    ++     K ++ RE+SP++ES  W
Sbjct  194   --------SDEVS-----SEERTMVRAGSPQSLLEKSSSRQNGKRVLVREESPETESNGW  240

Query  1235  ---------------ApnklpklnpskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQW  1104
                                      +  + Q AAEATMRKARVSVRARSEAPM+SDGCQW
Sbjct  241   RNPNKVPKHHGSSSNCGGNGSGNGNNNVIQQSAAEATMRKARVSVRARSEAPMLSDGCQW  300

Query  1103  RKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaama  924
             RKYGQKMAKGNPCPRAYYRCTM  GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAM+
Sbjct  301   RKYGQKMAKGNPCPRAYYRCTMVNGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMS  360

Query  923   masttsaaanmllSGA-MPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQ  750
             MASTT+AAA+MLLSG+ M S DG+MN TN LAR ILPCSSS+ATISASAPFPT+TLDLT 
Sbjct  361   MASTTTAAASMLLSGSTMSSQDGLMNPTNLLARTILPCSSSMATISASAPFPTITLDLTD  420

Query  749   TPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLY--NQSKFSGLHVSHQDIaa  576
             + N       P  QF +  +G  ++ Q+   LPQ+ GQ LY   QSKFSGLH+  Q + A
Sbjct  421   SSNGNNLTNNPLMQF-SQRSGFAELNQSV--LPQMMGQALYYNQQSKFSGLHMPSQPLNA  477

Query  575   aaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIM  417
                                      + +SAATAAI S+PNF AALAAAI+SI+
Sbjct  478   ------------------------GENVSAATAAIASNPNFAAALAAAITSII  506



>ref|XP_010496182.1| PREDICTED: probable WRKY transcription factor 42 [Camelina sativa]
 ref|XP_010496183.1| PREDICTED: probable WRKY transcription factor 42 [Camelina sativa]
 ref|XP_010496184.1| PREDICTED: probable WRKY transcription factor 42 [Camelina sativa]
Length=531

 Score =   314 bits (805),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 251/528 (48%), Positives = 322/528 (61%), Gaps = 94/528 (18%)
 Frame = -1

Query  1859  RGPPNEVDFF------------------SDKKADIVVKKEITLH---GEPVTKADLNTGL  1743
             R   +EVDFF                  +D+   + VK+EI       E  +   +N GL
Sbjct  26    RAVVDEVDFFRSAEKRDRVTRDEQNIIAADETHKVHVKREINSRVDDREDRSTDHINIGL  85

Query  1742  QLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYT  1563
              L+ AN+GSD+S VDD +S DMEE+R K +   L+ EL+K + +NQRL+ MLSQ + N+ 
Sbjct  86    NLLTANTGSDESMVDDGLSVDMEEKRTKCENVQLREELKKASEDNQRLKEMLSQTTNNFN  145

Query  1562  ALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaa  1383
             +LQ  L  +M+ Q +    + +T++++ A  +       +    VPRQF++L P      
Sbjct  146   SLQMQLVAVMRQQ-EDHHHLATTENKDNAKNR------HEVPEMVPRQFIDLGPP-----  193

Query  1382  aAQTDEASQSHTTSEERT-LSAGSPRN---NNTELSRHKGIIAREDSPDSES--W-----  1236
                +DE S     SEERT + +GSP++    ++     K ++ RE+SP++ES  W     
Sbjct  194   ---SDEVS-----SEERTTVRSGSPQSLLEKSSSRQNGKRVLVREESPETESNGWRNPYK  245

Query  1235  ----------ApnklpklnpskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKYGQ  1089
                                 +  ++Q AAEATMRKARVSVRARSEAPM+SDGCQWRKYGQ
Sbjct  246   IPKHHGSSSNCGGNGNGNGNNNVIEQSAAEATMRKARVSVRARSEAPMLSDGCQWRKYGQ  305

Query  1088  KMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamastt  909
             KMAKGNPCPRAYYRCTM  GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAM+MASTT
Sbjct  306   KMAKGNPCPRAYYRCTMVNGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMSMASTT  365

Query  908   saaanmllSGA-MPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSL  735
             +AAA+MLLSG+ M S DG+MN TN LAR ILPCSSS+ATISASAPFPT+TLDLT + N  
Sbjct  366   TAAASMLLSGSTMSSQDGLMNPTNLLARTILPCSSSMATISASAPFPTITLDLTDSSNGN  425

Query  734   PNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLY--NQSKFSGLHVSHQDIaaaaaqa  561
                  P  QF +  +G  ++ Q+   LP + GQ LY   QSKFSGLH+  Q + A     
Sbjct  426   NLTNNPLMQF-SQRSGFAELNQSV--LPHMMGQALYYNQQSKFSGLHMPSQPLNA-----  477

Query  560   aqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIM  417
                                 + +SAATAAI S+PNF AALAAAI+SI+
Sbjct  478   -------------------GENVSAATAAIASNPNFAAALAAAITSII  506



>gb|ABK28621.1| unknown [Arabidopsis thaliana]
Length=529

 Score =   313 bits (803),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 254/527 (48%), Positives = 322/527 (61%), Gaps = 92/527 (17%)
 Frame = -1

Query  1862  KRGPPNEVDFF-SDKKADIVVKKEITLHGEPVTKAD------------------LNTGLQ  1740
             +R   NEVDFF S +K D V ++E  +  +   +                    +N GL 
Sbjct  24    QRAVVNEVDFFRSAEKRDRVSREEQNIIADETHRVHVKRENSRVDDHDDRSTDHINIGLN  83

Query  1739  LVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTA  1560
             L+ AN+GSD+S VDD +S DMEE+R K + + L+ EL+K + +NQRL+ MLSQ + N+ +
Sbjct  84    LLTANTGSDESMVDDGLSVDMEEKRTKCENAQLREELKKASEDNQRLKQMLSQTTNNFNS  143

Query  1559  LQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaa  1380
             LQ  L  +M+ Q        +  +  V +R    +        VPRQF++L P       
Sbjct  144   LQMQLVAVMRQQEDHHHLATTENNDNVKNRHEVPE-------MVPRQFIDLGP-------  189

Query  1379  AQTDEASQSHTTSEERT-LSAGSP---RNNNTELSRHKGIIAREDSPDSES--W------  1236
               +DE S     SEERT + +GSP      ++     K ++ RE+SP++ES  W      
Sbjct  190   -HSDEVS-----SEERTTVRSGSPPSLLEKSSSRQNGKRVLVREESPETESNGWRNPNKV  243

Query  1235  ---------ApnklpklnpskPVDQAA-EATMRKARVSVRARSEAPMISDGCQWRKYGQK  1086
                            +   SK ++QAA EATMRK RVSVRARSEAPM+SDGCQWRKYGQK
Sbjct  244   PKHHASSSICGGNGSENASSKVIEQAAAEATMRKVRVSVRARSEAPMLSDGCQWRKYGQK  303

Query  1085  MAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamastts  906
             MAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAM MASTT+
Sbjct  304   MAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMNMASTTT  363

Query  905   aaanmllSGA-MPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLP  732
             AAA+MLLSG+ M + DG+MN TN LAR ILPCSSS+ATISASAPFPT+TLDLT++PN   
Sbjct  364   AAASMLLSGSTMSNQDGLMNPTNLLARTILPCSSSMATISASAPFPTITLDLTESPNGNN  423

Query  731   NYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLY--NQSKFSGLHVSHQDIaaaaaqaa  558
                 P  QF +  +G  ++ Q+   LP + GQ LY   QSKFSGLH+  Q + A      
Sbjct  424   PTNNPLMQF-SQRSGLVELNQSV--LPHMMGQALYYNQQSKFSGLHMPSQPLNA------  474

Query  557   qlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIM  417
                                +++SAATAAI S+PNF AALAAAI+SI+
Sbjct  475   ------------------GESVSAATAAIASNPNFAAALAAAITSII  503



>ref|XP_004506257.1| PREDICTED: probable WRKY transcription factor 31-like [Cicer 
arietinum]
Length=503

 Score =   312 bits (799),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 236/489 (48%), Positives = 298/489 (61%), Gaps = 57/489 (12%)
 Frame = -1

Query  1844  EVDFFSDKKAD--IVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvssDMEE  1671
             E+DFF D   D   VV      +     +  +NTGL L+  N+ SD+S VDD +S +  +
Sbjct  33    ELDFFKDNNNDHHKVVSHNDLNNTPSFMEFQVNTGLNLLTTNTSSDQSMVDDDMSPNSYD  92

Query  1670  RRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQ  1491
             ++ K++  +LQ +L+++  EN+RL  ML Q+  +YTALQ H++NLMQ +          +
Sbjct  93    KKTKDECLILQGDLDRVKMENRRLTLMLDQLKADYTALQMHMANLMQEK--------KAE  144

Query  1490  DREVADRK-SeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGS  1314
             ++EV D K  E+KK E     +PRQF++L   G AA A   D AS S   S ++    GS
Sbjct  145   EQEVFDGKFEEKKKVENSGVLMPRQFMDL---GLAANAEVDDPASPSXGRSRDQL---GS  198

Query  1313  PRNNNTELSRHKGIIARED-SPDSESWApnklpklnpskPVDQAAEATMRKARVSVRARS  1137
             P N     S  +GII  E+   + +            +  VDQ  EATMRKARVSVRARS
Sbjct  199   PTNVEVA-SMEEGIIKNENVGVEEKKEIERHNFSPPKNVNVDQV-EATMRKARVSVRARS  256

Query  1136  EAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGT  957
             +AP+ISDGCQWRKYGQKMAKGNPCPRAYYRCTM+  CPVRKQVQRCAEDRT+LITTYEG 
Sbjct  257   DAPIISDGCQWRKYGQKMAKGNPCPRAYYRCTMSSACPVRKQVQRCAEDRTVLITTYEGN  316

Query  956   hnhplppaamamasttsaaanmllSGAMPSAD-GMMNTNFLARAILPCSSSVATISASAP  780
             HNH LPPAA  M  TTS+AA MLLSG+  S D G+MN NFL R  LPCSS++ATISASAP
Sbjct  317   HNHALPPAARGMVETTSSAATMLLSGSTSSTDHGLMNPNFLTRTFLPCSSTMATISASAP  376

Query  779   FPTVTLDLTQTPNSLPNYQRPPTQFQA-PFTGAPQIPQNYPQLPQVFGQ--GLYNQSKFS  609
             FPT+TLDLTQ+PN        P Q Q    + AP +      +PQ+FGQ    + QSKFS
Sbjct  377   FPTITLDLTQSPN--------PLQLQNFANSSAPSL------IPQIFGQVPNNFQQSKFS  422

Query  608   GLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAI  429
             GL +S   I ++   +                      L+  +AAIT DPNFTAALA AI
Sbjct  423   GLQLSQNSIDSSHLASIP-------------------NLADFSAAITKDPNFTAALAVAI  463

Query  428   SSIMGGGSQ  402
             +SI GG  Q
Sbjct  464   TSIFGGVQQ  472



>ref|XP_009361023.1| PREDICTED: probable WRKY transcription factor 31 [Pyrus x bretschneideri]
Length=538

 Score =   313 bits (801),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 256/522 (49%), Positives = 312/522 (60%), Gaps = 79/522 (15%)
 Frame = -1

Query  1847  NEVDFFSDK---KAD----IVVKKEITLHGEPVTKA--DLNTGLQLVIANsgsdkstvd-  1698
             +E+DFF+DK   K D      VK+E   HG    K   D+N GL L+  N+ S+KS++D 
Sbjct  33    DELDFFADKGHLKEDRDHTAEVKEECERHGVGQEKQLPDVNIGLNLLTTNTSSEKSSMDD  92

Query  1697  -dsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQN  1521
               S S   E +   N L+VL+ EL +MN ENQ+LRG + Q++T+Y ALQ HL  LMQ Q 
Sbjct  93    GTSSSHTTENKHRTNQLAVLRAELGRMNVENQQLRGAIHQLNTHYQALQVHLVTLMQRQK  152

Query  1520  QQSSRIGSTQDREVADRKSeekkpekeePTV----PRQFLELVPgggaaaaAQTDEASQ-  1356
              Q     + +  ++    S   + ++    +    PRQF+++         A+ DE SQ 
Sbjct  153   NQKIDYQTAEQHKMNINGSVVLEEKQMMNGINNLAPRQFMDM-------GRAEKDELSQC  205

Query  1355  SHTTSEERTLSAGSPRNNNTELSR--------HKGIIAR------EDSPDSE--SWApnk  1224
             SH     +  S   PRN+  E           H+ I  R      EDSPD E   W P K
Sbjct  206   SHEGCRSQDCSGSPPRNDIVESMECCKSTSHVHRDISGRSRTAGGEDSPDQELQGWIPKK  265

Query  1223  lpklnpskPVDQAAEATM---RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAY  1053
             +PKL   + VDQ +   M   +KARVSVRARSEA MISDGCQWRKYGQKMAKGNPCPRAY
Sbjct  266   VPKLMSRREVDQPSSEAMSMIKKARVSVRARSEASMISDGCQWRKYGQKMAKGNPCPRAY  325

Query  1052  YRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAM  873
             YRCTM  GCPVRKQVQRCAED+TILITTYEG HNHPLPPAAMAMASTTSAAA+MLLSG+M
Sbjct  326   YRCTMRTGCPVRKQVQRCAEDQTILITTYEGHHNHPLPPAAMAMASTTSAAASMLLSGSM  385

Query  872   PSADGMMNTN-FLARAILP-CSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQA  699
             PSADG++++N FLAR  LP C  S+AT+SASAPFPTVTLDLT+T          PT  + 
Sbjct  386   PSADGLISSNSFLARTGLPNCPPSLATLSASAPFPTVTLDLTRT----------PTSSEM  435

Query  698   PFTGAPQIPQNYPQ-----LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqh  534
             P     Q+P N+P      +PQV GQ L NQS FS L                       
Sbjct  436   PLGQPNQLPPNFPHNNLMSVPQVLGQALCNQSNFSVL--------------------DSL  475

Query  533   papppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGG  408
                       AD +SAATAAIT+DPNFTAAL AAI+SI+G G
Sbjct  476   QGLDSTTHSLADKISAATAAITADPNFTAALVAAITSIVGNG  517



>gb|KFK29599.1| hypothetical protein AALP_AA7G155100 [Arabis alpina]
Length=537

 Score =   313 bits (801),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 273/530 (52%), Positives = 335/530 (63%), Gaps = 69/530 (13%)
 Frame = -1

Query  1880  INPAAEKRGPPNEVDFFSDKKA----------------DIVVKKEITLHGEPVTKADLNT  1749
             I P  E R   +EVDFFSDK+                  ++VK E +   +     D+N 
Sbjct  20    ITPLDEHRVVVDEVDFFSDKRDRVSREIINEEDDDEANKVLVKMENSRVEDNDRSRDVNI  79

Query  1748  GLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTN  1569
             GL L+ AN+GSD+STVDD +S DME++RAK + + LQ EL+KM  ENQRLR MLSQ + N
Sbjct  80    GLNLLTANTGSDESTVDDGLSMDMEDKRAKIENAQLQEELKKMKIENQRLREMLSQATNN  139

Query  1568  YTALQQHLSNLMQHQNQQSSRIGSTQDREVA-DRKSeekkpekeePTVPRQFLELVPggg  1392
             + +LQ  L  +M+ Q Q++S    +QD  +A D K+E +K ++ +  VPRQF++L P  G
Sbjct  140   FNSLQMQLVAVMRQQEQRNS----SQDHLLATDSKAEGRKRQEMQSMVPRQFMDLGPSSG  195

Query  1391  aa---aaAQTDEASQSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSES--WAp-  1230
             AA   A   + E +   + S    L + +PR         K ++ RE+SP+SES  W   
Sbjct  196   AAEPDAEVSSGERTMVRSGSPPSLLESSNPREGG------KRLLGREESPESESNPWGNP  249

Query  1229  ----------nklpklnpskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKYGQKM  1083
                       +          +DQ AAEATMRKARVSVRARSEAPMISDGCQWRKYGQKM
Sbjct  250   IKVQKHNPSSSNNNGNGNGNVIDQSAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKM  309

Query  1082  AKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsa  903
             AKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMASTT+A
Sbjct  310   AKGNPCPRAYYRCTMAGGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMASTTTA  369

Query  902   aanmllSGAMPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNY  726
             AA+MLLSG+M S DG+MN TN LARA+LPCSSS+ATISASAPFPT+TLDLT  P++  N 
Sbjct  370   AASMLLSGSMSSQDGLMNPTNLLARAMLPCSSSMATISASAPFPTITLDLT-NPSNGNNP  428

Query  725   QRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLY---NQSKFSGLHVSHQDIaaaaaqaaq  555
                       F   P    N   LPQV GQ LY    QSKFSGL +  Q +  AA  +  
Sbjct  429   NMTTNNPLMQFAQRPGF--NPAVLPQVVGQALYYNQQQSKFSGLQLPTQPLQMAATSSV-  485

Query  554   laqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGS  405
                              A+++SAA+AAI SDPNF AALAAAI+SI+ G S
Sbjct  486   -----------------AESVSAASAAIASDPNFAAALAAAITSIINGSS  518



>ref|XP_010432828.1| PREDICTED: probable WRKY transcription factor 42 [Camelina sativa]
 ref|XP_010432834.1| PREDICTED: probable WRKY transcription factor 42 [Camelina sativa]
Length=533

 Score =   312 bits (800),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 251/530 (47%), Positives = 321/530 (61%), Gaps = 96/530 (18%)
 Frame = -1

Query  1859  RGPPNEVDFF------------------SDKKADIVVKKEITLH---GEPVTKADLNTGL  1743
             R   +EVDFF                  +D+   + VK+EI       E  +   +N GL
Sbjct  26    RAVVDEVDFFRSAEKRDRVTRDEQNIIAADETHKVHVKREINSRVDDNEDRSTDHINIGL  85

Query  1742  QLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYT  1563
              L+ AN+GSD+S VDD +S DMEE+R K +   L+ EL+K + +NQRL+ MLSQ + N+ 
Sbjct  86    NLLTANTGSDESMVDDGLSVDMEEKRTKCENVQLREELKKASEDNQRLKEMLSQTTNNFN  145

Query  1562  ALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaa  1383
             +LQ  L  +M+ Q +    + +T++++ A  +       +    VPRQF++L P      
Sbjct  146   SLQMQLVAVMRQQ-EDHHHLATTENKDNAKNR------HEVPEMVPRQFIDLGPP-----  193

Query  1382  aAQTDEASQSHTTSEERT-LSAGSPRN---NNTELSRHKGIIAREDSPDSES--W-----  1236
                +DE S     SEERT + +GSP++    ++     K ++ RE+SP++ES  W     
Sbjct  194   ---SDEVS-----SEERTTVRSGSPQSLLEKSSSRQNGKRVLVREESPETESNGWRNPNK  245

Query  1235  ------------ApnklpklnpskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKY  1095
                                   +  ++Q AAEATMRKARVSVRARSEAPM+SDGCQWRKY
Sbjct  246   IPKHHGSSSNCGGNGNGNGNGNNNVIEQSAAEATMRKARVSVRARSEAPMLSDGCQWRKY  305

Query  1094  GQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamas  915
             GQKMAKGNPCPRAYYRCTM  GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAM+MAS
Sbjct  306   GQKMAKGNPCPRAYYRCTMVNGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMSMAS  365

Query  914   ttsaaanmllSGA-MPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPN  741
             TT+AAA+MLLSG+ M S DG+MN TN LAR ILPCSSS+ATISASAPFPT+TLDLT + N
Sbjct  366   TTTAAASMLLSGSTMSSQDGLMNPTNLLARTILPCSSSMATISASAPFPTITLDLTDSSN  425

Query  740   SLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLY--NQSKFSGLHVSHQDIaaaaa  567
                    P  QF +  +G  +  Q+   LP + GQ LY   QSKFSGLH+  Q + A   
Sbjct  426   GNNLTNNPLMQF-SQRSGFAESNQSV--LPHMMGQALYYNQQSKFSGLHMPSQPLNA---  479

Query  566   qaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIM  417
                                   + +SAATAAI S+PNF AALAAAI+SI+
Sbjct  480   ---------------------GENVSAATAAIASNPNFAAALAAAITSII  508



>ref|XP_008385959.1| PREDICTED: probable WRKY transcription factor 31 [Malus domestica]
 ref|XP_008366460.1| PREDICTED: probable WRKY transcription factor 31 [Malus domestica]
Length=542

 Score =   310 bits (794),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 259/524 (49%), Positives = 314/524 (60%), Gaps = 89/524 (17%)
 Frame = -1

Query  1847  NEVDFFSDK-------KADIVVKKEITLHGEPVTKA--DLNTGLQLVIA--Nsgsdkstv  1701
             +E+DFF+ K            VK+E   HG    K   D+NTGL L+    +S      V
Sbjct  40    DELDFFAHKGRLKEAKDHTAEVKEECDHHGVGQEKQLPDVNTGLNLLTTYTSSDKSSMDV  99

Query  1700  ddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQN  1521
               S S +ME++   N+L+VLQ EL +MN ENQRLRG++ QV+TNY ALQ HL  L   +N
Sbjct  100   GTSSSRNMEDKHRTNELAVLQAELGRMNVENQRLRGVIHQVNTNYQALQVHLVKL---KN  156

Query  1520  QQSSRIGSTQDR------EVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEAS  1359
             Q++ +  + Q +      EV   K   +   +     PRQF+++         A+ DE S
Sbjct  157   QKTDQQAAEQHKMNLNGSEVLKEK---QLMNEFNNLAPRQFMDM-------GRAEKDELS  206

Query  1358  Q-SHTTSEERTLSAGSPRNNNTELSR--------HKGIIAR------EDSPDSE--SWAp  1230
             Q SH     +  S   PRNN  E           H+ I  R      EDSPD E   W P
Sbjct  207   QCSHEGCRSQDCSGSFPRNNIVESMECCKGTSHVHRDISGRSSTTGAEDSPDHEFQGWIP  266

Query  1229  nklpklnps-kPVDQAAEATM---RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCP  1062
             NK+PKL    + VDQA+  T+   +KARVSVRARSEA MISDGCQWRKYGQKMAKGNPCP
Sbjct  267   NKVPKLMSPPREVDQASSETISMIKKARVSVRARSEASMISDGCQWRKYGQKMAKGNPCP  326

Query  1061  RAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllS  882
             RAYYRCTMA GCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAMAMASTTSAAA+MLLS
Sbjct  327   RAYYRCTMATGCPVRKQVQRCAEDRTILITTYEGQHNHPLPPAAMAMASTTSAAASMLLS  386

Query  881   GAMPSADGMMNTN-FLARAILP-CSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQ  708
             G+ PSADG++++N FLAR  LP C  S+AT+SA+APFPTVTLDLT+T          PT 
Sbjct  387   GSNPSADGLISSNTFLARTGLPNCPPSLATLSATAPFPTVTLDLTRT----------PTS  436

Query  707   FQAPFTGAPQIPQNYPQ-----LPQVFGQGLY-NQSKFSGLHVSHQDIaaaaaqaaqlaq  546
              + P     Q P N+P      +PQ+ GQ LY NQ KFS L+ S Q +            
Sbjct  437   SEMPLGQPNQXPSNFPHNNLMSVPQILGQALYNNQPKFSVLN-SLQGL------------  483

Query  545   qqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMG  414
                           AD +SAATAAI +DPNFT AL AAI+SI+G
Sbjct  484   -------DSTTHSLADKVSAATAAIAADPNFTTALVAAITSIVG  520



>gb|ABN08518.1| DNA-binding WRKY [Medicago truncatula]
Length=466

 Score =   307 bits (787),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 235/469 (50%), Positives = 297/469 (63%), Gaps = 63/469 (13%)
 Frame = -1

Query  1751  TGLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVST  1572
             T L L+  N+ +D+S +++ ++SD E++RAK +L VLQ ELE+M  EN +LR ML + + 
Sbjct  1     TSLNLLTTNTSNDQSMMEEDIASDSEDKRAKLELVVLQAELERMKVENHQLRNMLDEGNR  60

Query  1571  NYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLEL-VPgg  1395
              Y  LQ H  +++  Q+++       Q + +  +  EEK+       VPRQF+EL +P  
Sbjct  61    KYNTLQMHWMSMV--QDKKVEDCNEEQKQVMGGKLDEEKQNGNGGVLVPRQFMELGLP--  116

Query  1394  gaaaaAQTDEASQSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSE---------  1242
                 A  +D   +  +  + ++L+     NNN E S+ + ++   D  +S+         
Sbjct  117   ----ANHSDAIDEPRSQDQSKSLA-----NNNEEGSKDEELVLDHDKKESDRGNERNGSP  167

Query  1241  ------SWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMA  1080
                   +   N +   +P   V+Q AEATMRKARVSVRARSEA MI+DGCQWRKYGQKMA
Sbjct  168   ADRVLAANNNNNVANFSPQTNVEQ-AEATMRKARVSVRARSEANMINDGCQWRKYGQKMA  226

Query  1079  KGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaa  900
             KGNPCPRAYYRCTMA+GCPVRKQVQRCAED+TILITTYEG H H LPPAAM M  TTS+A
Sbjct  227   KGNPCPRAYYRCTMALGCPVRKQVQRCAEDKTILITTYEGHHIHALPPAAMEMVQTTSSA  286

Query  899   anmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTP--NSLPNY  726
             A MLLSG M SADG+MN N+L RAILP SSS+ATISASAPFPTVTLDLTQ+P  N  PN 
Sbjct  287   ARMLLSGPMTSADGLMNPNYLTRAILPYSSSIATISASAPFPTVTLDLTQSPNQNQFPNN  346

Query  725   QRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaq  546
                  QFQ PF      PQN+  LPQVFGQ L NQSKFSGL +S QD             
Sbjct  347   HS--NQFQFPF------PQNF--LPQVFGQTLLNQSKFSGLQMS-QD-------------  382

Query  545   qqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQP  399
                  +        ADT++    AI +DPNFTAALAAAI+SI+ G +QP
Sbjct  383   --AANSSQQTPQNLADTVN----AIAADPNFTAALAAAITSII-GAAQP  424



>ref|XP_003596950.1| WRKY transcription factor [Medicago truncatula]
 gb|AES67201.1| WRKY1b transcription factor [Medicago truncatula]
Length=602

 Score =   310 bits (795),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 236/471 (50%), Positives = 299/471 (63%), Gaps = 63/471 (13%)
 Frame = -1

Query  1757  LNTGLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQV  1578
             +NT L L+  N+ +D+S +++ ++SD E++RAK +L VLQ ELE+M  EN +LR ML + 
Sbjct  135   VNTSLNLLTTNTSNDQSMMEEDIASDSEDKRAKLELVVLQAELERMKVENHQLRNMLDEG  194

Query  1577  STNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLEL-VP  1401
             +  Y  LQ H  +++  Q+++       Q + +  +  EEK+       VPRQF+EL +P
Sbjct  195   NRKYNTLQMHWMSMV--QDKKVEDCNEEQKQVMGGKLDEEKQNGNGGVLVPRQFMELGLP  252

Query  1400  gggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSE-------  1242
                   A  +D   +  +  + ++L+     NNN E S+ + ++   D  +S+       
Sbjct  253   ------ANHSDAIDEPRSQDQSKSLA-----NNNEEGSKDEELVLDHDKKESDRGNERNG  301

Query  1241  --------SWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQK  1086
                     +   N +   +P   V+Q AEATMRKARVSVRARSEA MI+DGCQWRKYGQK
Sbjct  302   SPADRVLAANNNNNVANFSPQTNVEQ-AEATMRKARVSVRARSEANMINDGCQWRKYGQK  360

Query  1085  MAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamastts  906
             MAKGNPCPRAYYRCTMA+GCPVRKQVQRCAED+TILITTYEG H H LPPAAM M  TTS
Sbjct  361   MAKGNPCPRAYYRCTMALGCPVRKQVQRCAEDKTILITTYEGHHIHALPPAAMEMVQTTS  420

Query  905   aaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTP--NSLP  732
             +AA MLLSG M SADG+MN N+L RAILP SSS+ATISASAPFPTVTLDLTQ+P  N  P
Sbjct  421   SAARMLLSGPMTSADGLMNPNYLTRAILPYSSSIATISASAPFPTVTLDLTQSPNQNQFP  480

Query  731   NYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaql  552
             N      QFQ PF      PQN+  LPQVFGQ L NQSKFSGL +S QD           
Sbjct  481   NNHS--NQFQFPF------PQNF--LPQVFGQTLLNQSKFSGLQMS-QD-----------  518

Query  551   aqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQP  399
                    +        ADT++    AI +DPNFTAALAAAI+SI+ G +QP
Sbjct  519   ----AANSSQQTPQNLADTVN----AIAADPNFTAALAAAITSII-GAAQP  560



>ref|XP_006413694.1| hypothetical protein EUTSA_v10026864mg [Eutrema salsugineum]
 gb|ESQ55147.1| hypothetical protein EUTSA_v10026864mg [Eutrema salsugineum]
Length=538

 Score =   308 bits (789),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 248/473 (52%), Positives = 295/473 (62%), Gaps = 59/473 (12%)
 Frame = -1

Query  1880  INPAAEKRGPPNEVDFFSDKKADIVVKKEITLHGEPVTKA----------------DLNT  1749
             I P  E+R    EVDFFS+K+ D V ++ I    E   K                 D+N 
Sbjct  20    ITPLDERRVVVGEVDFFSEKR-DRVSRENINDDDEEPNKVHVKMENSRAEDNDRSRDVNI  78

Query  1748  GLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTN  1569
             GL L+ AN+GSD+STVDD +S DME++RAK + + LQ EL+KM  ENQRLR MLSQ + N
Sbjct  79    GLNLLTANTGSDESTVDDGLSMDMEDKRAKIENAQLQEELKKMKIENQRLREMLSQATNN  138

Query  1568  YTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPggga  1389
             + +LQ  L  +M+ Q Q   RI S       +  +  +K  + +  +PRQF++L P  GA
Sbjct  139   FNSLQMQLVAVMRQQEQ---RISSQDHLLATEGNAVGRKLPEVQAMIPRQFMDLGPSSGA  195

Query  1388  aaaAQTDEASQSHTTSEERT--LSAGSPRNNNTELSRHKG--IIAREDSPDSES--WAp-  1230
             A          +  +SEERT  LS   P    +   R  G  ++ RE+SP+SES  W   
Sbjct  196   AEH-------DAEVSSEERTMVLSGSPPSLLESSNPRESGKRLLGREESPESESNAWGNP  248

Query  1229  -----------nklpklnpskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKYGQK  1086
                        N          +DQ AAEATMRKARVSVRARSEA MI+DGCQWRKYGQK
Sbjct  249   NKVPKHNPPSGNNNNSNGNGNVIDQSAAEATMRKARVSVRARSEATMITDGCQWRKYGQK  308

Query  1085  MAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamastts  906
             MAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMASTT+
Sbjct  309   MAKGNPCPRAYYRCTMAGGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMASTTT  368

Query  905   aaanmllSGAMPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPN---S  738
             AAA+MLLSG+M S DG+MN TN LARAILPCSSS+ATISASAPFPT+TLDLT + N   S
Sbjct  369   AAASMLLSGSMSSQDGLMNPTNLLARAILPCSSSMATISASAPFPTITLDLTNSSNGNTS  428

Query  737   LPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLY---NQSKFSGLHVSHQ  588
                   P  QF       P +      LPQV GQ LY    QSKFSGL +  Q
Sbjct  429   NIGTNNPLMQFAQRPGFNPAV------LPQVVGQALYYNQQQSKFSGLQLPAQ  475



>gb|KFK30968.1| hypothetical protein AALP_AA6G051000 [Arabis alpina]
Length=517

 Score =   307 bits (787),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 255/521 (49%), Positives = 316/521 (61%), Gaps = 100/521 (19%)
 Frame = -1

Query  1847  NEVDFF-SDKKADIV------------VKKE---ITLHGEPVTKADLNTGLQLVIANsgs  1716
             +EVDFF S +K D V            VK+E   +  H +  T  D+N GL ++  N+ S
Sbjct  32    DEVDFFRSAEKRDRVSRDHDQKIIADDVKRENSRVDDHDDRST--DINIGLNILTTNTIS  89

Query  1715  dkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNL  1536
             D+STVDD +S DMEE+R K + + L+ EL K N +NQRL+ MLSQ + N+ +LQ  L  +
Sbjct  90    DESTVDDGLSVDMEEKRTKCENAQLREELRKSNEDNQRLKEMLSQTTNNFNSLQMQLVAV  149

Query  1535  MQHQ--NQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEA  1362
             M+ Q  +Q  + + S ++++            +    +PRQF++L P            +
Sbjct  150   MRQQEDHQHLATVESNKEKK----------RHEAPGMLPRQFMDLGP------------S  187

Query  1361  SQSHTTSEERTLSAGSP----RNNNTELSRHKG--IIAREDSPDSE--SWAp-------n  1227
             S   T+ E   + +GSP     N+N   SR  G  ++ RE+SPD+E   W         N
Sbjct  188   SAEVTSVETTAVPSGSPPSLLENSN---SRQGGKRLLVREESPDTEYNGWGNPNKLQKHN  244

Query  1226  klpklnpskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYY  1050
                       +DQ AAEATMRKARVSVRARSEAPM+SDGCQWRKYGQKMAKGNPCPRAYY
Sbjct  245   ASSSNCNGNVIDQSAAEATMRKARVSVRARSEAPMLSDGCQWRKYGQKMAKGNPCPRAYY  304

Query  1049  RCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGA-M  873
             RCTMAVGCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAM MASTT+AAA+MLLSG+ M
Sbjct  305   RCTMAVGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMTMASTTTAAASMLLSGSTM  364

Query  872   PSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPP-TQF--  705
              S DG+MN TN LAR +LPCSSS+ATISASAPFPT+TLDLT + N        P  QF  
Sbjct  365   SSQDGLMNPTNILARTMLPCSSSMATISASAPFPTITLDLTDSSNGNNATNNNPLMQFSQ  424

Query  704   QAPFTGAPQIPQNYPQLPQVFGQGLY---NQSKFSGLHVSHQDIaaaaaqaaqlaqqqqh  534
             +A F  A     N   LPQV GQ +Y    QSKFSGL  S                    
Sbjct  425   RADFAAA----LNQSVLPQVMGQAMYYNQQQSKFSGLSQS--------------------  460

Query  533   papppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                        +++SAATAAI S+PNF AALAAAI+SI+ G
Sbjct  461   -------LNAGESVSAATAAIASNPNFAAALAAAITSIING  494



>ref|NP_567644.1| WRKY DNA-binding protein 31 [Arabidopsis thaliana]
 sp|Q93WT0.1|WRK31_ARATH RecName: Full=Probable WRKY transcription factor 31; AltName: 
Full=WRKY DNA-binding protein 31 [Arabidopsis thaliana]
 gb|AAL11009.1| WRKY transcription factor 31 [Arabidopsis thaliana]
 gb|AEE84546.1| WRKY DNA-binding protein 31 [Arabidopsis thaliana]
Length=538

 Score =   307 bits (787),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 270/534 (51%), Positives = 330/534 (62%), Gaps = 77/534 (14%)
 Frame = -1

Query  1880  INPAAEKRGPPNEVDFFSDKKA---------------DIVVKKEITLHGEPVTKADLNTG  1746
             I P  + R   +EVDFFS+K+                 +++K E +   E     D+N G
Sbjct  20    ITPLDDHRVVVDEVDFFSEKRDRVSRENINDDDDEGNKVLIKMEGSRVEENDRSRDVNIG  79

Query  1745  LQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNY  1566
             L L+ AN+GSD+STVDD +S DME++RAK + + LQ EL+KM  ENQRLR MLSQ +TN+
Sbjct  80    LNLLTANTGSDESTVDDGLSMDMEDKRAKIENAQLQEELKKMKIENQRLRDMLSQATTNF  139

Query  1565  TALQQHLSNLMQHQNQQSSRIGSTQDREVA-DRKSeekkpekeePTVPRQFLELVPggga  1389
              ALQ  L  +M+ Q Q++S    +QD  +A + K+E +K ++ +  VPRQF++L P  GA
Sbjct  140   NALQMQLVAVMRQQEQRNS----SQDHLLAQESKAEGRKRQELQIMVPRQFMDLGPSSGA  195

Query  1388  aaaAQTDEASQSHTTSEERT----------LSAGSPRNNNTELSRHKGIIAREDSPDSES  1239
             A          +  +SEERT          L + +PR N   L    G     +  +S +
Sbjct  196   AEHG-------AEVSSEERTTVRSGSPPSLLESSNPRENGKRL---LGREESSEESESNA  245

Query  1238  WAp-----------nklpklnpskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKY  1095
             W             +          +DQ AAEATMRKARVSVRARSEA MISDGCQWRKY
Sbjct  246   WGNPNKVPKHNPSSSNSNGNRNGNVIDQSAAEATMRKARVSVRARSEAAMISDGCQWRKY  305

Query  1094  GQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamas  915
             GQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAA AMAS
Sbjct  306   GQKMAKGNPCPRAYYRCTMAGGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAATAMAS  365

Query  914   ttsaaanmllSGAMPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNS  738
             TT+AAA+MLLSG+M S DG+MN TN LARAILPCSSS+ATISASAPFPT+TLDLT +PN 
Sbjct  366   TTTAAASMLLSGSMSSQDGLMNPTNLLARAILPCSSSMATISASAPFPTITLDLTNSPNG  425

Query  737   LPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYN---QSKFSGLHVSHQDIaaaaa  567
                           F   P    N   LPQV GQ +YN   QSKFSGL +  Q +  AA 
Sbjct  426   NNPNMTTNNPLMQ-FAQRPGF--NPAVLPQVVGQAMYNNQQQSKFSGLQLPAQPLQIAAT  482

Query  566   qaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGS  405
              +                   A+++SAA+AAI SDPNF AALAAAI+SIM G S
Sbjct  483   SSV------------------AESVSAASAAIASDPNFAAALAAAITSIMNGSS  518



>ref|XP_010538731.1| PREDICTED: probable WRKY transcription factor 31 [Tarenaya hassleriana]
Length=538

 Score =   306 bits (785),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 231/503 (46%), Positives = 301/503 (60%), Gaps = 57/503 (11%)
 Frame = -1

Query  1844  EVDFFSDKKADIV------------VKKEITLHGEPVTKADLNTGLQLVIANsgsdkstv  1701
             EVDFFS+K+  +             VK EI    +     D+N GL L+ AN+GSD+STV
Sbjct  41    EVDFFSEKRDRVSRENIAGDTDRVHVKMEIPWVEDDDRSMDVNIGLNLLTANTGSDESTV  100

Query  1700  ddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQN  1521
             DD +S DMEE+R K+++  +Q +L+KM+ ENQRLR M+++ ++NY++LQ  L  +M+ Q 
Sbjct  101   DDGLSMDMEEKRVKSEVVQMQAKLQKMSEENQRLREMVNKANSNYSSLQMQLVAVMRRQE  160

Query  1520  QQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTS  1341
                +   S  DR +        K ++    VPRQF++L P         T    ++  +S
Sbjct  161   HYRTSSSSQADRCLGGE----GKRQERPAMVPRQFIDLGPSS-------TASEREAEVSS  209

Query  1340  EER-TLSAGSPRNNNTELSRHKGIIAREDSPDSE---SWApnklpklnpskPVDQAA--E  1179
             EER T+ +GSP  ++      K ++ RE+SP+SE       +          +D +A  E
Sbjct  210   EERMTVRSGSPPLHSNPRDEGKRLLGREESPESEFPNKVPKHYPSCNGNGNVIDHSATAE  269

Query  1178  ATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRC  999
             ATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRC
Sbjct  270   ATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRC  329

Query  998   AEDRTILITTYEGThnh-plppaamamasttsaaanmllSGAMPSADGMMN-TNFLARAI  825
             AEDR+ILITTYEG HNH   P A    ++TT+AA+ +L      + +G+MN TN LAR I
Sbjct  330   AEDRSILITTYEGNHNHPLPPAAMPMASTTTAAASMLLSGSMSSTQEGIMNPTNLLARTI  389

Query  824   LP-CSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQ  648
             LP CSS++ATISASAPFPT+TLDLT   ++       P    A   G      N   LP 
Sbjct  390   LPACSSTMATISASAPFPTITLDLTTNSSNANANASNPLLQFAHCPGFSAAAFNPSILPH  449

Query  647   VFGQGLY----NQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAAT  480
             V  Q  Y    +QSKFSGL +  Q +  A A                     A+++SA  
Sbjct  450   VVSQASYYNNNHQSKFSGLQLPAQSLPTALA---------------------AESVSATP  488

Query  479   AAITSDPNFTAALAAAISSIMGG  411
             AAI +DPNF AA+AAAI+SI+ G
Sbjct  489   AAIAADPNFAAAVAAAITSIING  511



>ref|XP_006283491.1| hypothetical protein CARUB_v10004543mg [Capsella rubella]
 gb|EOA16389.1| hypothetical protein CARUB_v10004543mg [Capsella rubella]
Length=540

 Score =   306 bits (784),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 265/531 (50%), Positives = 325/531 (61%), Gaps = 67/531 (13%)
 Frame = -1

Query  1880  INPAAEKRGPPNEVDFFSDKKA-----------------DIVVKKEITLHGEPVTKADLN  1752
             I P  E R   +EVDFFS+K+A                  + VK E +   E     D+N
Sbjct  20    ITPLDEHRVVVDEVDFFSEKRARVSRENINDAEDDEEADKVHVKMENSRVEENDRSRDVN  79

Query  1751  TGLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVST  1572
              GL L+ AN+GSD+STVDD +S DME++RAK + + LQ E+ KM  ENQRLR MLSQ + 
Sbjct  80    IGLNLLTANTGSDESTVDDGLSMDMEDKRAKIENAQLQEEVNKMKIENQRLRDMLSQATN  139

Query  1571  NYTALQQHLSNLMQHQNQQSSRIGSTQDREVA-DRKSeekkpekeePTVPRQFLELVPgg  1395
             N+ ALQ  L  +M+ Q Q++S    +QD  +A + K+E +  ++ +  VPRQF++L P  
Sbjct  140   NFNALQNQLVGVMRQQEQRNS----SQDHLLATEGKAEGRNRQELQTMVPRQFMDLGPSS  195

Query  1394  ---gaaaaAQTDEASQSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWAp--  1230
                   A   ++E +  H+ S    L + + R N   L    G     +  +S +W    
Sbjct  196   GAAEHEAEVSSEERTMIHSASPPSLLESSNLRENGKRL---LGREESPEESESNAWGNPN  252

Query  1229  ---------nklpklnpskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMA  1080
                      +          +DQ AAEATM+KARVSVRARSEAPMISDGCQWRKYGQKMA
Sbjct  253   KVPKHNSSSSNNNNNGNGNVIDQSAAEATMQKARVSVRARSEAPMISDGCQWRKYGQKMA  312

Query  1079  KGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaa  900
             KGNPCPRAYYRCTMA  CPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMASTT+AA
Sbjct  313   KGNPCPRAYYRCTMAGACPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMASTTTAA  372

Query  899   anmllSGAMPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQ  723
             A+MLLSG+M S DG+MN TN LARAILPCSSS+ATISASAPFPT+TLDLT +PN      
Sbjct  373   ASMLLSGSMSSQDGLMNPTNLLARAILPCSSSMATISASAPFPTITLDLTNSPNG----N  428

Query  722   RPPTQFQAPFTGAPQIPQNYPQ-LPQVFGQGLY---NQSKFSGLHVSHQDIaaaaaqaaq  555
              P      P     Q P   P  LPQV GQ LY    QSKFSGL +  Q +   A  +  
Sbjct  429   TPNMTTNNPLMQFAQRPGFNPAVLPQVVGQALYYNQQQSKFSGLQLPAQPLQIPATSSV-  487

Query  554   laqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
                              ++++SAA+AAI SDPNF AALAAAI+SIM G S 
Sbjct  488   -----------------SESVSAASAAIASDPNFAAALAAAITSIMNGSSH  521



>ref|XP_009114575.1| PREDICTED: LOW QUALITY PROTEIN: probable WRKY transcription factor 
42 [Brassica rapa]
Length=516

 Score =   305 bits (781),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 242/522 (46%), Positives = 316/522 (61%), Gaps = 83/522 (16%)
 Frame = -1

Query  1874  PAAEKRGPP--NEVDFFSDKKAD---IVVKKEITLH---------GEPVTKADLNTGLQL  1737
             P+ E+   P  +EVDFF  +K D   ++ ++   LH          +      +NTGL L
Sbjct  20    PSDEQHHRPIMDEVDFFRSEKRDDQNVITEETHRLHVKRENSRVDDDDYRSMGINTGLNL  79

Query  1736  VIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTAL  1557
             + AN+GSD+S VDD +S DMEE+R K + + L+ EL+K N ENQRL+ MLSQ + N+ +L
Sbjct  80    LTANTGSDESLVDDGLSVDMEEKRTKIENTQLREELKKSNEENQRLKEMLSQTTNNFNSL  139

Query  1556  QQHLSNLMQHQ--NQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLEL-VPgggaa  1386
             Q  L  +M+ +  +   +RI S         K ++    +    VPRQF++L +P    +
Sbjct  140   QMQLVAVMRQEEDHHHLARIES---------KDKDTNRHEAPEMVPRQFIDLGLPSAEVS  190

Query  1385  aaAQTDEASQSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSES--WAp------  1230
                 +DE  +  + S    L   S R       R K ++  E+SP++ES  W        
Sbjct  191   ----SDERIKVRSRSPPSLLEDSSSR------QRAKRVLEIEESPENESNGWGNPSKVSK  240

Query  1229  -nklpklnpskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRA  1056
              N          +DQ AA+ATMRKARVSVRARSEAPM+SDGCQWRKYGQKMAKGNPCPRA
Sbjct  241   HNASSSNGNGNAIDQSAADATMRKARVSVRARSEAPMLSDGCQWRKYGQKMAKGNPCPRA  300

Query  1055  YYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSG-  879
             YYRCTMAVGCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAM +ASTT+A A+MLLSG 
Sbjct  301   YYRCTMAVGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMYIASTTTAGASMLLSGS  360

Query  878   AMPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSL--PNYQRPPTQ  708
             AM + DG+MN TN  AR +LPCSSS+ TISASAPFPT+TLDLT++ +++  P    P  Q
Sbjct  361   AMSNQDGLMNPTNLFARTMLPCSSSMXTISASAPFPTITLDLTESASNVNGPTNNNPLMQ  420

Query  707   FQAPFTGAPQIPQNYPQLPQVFGQGLY---NQSKFSGLHVSHQDIaaaaaqaaqlaqqqq  537
             F +  +G  ++  N   LPQ+ GQ LY    QSKFSGLH+  Q +               
Sbjct  421   F-SQRSGLAEL--NQSGLPQMMGQALYYNQQQSKFSGLHIPSQSL---------------  462

Query  536   hpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                         +   +  AA+ ++PNF AALAAAI+SI+ G
Sbjct  463   ------------NAGESVNAAMATNPNFAAALAAAITSIING  492



>ref|XP_006645706.1| PREDICTED: probable WRKY transcription factor 31-like, partial 
[Oryza brachyantha]
Length=503

 Score =   303 bits (776),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 219/431 (51%), Positives = 264/431 (61%), Gaps = 87/431 (20%)
 Frame = -1

Query  1676  EERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGS  1497
             E+ R+ N+L+ +Q EL +MN ENQRLRGML+QV+++Y ALQ HL  LMQ + Q       
Sbjct  110   EKSRSSNELAKMQAELGRMNDENQRLRGMLTQVTSSYQALQMHLVALMQQRPQMLPPTQP  169

Query  1496  TQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAG  1317
                    D K++          VPRQFL+L P G      +      S++++E      G
Sbjct  170   LPPPPHQDGKADAA-------VVPRQFLDLGPSGAGG---EAAAEEPSNSSTE-----VG  214

Query  1316  SPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPV------DQAAEATMRKARV  1155
             SPR +++  ++ +    R DSPD+ S A   LP    +  +       QA EA MRKARV
Sbjct  215   SPRRSSSTGNKDQ---ERGDSPDAPSTAAGWLPGRAMAPQLADRGHDQQAQEANMRKARV  271

Query  1154  SVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILI  975
             SVRARSEAP+I+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR+ILI
Sbjct  272   SVRARSEAPIIADGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQRCAEDRSILI  331

Query  974   TTYEGThnhplppaamamasttsaaanmllSGAMPSADG---MMNTNFLARAILPCSSSV  804
             TTYEGTHNHPLPPAAMAMASTTSAAA+MLLSG+MPSADG   +M++NFLAR +LPCSSS+
Sbjct  332   TTYEGTHNHPLPPAAMAMASTTSAAASMLLSGSMPSADGAAGLMSSNFLARTVLPCSSSM  391

Query  803   ATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYN  624
             ATIS SAPFPTVTLDLT  P                  GAP   Q  P + Q+ G     
Sbjct  392   ATISGSAPFPTVTLDLTHAP-----------------PGAPNFAQPRPAIGQLPG-----  429

Query  623   QSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAA  444
                                                     +DT+SAA AAIT+DPNFT A
Sbjct  430   --------------------------------------PLSDTVSAAAAAITADPNFTVA  451

Query  443   LAAAISSIMGG  411
             LAAAI+SI+GG
Sbjct  452   LAAAITSIIGG  462



>ref|XP_010924340.1| PREDICTED: probable WRKY transcription factor 31 [Elaeis guineensis]
Length=575

 Score =   304 bits (779),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 263/518 (51%), Positives = 322/518 (62%), Gaps = 71/518 (14%)
 Frame = -1

Query  1865  EKRGPPNEVDFFSDK-------------KADIVVKKEITLHGEPVTKADLNTGLQLVIAN  1725
             EKR    EVDFFSD+               DI +KKE            +N GL L+  N
Sbjct  61    EKRRVVGEVDFFSDEIRRERARPDSDSNAPDISIKKE---------DLTINMGLHLLTTN  111

Query  1724  sgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHL  1545
             +G+D+ST+DD +S + E++ +K+DL+ +Q EL ++N ENQRL+ MLS  + N+ +L  H 
Sbjct  112   TGTDQSTMDDGLSVN-EDKESKSDLAAVQAELGRINQENQRLKSMLSHATNNFNSLHMHF  170

Query  1544  SNLMQHQNQQSSRIGSTQDREVAD-RKSeekkpekeePTVPRQFLEL--VPgggaaaaAQ  1374
               LMQ +NQ   R GS Q  EV D  K+ +K+ + E+PT PRQFL+L      G  +   
Sbjct  171   IALMQERNQ---RNGSLQGHEVIDHEKTGDKRSKHEDPTAPRQFLDLGLASLAGEGSHPT  227

Query  1373  TDEASQSHTTS-----EERTLSAGSPRNNNT--------ELSRHKGIIA--REDSPD--S  1245
             T+  SQ  + S     E  ++      N N+        E S  + + A  RE+SP   S
Sbjct  228   TEGGSQDRSISPPNNAEVLSMDYSLKENYNSKEAVPIDRERSDGRDVRATFREESPGKAS  287

Query  1244  ESWApnklpklnpskPVDQAA-EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNP  1068
             +SW PNK  KL+PSK  DQ A EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNP
Sbjct  288   QSWIPNKAAKLSPSKTSDQEAQEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNP  347

Query  1067  CPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanml  888
             CPRAYYRCTMA GCPVRKQVQRCAEDR++LITTYEG HNHPLPPAA  MASTTSAAAN L
Sbjct  348   CPRAYYRCTMAAGCPVRKQVQRCAEDRSVLITTYEGNHNHPLPPAAKEMASTTSAAANTL  407

Query  887   lSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQ  708
             L G+M S DG+MN+NFLA      SSS+A ISASAPFPTVTLDLT    S   ++RP TQ
Sbjct  408   LCGSMSSTDGLMNSNFLAS-----SSSMAAISASAPFPTVTLDLTHV--SSVAFRRPSTQ  460

Query  707   FQAPF---TGAPQIPQN-YPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqq  540
             FQ PF     AP +       LP  FGQ L+NQSKFSG  +    +              
Sbjct  461   FQVPFPNGAAAPGLGSTPTTSLPLEFGQTLFNQSKFSGFQMDRPRV-------------S  507

Query  539   qhpapppqhpLFADTLSAATAAITSDPNFTAALAAAIS  426
             Q      +    ADT+SAATAA+ +DPNFTA +AAAI+
Sbjct  508   QPKVDSVRPSSLADTVSAATAAMAADPNFTAVVAAAIT  545



>ref|XP_002867796.1| WRKY DNA-binding protein 31 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44055.1| WRKY DNA-binding protein 31 [Arabidopsis lyrata subsp. lyrata]
Length=538

 Score =   302 bits (773),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 268/535 (50%), Positives = 328/535 (61%), Gaps = 79/535 (15%)
 Frame = -1

Query  1880  INPAAEKRGPPNEVDFFSDKKADIVVKKEITLHGEPVTKA----------------DLNT  1749
             I P  E R   +EVDFFS+K+ D V ++ I    +   K                 D+N 
Sbjct  20    ITPLDEHRVVVDEVDFFSEKR-DRVSRENINDEDDEANKVEVKMENSRVEENDRSRDVNI  78

Query  1748  GLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTN  1569
             GL L+ AN+GSD+STVDD +S DME++RAK + + LQ EL+KM  ENQRLR MLSQ +TN
Sbjct  79    GLNLLTANTGSDESTVDDGLSMDMEDKRAKIENAQLQEELKKMKIENQRLRDMLSQAATN  138

Query  1568  YTALQQHLSNLMQHQNQQSSRIGSTQDREVA-DRKSeekkpekeePTVPRQFLELVPggg  1392
             + ALQ  L  +M+ Q Q++S    +QD  +A + ++E +K ++ +  VPRQF++L P  G
Sbjct  139   FNALQMQLITVMRQQEQRNS----SQDHLLATEGRAEGRKRQELQTMVPRQFMDLGPSSG  194

Query  1391  aaaaAQTDEASQSHTTSEERT----------LSAGSPRNNNTELSRHKGIIAREDSPDSE  1242
             AA          +  +SEERT          L + +PR N   L    G     +  +S 
Sbjct  195   AAEHG-------AEVSSEERTTVRSGSPPSLLESSNPRENGKRL---LGREESSEESESN  244

Query  1241  SWAp-----------nklpklnpskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRK  1098
             +W             +          +DQ AAEATMRKARVSVRARSEA MISDGCQWRK
Sbjct  245   AWGNPNKVPKHNPSSSNSNGNRNGNVIDQSAAEATMRKARVSVRARSEAAMISDGCQWRK  304

Query  1097  YGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamama  918
             YGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMA
Sbjct  305   YGQKMAKGNPCPRAYYRCTMAGGCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMA  364

Query  917   sttsaaanmllSGAMPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPN  741
             STT+AAA+MLLSG+M S DG+MN TN LARAILPCSSS+ATISASAPFPT+TLDLT +PN
Sbjct  365   STTTAAASMLLSGSMSSQDGLMNPTNLLARAILPCSSSMATISASAPFPTITLDLTNSPN  424

Query  740   SLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLY---NQSKFSGLHVSHQDIaaaa  570
                            F   P    N   LPQV GQ ++    QSKFSGL +  Q +    
Sbjct  425   GNNPNMTTNNPLMQ-FAQRPGF--NPAVLPQVVGQTMFYNQQQSKFSGLQLPAQPLQIPT  481

Query  569   aqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGS  405
               +                   A+++SAA+AAI SDPNF AALAAAI+SIM G S
Sbjct  482   TSSV------------------AESVSAASAAIASDPNFAAALAAAITSIMNGSS  518



>gb|AGV75954.1| WRKY transcription factor 54 [Gossypium hirsutum]
Length=504

 Score =   300 bits (768),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 223/483 (46%), Positives = 291/483 (60%), Gaps = 80/483 (17%)
 Frame = -1

Query  1865  EKRGPPNEVDFFSDKKADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvs  1686
             +KR    E+DFF++K   +V   +     +   + ++N GL L+  N+ +D+ST      
Sbjct  86    DKRRVVGELDFFAEKNDKLVDDADFMHTSDAGLELNVNIGLNLLTTNTSADQST------  139

Query  1685  sDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSR  1506
               ME+++A N+++VL+ +L +MNAEN+RL+ ML Q + NY  ++ HL +LM     ++  
Sbjct  140   --MEDKKANNEVAVLRAKLVQMNAENERLKEMLIQATENYNTMKIHLCSLMMKNGGKAKE  197

Query  1505  IGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTL  1326
                 +D E   R             VPRQF++L    G A AA  DE+S S         
Sbjct  198   ----EDEENKKRNGGI--------IVPRQFIDL----GLAVAADADESSSSSP-------  234

Query  1325  SAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRKARVSVR  1146
                            +G   REDS   ++  P           VDQ+ EA MRKARVSVR
Sbjct  235   ---------------EGKRQREDSSGGDNKVPRLD--------VDQS-EAAMRKARVSVR  270

Query  1145  ARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY  966
             ARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDRTILITTY
Sbjct  271   ARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQRCAEDRTILITTY  330

Query  965   EGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISAS  786
             EG HNHPLPP+AM+MASTTS+A  ML+SG+  S DG+MN+N L   +LPCSS++AT+SAS
Sbjct  331   EGNHNHPLPPSAMSMASTTSSAGRMLVSGSTSSPDGLMNSNLLTTTLLPCSSTMATVSAS  390

Query  785   APFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSG  606
              PFP+VTLDLTQ+  S P    PP     P+  A  +    P +PQV GQ L N SKF+G
Sbjct  391   TPFPSVTLDLTQSSFSTP----PP-----PYNVANSVAVTAPLVPQVSGQALDNLSKFAG  441

Query  605   LHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAIS  426
             + +S +D+                     +     DT++AATAAI +DP+F AALAAAI+
Sbjct  442   IQMS-KDL---------------DRLQQGEQNSIGDTVNAATAAIATDPSFAAALAAAIT  485

Query  425   SIM  417
             SI+
Sbjct  486   SII  488



>gb|EPS66178.1| hypothetical protein M569_08600, partial [Genlisea aurea]
Length=360

 Score =   295 bits (755),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 227/424 (54%), Positives = 260/424 (61%), Gaps = 76/424 (18%)
 Frame = -1

Query  1652  LSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVAD  1473
             L  LQ+ELE+MN ENQRLR  L+QV+ +++ L+ HLS+LM   N+ SS   + Q+     
Sbjct  2     LERLQMELERMNTENQRLRATLNQVTNDFSVLKMHLSSLM---NENSS---TAQEHNA--  53

Query  1472  RKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNTE  1293
                        +   P +              +     QS+T+SEERTLSA S +   T 
Sbjct  54    ------NANAMDLIYPSELFICFFFHQIFGVEKRKHEIQSNTSSEERTLSASSSKKKRT-  106

Query  1292  LSRHKGIIAREDSPDSESWApnklpklnpskPVDQA--AEATMRKARVSVRARSEAPMIS  1119
                      R+DSP SE W   K P       VD+    E+TMRKARVSVRARSEAPMIS
Sbjct  107   --------GRDDSPVSEGWVSEKAPV------VDRQPPLESTMRKARVSVRARSEAPMIS  152

Query  1118  DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplp  939
             DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA+DRT+L+TTYEG+HNHPLP
Sbjct  153   DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCADDRTVLVTTYEGSHNHPLP  212

Query  938   paamamasttsaaanmllSGAMPSADG----MMNTNFLARAILPCSSSVATISASAPFPT  771
             PAAMAMASTTSAAA+MLLSGAMPS D      MN N LAR ILPC+S++ATISASAPFPT
Sbjct  213   PAAMAMASTTSAAASMLLSGAMPSPDAMMNMNMNPNILARTILPCASNLATISASAPFPT  272

Query  770   VTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSH  591
             VTLDLTQTPN     QR P QFQ PF   P                 Y+QSKF GL  S 
Sbjct  273   VTLDLTQTPNPTTEVQR-PRQFQFPFATPP--------------PPCYDQSKFMGLQTSQ  317

Query  590   QDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
             Q                       Q    +DTLS    AIT+DPNF AALAAAI SI+GG
Sbjct  318   Q----------------------DQSQTLSDTLS----AITADPNFAAALAAAIKSIVGG  351

Query  410   GSQP  399
             G  P
Sbjct  352   GGNP  355



>gb|AGV75928.1| WRKY transcription factor 1 [Gossypium hirsutum]
Length=524

 Score =   300 bits (769),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 252/510 (49%), Positives = 319/510 (63%), Gaps = 63/510 (12%)
 Frame = -1

Query  1847  NEVDFF----SDKKADIV--------VKKEITLHGEPVTKADLNTGLQLVIANsgsdkst  1704
             NE+DFF    S K+ D          VK E   HG      D+NTGL L+  N+ S+KS+
Sbjct  23    NEMDFFAHDRSSKQHDKADYDVHHHHVKTESEHHGAD-QDDDVNTGLNLLTTNTASEKSS  81

Query  1703  vdd---svssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLM  1533
             V     + S +++E++  N L+ ++ EL+++NAENQRL+  L+QV++NY ALQ HL +L 
Sbjct  82    VAGDGITSSQNLKEKQRVNQLADIRAELDRINAENQRLKLTLNQVNSNYYALQMHLVSLT  141

Query  1532  Q-HQNQ--QSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEA  1362
             Q H+N+  +SS   +  +R + ++K         E  V RQF++LV        A+ DE 
Sbjct  142   QRHRNRIAESSEANTQMNRPIEEKK-------HGEGMVARQFMDLV---QTETKAEKDEL  191

Query  1361  SQSHTTSEERTLS-AGSPRNNNTE-LSR----HKGIIAREDSPDS----ESWApnklpkl  1212
             S+S  +SE+R    +GSP N   E + R    +K    RED+P+       W PNK PK 
Sbjct  192   SES--SSEDRCQELSGSPGNTIVESMERRQKNNKSRNQREDTPEGLPHPAGWLPNKGPKF  249

Query  1211  npskPVDQAAE--ATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTM  1038
             N SK  +QA +  A +RKARVSVRARSEA MISDGCQWRKYGQKMAKGNPCPRAYYRCTM
Sbjct  250   NTSKDNEQAQQTMAMIRKARVSVRARSEASMISDGCQWRKYGQKMAKGNPCPRAYYRCTM  309

Query  1037  AVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSAD-  861
             A GCPVRKQVQRCAEDRTIL+TTYEG HNHPLPPAAMAMASTTSAAA+ LLSG+MPSAD 
Sbjct  310   ATGCPVRKQVQRCAEDRTILVTTYEGNHNHPLPPAAMAMASTTSAAASTLLSGSMPSADH  369

Query  860   GMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAP  681
             G+MN+N + + +LP S ++ T+SASAPFPTVTLDLT  PN  P +Q  P         +P
Sbjct  370   GIMNSNIVPKGMLPGSPNLITLSASAPFPTVTLDLTHPPNQRPLHQLHPL--------SP  421

Query  680   QIPQNYPQLP-QVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLF  504
               P N   LP  + G  +YNQSK  G ++S Q                       Q    
Sbjct  422   NWPHNISSLPAHLLGHPIYNQSKLLGTYLSSQ---------GNNELPVHLSQNQMQGHPM  472

Query  503   ADTLSAATAAITSDPNFTAALAAAISSIMG  414
              DT +A  AAIT+DPNFTAAL AAI+SI+G
Sbjct  473   VDT-AATAAAITADPNFTAALVAAITSIIG  501



>gb|AEP04147.1| WRKY6 transcription factor [Musa acuminata AAA Group]
Length=277

 Score =   291 bits (746),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 188/264 (71%), Positives = 207/264 (78%), Gaps = 13/264 (5%)
 Frame = -1

Query  1181  EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQR  1002
             EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQR
Sbjct  2     EATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQR  61

Query  1001  CAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAIL  822
             CA+DR+ILITTYEGTHNHPLPPAAMAMASTTSAAA+MLLSG+M S DG+MN+NFLAR IL
Sbjct  62    CADDRSILITTYEGTHNHPLPPAAMAMASTTSAAASMLLSGSMSSTDGLMNSNFLARTIL  121

Query  821   PCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPT-QFQAPFTGAP---QIPQNYPQL  654
             PCSS++ATISASAPFPTVTLDLTQ P +   YQRPP   F  P+ GA      P   P L
Sbjct  122   PCSSNMATISASAPFPTVTLDLTQNPTNPLQYQRPPAGPFHVPYPGAAPAFSAPSQPPSL  181

Query  653   PQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAA  474
             PQVFGQ  +NQS FSGL +S +            AQ     A P   P  A+T++AATAA
Sbjct  182   PQVFGQTPHNQSTFSGLQMSLE---------MAAAQFPHPKAQPVMPPSMAETVNAATAA  232

Query  473   ITSDPNFTAALAAAISSIMGGGSQ  402
             IT+DPNFTAAL AAI SI+GG  Q
Sbjct  233   ITADPNFTAALTAAIKSIIGGNHQ  256



>ref|XP_010448942.1| PREDICTED: probable WRKY transcription factor 31 isoform X1 [Camelina 
sativa]
 ref|XP_010448943.1| PREDICTED: probable WRKY transcription factor 31 isoform X2 [Camelina 
sativa]
Length=540

 Score =   300 bits (768),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 266/532 (50%), Positives = 323/532 (61%), Gaps = 70/532 (13%)
 Frame = -1

Query  1880  INPAAEKRGPPNEVDFFSDKKA----------------DIVVKKEITLHGEPVTKADLNT  1749
             I P  E R   +EVDFFS+K+                  + VK E +   E     D+N 
Sbjct  20    ITPLDEHRVVVDEVDFFSEKRDRVSREDINDDEDEEANKVHVKMENSRIEESDRSRDVNI  79

Query  1748  GLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTN  1569
             GL L+ AN+GSD+STVDD +S DME++RAK + + LQ EL+KM  ENQRLR MLSQ + N
Sbjct  80    GLNLLTANTGSDESTVDDGLSMDMEDKRAKIENAQLQEELKKMKIENQRLRDMLSQATNN  139

Query  1568  YTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPggga  1389
             + +LQ  L  +M+ Q Q++S   S +     + K+E +K ++    VPRQF++L P  GA
Sbjct  140   FNSLQMQLVAVMRQQEQRNS---SQEHFLATEGKAEGRKRQELHTMVPRQFMDLGPSSGA  196

Query  1388  aaaAQTDEASQSHTTSEERTL-SAGSP------RNNNTELSRHKGIIAREDSPDSESWAp  1230
                       ++  +SEERT+  +GSP       N      R  G     +  +S +W  
Sbjct  197   TEH-------EAEVSSEERTMIHSGSPPSLLESSNLRENGKRLLGREESPEESESNAWGN  249

Query  1229  -----------nklpklnpskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKYGQK  1086
                        +          +DQ AAEATMRKARVSVRARSEAPMISDGCQWRKYGQK
Sbjct  250   PNKVPKHNSSSSNNNNNANGNVIDQSAAEATMRKARVSVRARSEAPMISDGCQWRKYGQK  309

Query  1085  MAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamastts  906
             MAKGNPCPRAYYRCTMA  CPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMASTT+
Sbjct  310   MAKGNPCPRAYYRCTMAGACPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMASTTT  369

Query  905   aaanmllSGAMPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPN  729
             AAA+MLLSG+M S DG+MN TN LARAILPCSSS+ATISASAPFPT+TLDLT +PN    
Sbjct  370   AAASMLLSGSMSSQDGLMNPTNLLARAILPCSSSMATISASAPFPTITLDLTNSPNGNNP  429

Query  728   YQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLY---NQSKFSGLHVSHQDIaaaaaqaa  558
                        F   P    N   LPQV GQ LY    QSKFSGL +  Q +   A  + 
Sbjct  430   NMTTNNPLMQ-FVQRPGF--NPAVLPQVVGQALYYNQQQSKFSGLQLPAQPLQIPATSSV  486

Query  557   qlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
                               ++++SAA+AAI SDPNF AALAAAI+SIM G S 
Sbjct  487   ------------------SESVSAASAAIASDPNFAAALAAAITSIMNGSSH  520



>ref|XP_010439371.1| PREDICTED: probable WRKY transcription factor 31 [Camelina sativa]
 ref|XP_010439372.1| PREDICTED: probable WRKY transcription factor 31 [Camelina sativa]
Length=540

 Score =   300 bits (767),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 267/535 (50%), Positives = 324/535 (61%), Gaps = 76/535 (14%)
 Frame = -1

Query  1880  INPAAEKRGPPNEVDFFSDKKA----------------DIVVKKEITLHGEPVTKADLNT  1749
             I P  E R   +EVDFFS+K+                  + VK E +   E     D+N 
Sbjct  20    ITPLDEHRVVVDEVDFFSEKRDRVSREDINDDEDEEANKVHVKMENSRVEENDRSRDVNI  79

Query  1748  GLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTN  1569
             GL+L+ AN+GSD+STVDD +S DME++RAK + + LQ EL+KM  ENQRLR MLSQ + N
Sbjct  80    GLKLLTANTGSDESTVDDGLSMDMEDKRAKIENAQLQEELKKMKIENQRLRDMLSQATNN  139

Query  1568  YTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPggga  1389
             + +LQ  L  +M+ Q Q++S   S +     + K+E +K ++    VPRQF++L P  GA
Sbjct  140   FNSLQMQLVAVMRQQEQRNS---SQEHLLATEGKAEGRKRQELHTMVPRQFMDLGPSSGA  196

Query  1388  aaaAQTDEASQSHTTSEERTL-SAGSP---------RNNNTELSRHKGIIAREDSPDSES  1239
                       ++   SEERT+  +GSP         R N   L    G     +  +S +
Sbjct  197   TE-------HEAEVLSEERTMIHSGSPPSLLESSNLRENGKRL---LGREESPEESESNA  246

Query  1238  WAp-----------nklpklnpskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKY  1095
             W             +          +DQ AAEATMRKARVSVRARSEAPMISDGCQWRKY
Sbjct  247   WGNPNKVPKHNSSSSNNNNNGNGNVIDQSAAEATMRKARVSVRARSEAPMISDGCQWRKY  306

Query  1094  GQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamas  915
             GQKMAKGNPCPRAYYRCTMA  CPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMAS
Sbjct  307   GQKMAKGNPCPRAYYRCTMAGACPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMAS  366

Query  914   ttsaaanmllSGAMPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNS  738
             TT+AAA+MLLSG+M S DG+MN TN LARAILPCSSS+ATISASAPFPT+TLDLT +PN 
Sbjct  367   TTTAAASMLLSGSMSSQDGLMNPTNLLARAILPCSSSMATISASAPFPTITLDLTNSPNG  426

Query  737   LPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLY---NQSKFSGLHVSHQDIaaaaa  567
                           F   P    N   LPQV GQ LY    QSKFSGL +  Q +   A 
Sbjct  427   NNPNMTTNNPLMQ-FVQRPGF--NPAVLPQVVGQALYYNQQQSKFSGLQLPAQPLQIPAT  483

Query  566   qaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
              +                   ++++SAA+AAI SDPNF AALAAAI+SIM G S 
Sbjct  484   SSV------------------SESVSAASAAIASDPNFAAALAAAITSIMNGSSH  520



>gb|AIE43881.1| WRKY transcription factor 16 [Gossypium hirsutum]
Length=525

 Score =   298 bits (764),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 250/511 (49%), Positives = 320/511 (63%), Gaps = 64/511 (13%)
 Frame = -1

Query  1847  NEVDFFSDKKAD-------------IVVKKEITLHGEPVTKADLNTGLQLVIANsgsdks  1707
             NE+DFF+D ++                VK E   HG      D+NTGL L+  N+ S+KS
Sbjct  23    NEMDFFADDRSSKQHDKADDDVHHHHHVKTESEHHGAD-QDDDVNTGLNLLTTNTASEKS  81

Query  1706  tvdd---svssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNL  1536
             +V     + S +++E++  N L+ ++ EL+++NAENQRL+  L+QV++NY ALQ HL +L
Sbjct  82    SVAGDGITSSQNLKEKQRVNQLADVRAELDRINAENQRLKLTLNQVNSNYYALQMHLVSL  141

Query  1535  MQ-HQNQ--QSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDE  1365
              Q H+N+  +SS   +  +R + ++K         E  V RQF++LV        A+ DE
Sbjct  142   TQRHRNRIAESSEANTQMNRPIEEKK-------HGEGMVARQFMDLV---QTETKAEKDE  191

Query  1364  ASQSHTTSEERTLS-AGSPRNNNTE-LSR----HKGIIAREDSPDS----ESWApnklpk  1215
              S+S  +SE+R    +GSP N   E + R    +K    RED+P+       W PNK PK
Sbjct  192   LSES--SSEDRCHELSGSPGNTIVESMERRQKNNKSRNQREDTPEGLPHPAGWLPNKGPK  249

Query  1214  lnpskPVDQAAE--ATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCT  1041
              N SK  +QA +  A +RKARVSVRARSEA MISDGCQWRKYGQKMAKGNPCPRAYYRCT
Sbjct  250   FNTSKDNEQAQQTMAMIRKARVSVRARSEASMISDGCQWRKYGQKMAKGNPCPRAYYRCT  309

Query  1040  MAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSAD  861
             MA GCPVRKQVQRCAEDRTIL+TTYEG HNHPLPPAAMAMASTTSAAA+ LLSG+MPSAD
Sbjct  310   MATGCPVRKQVQRCAEDRTILVTTYEGNHNHPLPPAAMAMASTTSAAASTLLSGSMPSAD  369

Query  860   -GMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGA  684
              G+MN+N + + +LP S ++ T+SASAPFPTVTLDLT  PN  P +Q  P         +
Sbjct  370   HGIMNSNIVPKGMLPGSPNLITLSASAPFPTVTLDLTHPPNQRPLHQLHPL--------S  421

Query  683   PQIPQNYPQLP-QVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpL  507
             P  P N  +LP  + G  +YNQSK  G ++S Q                       Q   
Sbjct  422   PNWPHNISRLPAHLLGHPIYNQSKLLGTYLSSQ---------GNNELPVHLSQNQMQGHP  472

Query  506   FADTLSAATAAITSDPNFTAALAAAISSIMG  414
               DT +A  AAIT+DPNFTAAL AAI+SI+G
Sbjct  473   MVDT-AATAAAITADPNFTAALVAAITSIIG  502



>gb|EMS55197.1| WRKY transcription factor 6 [Triticum urartu]
Length=609

 Score =   301 bits (770),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 238/464 (51%), Positives = 278/464 (60%), Gaps = 72/464 (16%)
 Frame = -1

Query  1676  EERRAKN--DLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRI  1503
             E+R  +N  +L+ +Q EL +MN ENQRLRGML+QV+++Y ALQ HL  LMQ Q  Q   +
Sbjct  138   EDRNGRNTGELAAMQAELSRMNEENQRLRGMLTQVNSSYHALQMHLVALMQ-QRTQMPPV  196

Query  1502  GSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLS  1323
                Q     D K+E          VPRQFL L P G        D A +   +S E    
Sbjct  197   QPQQPPTHEDGKNESA-------IVPRQFLGLGPSGA-----SADVAEEPSNSSTE----  240

Query  1322  AGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPV--------DQAAEATMR  1167
              GSPR +++  +         D P +  W P +       + +         QA EATMR
Sbjct  241   VGSPRRSSSNGNEDPERGDNPDGPSTAGWLPGRGMSQQQQQQLGAAAKGHDQQAQEATMR  300

Query  1166  KARVSVRARSEAPMI------------------SDGCQW-----RKYGQKMAKGNPCPRA  1056
             KARVSVRARSEAP++                  S  C W      KYGQKMAKGNPCPRA
Sbjct  301   KARVSVRARSEAPIVRLLLLLLDHFLVFALAILSSPCVWIVLTLPKYGQKMAKGNPCPRA  360

Query  1055  YYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGA  876
             YYRCTMA GCPVRKQVQRCAEDRTILITTYEGTHNHPLPPAAMAMASTTSAAA+MLLSG+
Sbjct  361   YYRCTMATGCPVRKQVQRCAEDRTILITTYEGTHNHPLPPAAMAMASTTSAAASMLLSGS  420

Query  875   MPSAD--GMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQ----TPNSLP-NYQRP  717
             MPSAD  G+M++NFLAR +LPCSSS+ATISASAPFPTVTLDLT      PN++P N  RP
Sbjct  421   MPSADGAGLMSSNFLARTVLPCSSSMATISASAPFPTVTLDLTHAPPGAPNAMPLNVARP  480

Query  716   --PTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqq  543
               P QF  P  G    P  +   P +    LYNQSKFSGL +S   +           Q 
Sbjct  481   HAPGQFHVPMPGGGMAPA-FAMPPHM----LYNQSKFSGLQMSSDSV--------DAGQF  527

Query  542   qqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
              Q   P       +DT+SAA AAIT+DPNFT ALAAAISSIM G
Sbjct  528   AQPRPPMGLPGQLSDTVSAAAAAITADPNFTVALAAAISSIMAG  571



>ref|XP_002872692.1| WRKY DNA-binding protein 42 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48951.1| WRKY DNA-binding protein 42 [Arabidopsis lyrata subsp. lyrata]
Length=529

 Score =   298 bits (764),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 228/460 (50%), Positives = 296/460 (64%), Gaps = 56/460 (12%)
 Frame = -1

Query  1871  AAEKRG--PPNEVDFFSDKKADIV-VKKE---ITLHGEPVTKADLNTGLQLVIANsgsdk  1710
             +AEKR     ++ D  +D +   V VK+E   +  H E  +   +N GL L+ AN+GSD+
Sbjct  36    SAEKRDRVSRDDQDMIADHETHRVHVKRENSRVDDH-EDRSTDHINIGLNLLTANTGSDE  94

Query  1709  stvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQ  1530
             S VDD +S DMEE+R K + + L+ EL+K + +NQRL+ MLSQ + ++ +LQ  L  +M+
Sbjct  95    SMVDDGLSVDMEEKRTKCENAQLRAELKKASEDNQRLKEMLSQTTNSFNSLQMQLVTVMR  154

Query  1529  HQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSH  1350
              Q +    + +T++++ A  +       +    VP+QF++L P        Q+DE S   
Sbjct  155   QQ-EDHHHLATTENKDNATNR------HEVPEMVPKQFIDLGP--------QSDEVS---  196

Query  1349  TTSEERT-LSAGSP---RNNNTELSRHKGIIAREDSPDSES--WApnklpklnpskPVD-  1191
               SEERT + +GSP      ++     K ++ RE+SP++ES  W        + +   D 
Sbjct  197   --SEERTTVRSGSPPSLLEKSSSRQNGKRVLVREESPETESNGWRNPNKVPKHHASSSDC  254

Query  1190  ---------------QAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRA  1056
                             AAEATMRKARVSVRARSEA M+SDGCQWRKYGQKMAKGNPCPRA
Sbjct  255   GGNGSENASNKVIEQAAAEATMRKARVSVRARSEANMLSDGCQWRKYGQKMAKGNPCPRA  314

Query  1055  YYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGA  876
             YYRCTMAVGCPVRKQVQRCAEDRTILITTYEG HNHPLPPAAM MASTT+AAA+MLLSG+
Sbjct  315   YYRCTMAVGCPVRKQVQRCAEDRTILITTYEGNHNHPLPPAAMNMASTTTAAASMLLSGS  374

Query  875   -MPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQ  702
              M + DG+MN TN LAR +LPCSSS+ATISASAPFPT+TLDLT + N       P  QF 
Sbjct  375   TMSNQDGLMNPTNLLARTMLPCSSSMATISASAPFPTITLDLTDSSNGNNPTNNPLMQF-  433

Query  701   APFTGAPQIPQNYPQLPQVFGQGLY--NQSKFSGLHVSHQ  588
             +  +G  ++ Q+   LP + GQ LY   QSKFSGLH+  Q
Sbjct  434   SQRSGFAELNQSV--LPHMMGQALYYNQQSKFSGLHMPSQ  471



>ref|XP_006396694.1| hypothetical protein EUTSA_v10028586mg [Eutrema salsugineum]
 gb|ESQ38147.1| hypothetical protein EUTSA_v10028586mg [Eutrema salsugineum]
Length=512

 Score =   297 bits (760),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 225/462 (49%), Positives = 295/462 (64%), Gaps = 68/462 (15%)
 Frame = -1

Query  1859  RGPPNEVDFFSDKKAD-----------IVVKKEIT-LHGEPVTKADLNTGLQLVIANsgs  1716
             R   +EVDFF  +K D           + VK+E + +  +      +NTGL L+ AN+GS
Sbjct  26    RAVMDEVDFFKSEKRDEQNIITDETHRVHVKRENSRVDDDDDRSTGINTGLNLLTANTGS  85

Query  1715  dkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNL  1536
             D S VDD +S DMEE+R K + + L+ EL+K   E QRL+ MLSQ + N+ +LQ  L  +
Sbjct  86    DGSMVDDGLSVDMEEKRTKCENAQLREELKKAAEETQRLKEMLSQTTNNFNSLQMQLVAV  145

Query  1535  MQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLEL-VPgggaaaaAQTDEAS  1359
             M+ Q   +  + +T+ ++ A+++       +    VPRQF++L +P              
Sbjct  146   MRQQEDHNHHLATTESKDKANKR------HEGPEMVPRQFIDLGLPS-------------  186

Query  1358  QSHTTSEERT-LSAGSPR-NNNTELSRHKGIIAREDSPDSES--W-----------Apnk  1224
              +  +SEERT + +GSP   N++   R K I+ RE+SP++ES  W           + + 
Sbjct  187   -ADVSSEERTTVRSGSPLLENSSSRQRGKRILEREESPETESNGWGNPNKVSKHNASSSN  245

Query  1223  lpklnpskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYR  1047
                      VDQ AAEATMRKARVSVRAR EAPM++DGCQWRKYGQKMAKGNPCPRAYYR
Sbjct  246   CNGNVNGNVVDQSAAEATMRKARVSVRARCEAPMLNDGCQWRKYGQKMAKGNPCPRAYYR  305

Query  1046  CTMAVG-CPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGA-M  873
             CTMAVG CPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAM+MASTT+AAA+MLLSG+ M
Sbjct  306   CTMAVGRCPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMSMASTTTAAASMLLSGSTM  365

Query  872   PSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAP  696
              S + +MN TN LAR +LPCSSS+ATISASAPFPT+TLDLT++ +++ N          P
Sbjct  366   SSQERLMNPTNLLARTMLPCSSSMATISASAPFPTITLDLTESASNVNN----------P  415

Query  695   FTGAPQIPQNYPQLPQVFGQGLY----NQSKFSGLHVSHQDI  582
              +  P + Q+   LP + GQ LY     QSKFSGL +  Q +
Sbjct  416   TSNNPLMNQSV--LPHMMGQALYYSQQQQSKFSGLQLPSQSL  455



>ref|XP_010434087.1| PREDICTED: probable WRKY transcription factor 31 [Camelina sativa]
 ref|XP_010434088.1| PREDICTED: probable WRKY transcription factor 31 [Camelina sativa]
 ref|XP_010434089.1| PREDICTED: probable WRKY transcription factor 31 [Camelina sativa]
Length=540

 Score =   297 bits (760),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 266/536 (50%), Positives = 324/536 (60%), Gaps = 78/536 (15%)
 Frame = -1

Query  1880  INPAAEKRGPPNEVDFFSDKKADIVVKKEITLHGEPVTKA-----------------DLN  1752
             I P  E R   +EVDFFS+K+ D V ++ I    +  T                   D+N
Sbjct  20    ITPLDEHRVVVDEVDFFSEKR-DRVSRENINDDEDEETNKVHVKMENSRVEGNDRSRDVN  78

Query  1751  TGLQLVIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVST  1572
              GL L+ AN+GSD+STVDD +S DME++RAK + + LQ EL+KM  EN RLR MLSQ + 
Sbjct  79    IGLNLLTANTGSDESTVDDGLSMDMEDKRAKIENAQLQEELKKMKIENHRLRDMLSQATN  138

Query  1571  NYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPggg  1392
             N+ +LQ  L  +M+ Q Q++S   S +     + K+E +K ++    VPRQF++L P  G
Sbjct  139   NFNSLQMQLVAVMRQQEQRNS---SQEHLLATEGKAEGRKRQELHTMVPRQFMDLGPSSG  195

Query  1391  aaaaAQTDEASQSHTTSEERTL-SAGSP---------RNNNTELSRHKGIIAREDSPDSE  1242
             A          ++  +SEERT+  +GSP         R N   L    G     +  +S 
Sbjct  196   ATE-------HEAEVSSEERTMIHSGSPPSLLESSNLRENGKRL---LGREESPEESESN  245

Query  1241  SWAp-----------nklpklnpskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRK  1098
             +W             +          +DQ AAEATMRKARVSVRARSEAPMISDGCQWRK
Sbjct  246   AWGNPNKVPKHNSSSSNNNNNGNGNVIDQSAAEATMRKARVSVRARSEAPMISDGCQWRK  305

Query  1097  YGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamama  918
             YGQKMAKGNPCPRAYYRCTMA  CPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAMAMA
Sbjct  306   YGQKMAKGNPCPRAYYRCTMAGACPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMAMA  365

Query  917   sttsaaanmllSGAMPSADGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPN  741
             STT+AAA+MLLSG+M S DG+MN TN LARAILPCSSS+ATISASAPFPT+TLDLT +PN
Sbjct  366   STTTAAASMLLSGSMSSQDGLMNPTNLLARAILPCSSSMATISASAPFPTITLDLTNSPN  425

Query  740   SLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLY---NQSKFSGLHVSHQDIaaaa  570
                            F   P    N   LPQV GQ LY    QSKFSGL +  Q +   A
Sbjct  426   GNNPNMTTNNPLMQ-FAQRPGF--NPAVLPQVVGQALYYNQQQSKFSGLQLPAQPLQIPA  482

Query  569   aqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
               +                   ++++SAA+AAI SDPNF AALAAAI+SIM G S 
Sbjct  483   TSSV------------------SESVSAASAAIASDPNFAAALAAAITSIMNGSSH  520



>ref|XP_010096871.1| WRKY transcription factor 6 [Morus notabilis]
 gb|EXB66325.1| WRKY transcription factor 6 [Morus notabilis]
Length=585

 Score =   297 bits (760),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 252/559 (45%), Positives = 320/559 (57%), Gaps = 93/559 (17%)
 Frame = -1

Query  1844  EVDFFSDKKADIVVKKEITLHGEPVT------------------------KADLNTGLQL  1737
             E+DFF++K  D +VK   T HG  V                         + D+NTGL L
Sbjct  27    ELDFFANKTVDHLVKA--TSHGHIVDGGDDDDKVEDQDRSERDHGVLQEMQLDVNTGLCL  84

Query  1736  VIANsgsdkstvddsvs-sDMEERR--AKNDLSVLQVELEKMNAENQRLRGMLSQVSTNY  1566
             +  N+ S+KS+VD+  S +++E+ +  A N+L+VLQ EL +MN ENQRLRG+LSQV+ +Y
Sbjct  85    LTTNTSSEKSSVDEGSSGNNLEDNKKPALNELAVLQAELGRMNNENQRLRGLLSQVNNDY  144

Query  1565  TALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLEL-VPggga  1389
               L  H+++LMQ QN Q+S     +++ ++  +  E+  +    T  RQF+++  P    
Sbjct  145   QILNMHVASLMQKQNSQNSETAEERNKMMS--RLLEENQKSLIVTKARQFMDIGEPQITG  202

Query  1388  aaaAQTDEASQSHTTSEERTLSAGSPRNN-------------------NTELSRHKGIIA  1266
                 +  ++S     S+ R   + + + N                   + ELS H     
Sbjct  203   EKDYEVSQSSLDQGRSQNRNSRSSNHQQNEIVESILECKSNIINSADFSKELSAHHRHDD  262

Query  1265  REDSPDSES----------WApnklpklnpskPVDQ-----AAE--ATMRKARVSVRARS  1137
             RE+  D E           W PNK+ +   S+  DQ     +AE  + +RKARVSVRARS
Sbjct  263   REEGTDQEQLGAGASPGSRWVPNKVARFGNSRYHDQDQATSSAETMSMIRKARVSVRARS  322

Query  1136  EAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGT  957
             EA M+SDGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAED+TIL TTYEG 
Sbjct  323   EASMLSDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVRKQVQRCAEDQTILTTTYEGH  382

Query  956   hnhplppaamamasttsaaanmllSGAMPSAD--GMMNTNFLARAILPCSSSVATISASA  783
             HNHPLPP AMAMASTTSAAA+MLLSG+MPSAD   + N NFLAR   PCS S AT+SASA
Sbjct  383   HNHPLPPTAMAMASTTSAAASMLLSGSMPSADHHSLFNPNFLARTAHPCSPSFATLSASA  442

Query  782   PFPTVTLDLTQTPNSLPNYQRPPTQF-------QAPFTGAPQI-PQNY--PQLPQVFGQG  633
             PFPTVTLDLT+TP +  +               Q  F    QI PQN       Q+FG G
Sbjct  443   PFPTVTLDLTRTPTTTSSSSSAEQILGQLRQLSQGNFHNLSQILPQNVMSSSSSQLFGHG  502

Query  632   LYNQ-SKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPN  456
             L +Q SK  GLH                          P   L ADT+S ATAAITSDPN
Sbjct  503   LADQCSKLVGLH------------GLNNGAANNPLDIAPAGHLQADTVSVATAAITSDPN  550

Query  455   FTAALAAAISSIMGGGSQP  399
             FTAAL AAI++I+GG  +P
Sbjct  551   FTAALVAAITNIIGGNVKP  569



>ref|XP_010553450.1| PREDICTED: WRKY transcription factor 6-like [Tarenaya hassleriana]
Length=527

 Score =   294 bits (752),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 258/584 (44%), Positives = 329/584 (56%), Gaps = 109/584 (19%)
 Frame = -1

Query  2027  MDKGWG-LTLEN--PD----RRAGFFTNKPVFGFNLSPRLN--PINgggsgggaGMVPIN  1875
             MD+GWG LTL++  PD       G FT+ PV   +    +   P++  G       +  +
Sbjct  1     MDRGWGGLTLDSSTPDLISSNSHGKFTDSPVADADQKTEMFRFPVSISGFRDREYELNSS  60

Query  1874  PAAEKRGPPNEVDFFSDKKADIV---------VKKEITLHGEPVTKADLNTGLQLVIANs  1722
                  R  P EVDFFSD K+ ++         VK+E   +     + D+NTGL L+   +
Sbjct  61    SGDNDRKVPGEVDFFSDHKSRVLRCGEDDCLRVKEEDKDY-----RTDVNTGLNLLTTAN  115

Query  1721  gsdkstvddsvssDM----EERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQ  1554
              +  S              EERRAKND++ LQV+L++MN+EN++L+ ML +V+ NY +L 
Sbjct  116   NNTGSDQSVVDDGMFSDTEEERRAKNDVAELQVQLQRMNSENRKLKEMLDEVTKNYNSLH  175

Query  1553  QHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQ  1374
               L+ LMQ Q                               +P + ++  P       A 
Sbjct  176   TQLA-LMQRQ-----------------------------RNIPNKVIDGKPWESQCIGAG  205

Query  1373  TDEAS-QSHTTSEERTLSAGSPRNNNTELSRH-----KGIIAREDSPDSES---W-Apnk  1224
                A  +S++  EER  S      NN EL R      +  +A+E+SP++ES   W +PNK
Sbjct  206   PSRADDESNSMLEERRRSP----ENNVELERDNDPRGEKRLAQEESPETESRSLWNSPNK  261

Query  1223  lpklnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRC  1044
             L K+N +  +DQ+ EA MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRC
Sbjct  262   LQKVNNNPQIDQSGEAMMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRC  321

Query  1043  TMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSA  864
             TMA GCPVRKQVQRCAED++ILITTYEG HNHPLPPAA+AMASTT+AAA MLLSG+  S 
Sbjct  322   TMATGCPVRKQVQRCAEDKSILITTYEGNHNHPLPPAAVAMASTTTAAATMLLSGSTSSH  381

Query  863   DGMMN-TNFLARAILP---CSSSVATISASAPFPTVTLDLTQT------PNSLPNYQRPP  714
             +G+MN  N LARAILP    ++S+ATISASAPFPTVTLDLT        P + P  + PP
Sbjct  382   EGLMNPANLLARAILPSSSSTASIATISASAPFPTVTLDLTHAPPPPSGPGNHPLVRSPP  441

Query  713   TQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqh  534
              Q          +P N   LPQV G+ LYNQSKFSG+  S                    
Sbjct  442   QQMM-------NLPPNL--LPQVVGRTLYNQSKFSGVQFSGN---------------FDG  477

Query  533   papppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGGGSQ  402
                 P      DT++    A+T DPNFTAALA  ISS++ G S 
Sbjct  478   CQIAPPSYALVDTVN----ALTKDPNFTAALATMISSMINGSSH  517



>emb|CDY21301.1| BnaC03g29850D [Brassica napus]
Length=507

 Score =   293 bits (750),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 224/458 (49%), Positives = 292/458 (64%), Gaps = 66/458 (14%)
 Frame = -1

Query  1859  RGPPNEVDFFSDKKAD---IVVKKEITLH----GEPVTKAD-----LNTGLQLVIANsgs  1716
             R   NEVDFF  +K D   I+  +   +H       V   D     +NTGL L+ A++GS
Sbjct  27    RAMMNEVDFFRSEKRDDENIITDETNRVHVKRENSRVVDDDDRSTGINTGLNLLTAHTGS  86

Query  1715  dkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNL  1536
             D+S VDD +S DMEE+R+K +   L+ EL+K   E QRL+ MLSQ + N+ +LQ  L  +
Sbjct  87    DESMVDDGLSVDMEEKRSKIENVQLREELKKAAEEIQRLKEMLSQTTNNFNSLQMQLVAV  146

Query  1535  MQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLEL-VPgggaaaaAQTDEAS  1359
             M+ Q +    +  T  +++A+++       +    VPRQF+EL +P              
Sbjct  147   MRQQ-EDHHHLAMTGSKDIANKR------HEGSEMVPRQFIELGLPT-------------  186

Query  1358  QSHTTSEERT-LSAGSP---RNNNTELSRHKGIIAREDSPDSES--WAp-------nklp  1218
              +  +SEERT + + SP     N++   R K ++ RE+SP+++S  W         N   
Sbjct  187   -AEVSSEERTTVRSRSPPSLLENSSSRQRGKRLLEREESPETQSNGWGNPNKVSKHNASS  245

Query  1217  klnpskPVDQA-AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCT  1041
               +    +DQ+ AEATMRKARVSVRARSEAP +SDGC WRKYGQKMAKGNPCPRAY+RCT
Sbjct  246   SNDNVSAIDQSTAEATMRKARVSVRARSEAPTLSDGCHWRKYGQKMAKGNPCPRAYFRCT  305

Query  1040  MAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGA-MPSA  864
             MAVGCPVRKQVQRCAE+R+ILITTYEG HNHPLPPAAM MASTT+AAA+MLLSG+ M S 
Sbjct  306   MAVGCPVRKQVQRCAEERSILITTYEGNHNHPLPPAAMYMASTTTAAASMLLSGSTMSSQ  365

Query  863   DGMMN-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTG  687
             DG+MN TN  AR +LPCSSS+ATISASAPFPT+TLDLT++ ++ P  QR         +G
Sbjct  366   DGLMNPTNLFARTMLPCSSSMATISASAPFPTITLDLTESASNFP--QR---------SG  414

Query  686   APQIPQNYPQLPQVFGQGLY---NQSKFSGLHVSHQDI  582
               ++  N   LPQ+ GQ LY    QSKFSGL +  Q +
Sbjct  415   FTEL--NQSGLPQMMGQALYYNQQQSKFSGLQIPTQSL  450



>ref|XP_008364680.1| PREDICTED: probable WRKY transcription factor 31 [Malus domestica]
Length=420

 Score =   289 bits (740),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 219/436 (50%), Positives = 262/436 (60%), Gaps = 68/436 (16%)
 Frame = -1

Query  1622  MNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpek  1443
             MN ENQRLRG + Q++T+Y ALQ HL  LMQ Q  Q +   + +  ++    S   + ++
Sbjct  1     MNVENQRLRGAIHQLNTHYQALQVHLVTLMQRQKNQKTDYQTAEQHKMNINGSVVLEEKQ  60

Query  1442  eePTV----PRQFLELVPgggaaaaAQTDEASQ-SHTTSEERTLSAGSPRNNNTELSR--  1284
                 +    P QF+++         A+ DE SQ SH     +      PRN+  E     
Sbjct  61    MMNGINNLAPIQFMDM-------GRAEKDELSQCSHEGCRSQDCXGSPPRNDIVESMECC  113

Query  1283  ------HKGIIAR------EDSPDSE--SWApnklpklnpskPVDQAAEATM---RKARV  1155
                   H+    R      E SPD E   W P K+PKL   + VDQ +   M   +KARV
Sbjct  114   KSTSHVHRDXSGRSRTAGGEXSPDQELQGWIPKKVPKLISPREVDQPSSEAMSMIKKARV  173

Query  1154  SVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILI  975
             SVRARSEA MISDGCQWRKYGQKMAKGNPCPRAYYRCTM  GCPVRKQVQRCAEDRTILI
Sbjct  174   SVRARSEASMISDGCQWRKYGQKMAKGNPCPRAYYRCTMRNGCPVRKQVQRCAEDRTILI  233

Query  974   TTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTN-FLARAILP-CSSSVA  801
             TTYEG HNHPLPPAAMAMASTTSA+A+M LSG+MPSADG++++N FLAR  LP    S+A
Sbjct  234   TTYEGHHNHPLPPAAMAMASTTSASASMJLSGSMPSADGLISSNSFLARTGLPNYPPSLA  293

Query  800   TISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQ-----LPQVFGQ  636
             T+SASAPFPTVTLDLT T          PT  + P     Q+P N+P      +PQ+ GQ
Sbjct  294   TLSASAPFPTVTLDLTNT----------PTSSEMPLGQPNQLPPNFPHNNLMSVPQILGQ  343

Query  635   GLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPN  456
              L NQSKFS L  S Q +                          AD +SAATAAIT+DPN
Sbjct  344   ALCNQSKFSVLD-SLQGL-------------------DSTTHSLADKVSAATAAITADPN  383

Query  455   FTAALAAAISSIMGGG  408
             FTAAL AAI+SI+  G
Sbjct  384   FTAALVAAITSIVVNG  399



>emb|CDX90863.1| BnaA03g25430D [Brassica napus]
Length=507

 Score =   290 bits (743),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 223/454 (49%), Positives = 290/454 (64%), Gaps = 58/454 (13%)
 Frame = -1

Query  1859  RGPPNEVDFFSDKKAD---IVVKKEITLH----GEPVTKAD-----LNTGLQLVIANsgs  1716
             R   +EVDFF  +K D   I+  +  T+H       V   D     +NTGL L+ A++GS
Sbjct  27    RAMMDEVDFFRSEKRDDQNIITDETNTVHVKRENSRVVDDDDRSTGINTGLNLLTAHTGS  86

Query  1715  dkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNL  1536
             D+S VDD +S DMEE+R+K +   L+ EL+K   E QRL+ MLSQ + N+ +LQ  L  +
Sbjct  87    DESMVDDGLSVDMEEKRSKIENVQLREELKKAAEEIQRLKEMLSQTTNNFNSLQMQLVAV  146

Query  1535  MQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLEL-VPgggaaaaAQTDEAS  1359
             M+ Q +    +  T  +++ +++       +    VPRQF+EL +P         T E S
Sbjct  147   MRQQ-EDHHHLAMTGSKDMTNKR------HEGSDMVPRQFMELGLP---------TAEVS  190

Query  1358  QSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSES--WAp-------nklpklnp  1206
                 T+  R+ S  S   N++   R K ++ RE+SP+++S  W         N     + 
Sbjct  191   SDERTTV-RSRSPPSLLENSSSRQRGKRLLEREESPETQSNGWGNPNKVSKHNASSSNDN  249

Query  1205  skPVDQA-AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVG  1029
                +DQ+ AEATMRKARVSVRARSEAP +SDGC WRKYGQKMAKGNPCPRAY+RCTMAVG
Sbjct  250   VSAIDQSTAEATMRKARVSVRARSEAPTLSDGCHWRKYGQKMAKGNPCPRAYFRCTMAVG  309

Query  1028  CPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGA-MPSADGMM  852
             CPVRKQVQRCAE+R+ILITTYEG HNHPLPPAAM MASTT+AAA+MLLSG+ M S DG+M
Sbjct  310   CPVRKQVQRCAEERSILITTYEGNHNHPLPPAAMYMASTTTAAASMLLSGSTMSSQDGLM  369

Query  851   N-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQI  675
             N TN  AR +LPCSSS+ATISASAPFPT+TLDLT++ ++ P  QR         +G  ++
Sbjct  370   NPTNLFARTMLPCSSSMATISASAPFPTITLDLTESASNFP--QR---------SGFTEL  418

Query  674   PQNYPQLPQVFGQGLY---NQSKFSGLHVSHQDI  582
               N   LPQ+ GQ LY    QSKFSGL +  Q +
Sbjct  419   --NQSGLPQMMGQALYYNQQQSKFSGLQIPTQSL  450



>gb|ACQ76807.1| WRKY transcription factor 42 [Brassica napus]
Length=519

 Score =   290 bits (741),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 222/455 (49%), Positives = 292/455 (64%), Gaps = 56/455 (12%)
 Frame = -1

Query  1847  NEVDFFSDKKAD---IVVKKEITLH----GEPVTKAD-----LNTGLQLVIANsgsdkst  1704
             +EVDFF  +K D   I+  +   +H       V   D     +NTGL L+ A++GSD+S 
Sbjct  31    DEVDFFRSEKRDDQNIITDETKRVHVKRENSRVVDDDDRSTGINTGLNLLTAHTGSDESM  90

Query  1703  vddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQ  1524
             VDD +S DMEE+R+K +   L+ EL+K   E QRL+ MLSQ + N+ +LQ  L  +M+ Q
Sbjct  91    VDDGLSVDMEEKRSKIENVQLREELKKAAEEIQRLKEMLSQTTNNFNSLQMQLVAVMRQQ  150

Query  1523  NQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLEL-VPgggaaaaAQTDEASQSHT  1347
              +    +  T  +++A+++       +    VPRQF+EL +P               +  
Sbjct  151   -EDHHHLAMTGSKDIANKR------HEGSEMVPRQFIELGLPT--------------AEV  189

Query  1346  TSEERT-LSAGSP---RNNNTELSRHKGIIAREDSPDSES--WAp-------nklpklnp  1206
             +SEERT + + SP     N++   R K ++ RE+SP+++S  W         N     + 
Sbjct  190   SSEERTTVRSRSPPSLLENSSSRQRGKRLLEREESPETQSNGWGNPNKVSKHNASSSNDN  249

Query  1205  skPVDQA-AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVG  1029
                +DQ+ AEATMRKARVSVRARSEAP +SDGC WRKYGQKMAKGNPCPRAY+RCTMAVG
Sbjct  250   VSAIDQSTAEATMRKARVSVRARSEAPTLSDGCHWRKYGQKMAKGNPCPRAYFRCTMAVG  309

Query  1028  CPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGA-MPSADGMM  852
             CPVRKQVQRCAE+R+ILITTYEG HNHPLPPAAM MASTT+AAA+MLLSG+ M S DG+M
Sbjct  310   CPVRKQVQRCAEERSILITTYEGNHNHPLPPAAMYMASTTTAAASMLLSGSTMSSQDGLM  369

Query  851   N-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAP-FTGAPQ  678
             N TN  AR +LPCSSS+ATISASAPFPT+TLDLT++ +++ N        Q P  +G  +
Sbjct  370   NPTNLFARTMLPCSSSMATISASAPFPTITLDLTESASNVNNQTNNNPLMQFPQRSGFTE  429

Query  677   IPQNYPQLPQVFGQGLY---NQSKFSGLHVSHQDI  582
             +  N   LPQ+ GQ LY    QSKFSGL +  Q +
Sbjct  430   L--NQSGLPQMMGQALYYNQQQSKFSGLQIPTQSL  462



>gb|ACI14401.1| WRKY42-1 transcription factor [Brassica napus]
Length=519

 Score =   290 bits (741),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 222/455 (49%), Positives = 292/455 (64%), Gaps = 56/455 (12%)
 Frame = -1

Query  1847  NEVDFFSDKKAD---IVVKKEITLH----GEPVTKAD-----LNTGLQLVIANsgsdkst  1704
             +EVDFF  +K D   I+  +   +H       V   D     +NTGL L+ A++GSD+S 
Sbjct  31    DEVDFFRSEKRDDQNIITDETKRVHVKRENSRVVDDDDRSTGINTGLNLLTAHTGSDESM  90

Query  1703  vddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQ  1524
             VDD +S DMEE+R+K +   L+ EL+K   E QRL+ MLSQ + N+ +LQ  L  +M+ Q
Sbjct  91    VDDGLSVDMEEKRSKIENVQLREELKKAAEEIQRLKEMLSQTTNNFNSLQMQLVAVMRQQ  150

Query  1523  NQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLEL-VPgggaaaaAQTDEASQSHT  1347
              +    +  T  +++A+++       +    VPRQF+EL +P               +  
Sbjct  151   -EDHHHLAMTGSKDIANKR------HEGSEMVPRQFIELGLPT--------------AEV  189

Query  1346  TSEERT-LSAGSP---RNNNTELSRHKGIIAREDSPDSES--WAp-------nklpklnp  1206
             +SEERT + + SP     N++   R K ++ RE+SP+++S  W         N     + 
Sbjct  190   SSEERTTVRSRSPPSLLENSSSRQRGKRLLEREESPETQSNGWGNPNKVSKYNASSSNDN  249

Query  1205  skPVDQA-AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVG  1029
                +DQ+ AEATMRKARVSVRARSEAP +SDGC WRKYGQKMAKGNPCPRAY+RCTMAVG
Sbjct  250   VSAIDQSTAEATMRKARVSVRARSEAPTLSDGCHWRKYGQKMAKGNPCPRAYFRCTMAVG  309

Query  1028  CPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGA-MPSADGMM  852
             CPVRKQVQRCAE+R+ILITTYEG HNHPLPPAAM MASTT+AAA+MLLSG+ M S DG+M
Sbjct  310   CPVRKQVQRCAEERSILITTYEGNHNHPLPPAAMYMASTTTAAASMLLSGSTMSSQDGLM  369

Query  851   N-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAP-FTGAPQ  678
             N TN  AR +LPCSSS+ATISASAPFPT+TLDLT++ +++ N        Q P  +G  +
Sbjct  370   NPTNLFARTMLPCSSSMATISASAPFPTITLDLTESASNVNNQTNNNPLMQFPQRSGFTE  429

Query  677   IPQNYPQLPQVFGQGLY---NQSKFSGLHVSHQDI  582
             +  N   LPQ+ GQ LY    QSKFSGL +  Q +
Sbjct  430   L--NQSGLPQMMGQALYYNQQQSKFSGLQIPTQSL  462



>ref|XP_007213947.1| hypothetical protein PRUPE_ppa003574mg [Prunus persica]
 gb|EMJ15146.1| hypothetical protein PRUPE_ppa003574mg [Prunus persica]
Length=564

 Score =   291 bits (744),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 241/481 (50%), Positives = 290/481 (60%), Gaps = 86/481 (18%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPVFGFNLSPRLNPINgggsgggaGMVP-------INPA  1869
             MDKGWGLTL++     GFF NKP     L    N        GG  M P       +   
Sbjct  36    MDKGWGLTLDS--ESFGFFLNKPPAAVKLDHHQNNSKRSNFFGGERMFPGIEFPVKLGGR  93

Query  1868  AEKRGPP-------------NEVDFFSDKK------------ADIVVKKEITLHGEPVTK  1764
              ++   P             +EVDFFSD+K             D+     I++  E  T 
Sbjct  94    EDQLAAPQPSIHDNNNRVVVDEVDFFSDRKNKHNTTTTDDDHQDMKSNGTISVKKENWTG  153

Query  1763  ADLNTGLQLVIANsgsdkstvddsvssDMEERRAKN-DLSVLQVELEKMNAENQRLRGML  1587
              D+NTGL LV AN+GSD+S VDD +SSDM+ +RAKN +L+ LQVEL++MN+EN RL+ ML
Sbjct  154   LDVNTGLHLVTANTGSDQSMVDDGISSDMDNKRAKNHELAQLQVELQRMNSENLRLKEML  213

Query  1586  SQVSTNYTALQQHLSNLMQHQN----------QQSSRIGSTQDREVADRKSeekkpekee  1437
              QV+ NY+ALQ H++ +MQ Q            QSS++   Q+ E    + +++      
Sbjct  214   GQVTNNYSALQMHVAAVMQQQQQQQQNHTAAADQSSQLNHDQNVEAKSDQEKKQG-----  268

Query  1436  PTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNTELS----------  1287
               VPRQFL L P   A    Q      S+++SE RT SA SP+N N   S          
Sbjct  269   -LVPRQFLNLGPRATAETDDQV-----SNSSSEARTRSA-SPQNINEAASSKDHHLKKND  321

Query  1286  --------------RHKGIIAREDSPDSES--WA--pnklpklnpskPVDQAAEATMRKA  1161
                           R    + RE+SP+SES  W            +KP+DQ+ EATMRKA
Sbjct  322   HPIGPLDPENSNNFRDGKRVGREESPESESQGWVPNKAPKLNSATNKPIDQSTEATMRKA  381

Query  1160  RVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTI  981
             RVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTI
Sbjct  382   RVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTI  441

Query  980   LITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN-TNFLARAILPCSSSV  804
             LITTYEG HNHPLPPAAMAMASTT+AAA+MLLSG+M SADG+MN  N LARAILPCSSSV
Sbjct  442   LITTYEGNHNHPLPPAAMAMASTTTAAASMLLSGSMSSADGIMNPNNLLARAILPCSSSV  501

Query  803   A  801
             A
Sbjct  502   A  502



>ref|XP_006847281.1| hypothetical protein AMTR_s00015p00181570 [Amborella trichopoda]
 gb|ERN08862.1| hypothetical protein AMTR_s00015p00181570 [Amborella trichopoda]
Length=511

 Score =   289 bits (739),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 228/490 (47%), Positives = 278/490 (57%), Gaps = 76/490 (16%)
 Frame = -1

Query  1844  EVDFFSDKKADIVVKKEITLHGEPVTKA-----DLNTGLQLVIANsgsdkstvddsvssD  1680
             EVDF SDKK+  V  + +               D+NTGL+L+  N+ S            
Sbjct  20    EVDFLSDKKSGFVRTRRLEDFEVKKKIKEEELLDVNTGLRLLTGNNNSSSHQSTLEDDDM  79

Query  1679  ME--ERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLM------QHQ  1524
                  R+  N+++VLQ ELE++N EN RLR ML Q+S NY +L  + ++L+      QH 
Sbjct  80    GTPGNRKGNNEVNVLQAELERVNEENLRLRSMLEQISNNYKSLHNYFNSLVLTSNGDQHM  139

Query  1523  NQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTT  1344
              Q+  + G  +++E  D              VPRQF++L P   A    +TD  SQS  +
Sbjct  140   EQE--KTGGLKNQETGD----------GFMMVPRQFMDLGPAAVA----ETDNRSQSPPS  183

Query  1343  SEERTLSAGSPRNNNTELSRHKGIIAREDSPDSES----WApnklpklnpskPVDQAA--  1182
               + +  +GSP +N+  L++    I    + D +S    W  +           DQAA  
Sbjct  184   EGQSSEPSGSPSHNSQGLTKDYRTIHPSFADDRKSGDHDWNESAFKLHPAKNG-DQAAAG  242

Query  1181  --EATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQV  1008
               EATMRKARVSVRARSEA MI DGCQWRKYGQK+AKGNPCPRAYYRCTMA GCPVRKQV
Sbjct  243   AGEATMRKARVSVRARSEAAMIIDGCQWRKYGQKLAKGNPCPRAYYRCTMAAGCPVRKQV  302

Query  1007  QRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSAD-GMMNTNFLAR  831
             QRCAEDR+ILITTYEG HNHPLPPAA AMASTTSAAA MLLSG+M SAD G+MN N L  
Sbjct  303   QRCAEDRSILITTYEGNHNHPLPPAATAMASTTSAAACMLLSGSMSSADGGIMNPNIL--  360

Query  830   AILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPF---TGAPQIPQNYP  660
               +P SS+VATISASAPFPTVTLDLT TP        P + F  PF   T AP  P +YP
Sbjct  361   --IPSSSTVATISASAPFPTVTLDLTHTPPP----HLPRSHFPFPFPATTAAPAHP-SYP  413

Query  659   QLPQVFGQGLY-NQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAA  483
               PQ     L  NQS FSGL +S                              A+T+S  
Sbjct  414   --PQALANSLLNNQSIFSGLQIS-------------------PGLEAAGQLSLANTVS--  450

Query  482   TAAITSDPNF  453
              AAIT+DPNF
Sbjct  451   -AAITADPNF  459



>ref|NP_001288972.1| probable WRKY transcription factor 42 [Brassica rapa]
 gb|AHB33837.1| WRKY transcription factor 31 [Brassica rapa]
 gb|AHB33844.1| WRKY transcription factor 42 [Brassica rapa]
Length=519

 Score =   288 bits (738),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 222/455 (49%), Positives = 291/455 (64%), Gaps = 56/455 (12%)
 Frame = -1

Query  1847  NEVDFFSDKKAD---IVVKKEITLH----GEPVTKAD-----LNTGLQLVIANsgsdkst  1704
             +EVDFF  +K D   I+  +   +H       V   D     +NTGL L+ A++GSD+S 
Sbjct  31    DEVDFFRSEKRDDQNIITDETNRVHVKRENSRVVDDDDRSTGINTGLNLLTAHTGSDESM  90

Query  1703  vddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQ  1524
             VDD +S DMEE+R+K +   L+ EL+K   E QRL+ MLSQ + N+ +LQ  L  +M+ Q
Sbjct  91    VDDGLSVDMEEKRSKIENVQLREELKKAAEEIQRLKEMLSQTTNNFNSLQMQLVAVMRQQ  150

Query  1523  NQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLEL-VPgggaaaaAQTDEASQSHT  1347
              +    +  T  +++ +++       +    VPRQF+EL +P               +  
Sbjct  151   -EDHHHLAMTGSKDMTNKR------HEGSEMVPRQFMELGLPT--------------AEV  189

Query  1346  TSEERT-LSAGSP---RNNNTELSRHKGIIAREDSPDSES--WAp-------nklpklnp  1206
             +SEERT + + SP     N++   R K ++ RE+SP+++S  W         N     + 
Sbjct  190   SSEERTTVRSRSPPSLLENSSSRQRGKRLLEREESPETQSNGWGNPNKVSKHNASSSNDN  249

Query  1205  skPVDQA-AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVG  1029
                +DQ+ AEATMRKARVSVRARSEAP +SDGC WRKYGQKMAKGNPCPRAY+RCTMAVG
Sbjct  250   VSAIDQSTAEATMRKARVSVRARSEAPTLSDGCHWRKYGQKMAKGNPCPRAYFRCTMAVG  309

Query  1028  CPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGA-MPSADGMM  852
             CPVRKQVQRCAEDR+ILITTYEG HNHPLPPAAM MASTT+AAA+MLLSG+ M S DG+M
Sbjct  310   CPVRKQVQRCAEDRSILITTYEGNHNHPLPPAAMYMASTTTAAASMLLSGSTMSSQDGLM  369

Query  851   N-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAP-FTGAPQ  678
             N TN  AR +LPCSSS+ATISASAPFPT+TLDLT++ +++ N        Q P  +G  +
Sbjct  370   NPTNLFARTMLPCSSSMATISASAPFPTITLDLTESASNVNNQTNNNPLMQFPQRSGFTE  429

Query  677   IPQNYPQLPQVFGQGLY---NQSKFSGLHVSHQDI  582
             +  N   LPQ+ GQ LY    QSKFSGL +  Q +
Sbjct  430   L--NQSGLPQMMGQALYYNQQQSKFSGLQIPTQSL  462



>ref|XP_009379659.1| PREDICTED: probable WRKY transcription factor 31 [Pyrus x bretschneideri]
Length=420

 Score =   284 bits (727),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 225/436 (52%), Positives = 268/436 (61%), Gaps = 68/436 (16%)
 Frame = -1

Query  1622  MNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpek  1443
             MN ENQ+LRG + Q++T+Y ALQ HL  LMQ Q  Q     + +  ++    S   + ++
Sbjct  1     MNVENQQLRGAIHQLNTHYQALQVHLVTLMQRQKNQKIDYQTAEQHKMNINGSVVLEEKQ  60

Query  1442  eePTV----PRQFLELVPgggaaaaAQTDEASQ-SHTTSEERTLSAGSPRNNNTELSR--  1284
                 +    PRQF+++         A+ DE SQ SH     +  S   PRN+  E     
Sbjct  61    MMNGINNLAPRQFMDM-------GRAEKDELSQCSHEGCRSQDCSGSPPRNDIVESMECC  113

Query  1283  ------HKGIIAR------EDSPDSE--SWApnklpklnpskPVDQAAEATM---RKARV  1155
                   H+ I  R      EDSPD E   W P K+PKL   + VDQ +   M   +KARV
Sbjct  114   KSTSHVHRDISGRSRTAGGEDSPDQELQGWIPKKVPKLMSRREVDQPSSEAMSMIKKARV  173

Query  1154  SVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILI  975
             SVRARSEA MISDGCQWRKYGQKMAKGNPCPRAYYRCTM  GCPVRKQVQRCAED+TILI
Sbjct  174   SVRARSEASMISDGCQWRKYGQKMAKGNPCPRAYYRCTMRTGCPVRKQVQRCAEDQTILI  233

Query  974   TTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTN-FLARAILP-CSSSVA  801
             TTYEG HNHPLPPAAMAMASTTSAAA+MLLSG+MPSADG++++N FLAR  LP C  S+A
Sbjct  234   TTYEGHHNHPLPPAAMAMASTTSAAASMLLSGSMPSADGLISSNSFLARTGLPNCPPSLA  293

Query  800   TISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQ-----LPQVFGQ  636
             T+SASAPFPTVTLDLT+T          PT  + P     Q+P N+P      +PQV GQ
Sbjct  294   TLSASAPFPTVTLDLTRT----------PTSSEMPLGQPNQLPPNFPHNNLMSVPQVLGQ  343

Query  635   GLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPN  456
              L NQS FS L  S Q +                          AD +SAATAAIT+DPN
Sbjct  344   ALCNQSNFSVLD-SLQGL-------------------DSTTHSLADKISAATAAITADPN  383

Query  455   FTAALAAAISSIMGGG  408
             FTAAL AAI+SI+G G
Sbjct  384   FTAALVAAITSIVGNG  399



>ref|XP_004507670.1| PREDICTED: probable WRKY transcription factor 31-like [Cicer 
arietinum]
Length=470

 Score =   285 bits (730),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 242/496 (49%), Positives = 296/496 (60%), Gaps = 88/496 (18%)
 Frame = -1

Query  1847  NEVDFFSDKKAD----------IVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvd  1698
             +E+DFFSD+  D          + +K +  L  +P++  ++NTGLQL+I N+GSD+STVD
Sbjct  32    DELDFFSDRNDDKSSSPEQFDDVSIKNQ--LLSDPIS-PNVNTGLQLLITNTGSDESTVD  88

Query  1697  dsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQH-QN  1521
             D  S   +E+R KN++  LQ +L + N EN+ L+ ML+ V+TNYT LQ   ++LMQ  QN
Sbjct  89    DGSSIIAQEKRLKNEVESLQEKLRRRNEENENLKEMLNDVTTNYTTLQTRYASLMQQLQN  148

Query  1520  QQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTS  1341
             Q +     +   EV + K                                  A ++   S
Sbjct  149   QPTE----SSQYEVVEGK----------------------------------AEENDCFS  170

Query  1340  EERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAA-EATMRK  1164
             +E+T S+    NN  E    +G   RE S   + W  NK+ KL+ S   DQ+  EATMRK
Sbjct  171   DEKTRSSTGQNNNKDE---KEG--DRESSEQQQMWESNKVNKLSTSNATDQSGVEATMRK  225

Query  1163  ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT  984
             ARVSVRARSEA MISDGCQWRKYGQKMAKGNPCPRAYYRCTM  GCPVRKQVQRCAEDRT
Sbjct  226   ARVSVRARSEANMISDGCQWRKYGQKMAKGNPCPRAYYRCTMNPGCPVRKQVQRCAEDRT  285

Query  983   ILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILP-CS-S  810
             ILITTYEG HNH LPP A+AMASTTSAAA MLLSG+MPSADG++N N + RA+ P CS S
Sbjct  286   ILITTYEGAHNHALPPPALAMASTTSAAATMLLSGSMPSADGVINHNLITRAMFPKCSPS  345

Query  809   SVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGL  630
              +AT+SASAPFPTVTLDLTQ      N         +PF           QLPQV  Q L
Sbjct  346   GMATLSASAPFPTVTLDLTQNNTDNNNNN---NNCHSPFFPPQNCGSGGGQLPQVIAQAL  402

Query  629   YNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLS-AATAAITSDPNF  453
             YNQSKFSGL +S                                +LS AA AAIT+DPNF
Sbjct  403   YNQSKFSGLQLSQDSQLQQP------------------------SLSPAAAAAITADPNF  438

Query  452   TAALAAAISSIMGGGS  405
              AALAAAI+SI+G  +
Sbjct  439   AAALAAAITSIIGAST  454



>gb|AGA37244.1| WRKY transcription factor 42.1 [Brassica napus]
Length=519

 Score =   286 bits (733),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 221/455 (49%), Positives = 291/455 (64%), Gaps = 56/455 (12%)
 Frame = -1

Query  1847  NEVDFFSDKKAD---IVVKKEITLH----GEPVTKAD-----LNTGLQLVIANsgsdkst  1704
             +EVDFF  +K D   I+  +   +H       V   D     +NTGL L+ A++GSD+S 
Sbjct  31    DEVDFFRSEKRDDQNIITDETNRVHVKRENSRVVDDDDRSTGINTGLNLLTAHTGSDESM  90

Query  1703  vddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQ  1524
             VDD +S DMEE+R+K +   L+ EL+K   E QRL+ MLSQ + N+ +LQ  L  +M+ Q
Sbjct  91    VDDGLSVDMEEKRSKIENVQLREELKKAAEEIQRLKEMLSQTTNNFNSLQMQLVAVMRQQ  150

Query  1523  NQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLEL-VPgggaaaaAQTDEASQSHT  1347
              +    +  T  +++ +++       +    VPRQF+EL +P               +  
Sbjct  151   -EDHHHLAMTGSKDMTNKR------HEGSEMVPRQFMELGLPT--------------AEV  189

Query  1346  TSEERT-LSAGSP---RNNNTELSRHKGIIAREDSPDSES--WAp-------nklpklnp  1206
             +SEERT + + SP     N++   R K ++ RE+SP+++S  W         N     + 
Sbjct  190   SSEERTTVRSRSPPSLLENSSSRQRGKRLLEREESPETQSNGWGNPNKVSKYNASSSNDN  249

Query  1205  skPVDQA-AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVG  1029
                +DQ+ AEATMRKARVSVRARSEAP +SDGC WRKYGQKMAKGNPCPRAY+RCTMAVG
Sbjct  250   VSAIDQSTAEATMRKARVSVRARSEAPTLSDGCHWRKYGQKMAKGNPCPRAYFRCTMAVG  309

Query  1028  CPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGA-MPSADGMM  852
             CPVRKQVQRCAE+R+ILITTYEG HNHPLPPAAM MASTT+AAA+MLLSG+ M S DG+M
Sbjct  310   CPVRKQVQRCAEERSILITTYEGNHNHPLPPAAMYMASTTTAAASMLLSGSTMSSQDGLM  369

Query  851   N-TNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAP-FTGAPQ  678
             N TN  AR +LPCSSS+ATISASAPFPT+TLDLT++ +++ N        Q P  +G  +
Sbjct  370   NPTNLFARTMLPCSSSMATISASAPFPTITLDLTESASNVNNQTNNNPLMQFPQRSGFTE  429

Query  677   IPQNYPQLPQVFGQGLY---NQSKFSGLHVSHQDI  582
             +  N   LPQ+ GQ LY    QSKFSGL +  Q +
Sbjct  430   L--NQSGLPQMMGQALYYNQQQSKFSGLQIPTQSL  462



>ref|XP_009403538.1| PREDICTED: probable WRKY transcription factor 31 [Musa acuminata 
subsp. malaccensis]
Length=499

 Score =   285 bits (730),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 215/429 (50%), Positives = 267/429 (62%), Gaps = 41/429 (10%)
 Frame = -1

Query  1847  NEVDFFSDKKADIVVKKEITLH----GEPVTKADLN-TGLQLVIANsgsdkstvddsvss  1683
             NEVDFFS ++   V + E  L        + K DL   GL L+IAN+ SD STVDD+V  
Sbjct  4     NEVDFFSAERRKAVGRVEADLGPKVPSSCIKKEDLTIAGLNLLIANARSDLSTVDDAVLP  63

Query  1682  DMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRI  1503
               + + +K++L+ ++ EL ++  ENQ+LR ML+Q  +NY ALQ HL+ L Q  +    R+
Sbjct  64    ADDRKESKSELAAMRDELARVKEENQKLREMLNQAISNYNALQMHLTALRQQHDVVDGRV  123

Query  1502  GSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTL-  1326
              +  D                E  VPRQF++L P G        DE S S T + +R   
Sbjct  124   EAKNDEH-------------GEVLVPRQFMDLGPAG------DADEPSHSSTATRDRPSP  164

Query  1325  --SAGSPRNNNTEL---SRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRKA  1161
                 G  R+ ++E    S  K I+   D P+S   A +           +QA EA MRKA
Sbjct  165   PPDNGGVRSMDSERRKRSTDKEIVPPPDHPNSNREASS----------TEQAHEAIMRKA  214

Query  1160  RVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTI  981
             RVSVRARS+APMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCA+DR+I
Sbjct  215   RVSVRARSDAPMIADGCQWRKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQRCADDRSI  274

Query  980   LITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVA  801
             L TTYEGTHNHPLPPAAMAMASTTSAA +MLLSG+M S +G+MN +F+AR +LP SSS+A
Sbjct  275   LTTTYEGTHNHPLPPAAMAMASTTSAAVSMLLSGSMSSPEGLMNPSFMARTVLPFSSSMA  334

Query  800   TISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQ  621
             TISASAPFPTV LDLT  P++    QRP          A      Y  +P   GQ   NQ
Sbjct  335   TISASAPFPTVMLDLTHRPDAT-QLQRPAPAQFQFPFPAAAAAAGYFPVPNASGQTHINQ  393

Query  620   SKFSGLHVS  594
             S+FSGL +S
Sbjct  394   SRFSGLQLS  402



>ref|XP_003610463.1| Transcription factor WRKY [Medicago truncatula]
 ref|XP_003619282.1| Transcription factor WRKY19 [Medicago truncatula]
 gb|AES92660.1| WRKY1b transcription factor [Medicago truncatula]
Length=492

 Score =   285 bits (728),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 228/490 (47%), Positives = 296/490 (60%), Gaps = 88/490 (18%)
 Frame = -1

Query  1847  NEVDFFSDKKADIVVKKEITLHGEPVTKAD---------------LNTGLQLVIANsgsd  1713
             +EVDFFS+ K++   ++++  H   + K +               +NTGLQL+I N+GSD
Sbjct  34    DEVDFFSNDKSEQQQQQQLDDHVS-IKKTNNNQIYDPHCNLRAHHVNTGLQLLITNTGSD  92

Query  1712  kstvddsvssDMEE-RRAKNDLS-VLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSN  1539
             +S +DD  S + ++ +RAK   +  LQ EL ++NAENQ+L+ MLS ++++YT L     +
Sbjct  93    QSMMDDRTSINAQDNKRAKTQQTDQLQEELGRVNAENQKLKDMLSDMNSSYTNLHNRFIS  152

Query  1538  LMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEAS  1359
             LMQ Q  Q+     T+   + + K+ EK        V R+F+                  
Sbjct  153   LMQQQQNQT-----TEHDHIVNGKAVEKGDG----VVARKFMN----------------G  187

Query  1358  QSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpkl----npskPVD  1191
              +    +++     +P+NN+           +E  PD+               NPS   D
Sbjct  188   PAAEVDDQQEPEPCTPQNNH-----------KEPDPDASELVQLLDRSQLPRLNPSNAAD  236

Query  1190  QA-AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRK  1014
             QA AEATMRKARVSVRARSEA MI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA+GCPVRK
Sbjct  237   QANAEATMRKARVSVRARSEAHMINDGCQWRKYGQKMAKGNPCPRAYYRCTMALGCPVRK  296

Query  1013  QVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLA  834
             QVQRCAEDR+ILITTYEGTH+HPLPPAAM MASTT+AAA +LLSG+M SADG+MN N LA
Sbjct  297   QVQRCAEDRSILITTYEGTHSHPLPPAAMPMASTTAAAATVLLSGSMSSADGVMNPNLLA  356

Query  833   RAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNY--P  660
             R +  CSSS+AT+SASAPFPTVTLDLT+  ++  N    P+QFQ         PQN+   
Sbjct  357   RILPNCSSSMATLSASAPFPTVTLDLTR--DTTDNNGNSPSQFQLG------QPQNFGSG  408

Query  659   QLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAAT  480
             QLPQV  Q LYNQSKFSGL +S QD+  ++                          S+ +
Sbjct  409   QLPQVIAQALYNQSKFSGLQMS-QDVGGSSQLHPTQQA------------------SSLS  449

Query  479   AAITSDPNFT  450
             AAIT+DPNFT
Sbjct  450   AAITADPNFT  459



>emb|CDY24892.1| BnaA03g59960D [Brassica napus]
Length=524

 Score =   281 bits (718),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 213/402 (53%), Positives = 258/402 (64%), Gaps = 55/402 (14%)
 Frame = -1

Query  1838  DFFSDKK--------ADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvss  1683
             DFFSD+K        A   VKKE+        + D++TGL L    + SD+S  DD  S 
Sbjct  92    DFFSDEKSRVCYLEDAGFCVKKEVQDD-----RTDVHTGLNL---RTRSDQSVTDDEESY  143

Query  1682  DMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSR-  1506
             +ME++ AKN+   LQ EL+K+  ENQ+LR +L+Q S +YT+LQ H+ +LMQ Q +Q ++ 
Sbjct  144   EMEDKCAKNESIKLQDELKKVTIENQKLRELLTQASNSYTSLQMHIVSLMQQQQKQQNKA  203

Query  1505  IGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTL  1326
             I +T++ E              E  VPRQFL+LVP      A        S++++E+RT 
Sbjct  204   IEATENHE--------------ETIVPRQFLDLVPSRAPGEAEDV-----SNSSTEDRTR  244

Query  1325  SAGSP----RNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRKAR  1158
             S GS     RNN     R    + RE+SP++ES       +   +   DQ  EA MRKAR
Sbjct  245   SGGSSAAERRNNEV---RDGKRLGREESPETES----NKVQKVNNSTFDQPGEAIMRKAR  297

Query  1157  VSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTIL  978
             VSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTM  GCPVRKQVQRCAEDR+IL
Sbjct  298   VSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMITGCPVRKQVQRCAEDRSIL  357

Query  977   ITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN-TNFLARAILPCSSSVA  801
             ITTYEG HNHPLPPAA+AMASTT+AAANMLLSG+M S D MMN TN LARA+LPCS+S+A
Sbjct  358   ITTYEGNHNHPLPPAAVAMASTTTAAANMLLSGSMSSHDVMMNPTNLLARAVLPCSTSMA  417

Query  800   TISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQI  675
             TISASAPFPT        P        PPT F  P   A  I
Sbjct  418   TISASAPFPT-------RPQQQQMTNIPPTAFSQPHAVANTI  452



>gb|ABS18433.1| WRKY34 [Glycine max]
Length=263

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 178/256 (70%), Positives = 196/256 (77%), Gaps = 24/256 (9%)
 Frame = -1

Query  1160  RVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTI  981
             RVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTI
Sbjct  1     RVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTI  60

Query  980   LITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVA  801
             L TTYEGTHNHPLPPAAMAMASTT+AAA+MLLSG+M SADG+MN N L RAILPC SS+A
Sbjct  61    LTTTYEGTHNHPLPPAAMAMASTTAAAASMLLSGSMTSADGIMNPNLLTRAILPC-SSMA  119

Query  800   TISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNY------PQLPQVFG  639
             T+SASAPFPTVTLDLT   N+  NYQRP    Q P    P  PQ++      PQLPQ+  
Sbjct  120   TLSASAPFPTVTLDLTHNQNAFQNYQRP----QTPL--FPSQPQDFIAGSTPPQLPQLIA  173

Query  638   QGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDP  459
             Q LYNQSKFSGL +S QD+          +Q  +    P Q     DT+S    AIT+DP
Sbjct  174   QALYNQSKFSGLQLS-QDV------GPNNSQAPRPFLQPSQQVSLTDTIS----AITADP  222

Query  458   NFTAALAAAISSIMGG  411
             NFTAAL +AISSI+GG
Sbjct  223   NFTAALVSAISSIIGG  238



>ref|XP_008673468.1| PREDICTED: LOW QUALITY PROTEIN: WRKY transcription factor 6-like 
[Zea mays]
Length=541

 Score =   280 bits (717),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 220/427 (52%), Positives = 255/427 (60%), Gaps = 51/427 (12%)
 Frame = -1

Query  1673  ERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQ--NQQSSRIG  1500
             + R  N+LS +Q EL +MN ENQRLRGML+QV+T+Y ALQ HL  LMQ +   Q      
Sbjct  115   QNRNTNELSAMQSELARMNDENQRLRGMLTQVTTSYQALQMHLVALMQARADGQPMMPPA  174

Query  1499  STQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSA  1320
               Q   V D  +            PRQFL L P   A      +E S S T         
Sbjct  175   VAQTLPVTDAAAVMPS--------PRQFLGLGPAAAA------EETSNSST-------EV  213

Query  1319  GSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRKARVSVRAR  1140
             GSPR +++   R        +  DS   A            + Q  EA+MRKARVSVRAR
Sbjct  214   GSPRPSSSAGRRQDQQQQAAERGDSPDPADPSTTARQ----LAQQQEASMRKARVSVRAR  269

Query  1139  SEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG  960
             SEAP+I+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCA+DR+ILITTYEG
Sbjct  270   SEAPIIADGCQWRKYGQKMAKGNPCPRAYYRCTMANGCPVRKQVQRCADDRSILITTYEG  329

Query  959   ThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAP  780
             THNHPLPPAA+AMASTTSAAA+MLLSG+MPS D     NFLARA+LPCSS +ATISASAP
Sbjct  330   THNHPLPPAAVAMASTTSAAASMLLSGSMPSGD-----NFLARAVLPCSSGMATISASAP  384

Query  779   FPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSKFSGLH  600
             FPTVTLDLT  P   P   RPP   QA                 ++       SKFSGLH
Sbjct  385   FPTVTLDLTNGPPGAPPPARPPPHLQA---------------AALYSATHQASSKFSGLH  429

Query  599   VSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSI  420
             +S    +++ +              P   P      +AA AAI SDPNFT ALAAAI+SI
Sbjct  430   MS----SSSTSDNINNVGTTTRVVAPDAPPHMNTVTAAAAAAIASDPNFTVALAAAITSI  485

Query  419   MGGGSQP  399
             +GGG  P
Sbjct  486   IGGGGHP  492



>ref|XP_009394235.1| PREDICTED: probable WRKY transcription factor 31 [Musa acuminata 
subsp. malaccensis]
Length=426

 Score =   275 bits (703),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 219/487 (45%), Positives = 261/487 (54%), Gaps = 104/487 (21%)
 Frame = -1

Query  1847  NEVDFFSDKKADIVVKKEITLHGEP---VTKAD---LNTGLQLVIANsgsdkstvddsvs  1686
             +E+DFF+  + +       T HG P   + K D   +N G QL    +           S
Sbjct  21    DEMDFFAKAEKERARPASATDHGVPHLGLKKEDPAAVNIGFQL-FPETLERDHPTVQQQS  79

Query  1685  sDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSR  1506
                E+  AK  +  +Q EL + N EN+RL+ MLS  + NY AL  HL  LMQ +N     
Sbjct  80    PPDEDNDAKRVVEAMQAELARTNEENRRLKNMLSDATNNYNALHVHLIRLMQQRNLSD--  137

Query  1505  IGSTQDREVADR--KSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEER  1332
              G+TQ  EV     +  E+  E+    VP QF++L P          DE S S T    R
Sbjct  138   -GNTQFHEVTSEADERREEGDEEGGAVVPLQFIDLRPASV------VDEESHSITDEGTR  190

Query  1331  TLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRKARVS  1152
                + SP                 D P S+S               +Q  EA+ RKARVS
Sbjct  191   RRRSSSP----------------ADQPPSKSS--------------EQEHEASTRKARVS  220

Query  1151  VRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILIT  972
             VRARS APMI DGC WRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCAEDR++LIT
Sbjct  221   VRARSSAPMIGDGCHWRKYGQKMAKGNPCPRAYYRCTMAAGCPVRKQVQRCAEDRSVLIT  280

Query  971   TYEGThnhplppaamamasttsaaanmllSGAMPSADGMMN-TNFLARAILPCSSSVATI  795
              YEGTHNHPLPPAAMAMASTTSAAA MLLSG+  S++G+ N +N LARAI+P SS V T+
Sbjct  281   NYEGTHNHPLPPAAMAMASTTSAAAAMLLSGSTSSSEGVTNPSNPLARAIMPSSSGVVTV  340

Query  794   SASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYNQSK  615
             SASAPFPTVTLDLT+T   LP                           +VFGQ  +NQSK
Sbjct  341   SASAPFPTVTLDLTRTSGPLPASSS----------------------TRVFGQPPHNQSK  378

Query  614   FSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAA  435
                                                  ADT+S ATAA+ +DPNFTAALAA
Sbjct  379   ---------------------------------PQSVADTVSVATAAMVADPNFTAALAA  405

Query  434   AISSIMG  414
             AISS+MG
Sbjct  406   AISSMMG  412



>ref|XP_007051308.1| WRKY family transcription factor, putative [Theobroma cacao]
 gb|EOX95465.1| WRKY family transcription factor, putative [Theobroma cacao]
Length=511

 Score =   277 bits (708),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 211/486 (43%), Positives = 284/486 (58%), Gaps = 64/486 (13%)
 Frame = -1

Query  1844  EVDFFS--DKKADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsdkstvddsvssDMEE  1671
             E+DFFS   +  D + + +I      +  + +NTGL L+ ++    ++T          E
Sbjct  42    EMDFFSTNSQPHDPLQESKINNGSSSLFDSGVNTGLNLLSSSPRVSRTT---------NE  92

Query  1670  RRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQQSSRIGSTQ  1491
                 +++  L++EL++++ EN+RLR ML Q++ NY  LQ  L   M  Q Q     G   
Sbjct  93    ETPNSEMRALRIELQRLHEENRRLRSMLDQITKNYNELQGQL--FMAVQKQAHGNQG---  147

Query  1490  DREVADRKSeekkpekeePTVPRQFLELVPggg--aaaaAQTDEASQSHTTSEERTLSAG  1317
                  ++K           +V +QF++  P       A + +D+ +Q  + S   T    
Sbjct  148   -----EQKGAVNGMSSLTESV-QQFMDPRPSTALDVNAPSASDDKTQELSVSPVNTTEVV  201

Query  1316  SPRNNNTELSRHKGI-IAREDSPD--SESWApnklpklnpskPVDQAAEATMRKARVSVR  1146
             S +  + +++R  G  ++ ED  D  S+SW   K PK+  SK  +Q +E   RKARVSVR
Sbjct  202   S-KERDHQMTRIPGKHVSVEDGTDRTSQSWGSPKSPKVEQSKNEEQVSEVPFRKARVSVR  260

Query  1145  ARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTY  966
             ARSEAP+ISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAED++ILITTY
Sbjct  261   ARSEAPLISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDKSILITTY  320

Query  965   EGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISAS  786
             EG HNHPLPPAA AMA+TTSAAA MLLSG+  S DG+ ++ +     LP  S++AT+SAS
Sbjct  321   EGNHNHPLPPAATAMANTTSAAAAMLLSGSTTSKDGLSSSGYFPS--LPYGSTMATLSAS  378

Query  785   APFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIP-QNYPQLPQVFGQGLYNQSKFS  609
             APFPT+TLDLTQ PN++P ++ PP+    P      +P Q YPQL    G  +++ +K S
Sbjct  379   APFPTITLDLTQGPNAVPFFRPPPSTATFP------LPLQGYPQL---LGHSMFSPTKLS  429

Query  608   GLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAI  429
              L V+                              A  +   TAAI SDPNFTAALAAAI
Sbjct  430   ALPVTQ------------------------LGQRPASMVDTVTAAIASDPNFTAALAAAI  465

Query  428   SSIMGG  411
             S+IMG 
Sbjct  466   STIMGA  471



>emb|CBI28821.3| unnamed protein product [Vitis vinifera]
Length=498

 Score =   276 bits (705),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 240/572 (42%), Positives = 298/572 (52%), Gaps = 147/572 (26%)
 Frame = -1

Query  2027  MDKGWGLTLENPDRRAGFFTNKPV----FGFNLSPRLNPINgggsgggaGM-VPIN----  1875
             M KG GL+         FF +KP+    F  + S R   ++   +     +  P+N    
Sbjct  1     MAKGSGLSF---GSDPIFFLHKPIVINSFPEDHSKRFAAMDATKNQSTTTIQFPVNLNCA  57

Query  1874  ------PAAEKRGPPNEVDFFSDKKADIVVKKEITLHGEPVTKADLNTGLQLVIANsgsd  1713
                   P  EK    +E+DFF+DK  D   K   T +       ++NTGL L+ AN+ SD
Sbjct  58    HPDSPVPDDEKPRIVDEMDFFADKNRD--SKPPTTDNKNSPYYFNVNTGLHLLTANTSSD  115

Query  1712  kstvddsvss-DMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNL  1536
             +S VDD +S  +++++R KN+L VLQ E+E+M+AEN+RLR ML+QV+ NY ALQ H+  L
Sbjct  116   QSMVDDGMSPPNVDDKRVKNELVVLQAEIERMHAENERLRSMLNQVTNNYNALQVHMVAL  175

Query  1535  MQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQ  1356
             MQ Q          ++ E  D+K            VPRQF++L    G AA A+ +E S 
Sbjct  176   MQDQ--------KAENNEEHDQK--HSGNNNGGVVVPRQFIDL----GLAAKAEVEEPSL  221

Query  1355  SHTTSEERTLS-AGSPRNNN-----------TELSRHKGIIAREDSPDSES-WApnklpk  1215
             S  +SE R+   +GSP NN             E   +   I RE+SPD  S W  NK+P+
Sbjct  222   S--SSEGRSGDRSGSPINNGEVGSKELELRKNEKKEYSSGIGREESPDQGSQWGANKVPR  279

Query  1214  lnpskPVDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMA  1035
             LNPSK VDQ  EATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA
Sbjct  280   LNPSKNVDQT-EATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMA  338

Query  1034  VGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGM  855
              GCPVRKQVQRCAEDR+ILITTYEG HNHPLP                      P+A  M
Sbjct  339   AGCPVRKQVQRCAEDRSILITTYEGNHNHPLP----------------------PAAMAM  376

Query  854   MNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQI  675
              +T   A  +L        +S S P P                   PT    P    P  
Sbjct  377   ASTTSSAARML--------LSGSMPTPF------------------PTNLAGPAAATPS-  409

Query  674   PQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADT  495
                   LPQ+F Q LYNQS                                         
Sbjct  410   ----SLLPQIFNQALYNQS-----------------------------------------  424

Query  494   LSAATAAITSDPNFTAALAAAISSIMGGGSQP  399
              +AATAAIT+DPNFTAALAAAI+SI+ GG+QP
Sbjct  425   -NAATAAITADPNFTAALAAAITSII-GGAQP  454



>emb|CDX94553.1| BnaC09g22830D [Brassica napus]
Length=491

 Score =   275 bits (703),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 216/522 (41%), Positives = 297/522 (57%), Gaps = 108/522 (21%)
 Frame = -1

Query  1874  PAAEKRGPP--NEVDFFSDKKAD---IVVKKEITLH---------GEPVTKADLNTGLQL  1737
             P+ E+   P  +EVDFF  +K D   ++ ++   LH          +      +NTGL L
Sbjct  20    PSDEQHHRPIMDEVDFFRSEKRDDQNVITEETHRLHVKRENSRVDDDDDRSMGINTGLNL  79

Query  1736  VIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTAL  1557
             + AN+GSD+S VDD +S DMEE+R K + + L+ EL+K N ENQRL+ MLSQ + N+ +L
Sbjct  80    LTANTGSDESLVDDGLSVDMEEKRTKIENTQLREELKKSNEENQRLKEMLSQTTNNFNSL  139

Query  1556  QQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLEL-VPgggaaaa  1380
             Q  L  +M+ Q +    + + +       K ++    +    VPRQF++L +P       
Sbjct  140   QMQLVAVMR-QEEDHHHLATIES------KDKDTNRHEAPEMVPRQFIDLGLPS------  186

Query  1379  AQTDEASQSHTTSEERTLSAGSPRN---NNTELSRHKGIIAREDSPDSES--WApnklpk  1215
                     +  +S+ER +++ SP++   +++   R K ++  E+SP++ES  W       
Sbjct  187   --------AEVSSDER-ITSRSPQSLLEDSSSRQRAKRVLEIEESPENESNGWGNPSKVS  237

Query  1214  lnpskP-------VDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPR  1059
              + +         +DQ AAEATMRKARVSVRARSEAPM+SDGCQWRKYGQKMAKGNPCPR
Sbjct  238   KHNASSSNGNGNAIDQSAAEATMRKARVSVRARSEAPMLSDGCQWRKYGQKMAKGNPCPR  297

Query  1058  AYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSG  879
             AYYRCTMAVGCPVRKQVQRCA+DR+ILITTYEG HNHPLP                    
Sbjct  298   AYYRCTMAVGCPVRKQVQRCADDRSILITTYEGNHNHPLP--------------------  337

Query  878   AMPSADGMMNTNFLARAILPCSSSV-ATISASAPFPTVTLDLTQTPNSL--PNYQRPPTQ  708
               P+A  M +T   A ++L   S++ ATISASAPFPT+TLDLT++ + +  P    P  Q
Sbjct  338   --PAAMYMASTTTAAASMLLSGSTIMATISASAPFPTITLDLTESASDVNGPTNNNPLMQ  395

Query  707   FQAPFTGAPQIPQNYPQLPQVFGQGLY---NQSKFSGLHVSHQDIaaaaaqaaqlaqqqq  537
             F A  +G  ++  N   LPQ+ GQ LY    QSKFSGLH+  Q +               
Sbjct  396   F-AQRSGFAEL--NQSGLPQMMGQALYYNQQQSKFSGLHIPSQSL---------------  437

Query  536   hpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMGG  411
                         +   +  AA+ ++PNF AALAAAI+SI+ G
Sbjct  438   ------------NAGESVNAAMPANPNFAAALAAAITSIING  467



>ref|XP_002457035.1| hypothetical protein SORBIDRAFT_03g000240 [Sorghum bicolor]
 gb|EES02155.1| hypothetical protein SORBIDRAFT_03g000240 [Sorghum bicolor]
Length=570

 Score =   276 bits (705),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 232/497 (47%), Positives = 285/497 (57%), Gaps = 67/497 (13%)
 Frame = -1

Query  1844  EVDFFSDKKADIVVKKEITLHGEPVT-------------KADLNTGLQLVIANsgsdkst  1704
             EVDFFSD+K         T     V+             K DL   + L+     +    
Sbjct  59    EVDFFSDQKIAADAANNNTCGRTTVSPGSGSGASCLAIKKEDLT--INLLPGTGSNANDD  116

Query  1703  vddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQ  1524
                +    +++ +   + + +Q EL +MN ENQRLRGML+QV+++Y ALQ HL  LMQ +
Sbjct  117   EAATRLRLLDQDKQSRNTNEMQAELARMNDENQRLRGMLTQVTSSYQALQMHLVALMQAR  176

Query  1523  NQQSSRI---------GSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQT  1371
                 +++           T D   A               +PRQFL L P   A      
Sbjct  177   AGGQAQLMLPPVAQALPPTTDGAAA-----------AVMPLPRQFLGLGPAAAA------  219

Query  1370  DEASQSHTTSEERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVD  1191
             +E S S T         GSPR +++     +    R DSPD+ +                
Sbjct  220   EETSNSST-------EVGSPRRSSSTGGNRRA--ERGDSPDASTRQQQVAQ---------  261

Query  1190  QAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQ  1011
             Q  EA+MRKARVSVRARSEAP+I+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQ
Sbjct  262   QQQEASMRKARVSVRARSEAPIIADGCQWRKYGQKMAKGNPCPRAYYRCTMANGCPVRKQ  321

Query  1010  VQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLAR  831
             VQRCA+DR+ILITTYEGTHNHPLPPAAMAMASTTSAAA+MLLSG+MPS D MM +NFLAR
Sbjct  322   VQRCADDRSILITTYEGTHNHPLPPAAMAMASTTSAAASMLLSGSMPSGD-MMTSNFLAR  380

Query  830   AILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLP  651
             A+LPCSSS+ATISASAPFPTVTLDLT  P   P   RP   FQ P     Q+ Q +  L 
Sbjct  381   AVLPCSSSMATISASAPFPTVTLDLTHGP---PAAARPQPHFQVPLPPHQQVQQQHHHLQ  437

Query  650   QVFGQGLY-NQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAA  474
                    + + SKFSGLH+S     + +     +    +        P   DT++AA AA
Sbjct  438   AAALYNAHQSSSKFSGLHMSSS---STSDNNNNVGTSSRAAVAAADAPPHMDTVTAAAAA  494

Query  473   ITSDPNFTAALAAAISS  423
             IT+DPNFT ALAAAI+S
Sbjct  495   ITADPNFTVALAAAITS  511



>ref|XP_002529927.1| WRKY transcription factor, putative [Ricinus communis]
 gb|EEF32481.1| WRKY transcription factor, putative [Ricinus communis]
Length=559

 Score =   274 bits (701),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 237/511 (46%), Positives = 294/511 (58%), Gaps = 81/511 (16%)
 Frame = -1

Query  1844  EVDFFSDKK---------ADIVVKKEITLHGEP-------VTKADLNTGLQLVIANsgsd  1713
             E+DFF+ +          ADI++K+EI   G+          K  +NTGL LV     SD
Sbjct  74    EMDFFAHRNFSKQKSSPTADIIIKQEIRYDGDDHDELEHQKKKQHVNTGLNLVTGTMVSD  133

Query  1712  kstvddsvssDMEERRAK-NDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNL  1536
             KS VDD  S + ++ + K  +L +LQ E+  +N+ENQRLRGM+ QV+ NY ALQ HL  L
Sbjct  134   KSMVDDGPSQNKQDYQQKMKELDILQAEINHINSENQRLRGMIHQVNNNYHALQMHLGAL  193

Query  1535  MQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQ  1356
             MQ+   ++ +    Q+  V +R        +   TV RQFL+L   G A      ++   
Sbjct  194   MQNPKAKTEK----QEEVVNERH-------RRSITVARQFLDL---GKAEIVELKNDHRN  239

Query  1355  SHTTSEERTLSAG-SPR-------NNNTELSRHKGIIAREDSPDSES----WApnklpkl  1212
             S +T+EER+     SP        N+ +       I    D   SE+    W PNK+PK 
Sbjct  240   SQSTTEERSGDCSISPNIVESMEINDKSPTHISNPINGNADYQSSEAAFHGWVPNKVPKF  299

Query  1211  npskPVD-QAAEATM---RKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRC  1044
               SK V+ +  E TM   RKARVSVRA S+A  ISDGCQWRKYGQK+AKGNPCPRAYYRC
Sbjct  300   ISSKDVNHEQKEETMSMIRKARVSVRAISDASTISDGCQWRKYGQKLAKGNPCPRAYYRC  359

Query  1043  TMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSA  864
             TM+ GCPVRKQVQR  EDR +LITTYEG HNHPLPPAAMAMASTTSAAA MLLSG+  S 
Sbjct  360   TMSSGCPVRKQVQRSVEDRAVLITTYEGHHNHPLPPAAMAMASTTSAAAAMLLSGSTSSP  419

Query  863   DGMMNTNFLARAI-LPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTG  687
             DG++NTN LA+A    C    A++SASAPFPTVTLDLT TP    + QR     Q     
Sbjct  420   DGLVNTNLLAKATPYSCPPGFASLSASAPFPTVTLDLTHTPAVANSSQRITQDHQFHLAT  479

Query  686   APQIPQNYPQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpL  507
             APQ           FG GL NQ++ SG+  S Q +                         
Sbjct  480   APQF----------FGPGLCNQARVSGI-FSPQGMDQLQPTD------------------  510

Query  506   FADTLSAATAAITSDPNFTAALAAAISSIMG  414
                 +SAATAAITSDPNFTAAL AAI+S++G
Sbjct  511   ----VSAATAAITSDPNFTAALVAAITSVIG  537



>ref|XP_007142321.1| hypothetical protein PHAVU_008G270500g [Phaseolus vulgaris]
 gb|ESW14315.1| hypothetical protein PHAVU_008G270500g [Phaseolus vulgaris]
Length=456

 Score =   268 bits (684),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 186/430 (43%), Positives = 249/430 (58%), Gaps = 70/430 (16%)
 Frame = -1

Query  1679  MEERRA------KNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQ  1518
             MEE  A      K+    +  EL +MNAENQRLR ++ +++ N  AL+  L N+ Q Q+ 
Sbjct  73    MEENEALETVDEKSRFVAMVSELHQMNAENQRLRELVDEMNNNCNALRMQLINITQKQHN  132

Query  1517  QSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSE  1338
             Q +   S +  E+                VPR FLE+        + + ++ S+     +
Sbjct  133   QGNNGVSGEKEEM----------------VPRPFLEM------GVSEKEEQPSEEKVKVD  170

Query  1337  ERTLSAGSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAE--ATMRK  1164
                   GS +    +    K    RE S   ++              +DQ +E  + ++K
Sbjct  171   LMHQCKGSDQKEIED----KLDCGRESS---KARMEADQQLSTKLSKLDQNSETLSMIKK  223

Query  1163  ARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRT  984
             ARVSVRARS++ MI+DGCQWRKYGQKMAKGNPCPRAYYRCTM+  CPVRKQVQRCAEDR+
Sbjct  224   ARVSVRARSDSTMIADGCQWRKYGQKMAKGNPCPRAYYRCTMSSACPVRKQVQRCAEDRS  283

Query  983   ILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSV  804
             ++ITTYEG HNH LPP A AMA+TTSAAA+MLLSG+MPS+DG +N   L  A LPCS ++
Sbjct  284   VVITTYEGQHNHALPPTAQAMAATTSAAASMLLSGSMPSSDGQINPTMLQSASLPCSQNM  343

Query  803   ATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYN  624
             AT+SASAPFPT+TLDLTQ P +                 +P + + +  +P++FG  L +
Sbjct  344   ATLSASAPFPTITLDLTQNPTNQLGLL------------SPLLARKFMSVPKIFGHSLCD  391

Query  623   QSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAA  444
             Q+K +GLH S                           P FA++ +AATAAIT+DPNFTAA
Sbjct  392   QTKLAGLHESQ---------------------GRDSSPSFANSFNAATAAITADPNFTAA  430

Query  443   LAAAISSIMG  414
             L AAI+S+MG
Sbjct  431   LVAAITSVMG  440



>emb|CDY16669.1| BnaA09g20470D [Brassica napus]
Length=492

 Score =   268 bits (686),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 199/465 (43%), Positives = 272/465 (58%), Gaps = 80/465 (17%)
 Frame = -1

Query  1874  PAAEKRGPP--NEVDFFSDKKAD---IVVKKEITLH-GEPVTKAD--------LNTGLQL  1737
             P+ E+   P  +EVDFF  +K D   ++ ++   LH     ++ D        +NTGL L
Sbjct  20    PSDEQHHRPIMDEVDFFRSEKRDDQNVITEETHRLHVKRENSRVDDDNDRSMGINTGLNL  79

Query  1736  VIANsgsdkstvddsvssDMEERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTAL  1557
             + AN+GSD+S VDD +S DMEE+R K + + L+ EL+K N ENQRL+ MLSQ + N+ +L
Sbjct  80    LTANTGSDESLVDDGLSVDMEEKRTKIENTQLREELKKSNEENQRLKEMLSQTTNNFNSL  139

Query  1556  QQHLSNLMQHQNQQSSRIGSTQDREVADRKSeekkpekeePTVPRQFLEL-VPgggaaaa  1380
             Q  L  +M+ Q +    + + +       K ++    +    VPRQF++L +P       
Sbjct  140   QMQLVAVMR-QEEDHHHLATIES------KDKDTNRHEASEMVPRQFIDLGLPS------  186

Query  1379  AQTDEASQSHTTSEER-TLSAGSP---RNNNTELSRHKGIIAREDSPDSES--WAp----  1230
                     +  +S+ER T+ + SP     +++   R K ++  E+SP++ES  W      
Sbjct  187   --------AEVSSDERITVRSRSPPSLLEDSSSRQRAKRVLEIEESPENESNGWGNPSKV  238

Query  1229  ---nklpklnpskPVDQ-AAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCP  1062
                N          +DQ AA+ATMRKARVSVRARSEAPM+SDGCQWRKYGQKMAKGNPCP
Sbjct  239   SKHNASSSNGNGNAIDQSAADATMRKARVSVRARSEAPMLSDGCQWRKYGQKMAKGNPCP  298

Query  1061  RAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllS  882
             RAYYRCTMAVGCPVRKQVQRCAEDR+ILITTYEG HNHPLP                   
Sbjct  299   RAYYRCTMAVGCPVRKQVQRCAEDRSILITTYEGNHNHPLP-------------------  339

Query  881   GAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLDLTQTPNSL--PNYQRPPTQ  708
                P+A  M +T   A ++L   S+++   ASAPFPT+TLDLT++ +++  P    P  Q
Sbjct  340   ---PAAMYMASTTTAAASMLLSGSTMSNQDASAPFPTITLDLTESASNVNGPTNNNPLMQ  396

Query  707   FQAPFTGAPQIPQNYPQLPQVFGQGLY---NQSKFSGLHVSHQDI  582
             F +  +G  ++  N   LPQ+ GQ LY    QSKFSGLH+  Q +
Sbjct  397   F-SQRSGFAEL--NQSGLPQMMGQALYYNQQQSKFSGLHIPSQSL  438



>gb|KHG18638.1| putative WRKY transcription factor 42 -like protein [Gossypium 
arboreum]
Length=531

 Score =   270 bits (689),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 202/431 (47%), Positives = 255/431 (59%), Gaps = 59/431 (14%)
 Frame = -1

Query  1673  ERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQ---HQNQQSSRI  1503
             E + K   S L++ELEK+N EN+RLR ML Q++ NY  LQ  L   +Q   H+N+Q    
Sbjct  100   EEKHKAQESALKMELEKLNEENRRLRSMLDQITKNYNELQGQLLMALQKQAHRNEQ----  155

Query  1502  GSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaa--AQTDEASQSHTTSEERT  1329
                      ++K           +V +QF++  P         + +D+ +Q  + S E T
Sbjct  156   ---------EQKDAVNGMASTIMSV-QQFMDPRPSSALDVNEPSGSDDKTQELSASPENT  205

Query  1328  LSAGSPRNNNTELSRHKGI-IAREDSPD--SESWApnklpklnpskPVDQAAEATMRKAR  1158
             +   S   ++  +    G  ++ EDS D  S++W   K PK++ SK  DQ +E   RKAR
Sbjct  206   MEIVSKEYDHRMVQNMPGKQVSIEDSTDQTSQNWGSLKSPKVDQSKNEDQVSEVPFRKAR  265

Query  1157  VSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTIL  978
             VSVRARSEAP+ISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCA+D++IL
Sbjct  266   VSVRARSEAPLISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCADDKSIL  325

Query  977   ITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVAT  798
             ITTYEG HNHPLPPAA AMA+TTSAAA MLLSG+  S DG+  + +     LP +SS+AT
Sbjct  326   ITTYEGNHNHPLPPAATAMANTTSAAAAMLLSGSTKSKDGLPTSAYYPS--LPYASSMAT  383

Query  797   ISASAPFPTVTLDLTQTPNSLPNYQRPP--TQFQAPFTGAPQIPQNYPQLPQVFGQGLYN  624
             +SASAPFPT+TLDLTQ PN++   + PP  T F  P  G       YPQL    G  ++ 
Sbjct  384   LSASAPFPTITLDLTQGPNAVQMLRPPPSATSFPLPLHG-------YPQL---LGNPMFG  433

Query  623   QSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAA  444
               K S    + Q                            A  +   TAAI SDPNFTAA
Sbjct  434   PPKLSTASPALQ-----------------------LGQRPASMVETVTAAIASDPNFTAA  470

Query  443   LAAAISSIMGG  411
             LAAAIS+IMG 
Sbjct  471   LAAAISTIMGA  481



>tpg|DAA52674.1| TPA: putative WRKY DNA-binding domain superfamily protein, partial 
[Zea mays]
Length=410

 Score =   261 bits (666),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 180/312 (58%), Positives = 205/312 (66%), Gaps = 32/312 (10%)
 Frame = -1

Query  1673  ERRAKNDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQ--NQQSSRIG  1500
             + R  N+LS +Q EL +MN ENQRLRGML+QV+T+Y ALQ HL  LMQ +   Q      
Sbjct  115   QNRNTNELSAMQSELARMNDENQRLRGMLTQVTTSYQALQMHLVALMQARADGQPMMPPA  174

Query  1499  STQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSA  1320
               Q   V D  +            PRQFL L P          +E S S T         
Sbjct  175   VAQTLPVTDAAAVMPS--------PRQFLGLGPAAA------AEETSNSST-------EV  213

Query  1319  GSPRNNNTELSRHKGIIAREDSPDSESWApnklpklnpskPVDQAAEATMRKARVSVRAR  1140
             GSPR +++   R        +  DS   A            + Q  EA+MRKARVSVRAR
Sbjct  214   GSPRPSSSAGRRQDQQQQAAERGDSPDPADPSTTARQ----LAQQQEASMRKARVSVRAR  269

Query  1139  SEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEG  960
             SEAP+I+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCA+DR+ILITTYEG
Sbjct  270   SEAPIIADGCQWRKYGQKMAKGNPCPRAYYRCTMANGCPVRKQVQRCADDRSILITTYEG  329

Query  959   ThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAP  780
             THNHPLPPAA+AMASTTSAAA+MLLSG+MPS D     NFLARA+LPCSS +ATISASAP
Sbjct  330   THNHPLPPAAVAMASTTSAAASMLLSGSMPSGD-----NFLARAVLPCSSGMATISASAP  384

Query  779   FPTVTLDLTQTP  744
             FPTVTLDLT  P
Sbjct  385   FPTVTLDLTNGP  396



>ref|XP_004294408.1| PREDICTED: WRKY transcription factor 6-like [Fragaria vesca subsp. 
vesca]
Length=547

 Score =   263 bits (672),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 224/533 (42%), Positives = 289/533 (54%), Gaps = 87/533 (16%)
 Frame = -1

Query  1862  KRGPPNEVDFFSDKKADIVVKKEITLHGEP--VTKADLNTGLQLVIA--Nsgsdkstvdd  1695
             KR   +E+DFF+D     + + + TL  +     +  L+TGL L+    ++    ST D 
Sbjct  27    KRVVHDELDFFADHHKGSLKETDQTLEDKEDMAQEKQLDTGLNLLTTYTSTSDKSSTDDG  86

Query  1694  svssDMEERRAK-NDLSVLQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQNQ  1518
             S S  ME+ +   N+L V+Q EL +MN +NQRLR M++QV+ NY +LQ HL   MQ Q  
Sbjct  87    STSHSMEDHKQTINELEVVQAELGRMNVDNQRLRVMITQVNNNYKSLQVHLLEFMQRQQN  146

Query  1517  QSSRIGSTQDREVADRKSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSE  1338
             Q       +  ++    +  ++ +     VPRQF+++   G      + +  S  H++ +
Sbjct  147   QP-----VKQHKMVINGTAPEEKQIMNNIVPRQFMDMGRAGNITHHEKNELVS--HSSLD  199

Query  1337  ERTLS----AGSP-------------------RNNNTELSRHKGIIAREDSPDSESWApn  1227
                LS    +GSP                   ++   E S  +G   +E    S  W P 
Sbjct  200   MARLSNNDCSGSPPIVESMDHFKSPVQRGSKRKSGGAEDSSSEG---QEFPAGSPGWVPK  256

Query  1226  kl-pklnpskPVDQAAEAT------MRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNP  1068
             K+    +    VD  A A+      ++KARVSVRARSE+ MISDGCQWRKYGQKMAKGNP
Sbjct  257   KIPKLSSGDVDVDHQAAASEETVSMIKKARVSVRARSESSMISDGCQWRKYGQKMAKGNP  316

Query  1067  CPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanml  888
             CPRAYYRCTM  GCPVRKQVQRCAED+TIL TTYEG HNHPLPPAAM M STTSAAA+M+
Sbjct  317   CPRAYYRCTMGTGCPVRKQVQRCAEDKTILTTTYEGHHNHPLPPAAMTMVSTTSAAASMI  376

Query  887   lSGAMPSAD-----GMMNT---NFLARAILP------CSSSVATISASAPFPTVTLDLTQ  750
             LSG+MPSAD      ++N+   NFL    L       C  S AT+SASAPFPTVTLDLT+
Sbjct  377   LSGSMPSADQHPHHAIINSSSNNFLQGTALHHPQLPNCPPSFATLSASAPFPTVTLDLTR  436

Query  749   TPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQLPQVFGQGLYN-QSKFSGLHVSHQDIaaa  573
              P +                  P   QN P LP V GQ L N +SK + L          
Sbjct  437   APTTASETM--------ALNQLPNFSQNLP-LPHVLGQALCNSESKLTLL----------  477

Query  572   aaqaaqlaqqqqhpapppqhpLFADTLSAATAAITSDPNFTAALAAAISSIMG  414
                        +       H + AD +SAATAAIT+DPNF A L AAI+SIMG
Sbjct  478   --------DGLRGLDTTTNHSILADKVSAATAAITADPNFAAVLVAAITSIMG  522



>gb|AIY62472.1| WRKY54 [Gossypium aridum]
Length=325

 Score =   256 bits (653),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 165/260 (63%), Positives = 192/260 (74%), Gaps = 26/260 (10%)
 Frame = -1

Query  1196  VDQAAEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVR  1017
             VDQ+ EA MRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVR
Sbjct  68    VDQS-EAAMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMATGCPVR  126

Query  1016  KQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFL  837
             KQVQRCAEDRTILITTYEG HNHPLPP+AM+MASTTS+AA ML+SG+  S DG+MN+N L
Sbjct  127   KQVQRCAEDRTILITTYEGNHNHPLPPSAMSMASTTSSAARMLVSGSTSSPDGLMNSNLL  186

Query  836   ARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNYPQ  657
                +LPCSS++ATISAS PFP+VTLDLTQ+  S P    PP     P+  A  +      
Sbjct  187   TTTLLPCSSTMATISASTPFPSVTLDLTQSLFSSP----PP-----PYNVANSVAVTAAL  237

Query  656   LPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAATA  477
             +PQVFGQ L NQSKFSG  +S +D+                     +     DT++AATA
Sbjct  238   VPQVFGQALDNQSKFSGTQMS-KDL---------------DRLQQGEQNSIVDTVNAATA  281

Query  476   AITSDPNFTAALAAAISSIM  417
             AI +DP+F AALAAAI+SI+
Sbjct  282   AIATDPSFAAALAAAITSII  301



>tpg|DAA52672.1| TPA: putative WRKY DNA-binding domain superfamily protein, partial 
[Zea mays]
Length=286

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 177/305 (58%), Positives = 201/305 (66%), Gaps = 38/305 (12%)
 Frame = -1

Query  1643  LQVELEKMNAENQRLRGMLSQVSTNYTALQQHLSNLMQHQ--NQQSSRIGSTQDREVADR  1470
             +Q EL +MN ENQRLRGML+QV+T+Y ALQ HL  LMQ +   Q        Q   V D 
Sbjct  1     MQSELARMNDENQRLRGMLTQVTTSYQALQMHLVALMQARADGQPMMPPAVAQTLPVTDA  60

Query  1469  KSeekkpekeePTVPRQFLELVPgggaaaaAQTDEASQSHTTSEERTLSAGSPRNNNTEL  1290
              +            PRQFL L P          +E S S T         GSPR +++  
Sbjct  61    AAVMPS--------PRQFLGLGPAAA------AEETSNSST-------EVGSPRPSSSAG  99

Query  1289  SRHKGIIARE---DSPDSESWApnklpklnpskPVDQAAEATMRKARVSVRARSEAPMIS  1119
              R           DSPD              ++ + Q  EA+MRKARVSVRARSEAP+I+
Sbjct  100   RRQDQQQQAAERGDSPDPAD-------PSTTARQLAQQQEASMRKARVSVRARSEAPIIA  152

Query  1118  DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVRKQVQRCAEDRTILITTYEGThnhplp  939
             DGCQWRKYGQKMAKGNPCPRAYYRCTMA GCPVRKQVQRCA+DR+ILITTYEGTHNHPLP
Sbjct  153   DGCQWRKYGQKMAKGNPCPRAYYRCTMANGCPVRKQVQRCADDRSILITTYEGTHNHPLP  212

Query  938   paamamasttsaaanmllSGAMPSADGMMNTNFLARAILPCSSSVATISASAPFPTVTLD  759
             PAA+AMASTTSAAA+MLLSG+MPS D     NFLARA+LPCSS +ATISASAPFPTVTLD
Sbjct  213   PAAVAMASTTSAAASMLLSGSMPSGD-----NFLARAVLPCSSGMATISASAPFPTVTLD  267

Query  758   LTQTP  744
             LT  P
Sbjct  268   LTNGP  272



>gb|ABC87922.1| WRKY1, partial [Coffea racemosa]
 gb|ABC87924.1| WRKY1-1, partial [Coffea racemosa]
 gb|ABC87926.1| WRKY1, partial [Coffea liberica]
 gb|ABC87930.1| WRKY1, partial [Coffea eugenioides]
 gb|ABC87934.1| WRKY1-1, partial [Coffea eugenioides]
Length=185

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 159/173 (92%), Gaps = 2/173 (1%)
 Frame = -1

Query  1196  VDQA-AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPV  1020
             VD A AEATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPV
Sbjct  14    VDHAQAEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPV  73

Query  1019  RKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNF  840
             RKQVQRCAEDRT+LITTYEGTHNHPLPPAAMAMASTTSAAANMLLSG+M SADG+MN NF
Sbjct  74    RKQVQRCAEDRTVLITTYEGTHNHPLPPAAMAMASTTSAAANMLLSGSMSSADGLMNPNF  133

Query  839   LARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAP  681
             LAR ILPCSS++ATISASAPFPTVTLDLTQTPN L   ++P T FQ PF G P
Sbjct  134   LARTILPCSSNMATISASAPFPTVTLDLTQTPNPLQFQRQPSTPFQLPF-GTP  185



>gb|ABC87932.1| WRKY1, partial [Coffea congensis]
Length=185

 Score =   249 bits (636),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 159/173 (92%), Gaps = 2/173 (1%)
 Frame = -1

Query  1196  VDQA-AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPV  1020
             VD A AEATMRKARVSVRARSEAPMI+DGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPV
Sbjct  14    VDHAQAEATMRKARVSVRARSEAPMITDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPV  73

Query  1019  RKQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNF  840
             RKQVQRCAEDRT+LITTYEGTHNHPLPPAAMAMASTTSAAANMLLSG+M SADG+MN NF
Sbjct  74    RKQVQRCAEDRTVLITTYEGTHNHPLPPAAMAMASTTSAAANMLLSGSMSSADGLMNPNF  133

Query  839   LARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAP  681
             LAR ILPCSS++ATISASAPFPTVTLDLTQTPN L   ++P T FQ PF G P
Sbjct  134   LARTILPCSSNMATISASAPFPTVTLDLTQTPNPLQFQRQPSTPFQLPF-GTP  185



>gb|AES92661.2| WRKY1b transcription factor [Medicago truncatula]
Length=358

 Score =   254 bits (649),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 187/251 (75%), Gaps = 30/251 (12%)
 Frame = -1

Query  1193  DQA-AEATMRKARVSVRARSEAPMISDGCQWRKYGQKMAKGNPCPRAYYRCTMAVGCPVR  1017
             DQA AEATMRKARVSVRARSEA MI+DGCQWRKYGQKMAKGNPCPRAYYRCTMA+GCPVR
Sbjct  102   DQANAEATMRKARVSVRARSEAHMINDGCQWRKYGQKMAKGNPCPRAYYRCTMALGCPVR  161

Query  1016  KQVQRCAEDRTILITTYEGThnhplppaamamasttsaaanmllSGAMPSADGMMNTNFL  837
             KQVQRCAEDR+ILITTYEGTH+HPLPPAAM MASTT+AAA +LLSG+M SADG+MN N L
Sbjct  162   KQVQRCAEDRSILITTYEGTHSHPLPPAAMPMASTTAAAATVLLSGSMSSADGVMNPNLL  221

Query  836   ARAILPCSSSVATISASAPFPTVTLDLTQTPNSLPNYQRPPTQFQAPFTGAPQIPQNY--  663
             AR +  CSSS+AT+SASAPFPTVTLDLT+  ++  N    P+QFQ         PQN+  
Sbjct  222   ARILPNCSSSMATLSASAPFPTVTLDLTR--DTTDNNGNSPSQFQL------GQPQNFGS  273

Query  662   PQLPQVFGQGLYNQSKFSGLHVSHQDIaaaaaqaaqlaqqqqhpapppqhpLFADTLSAA  483
              QLPQV  Q LYNQSKFSGL +S QD+  ++                          S+ 
Sbjct  274   GQLPQVIAQALYNQSKFSGLQMS-QDVGGSSQLHPTQQA------------------SSL  314

Query  482   TAAITSDPNFT  450
             +AAIT+DPNFT
Sbjct  315   SAAITADPNFT  325



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6411565948700